Add annotation of reference cDNAs/Proteins with blastn/blastx/diamond
>BMgn002072|Gene000001
ATGTTTTTTCAGGCAGCCAGTGCGTTGTTCACGCTGGACGGTCCAAAGAGTCAGGCCTTA
TCACGTCGTCTGGCCCGGGGCGAGCGTCGCCGCAGACGGTGTCGAGTAGCCCTGGCGGTG
CTGGCGTTACTGCTGCTACTGGCGTCGGTGGGAGCCGTGGAGCTTATCATGTCGCGAGGA
CAGAGGGTCTTCGGAGCCGTCCTGCGATGA
>BMgn002071|Gene000002
GCAGTATCAGTTTGGAGTTGACATAAAGTGGCTTTCTCCGTGTTATCTTGTGCAACTAGG
AGGCAGAATGAGTCCAATAAAACCAAATCCAGCCAAAGCCTTGCTACGTAACGAAATTGC
CGCTAAAATCGCCGCCTTGACGAATGAAGAGAAAAAAAGACAATCGCAAATTGTTTATGA
AAAGGTTATCAACCACTCATGGTACAAATCATCAAGTCGTATTGCTCTCTACATGAGCAC
>BMgn002072|Gene000001
ATGTTTTTTCAGGCAGCCAGTGCGTTGTTCACGCTGGACGGTCCAAAGAGTCAGGCCTTA
TCACGTCGTCTGGCCCGGGGCGAGCGTCGCCGCAGACGGTGTCGAGTAGCCCTGGCGGTG
CTGGCGTTACTGCTGCTACTGGCGTCGGTGGGAGCCGTGGAGCTTATCATGTCGCGAGGA
CAGAGGGTCTTCGGAGCCGTCCTGCGATGA
>BMgn002071|Gene000002
GCAGTATCAGTTTGGAGTTGACATAAAGTGGCTTTCTCCGTGTTATCTTGTGCAACTAGG
AGGCAGAATGAGTCCAATAAAACCAAATCCAGCCAAAGCCTTGCTACGTAACGAAATTGC
CGCTAAAATCGCCGCCTTGACGAATGAAGAGAAAAAAAGACAATCGCAAATTGTTTATGA
AAAGGTTATCAACCACTCATGGTACAAATCATCAAGTCGTATTGCTCTCTACATGAGCAC
>FBgn0004907;CG17870-PD 14-3-3zeta~14-3-3zeta;14-3-3_protein
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>FBgn0004907;CG17870-PB 14-3-3zeta~14-3-3zeta;14-3-3_protein
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKNAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>FBgn0004907;CG17870-PF 14-3-3zeta~14-3-3zeta;14-3-3_protein
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKKAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>FBgn0020238;CG31196-PA 14-3-3epsilon~14-3-3epsilon;14-3-3_protein
MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDGEPKEQIQDVEDQDVS
>FBgn0020238;CG31196-PB 14-3-3epsilon~14-3-3epsilon;14-3-3_protein
MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEVDPNAGDGEPKEQIQDVEDQDVS
>FBgn0004907;CG17870-PD 14-3-3zeta~14-3-3zeta;14-3-3_protein
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>FBgn0004907;CG17870-PB 14-3-3zeta~14-3-3zeta;14-3-3_protein
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKNAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>FBgn0004907;CG17870-PF 14-3-3zeta~14-3-3zeta;14-3-3_protein
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKKAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>FBgn0020238;CG31196-PA 14-3-3epsilon~14-3-3epsilon;14-3-3_protein
MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDGEPKEQIQDVEDQDVS
>FBgn0020238;CG31196-PB 14-3-3epsilon~14-3-3epsilon;14-3-3_protein
MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEVDPNAGDGEPKEQIQDVEDQDVS
annotation~blast-diamond_for_cDNA -c 8 -m 32 -x input_2/ -y input_3/ -z input_4/ input_1/test.fa
qseqid length blastn.GenesetA.nt.fasta:sseqid qlen slen pident length mismatch gapopen qstart qend sstart send qframe evalue bitscore stitle blastx.Dm-r6.49.fasta:sseqid qlen slen pident length mismatch gapopen qstart qend sstart send qframe evalue bitscore stitle diamond.Dm-r6.49.fasta:sseqid qlen slen pident length mismatch gapopen qstart qend sstart send qframe evalue bitscore stitle
BMgn002071|Gene000002 781 BMgn002071|Gene000002 781 781 100.000 781 0 0 1 781 1 781 1 0.0 1443 BMgn002071|Gene000002 FBgn0085453;CG34424-PB 781 201 34.343 198 118 4 68 625 1 198 2 9.15e-32 116 FBgn0085453;CG34424-PB Methenyltetrahydrofolate_synthetase~Mthfs;CYCLO-LIGASES FBgn0085453;CG34424-PB 781 201 34.4 192 114 4 86 625 7 198 2 7.23e-29 108 FBgn0085453;CG34424-PB Methenyltetrahydrofolate_synthetase~Mthfs;CYCLO-LIGASES
BMgn002072|Gene000001 210 BMgn002072|Gene000001 210 210 100.000 210 0 0 1 210 1 210 1 4.17e-108 388 BMgn002072|Gene000001
BMgn002073|Gene000003 4740 BMgn002073|Gene000003 4740 5525 100.000 4740 0 0 1 4740 1 4740 1 0.0 8754 BMgn002073|Gene000003 FBgn0036043;CG8177-PI 4740 1201 50.333 1200 492 19 63 3386 14 1201 3 0.0 1049 FBgn0036043;CG8177-PI Anion_exchanger_2~Ae2;SLC4:_Bicarbonate_transporter FBgn0036043;CG8177-PI 4740 1201 50.6 1212 487 21 36 3383 5 1200 3 0.0 1016 FBgn0036043;CG8177-PI Anion_exchanger_2~Ae2;SLC4:_Bicarbonate_transporter
pp annotation~diamond -c 8 -m 32 -x input_2/ -y input_3/ -z input_4/ input_1/test.fa Checking the realpath of input files. 0 input_1/test.fa 0 input_2/ 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.njs 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.ndb 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.ntf 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.nin 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.nhr 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.nsq 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.not 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.nto 0 input_3/ 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.pjs 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.pdb 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.ptf 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.pin 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.phr 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.psq 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.pot 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.pto 0 input_4/ 1 /yoshitake/test/annotation~diamond/input_4/Dm-r6.49.fasta 1 /yoshitake/test/annotation~diamond/input_4/Dm-r6.49.fasta.formatted.txt 