# This output was generated with AUGUSTUS (version 3.4.0). # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de), # O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff. # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), # Using native and syntenically mapped cDNA alignments to improve de novo gene finding # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 # No extrinsic information on sequences given. # Sources of extrinsic information: M RM # Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ... # saccharomyces version. Using default transition matrix. # Looks like split/input_2/input_2.fa_chunk_0000012 is in fasta format. # We have hints for 0 sequences and for 0 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 25019, name = 6_related_000180F) ----- # # Predicted genes for sequence number 1 on both strands # start gene g1 6_related_000180F AUGUSTUS gene 153 542 0.4 + . g1 6_related_000180F AUGUSTUS transcript 153 542 0.4 + . g1.t1 6_related_000180F AUGUSTUS start_codon 153 155 . + 0 transcript_id "g1.t1"; gene_id "g1"; 6_related_000180F AUGUSTUS CDS 153 542 0.4 + 0 transcript_id "g1.t1"; gene_id "g1"; 6_related_000180F AUGUSTUS stop_codon 540 542 . + 0 transcript_id "g1.t1"; gene_id "g1"; # protein sequence = [MDYTETWAAVSRLESIRMLAAVAASLGLELWQVDFVAAYLNSIPEVDIYMRQPPGYVTPETEGKVCLLLKTIYGTMQG # AHDWANTLDKSFTSLGYQASKADPCICTKRHPGVTITATYTDDVWGASESR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1 ### # start gene g2 6_related_000180F AUGUSTUS gene 798 1473 0.43 + . g2 6_related_000180F AUGUSTUS transcript 798 1473 0.43 + . g2.t1 6_related_000180F AUGUSTUS start_codon 798 800 . + 0 transcript_id "g2.t1"; gene_id "g2"; 6_related_000180F AUGUSTUS CDS 798 800 0.43 + 0 transcript_id "g2.t1"; gene_id "g2"; 6_related_000180F AUGUSTUS CDS 880 1473 0.99 + 0 transcript_id "g2.t1"; gene_id "g2"; 6_related_000180F AUGUSTUS stop_codon 1471 1473 . + 0 transcript_id "g2.t1"; gene_id "g2"; # protein sequence = [MSVYYLASRATPESLIGALLHVVGYIKSTINYGITFSHDFPLKPMGYVDASYGDDPNTRRSTSGQVFVMSGGPVSWSS # KRQATVALSTVEAEYVALSRGAQQLKWMYAWMEEIGMEQEKPGVLRGDNEGAVSLTKNTHGHHHVKHIDLRTHYIRELVSSKELVVEGIRGTENPVDL # FTKPLPRDTHHRYLEELNIVQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g2 ### # start gene g3 6_related_000180F AUGUSTUS gene 5687 7753 0.84 + . g3 6_related_000180F AUGUSTUS transcript 5687 7753 0.84 + . g3.t1 6_related_000180F AUGUSTUS start_codon 5687 5689 . + 0 transcript_id "g3.t1"; gene_id "g3"; 6_related_000180F AUGUSTUS CDS 5687 7753 0.84 + 0 transcript_id "g3.t1"; gene_id "g3"; 6_related_000180F AUGUSTUS stop_codon 7751 7753 . + 0 transcript_id "g3.t1"; gene_id "g3"; # protein sequence = [MDATHSYNPSSTREDENNSTSENQYHRHQYPTTTRFLPPIDAFDDSLDEEEDDDMPPGIMVDELSPLPPRLLMHDADE # DMLPPGIIITNDMPDTEQRNRNEGKVGDDPPPLVLPPATLSRGGSVLTSDGKTPNRTTNTTRNQPARTGPLTFNYTFLPDMSLATASDGSPGARITEV # ASDLGGLNPENTTYSSLPDASGVEYDPGAIHSVAYPSYPTSYPPTSYHHIPRPPNAFILFRSAFIRSRKISSEIEGNHSTLSKIIGRVWRSLPPPERA # EWEARARIAQEEHRLRYPDWRFSPAGGGSGGGGKGRSKGNRGKGRGRGRGRGRLKAGQGGGDSVTSSAGNEASADMVEGSGQDKGNEEPQEPNEGGLR # RIQLVPRASSSTSMPVSFRTVDTPSNPKYPATSSTQTLSASSAGRAVVVDDPLEISVRNPITSNLQREVVNADVFRTLSATDSNSNMLTSGIDESQGS # ERESDQPREQGGSETVAIDSLSSASTWYPSATAIVKNETDARVDAIADMLAQGFEGRSLEVAVREWEVADEKQKERKRKDRERKERREGRERGMKERE # KRKGNAKEMVIVGMAAQKSHEWVEEANAGVRGSANASMTGQAREMDLDQHQQSQDPGEGRREDETESRRSEQTLYAHVPEFGVEEGFLHGDFGHHGWF # TSYSLGDRKVLYVCRGAVRTFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g3 ### # start gene g4 6_related_000180F AUGUSTUS gene 10025 11740 0.33 - . g4 6_related_000180F AUGUSTUS transcript 10025 11740 0.33 - . g4.t1 6_related_000180F AUGUSTUS stop_codon 10025 10027 . - 0 transcript_id "g4.t1"; gene_id "g4"; 6_related_000180F AUGUSTUS CDS 10025 11740 0.33 - 0 transcript_id "g4.t1"; gene_id "g4"; 6_related_000180F AUGUSTUS start_codon 11738 11740 . - 0 transcript_id "g4.t1"; gene_id "g4"; # protein sequence = [MDIVLEPLKVTARIGCMMSNPVGQLRVCYTPLASTIVDTPEASLIACTGGKDSPFTKAIYKNYGDSSRHAPRLSSSTL # DTIDSIQARNIFPQNLPAYQRAAVTARTNGVVYPFWRDWALAEPCKFLTPEPLHHWHKMFWDHDAKWAIQAVGASHIDFRFSIHQPTVGYRHFQEGIS # SLKQVTGCTHRDIQRYLIPVISGAISAKFVMALRALLDFRYSGQAQRFSQTSSLRVQTALKEFHESKLVILELKARVNPKGKLIDHWEIPKLEFMQSV # EPSIRASGPIMQWTADITEHAHITLVKDPARSGNNHDFEIQICRSLDRLDHVRRFDLMTAMKDASVDFRLEDVEGDEGQDQGAEGLQVDEEEDMELEI # TKISSTEKLVTHLNPVSKKLFGSFRPKQNFFLKARLLERAPSAPLPHRSFIDNVTGEISAFSLVRDPDLKTQTIEEASRLYSLSDFHGACSDLIDRIK # SGTKIFTIGGRKTGNTQSPLPFYRVKVWSRLRIQSRTYFNLDLLTDPHTIFSAPPGPGWEFGRQNAVIVNVDQSFQWPRSSLEGEFSFPYFLSLLLSS # HIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g4 ### # start gene g5 6_related_000180F AUGUSTUS gene 13214 14614 0.99 - . g5 6_related_000180F AUGUSTUS transcript 13214 14614 0.99 - . g5.t1 6_related_000180F AUGUSTUS stop_codon 13214 13216 . - 0 transcript_id "g5.t1"; gene_id "g5"; 6_related_000180F AUGUSTUS CDS 13214 14614 0.99 - 0 transcript_id "g5.t1"; gene_id "g5"; 6_related_000180F AUGUSTUS start_codon 14612 14614 . - 0 transcript_id "g5.t1"; gene_id "g5"; # protein sequence = [MDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLNEGSQREPN # HTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESASERLPAHQ # PWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGA # QYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDNILIFSNELKEHRQVVREVLTRLEKH # DLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVHDWPVPTNFRELRGFLGFANFYRRFIIREGSMECYAPTSKDLASCEVVSCSTTLEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g5 ### # start gene g6 6_related_000180F AUGUSTUS gene 16953 18110 0.93 - . g6 6_related_000180F AUGUSTUS transcript 16953 18110 0.93 - . g6.t1 6_related_000180F AUGUSTUS stop_codon 16953 16955 . - 0 transcript_id "g6.t1"; gene_id "g6"; 6_related_000180F AUGUSTUS CDS 16953 18110 0.93 - 