1 /yoshitake/test/annotation~diamond/input_4/Dm-r6.49.fasta.formatted.txt.dmnd c2997108/centos7:3-java centos:centos6 ncbi/blast:2.13.0 quay.io/biocontainers/diamond:2.1.4--hb97b32f_0 quay.io/biocontainers/exonerate:2.2.0--1 using docker + set -o pipefail + find input_1/test.fa input_2/ input_3/ input_4/ + grep -E '(fa|fasta|fsa|fna|faa)[.]gz$' + read i + xargs '-d\n' -I '{}' -P 8 bash -c '{}' + true + find input_1/test.fa input_2/ input_3/ input_4/ + grep -E '(fa|fasta|fsa|fna|faa)$' + read i + xargs '-d\n' -I '{}' -P 8 bash -c '{}' + echo 'PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm quay.io/biocontainers/exonerate:2.2.0--1 fastareformat "input_1/test.fa" |sed '\''s/\r//g'\'' > "input_1/test.fa".formatted.txt' + read i + echo 'PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm quay.io/biocontainers/exonerate:2.2.0--1 fastareformat "input_2/GenesetA.nt.fasta" |sed '\''s/\r//g'\'' > "input_2/GenesetA.nt.fasta".formatted.txt' + read i + echo 'PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm quay.io/biocontainers/exonerate:2.2.0--1 fastareformat "input_3/Dm-r6.49.fasta" |sed '\''s/\r//g'\'' > "input_3/Dm-r6.49.fasta".formatted.txt' + read i + echo 'PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm quay.io/biocontainers/exonerate:2.2.0--1 fastareformat "input_4/Dm-r6.49.fasta" |sed '\''s/\r//g'\'' > "input_4/Dm-r6.49.fasta".formatted.txt' + read i ++ echo input_1/test.fa ++ sed 's/[.]gz$//' + input=input_1/test.fa.formatted.txt + xargs '-d\n' -I '{}' -P 1 bash -c '{}' + grep -E '(fa|fasta|fsa|fna|faa)[.]formatted[.]txt$' + find input_2/ + read i ++ basename input_2/GenesetA.nt.fasta.formatted.txt + echo 'PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm ncbi/blast:2.13.0 makeblastdb -in "input_2/GenesetA.nt.fasta.formatted.txt" -dbtype nucl; PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm ncbi/blast:2.13.0 blastn -db "input_2/GenesetA.nt.fasta.formatted.txt" -query "input_1/test.fa.formatted.txt" -num_threads 8 -outfmt "6 qseqid sseqid qlen slen pident length mismatch gapopen qstart qend sstart send qframe evalue bitscore stitle" -out "input_1/test.fa.formatted.txt.blastn.GenesetA.nt.fasta.formatted.txt.tsv" ' + read i + find input_3/ + grep -E '(fa|fasta|fsa|fna|faa)[.]formatted[.]txt$' + read i ++ basename input_3/Dm-r6.49.fasta.formatted.txt + echo 'PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm ncbi/blast:2.13.0 makeblastdb -in "input_3/Dm-r6.49.fasta.formatted.txt" -dbtype prot; PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm ncbi/blast:2.13.0 blastx -db "input_3/Dm-r6.49.fasta.formatted.txt" -query "input_1/test.fa.formatted.txt" -num_threads 8 -outfmt "6 qseqid sseqid qlen slen pident length mismatch gapopen qstart qend sstart send qframe evalue bitscore stitle" -out "input_1/test.fa.formatted.txt.blastx.Dm-r6.49.fasta.formatted.txt.tsv" ' + read i + find input_4/ + grep -E '(fa|fasta|fsa|fna|faa)[.]formatted[.]txt$' + read i ++ basename input_4/Dm-r6.49.fasta.formatted.txt + echo 'PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm quay.io/biocontainers/diamond:2.1.4--hb97b32f_0 diamond makedb --in "input_4/Dm-r6.49.fasta.formatted.txt" -d "input_4/Dm-r6.49.fasta.formatted.txt"; PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm quay.io/biocontainers/diamond:2.1.4--hb97b32f_0 diamond blastx -d "input_4/Dm-r6.49.fasta.formatted.txt" -q "input_1/test.fa.formatted.txt" --threads 8 --outfmt 6 qseqid sseqid qlen slen pident length mismatch gapopen qstart qend sstart send qframe evalue bitscore salltitles -o "input_1/test.fa.formatted.txt.diamond.Dm-r6.49.fasta.formatted.txt.tsv" --sensitive' + read i Building a new DB, current time: 03/07/2023 17:51:34 New DB name: /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt New DB title: input_2/GenesetA.nt.fasta.formatted.txt Sequence type: Nucleotide Deleted existing Nucleotide BLAST database named /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt Keep MBits: T Maximum file size: 3000000000B Adding sequences from FASTA; added 16823 sequences in 0.536334 seconds. Building a new DB, current time: 03/07/2023 17:51:38 New DB name: /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt New DB title: input_3/Dm-r6.49.fasta.formatted.txt Sequence type: Protein Deleted existing Protein BLAST database named /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt Keep MBits: T Maximum file size: 3000000000B Adding sequences from FASTA; added 22449 sequences in 0.638087 seconds. diamond v2.1.4.158 (C) Max Planck Society for the Advancement of Science Documentation, support and updates available at http://www.diamondsearch.org Please cite: http://dx.doi.org/10.1038/s41592-021-01101-x Nature Methods (2021) #CPU threads: 16 Scoring parameters: (Matrix=BLOSUM62 Lambda=0.267 K=0.041 Penalties=11/1) Database input file: input_4/Dm-r6.49.fasta.formatted.txt Opening the database file... [0.009s] Loading sequences... [0.115s] Masking sequences... [0.229s] Writing sequences... [0.012s] Hashing sequences... [0.005s] Loading sequences... [0s] Writing trailer... [0s] Closing the input file... [0s] Closing the database file... [0.004s] Database sequences 22449 Database letters 15508912 Database hash a5438a99987074936422a8c4d8ca0151 Total time 0.377000s diamond v2.1.4.158 (C) Max Planck Society for the Advancement of Science Documentation, support and updates available at http://www.diamondsearch.org Please cite: http://dx.doi.org/10.1038/s41592-021-01101-x Nature Methods (2021) #CPU threads: 8 Scoring parameters: (Matrix=BLOSUM62 Lambda=0.267 K=0.041 Penalties=11/1) Temporary directory: input_1 #Target sequences to report alignments for: 25 Opening the database... [0.014s] Database: input_4/Dm-r6.49.fasta.formatted.txt (type: Diamond database, sequences: 22449, letters: 15508912) Block size = 2000000000 Algorithm: Double-indexed Building query histograms... [0.002s] Loading reference sequences... [0.026s] Masking reference... [0.273s] Initializing temporary storage... [0s] Building reference histograms... [0.726s] Allocating buffers... [0s] Processing query block 1, reference block 1/1, shape 1/16, index chunk 1/4. Building reference seed array... [0.07s] Building query seed array... [0.002s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.004s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 1/16, index chunk 2/4. Building reference seed array... [0.076s] Building query seed array... [0.002s] Computing hash join... [0.01s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 1/16, index chunk 3/4. Building reference seed array... [0.07s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 1/16, index chunk 4/4. Building reference seed array... [0.059s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 2/16, index chunk 1/4. Building reference seed array... [0.054s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 2/16, index chunk 2/4. Building reference seed array... [0.063s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 2/16, index chunk 3/4. Building reference seed array... [0.07s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 2/16, index chunk 4/4. Building reference seed array... [0.054s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 3/16, index chunk 1/4. Building reference seed array... [0.051s] Building query seed array... [0.001s] Computing hash join... [0.006s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 3/16, index chunk 2/4. Building reference seed array... [0.065s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 3/16, index chunk 3/4. Building reference seed array... [0.065s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 3/16, index chunk 4/4. Building reference seed array... [0.057s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 4/16, index chunk 1/4. Building reference seed array... [0.058s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 4/16, index chunk 2/4. Building reference seed array... [0.07s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 4/16, index chunk 3/4. Building reference seed array... [0.067s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 4/16, index chunk 4/4. Building reference seed array... [0.056s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 5/16, index chunk 1/4. Building reference seed array... [0.064s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 5/16, index chunk 2/4. Building reference seed array... [0.069s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 5/16, index chunk 3/4. Building reference seed array... [0.064s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 5/16, index chunk 4/4. Building reference seed array... [0.053s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 6/16, index chunk 1/4. Building reference seed array... [0.055s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 6/16, index chunk 2/4. Building reference seed array... [0.067s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 6/16, index chunk 3/4. Building reference seed array... [0.068s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 6/16, index chunk 4/4. Building reference seed array... [0.054s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 7/16, index chunk 1/4. Building reference seed array... [0.058s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 7/16, index chunk 2/4. Building reference seed array... [0.068s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 7/16, index chunk 3/4. Building reference seed array... [0.068s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 7/16, index chunk 4/4. Building reference seed array... [0.057s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 8/16, index chunk 1/4. Building reference seed array... [0.053s] Building query seed array... [0.001s] Computing hash join... [0.006s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 8/16, index chunk 2/4. Building reference seed array... [0.064s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 8/16, index chunk 3/4. Building reference seed array... [0.07s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 8/16, index chunk 4/4. Building reference seed array... [0.051s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 9/16, index chunk 1/4. Building reference seed array... [0.061s] Building query seed array... [0.001s] Computing hash join... [0.01s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 9/16, index chunk 2/4. Building reference seed array... [0.07s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 9/16, index chunk 3/4. Building reference seed array... [0.073s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 9/16, index chunk 4/4. Building reference seed array... [0.051s] Building query seed array... [0.002s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 10/16, index chunk 1/4. Building reference seed array... [0.065s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 10/16, index chunk 2/4. Building reference seed array... [0.076s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 10/16, index chunk 3/4. Building reference seed array... [0.068s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 10/16, index chunk 4/4. Building reference seed array... [0.05s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 11/16, index chunk 1/4. Building reference seed array... [0.055s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 11/16, index chunk 2/4. Building reference seed array... [0.069s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 11/16, index chunk 3/4. Building reference seed array... [0.076s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 11/16, index chunk 4/4. Building reference seed array... [0.062s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 12/16, index chunk 1/4. Building reference seed array... [0.059s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 12/16, index chunk 2/4. Building reference seed array... [0.066s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 12/16, index chunk 3/4. Building reference seed array... [0.069s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 12/16, index chunk 4/4. Building reference seed array... [0.061s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 13/16, index chunk 1/4. Building reference seed array... [0.056s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 13/16, index chunk 2/4. Building reference seed array... [0.071s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 13/16, index chunk 3/4. Building reference seed array... [0.066s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 13/16, index chunk 4/4. Building reference seed array... [0.055s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 14/16, index chunk 1/4. Building reference seed array... [0.059s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 14/16, index chunk 2/4. Building reference seed array... [0.065s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 14/16, index chunk 3/4. Building reference seed array... [0.072s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 14/16, index chunk 4/4. Building reference seed array... [0.053s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 15/16, index chunk 1/4. Building reference seed array... [0.056s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 15/16, index chunk 2/4. Building reference seed array... [0.067s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 15/16, index chunk 3/4. Building reference seed array... [0.074s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 15/16, index chunk 4/4. Building reference seed array... [0.067s] Building query seed array... [0.002s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 16/16, index chunk 1/4. Building reference seed array... [0.058s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 16/16, index chunk 2/4. Building reference seed array... [0.073s] Building query seed array... [0.002s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 16/16, index chunk 3/4. Building reference seed array... [0.066s] Building query seed array... [0.001s] Computing hash join... [0.006s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 16/16, index chunk 4/4. Building reference seed array... [0.062s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Deallocating buffers... [0s] Clearing query masking... [0s] Computing alignments... Loading trace points... [0.001s] Sorting trace points... [0s] Computing alignments... [0.014s] Deallocating buffers... [0s] Loading trace points... [0s] [0.016s] Deallocating reference... [0.001s] Loading reference sequences... [0s] Deallocating buffers... [0s] Deallocating queries... [0s] Total time = 6.07s Reported 19 pairwise alignments, 19 HSPs. 2 queries aligned. + for i in '"$input".*.tsv' ++ basename input_1/test.fa.formatted.txt.blastn.GenesetA.nt.fasta.formatted.txt.tsv ++ sed 's/.*[.]formatted[.]txt[.]\(.*\)[.]formatted[.]txt[.]tsv$/\1/' + awk '-F\t' -v name=blastn.GenesetA.nt.fasta 'BEGIN{print "qseqid\t"name":sseqid\tqlen\tslen\tpident\tlength\tmismatch\tgapopen\tqstart\tqend\tsstart\tsend\tqframe\tevalue\tbitscore\tstitle"} {if($1!=old){print $0; old=$1}}' input_1/test.fa.formatted.txt.blastn.GenesetA.nt.fasta.formatted.txt.tsv + for i in '"$input".*.tsv' ++ basename input_1/test.fa.formatted.txt.blastx.Dm-r6.49.fasta.formatted.txt.tsv ++ sed 's/.*[.]formatted[.]txt[.]\(.*\)[.]formatted[.]txt[.]tsv$/\1/' + awk '-F\t' -v name=blastx.Dm-r6.49.fasta 'BEGIN{print "qseqid\t"name":sseqid\tqlen\tslen\tpident\tlength\tmismatch\tgapopen\tqstart\tqend\tsstart\tsend\tqframe\tevalue\tbitscore\tstitle"} {if($1!=old){print $0; old=$1}}' input_1/test.fa.formatted.txt.blastx.Dm-r6.49.fasta.formatted.txt.tsv + for i in '"$input".*.tsv' ++ basename input_1/test.fa.formatted.txt.diamond.Dm-r6.49.fasta.formatted.txt.tsv ++ sed 's/.*[.]formatted[.]txt[.]\(.*\)[.]formatted[.]txt[.]tsv$/\1/' + awk '-F\t' -v name=diamond.Dm-r6.49.fasta 'BEGIN{print "qseqid\t"name":sseqid\tqlen\tslen\tpident\tlength\tmismatch\tgapopen\tqstart\tqend\tsstart\tsend\tqframe\tevalue\tbitscore\tstitle"} {if($1!=old){print $0; old=$1}}' input_1/test.fa.formatted.txt.diamond.Dm-r6.49.fasta.formatted.txt.tsv + FUNC_RUN_DOCKER c2997108/centos7:3-java merge_table.pl -k input_1/test.fa.formatted.txt.blastn.GenesetA.nt.fasta.formatted.txt.tsv.txt input_1/test.fa.formatted.txt.blastx.Dm-r6.49.fasta.formatted.txt.tsv.txt input_1/test.fa.formatted.txt.diamond.Dm-r6.49.fasta.formatted.txt.tsv.txt + PP_RUN_IMAGE=c2997108/centos7:3-java + shift + PP_RUN_DOCKER_CMD=("${@}") ++ date +%Y%m%d_%H%M%S_%3N + PPDOCNAME=pp20230308_025150_268_30256 + echo pp20230308_025150_268_30256 ++ id -u ++ id -g + docker run --name pp20230308_025150_268_30256 -v /yoshitake/test/annotation~diamond:/yoshitake/test/annotation~diamond -w /yoshitake/test/annotation~diamond -u 2007:600 -i --rm c2997108/centos7:3-java merge_table.pl -k input_1/test.fa.formatted.txt.blastn.GenesetA.nt.fasta.formatted.txt.tsv.txt input_1/test.fa.formatted.txt.blastx.Dm-r6.49.fasta.formatted.txt.tsv.txt input_1/test.fa.formatted.txt.diamond.Dm-r6.49.fasta.formatted.txt.tsv.txt + post_processing + '[' 1 = 1 ']' + rm -f /yoshitake/test/annotation~diamond/pp-singularity-flag + '[' '' = y ']' + echo 0 + exit PID: 413167 Checking the realpath of input files. 0 input_1/test.fa 0 input_2/ 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.njs 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.ndb 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.ntf 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.nin 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.nhr 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.nsq 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.not 1 /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt.nto 0 input_3/ 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.pjs 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.pdb 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.ptf 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.pin 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.phr 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.psq 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.pot 1 /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt.pto 0 input_4/ 1 /yoshitake/test/annotation~diamond/input_4/Dm-r6.49.fasta 1 /yoshitake/test/annotation~diamond/input_4/Dm-r6.49.fasta.formatted.txt 1 /yoshitake/test/annotation~diamond/input_4/Dm-r6.49.fasta.formatted.txt.dmnd c2997108/centos7:3-java centos:centos6 ncbi/blast:2.13.0 quay.io/biocontainers/diamond:2.1.4--hb97b32f_0 quay.io/biocontainers/exonerate:2.2.0--1 using docker + set -o pipefail + find input_1/test.fa input_2/ input_3/ input_4/ + grep -E '(fa|fasta|fsa|fna|faa)[.]gz$' + read i + xargs '-d\n' -I '{}' -P 8 bash -c '{}' + true + find input_1/test.fa input_2/ input_3/ input_4/ + grep -E '(fa|fasta|fsa|fna|faa)$' + read i + xargs '-d\n' -I '{}' -P 8 bash -c '{}' + echo 'PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm quay.io/biocontainers/exonerate:2.2.0--1 fastareformat "input_1/test.fa" |sed '\''s/\r//g'\'' > "input_1/test.fa".formatted.txt' + read i + echo 'PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm quay.io/biocontainers/exonerate:2.2.0--1 fastareformat "input_2/GenesetA.nt.fasta" |sed '\''s/\r//g'\'' > "input_2/GenesetA.nt.fasta".formatted.txt' + read i + echo 'PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm quay.io/biocontainers/exonerate:2.2.0--1 fastareformat "input_3/Dm-r6.49.fasta" |sed '\''s/\r//g'\'' > "input_3/Dm-r6.49.fasta".formatted.txt' + read i + echo 'PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm quay.io/biocontainers/exonerate:2.2.0--1 fastareformat "input_4/Dm-r6.49.fasta" |sed '\''s/\r//g'\'' > "input_4/Dm-r6.49.fasta".formatted.txt' + read i ++ echo input_1/test.fa ++ sed 's/[.]gz$//' + input=input_1/test.fa.formatted.txt + xargs '-d\n' -I '{}' -P 1 bash -c '{}' + find input_2/ + grep -E '(fa|fasta|fsa|fna|faa)[.]formatted[.]txt$' + read i ++ basename input_2/GenesetA.nt.fasta.formatted.txt + echo 'PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm ncbi/blast:2.13.0 makeblastdb -in "input_2/GenesetA.nt.fasta.formatted.txt" -dbtype nucl; PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm ncbi/blast:2.13.0 blastn -db "input_2/GenesetA.nt.fasta.formatted.txt" -query "input_1/test.fa.formatted.txt" -num_threads 8 -outfmt "6 qseqid sseqid qlen slen pident length mismatch gapopen qstart qend sstart send qframe evalue bitscore stitle" -out "input_1/test.fa.formatted.txt.blastn.GenesetA.nt.fasta.formatted.txt.tsv" ' + read i + find input_3/ + grep -E '(fa|fasta|fsa|fna|faa)[.]formatted[.]txt$' + read i ++ basename input_3/Dm-r6.49.fasta.formatted.txt + echo 'PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm ncbi/blast:2.13.0 makeblastdb -in "input_3/Dm-r6.49.fasta.formatted.txt" -dbtype prot; PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm ncbi/blast:2.13.0 blastx -db "input_3/Dm-r6.49.fasta.formatted.txt" -query "input_1/test.fa.formatted.txt" -num_threads 8 -outfmt "6 qseqid sseqid qlen slen pident length mismatch gapopen qstart qend sstart send qframe evalue bitscore stitle" -out "input_1/test.fa.formatted.txt.blastx.Dm-r6.49.fasta.formatted.txt.tsv" ' + read i + find input_4/ + grep -E '(fa|fasta|fsa|fna|faa)[.]formatted[.]txt$' + read i ++ basename input_4/Dm-r6.49.fasta.formatted.txt + echo 'PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm quay.io/biocontainers/diamond:2.1.4--hb97b32f_0 diamond makedb --in "input_4/Dm-r6.49.fasta.formatted.txt" -d "input_4/Dm-r6.49.fasta.formatted.txt"; PPDOCNAME=pp`date +%Y%m%d_%H%M%S_%3N`_$RANDOM; echo $PPDOCNAME >> /yoshitake/test/annotation~diamond/pp-docker-list; docker run --name ${PPDOCNAME} -v $PWD:$PWD -w $PWD -u 2007:600 -i --rm quay.io/biocontainers/diamond:2.1.4--hb97b32f_0 diamond blastx -d "input_4/Dm-r6.49.fasta.formatted.txt" -q "input_1/test.fa.formatted.txt" --threads 8 --outfmt 6 qseqid sseqid qlen slen pident length mismatch gapopen qstart qend sstart send qframe evalue bitscore salltitles -o "input_1/test.fa.formatted.txt.diamond.Dm-r6.49.fasta.formatted.txt.tsv" --sensitive' + read i Building a new DB, current time: 03/07/2023 17:53:08 New DB name: /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt New DB title: input_2/GenesetA.nt.fasta.formatted.txt Sequence type: Nucleotide Deleted existing Nucleotide BLAST database named /yoshitake/test/annotation~diamond/input_2/GenesetA.nt.fasta.formatted.txt Keep MBits: T Maximum file size: 3000000000B Adding sequences from FASTA; added 16823 sequences in 0.516625 seconds. Building a new DB, current time: 03/07/2023 17:53:12 New DB name: /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt New DB title: input_3/Dm-r6.49.fasta.formatted.txt Sequence type: Protein Deleted existing Protein BLAST database named /yoshitake/test/annotation~diamond/input_3/Dm-r6.49.fasta.formatted.txt Keep MBits: T Maximum file size: 3000000000B Adding sequences from FASTA; added 22449 sequences in 0.631008 seconds. diamond v2.1.4.158 (C) Max Planck Society for the Advancement of Science Documentation, support and updates available at http://www.diamondsearch.org Please cite: http://dx.doi.org/10.1038/s41592-021-01101-x Nature Methods (2021) #CPU threads: 16 Scoring parameters: (Matrix=BLOSUM62 Lambda=0.267 K=0.041 Penalties=11/1) Database input file: input_4/Dm-r6.49.fasta.formatted.txt Opening the database file... [0.01s] Loading sequences... [0.113s] Masking sequences... [0.229s] Writing sequences... [0.012s] Hashing sequences... [0.005s] Loading sequences... [0s] Writing trailer... [0s] Closing the input file... [0s] Closing the database file... [0.004s] Database sequences 22449 Database letters 15508912 Database hash a5438a99987074936422a8c4d8ca0151 Total time 0.375000s diamond v2.1.4.158 (C) Max Planck Society for the Advancement of Science Documentation, support and updates available at http://www.diamondsearch.org Please cite: http://dx.doi.org/10.1038/s41592-021-01101-x Nature Methods (2021) #CPU threads: 8 Scoring parameters: (Matrix=BLOSUM62 Lambda=0.267 K=0.041 Penalties=11/1) Temporary directory: input_1 #Target sequences to report alignments for: 25 Opening the database... [0.016s] Database: input_4/Dm-r6.49.fasta.formatted.txt (type: Diamond database, sequences: 22449, letters: 15508912) Block size = 2000000000 Algorithm: Double-indexed Building query histograms... [0.002s] Loading reference sequences... [0.025s] Masking reference... [0.239s] Initializing temporary storage... [0s] Building reference histograms... [0.726s] Allocating buffers... [0.001s] Processing query block 1, reference block 1/1, shape 1/16, index chunk 1/4. Building reference seed array... [0.07s] Building query seed array... [0.002s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.004s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 1/16, index chunk 2/4. Building reference seed array... [0.074s] Building query seed array... [0.002s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 1/16, index chunk 3/4. Building reference seed array... [0.068s] Building query seed array... [0.002s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 1/16, index chunk 4/4. Building reference seed array... [0.056s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 2/16, index chunk 1/4. Building reference seed array... [0.056s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 2/16, index chunk 2/4. Building reference seed array... [0.066s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 2/16, index chunk 3/4. Building reference seed array... [0.068s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 2/16, index chunk 4/4. Building reference seed array... [0.06s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 3/16, index chunk 1/4. Building reference seed array... [0.061s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 3/16, index chunk 2/4. Building reference seed array... [0.064s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 3/16, index chunk 3/4. Building reference seed array... [0.07s] Building query seed array... [0.002s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 3/16, index chunk 4/4. Building reference seed array... [0.057s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 4/16, index chunk 1/4. Building reference seed array... [0.052s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 4/16, index chunk 2/4. Building reference seed array... [0.066s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 4/16, index chunk 3/4. Building reference seed array... [0.07s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 4/16, index chunk 4/4. Building reference seed array... [0.061s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 5/16, index chunk 1/4. Building reference seed array... [0.061s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 5/16, index chunk 2/4. Building reference seed array... [0.07s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 5/16, index chunk 3/4. Building reference seed array... [0.074s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 5/16, index chunk 4/4. Building reference seed array... [0.058s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 6/16, index chunk 1/4. Building reference seed array... [0.056s] Building query seed array... [0.002s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 6/16, index chunk 2/4. Building reference seed array... [0.064s] Building query seed array... [0.002s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 6/16, index chunk 3/4. Building reference seed array... [0.071s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 6/16, index chunk 4/4. Building reference seed array... [0.053s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 7/16, index chunk 1/4. Building reference seed array... [0.058s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 7/16, index chunk 2/4. Building reference seed array... [0.07s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 7/16, index chunk 3/4. Building reference seed array... [0.064s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 7/16, index chunk 4/4. Building reference seed array... [0.051s] Building query seed array... [0.001s] Computing hash join... [0.006s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 8/16, index chunk 1/4. Building reference seed array... [0.051s] Building query seed array... [0.001s] Computing hash join... [0.006s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 8/16, index chunk 2/4. Building reference seed array... [0.063s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 8/16, index chunk 3/4. Building reference seed array... [0.07s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 8/16, index chunk 4/4. Building reference seed array... [0.055s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 9/16, index chunk 1/4. Building reference seed array... [0.058s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 9/16, index chunk 2/4. Building reference seed array... [0.07s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 9/16, index chunk 3/4. Building reference seed array... [0.068s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 9/16, index chunk 4/4. Building reference seed array... [0.058s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 10/16, index chunk 1/4. Building reference seed array... [0.06s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 10/16, index chunk 2/4. Building reference seed array... [0.069s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 10/16, index chunk 3/4. Building reference seed array... [0.075s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 10/16, index chunk 4/4. Building reference seed array... [0.06s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 11/16, index chunk 1/4. Building reference seed array... [0.064s] Building query seed array... [0.002s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 11/16, index chunk 2/4. Building reference seed array... [0.071s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 11/16, index chunk 3/4. Building reference seed array... [0.07s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 11/16, index chunk 4/4. Building reference seed array... [0.06s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 12/16, index chunk 1/4. Building reference seed array... [0.057s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 12/16, index chunk 2/4. Building reference seed array... [0.076s] Building query seed array... [0.001s] Computing hash join... [0.01s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 12/16, index chunk 3/4. Building reference seed array... [0.075s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 12/16, index chunk 4/4. Building reference seed array... [0.058s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 13/16, index chunk 1/4. Building reference seed array... [0.064s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 13/16, index chunk 2/4. Building reference seed array... [0.074s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 13/16, index chunk 3/4. Building reference seed array... [0.068s] Building query seed array... [0.002s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 13/16, index chunk 4/4. Building reference seed array... [0.057s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 14/16, index chunk 1/4. Building reference seed array... [0.054s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 14/16, index chunk 2/4. Building reference seed array... [0.063s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 14/16, index chunk 3/4. Building reference seed array... [0.075s] Building query seed array... [0.001s] Computing hash join... [0.01s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 14/16, index chunk 4/4. Building reference seed array... [0.061s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 15/16, index chunk 1/4. Building reference seed array... [0.064s] Building query seed array... [0.001s] Computing hash join... [0.009s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 15/16, index chunk 2/4. Building reference seed array... [0.073s] Building query seed array... [0.001s] Computing hash join... [0.01s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 15/16, index chunk 3/4. Building reference seed array... [0.069s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 15/16, index chunk 4/4. Building reference seed array... [0.058s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 16/16, index chunk 1/4. Building reference seed array... [0.051s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 16/16, index chunk 2/4. Building reference seed array... [0.065s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 16/16, index chunk 3/4. Building reference seed array... [0.071s] Building query seed array... [0.001s] Computing hash join... [0.008s] Masking low complexity seeds... [0s] Searching alignments... [0.001s] Deallocating memory... [0s] Processing query block 1, reference block 1/1, shape 16/16, index chunk 4/4. Building reference seed array... [0.056s] Building query seed array... [0.001s] Computing hash join... [0.007s] Masking low complexity seeds... [0s] Searching alignments... [0s] Deallocating memory... [0s] Deallocating buffers... [0s] Clearing query masking... [0s] Computing alignments... Loading trace points... [0.001s] Sorting trace points... [0s] Computing alignments... [0.011s] Deallocating buffers... [0s] Loading trace points... [0s] [0.013s] Deallocating reference... [0.001s] Loading reference sequences... [0s] Deallocating buffers... [0s] Deallocating queries... [0s] Total time = 6.09s Reported 19 pairwise alignments, 19 HSPs. 2 queries aligned. + for i in '"$input".*.tsv' ++ basename input_1/test.fa.formatted.txt.blastn.GenesetA.nt.fasta.formatted.txt.tsv ++ sed 's/.*[.]formatted[.]txt[.]\(.*\)[.]formatted[.]txt[.]tsv$/\1/' + awk '-F\t' -v name=blastn.GenesetA.nt.fasta 'BEGIN{print "qseqid\t"name":sseqid\tqlen\tslen\tpident\tlength\tmismatch\tgapopen\tqstart\tqend\tsstart\tsend\tqframe\tevalue\tbitscore\tstitle"} {if($1!=old){print $0; old=$1}}' input_1/test.fa.formatted.txt.blastn.GenesetA.nt.fasta.formatted.txt.tsv + for i in '"$input".*.tsv' ++ basename input_1/test.fa.formatted.txt.blastx.Dm-r6.49.fasta.formatted.txt.tsv ++ sed 's/.*[.]formatted[.]txt[.]\(.*\)[.]formatted[.]txt[.]tsv$/\1/' + awk '-F\t' -v name=blastx.Dm-r6.49.fasta 'BEGIN{print "qseqid\t"name":sseqid\tqlen\tslen\tpident\tlength\tmismatch\tgapopen\tqstart\tqend\tsstart\tsend\tqframe\tevalue\tbitscore\tstitle"} {if($1!=old){print $0; old=$1}}' input_1/test.fa.formatted.txt.blastx.Dm-r6.49.fasta.formatted.txt.tsv + for i in '"$input".*.tsv' ++ basename input_1/test.fa.formatted.txt.diamond.Dm-r6.49.fasta.formatted.txt.tsv ++ sed 's/.*[.]formatted[.]txt[.]\(.*\)[.]formatted[.]txt[.]tsv$/\1/' + awk '-F\t' -v name=diamond.Dm-r6.49.fasta 'BEGIN{print "qseqid\t"name":sseqid\tqlen\tslen\tpident\tlength\tmismatch\tgapopen\tqstart\tqend\tsstart\tsend\tqframe\tevalue\tbitscore\tstitle"} {if($1!=old){print $0; old=$1}}' input_1/test.fa.formatted.txt.diamond.Dm-r6.49.fasta.formatted.txt.tsv + FUNC_RUN_DOCKER c2997108/centos7:3-java merge_table.pl -k input_1/test.fa.formatted.txt.blastn.GenesetA.nt.fasta.formatted.txt.tsv.txt input_1/test.fa.formatted.txt.blastx.Dm-r6.49.fasta.formatted.txt.tsv.txt input_1/test.fa.formatted.txt.diamond.Dm-r6.49.fasta.formatted.txt.tsv.txt + PP_RUN_IMAGE=c2997108/centos7:3-java + shift + PP_RUN_DOCKER_CMD=("${@}") ++ date +%Y%m%d_%H%M%S_%3N + PPDOCNAME=pp20230308_025324_830_6197 + echo pp20230308_025324_830_6197 ++ id -u ++ id -g + docker run --name pp20230308_025324_830_6197 -v /yoshitake/test/annotation~diamond:/yoshitake/test/annotation~diamond -w /yoshitake/test/annotation~diamond -u 2007:600 -i --rm c2997108/centos7:3-java merge_table.pl -k input_1/test.fa.formatted.txt.blastn.GenesetA.nt.fasta.formatted.txt.tsv.txt input_1/test.fa.formatted.txt.blastx.Dm-r6.49.fasta.formatted.txt.tsv.txt input_1/test.fa.formatted.txt.diamond.Dm-r6.49.fasta.formatted.txt.tsv.txt + FUNC_RUN_DOCKER c2997108/centos7:3-java java -Xmx1G -jar /usr/local/bin/excel2.jar result.txt result.xlsx + PP_RUN_IMAGE=c2997108/centos7:3-java + shift + PP_RUN_DOCKER_CMD=("${@}") ++ date +%Y%m%d_%H%M%S_%3N + PPDOCNAME=pp20230308_025325_546_29793 + echo pp20230308_025325_546_29793 ++ id -u ++ id -g + docker run --name pp20230308_025325_546_29793 -v /yoshitake/test/annotation~diamond:/yoshitake/test/annotation~diamond -w /yoshitake/test/annotation~diamond -u 2007:600 -i --rm c2997108/centos7:3-java java -Xmx1G -jar /usr/local/bin/excel2.jar result.txt result.xlsx Start converting + post_processing + '[' 1 = 1 ']' + rm -f /yoshitake/test/annotation~diamond/pp-singularity-flag + '[' '' = y ']' + echo 0 + exit PID: 418384