0 transcript_id "g6.t1"; gene_id "g6"; 6_related_000180F AUGUSTUS start_codon 18108 18110 . - 0 transcript_id "g6.t1"; gene_id "g6"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQLDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEAHSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLREHFFTT # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRRRCFGCGAQGHVK # QNCPHKETTCRYCGHRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRAN # AMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g6 ### # start gene g7 6_related_000180F AUGUSTUS gene 20643 20987 0.97 + . g7 6_related_000180F AUGUSTUS transcript 20643 20987 0.97 + . g7.t1 6_related_000180F AUGUSTUS start_codon 20643 20645 . + 0 transcript_id "g7.t1"; gene_id "g7"; 6_related_000180F AUGUSTUS CDS 20643 20987 0.97 + 0 transcript_id "g7.t1"; gene_id "g7"; 6_related_000180F AUGUSTUS stop_codon 20985 20987 . + 0 transcript_id "g7.t1"; gene_id "g7"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVNELASFLCERERKESNGHSNQPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g7 ### # start gene g8 6_related_000180F AUGUSTUS gene 23726 24438 0.26 + . g8 6_related_000180F AUGUSTUS transcript 23726 24438 0.26 + . g8.t1 6_related_000180F AUGUSTUS start_codon 23726 23728 . + 0 transcript_id "g8.t1"; gene_id "g8"; 6_related_000180F AUGUSTUS CDS 23726 23936 0.28 + 0 transcript_id "g8.t1"; gene_id "g8"; 6_related_000180F AUGUSTUS CDS 23999 24438 0.43 + 2 transcript_id "g8.t1"; gene_id "g8"; 6_related_000180F AUGUSTUS stop_codon 24436 24438 . + 0 transcript_id "g8.t1"; gene_id "g8"; # protein sequence = [MMRSVPSKDLDVFASLRGKVSPVVASKISTLSPPLEIKSSTSVPKAPVAPPRLIRRNRELESLKADASTFFSSPRSTR # SRDSDNELLSGFPSAVSASRASSSTKVSTDRKEPKPKTTVKVVEDSKASKPTSSAMVYKRVRLPSRSRKIAPTTAKGKSRQVVVSDDDSASNEVESED # EEEDEDEEEDSAPPPKRLKTTSSLPGKTLFFFLFDFINSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g8 ### # # ----- prediction on sequence number 2 (length = 3632394, name = 7) ----- # # Predicted genes for sequence number 2 on both strands # start gene g9 7 AUGUSTUS gene 10970 12793 0.25 - . g9 7 AUGUSTUS transcript 10970 12793 0.25 - . g9.t1 7 AUGUSTUS stop_codon 10970 10972 . - 0 transcript_id "g9.t1"; gene_id "g9"; 7 AUGUSTUS CDS 10970 12793 0.25 - 0 transcript_id "g9.t1"; gene_id "g9"; 7 AUGUSTUS start_codon 12791 12793 . - 0 transcript_id "g9.t1"; gene_id "g9"; # protein sequence = [MALEKPPSRNETIPDISSSWSGESLSRWISLSGNPEELISSSNSLLLEGTNVAGRSSSFGHSMNDNKNHTLQSAQYPE # THYTYSHPVLSPIGYHLDLSAVQPLAASPSSEGTISPTSHSEIYASSQHSSIGIPAPGNPLSWSHPAPGTGLPDELNSPKPSPVQYTSHLPYPHSSSG # LNTPFMSVVHSPATGSPALHMSTFLPEQAFSAYPERPLTHIDPPREQYVNMSDVASLGGDASSMHRYPSPHALESNRFSSANFGLGSQEDFQGTSRRG # NKRTRAHDSLEVEAPAVKRPRGRPRKDFLLRVKSKIQSRTGAGIENVESDEEIGGDGDSDSYVPSRSTSPPFQDRRKRMSDSSYESSASGNSLNRNST # RATFSLRQLEELSSLSPTDIAAAKGLAQFDFTHGGGSGHSNPGPTSSVAKKSRGRKVPVDGGAMTNVHTSGAPSAEPSFNLNSPNLYTLPDPSNSTGG # DDSTSQYEGGSHSQYANYEGSWPSYPQASSVGETSAPKQGRPPARGRYANNTEVRVVSGGIKKATGDRRYVCTAPECGKCFVRGEHLKRHVRSLHSWE # KRECHFFLRFLWSCCFRARLLFIASHNILIGFFPCPSST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g9 ### # start gene g10 7 AUGUSTUS gene 19551 20460 0.91 + . g10 7 AUGUSTUS transcript 19551 20460 0.91 + . g10.t1 7 AUGUSTUS start_codon 19551 19553 . + 0 transcript_id "g10.t1"; gene_id "g10"; 7 AUGUSTUS CDS 19551 20132 0.91 + 0 transcript_id "g10.t1"; gene_id "g10"; 7 AUGUSTUS CDS 20194 20460 1 + 0 transcript_id "g10.t1"; gene_id "g10"; 7 AUGUSTUS stop_codon 20458 20460 . + 0 transcript_id "g10.t1"; gene_id "g10"; # protein sequence = [MTEVSQLLTAPPPTPFSEAPLSQVVSSKAVLREDCRHRLIAAPLRQVDSALDSTFSLTPAPLIAAPLRQVNIDLPPSP # LTSVPTAHQFPLTTGISVAQSVSPKASSSLKKLVLANGTCVCFIPSDVPDPALVSFSDNIPKLVRMWDDAVPGYRAEECLLKIKGHGIPLRLWEQAYK # YGGDGRWKGTKDKWGKWKFIVEAYNRLGEDGFWAKYRDTKTNKPMTYTAIVEALRIERKVHDAIVATQLHDQFGSGFKDKFGYRGQQLVKPSAIVKRS # RMFENIRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g10 ### # start gene g11 7 AUGUSTUS gene 22027 22461 1 - . g11 7 AUGUSTUS transcript 22027 22461 1 - . g11.t1 7 AUGUSTUS stop_codon 22027 22029 . - 0 transcript_id "g11.t1"; gene_id "g11"; 7 AUGUSTUS CDS 22027 22461 1 - 0 transcript_id "g11.t1"; gene_id "g11"; 7 AUGUSTUS start_codon 22459 22461 . - 0 transcript_id "g11.t1"; gene_id "g11"; # protein sequence = [MDPLNNFTGLTDIIRTFGDEPYSFAEQALDDLDAEKEASYSDTQLIAGQDDEMDVLNDHPDGSLFPLIDEEDIGGSEE # SDSDTDDDVMGRRPSPARSARTIAKRRHSSSKSERSGTAIDSNGLRGILNEASKGVSHDTAADYRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g11 ### # start gene g12 7 AUGUSTUS gene 38850 39738 0.94 - . g12 7 AUGUSTUS transcript 38850 39738 0.94 - . g12.t1 7 AUGUSTUS stop_codon 38850 38852 . - 0 transcript_id "g12.t1"; gene_id "g12"; 7 AUGUSTUS CDS 38850 39045 1 - 1 transcript_id "g12.t1"; gene_id "g12"; 7 AUGUSTUS CDS 39134 39738 0.94 - 0 transcript_id "g12.t1"; gene_id "g12"; 7 AUGUSTUS start_codon 39736 39738 . - 0 transcript_id "g12.t1"; gene_id "g12"; # protein sequence = [MCPKAKLVQEHWVDYESSVYSKVGNIQLSRLMGADSNLDHDSKFGIEHKPTAASLTAQVLSEGGKPYYIPAGASDHPL # GGLGFARWAFEVYAQEKELGVFFDTVLVCAVTGSTFAGMIAGFKLLAKTYPEDGERLGRRKVIGIDASATPAETRSQVLRIAKATAEKIGLGADEIEE # DDVILDERYHAGTYGIPDKQTIEAIRYGARMDAFITDPVYEGKSLAGMIDMVKKGEIRALDGENSTNILYAHLGGQLALNAYWDMEERAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g12 ### # start gene g13 7 AUGUSTUS gene 46516 47964 0.38 - . g13 7 AUGUSTUS transcript 46516 47964 0.38 - . g13.t1 7 AUGUSTUS stop_codon 46516 46518 . - 0 transcript_id "g13.t1"; gene_id "g13"; 7 AUGUSTUS CDS 46516 47964 0.38 - 0 transcript_id "g13.t1"; gene_id "g13"; 7 AUGUSTUS start_codon 47962 47964 . - 0 transcript_id "g13.t1"; gene_id "g13"; # protein sequence = [MLSAFIPPLTRFKHPLLRFAASSTGSFGVTMCISLLSSSSFSSSSASSLQSWSSPWSHLYLSASSSWGTSTEKGFSAL # FCILILAGTVCDWAFWRKWGECPDEKWDSYLAEYAVNLPNDVKRAGSFRPFESVWERVFGSRDNRNEEARALKEGNFEKEVAFQIDDAELGLDLDAEY # LSSPGPGKLRKFDSTSPFTNSVDEPLPLYKPHPGLLLKNGRRSSSSRSLSSPSPGFRKKEMVKFRPLDELSSSDEDELDHEKERARIRAVRRRTDPKI # RPMSPSLSDTDNALFGPPDYSDFEDKGDKGRTVGEEDIVSGATRSMSSTPQWTPRFLKQHRSSLSSAHSSAHSSPSQTSRSSERTAVASSNSHPIPPV # LAEASPSLSTPTSTKALPVTQPLVQPLSSSVTPPLVLPVPATPSLLNALHRVEKARNDAYSQEMVGSGSGGAGRDPVIMREEGRGQRWGDFWHEVNEV # KVKGGNRGEGRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g13 ### # start gene g14 7 AUGUSTUS gene 50602 51154 0.42 - . g14 7 AUGUSTUS transcript 50602 51154 0.42 - . g14.t1 7 AUGUSTUS stop_codon 50602 50604 . - 0 transcript_id "g14.t1"; gene_id "g14"; 7 AUGUSTUS CDS 50602 50840 0.46 - 2 transcript_id "g14.t1"; gene_id "g14"; 7 AUGUSTUS CDS 50911 51154 0.48 - 0 transcript_id "g14.t1"; gene_id "g14"; 7 AUGUSTUS start_codon 51152 51154 . - 0 transcript_id "g14.t1"; gene_id "g14"; # protein sequence = [MHYSQLLRVLLSAALALHATTVTASPIRAPDVEGGIGASALGKRATIELYHVTTAASAASIHSGGVKLQVKPTIGDDF # NPKGKGGFYVSDNKAGILDWCKKRQVDANNVKTNCADLITFKFDESALTSLKVHKFGPATLSSTTINSWMEVSQVLANSSFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g14 ### # start gene g15 7 AUGUSTUS gene 60729 61634 0.88 - . g15 7 AUGUSTUS transcript 60729 61634 0.88 - . g15.t1 7 AUGUSTUS stop_codon 60729 60731 . - 0 transcript_id "g15.t1"; gene_id "g15"; 7 AUGUSTUS CDS 60729 61634 0.88 - 0 transcript_id "g15.t1"; gene_id "g15"; 7 AUGUSTUS start_codon 61632 61634 . - 0 transcript_id "g15.t1"; gene_id "g15"; # protein sequence = [MTDQAAAEALVAVGRAGGSSAPGEESDDHEALEGEQPKKKRARKSKGEGVYEGDLHQWTGEGGSPSMHHHPIHRPHSI # PPMGFMHPSLQRPGSSSFNHGGGMLPGINSMDVSGGDPSKRLGGMVFVPGGPGVPGTAAVAGGSNSPGYIRSGSPHAHSPSNGQHPGTLLLPSPQGPG # GMFQPLDVPGGSGTGSTMVAVLPGTTFALIPSVSELERHYAELRDQKMRMEEILERTEKMMQGIKRGIDEMRGGDSGEVRPSSTAPGSTPAPSAPIQR # PPSSSVTEKDRRESVWTVVDATNRGNE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g15 ### # start gene g16 7 AUGUSTUS gene 62235 63419 0.42 - . g16 7 AUGUSTUS transcript 62235 63419 0.42 - . g16.t1 7 AUGUSTUS stop_codon 62235 62237 . - 0 transcript_id "g16.t1"; gene_id "g16"; 7 AUGUSTUS CDS 62235 63109 0.51 - 2 transcript_id "g16.t1"; gene_id "g16"; 7 AUGUSTUS CDS 63281 63419 0.57 - 0 transcript_id "g16.t1"; gene_id "g16"; 7 AUGUSTUS start_codon 63417 63419 . - 0 transcript_id "g16.t1"; gene_id "g16"; # protein sequence = [MPPLTVIHSLSRYTPLALSLVLAFLAALWVSQSCWLSVSGICHSASFSHSPGSSESQTTPVPNGESASSLSAPAAGPP # ANNNNISPARSPPSVSFFNSHQLPHPALGPPHSSSSSGLHLPHQLSPVVSGSSASTNPIGVPPADPAPAVIGPGTCPGDGRCDGTGGSKTCSGCPTFN # NNVNNAFTMCARVEEGDRKRSPATSQQQHSQHHTTGVATSLHHPMPPQQISQHTGSATAAGASPSMMGGVTPGGDGSGSVDPNNHNGGGGGPTGSGNT # NNFGGGDGSGGGPGTPGGGNGNNNSRKVRAAVGALCCANCGTSATPLWRRDDVGNNICNACGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g16 ### # start gene g17 7 AUGUSTUS gene 63906 64394 0.78 - . g17 7 AUGUSTUS transcript 63906 64394 0.78 - . g17.t1 7 AUGUSTUS stop_codon 63906 63908 . - 0 transcript_id "g17.t1"; gene_id "g17"; 7 AUGUSTUS CDS 63906 64394 0.78 - 0 transcript_id "g17.t1"; gene_id "g17"; 7 AUGUSTUS start_codon 64392 64394 . - 0 transcript_id "g17.t1"; gene_id "g17"; # protein sequence = [MEPPIPASFNAIHAASLATISKYTQYAAGPASTVRATEHPARQLSDLSANLSSSTANSTSAESPDSSDSNSVTSPSIQ # TQQLVVELARLHKNSDSVLDPQLDSRSDSASPTLTNQSQSDKLSPVVRQPCENCHTLDTPLWRRDSEGHPVCNACGEYTFPDPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g17 ### # start gene g18 7 AUGUSTUS gene 78292 78780 0.67 - . g18 7 AUGUSTUS transcript 78292 78780 0.67 - . g18.t1 7 AUGUSTUS stop_codon 78292 78294 . - 0 transcript_id "g18.t1"; gene_id "g18"; 7 AUGUSTUS CDS 78292 78780 0.67 - 0 transcript_id "g18.t1"; gene_id "g18"; 7 AUGUSTUS start_codon 78778 78780 . - 0 transcript_id "g18.t1"; gene_id "g18"; # protein sequence = [MDILLRGISTEYTVSVGGVVNSESLARQAVVIAEAYQIDRMYSDRFKGYSGDLSPPTADPFIELFFTPGSVSLAVAAH # TILPLSRGSIHINTTDPSADPIADMQYLTSEVDIRAAVAAARRISLIAVTPPFSDLITEDALHQSGVPLVNATEEEVRKWVLDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g18 ### # start gene g19 7 AUGUSTUS gene 81804 82103 0.48 - . g19 7 AUGUSTUS transcript 81804 82103 0.48 - . g19.t1 7 AUGUSTUS stop_codon 81804 81806 . - 0 transcript_id "g19.t1"; gene_id "g19"; 7 AUGUSTUS CDS 81804 82103 0.48 - 0 transcript_id "g19.t1"; gene_id "g19"; 7 AUGUSTUS start_codon 82101 82103 . - 0 transcript_id "g19.t1"; gene_id "g19"; # protein sequence = [MGEQHKQHETPNLSPPTSLPLFTPPNTMPFASTATPTSNTLAASTSSPDASKAKPKAADDASGAAEVAMSWGQVLWEK # WRWGVLIALAVVVSRLSSARS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g19 ### # start gene g20 7 AUGUSTUS gene 92888 94202 0.62 + . g20 7 AUGUSTUS transcript 92888 94202 0.62 + . g20.t1 7 AUGUSTUS start_codon 92888 92890 . + 0 transcript_id "g20.t1"; gene_id "g20"; 7 AUGUSTUS CDS 92888 92949 0.68 + 0 transcript_id "g20.t1"; gene_id "g20"; 7 AUGUSTUS CDS 93251 94202 0.83 + 1 transcript_id "g20.t1"; gene_id "g20"; 7 AUGUSTUS stop_codon 94200 94202 . + 0 transcript_id "g20.t1"; gene_id "g20"; # protein sequence = [MIFKFQIKRAPSGTIVTCRFKYHDTSYELIAKRAGLTPDATLINGKGRYVGGVSILKVLPAQLQRLPLLSQPNIPLEV # INVEYGKRYRFRVISMSCGVDHGFSIDGHDLTIIEVDGVNTQPLTVNHIQLYAAQRYSVVLHANQKPDVYRIRALATSGVGAQNFTNGVNSGILRYKN # AAGNSDREPTSSQQSHMVSLNENDLRPLECPGAPGKPYPGGADLVLNLTMGFGVVPGASAPSFFMNNVSYVSPKVPVLLQILSGARSAQDLLPAGSVY # TLPRNKVIEINLLGGSAIGGPHPFHLHGVCIQILSSHLPPLIYLYFSMPSMLSRPQVAQNTTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g20 ### # start gene g21 7 AUGUSTUS gene 97433 98528 0.85 + . g21 7 AUGUSTUS transcript 97433 98528 0.85 + . g21.t1 7 AUGUSTUS start_codon 97433 97435 . + 0 transcript_id "g21.t1"; gene_id "g21"; 7 AUGUSTUS CDS 97433 98087 0.86 + 0 transcript_id "g21.t1"; gene_id "g21"; 7 AUGUSTUS CDS 98164 98528 0.98 + 2 transcript_id "g21.t1"; gene_id "g21"; 7 AUGUSTUS stop_codon 98526 98528 . + 0 transcript_id "g21.t1"; gene_id "g21"; # protein sequence = [MSKETKAWAATSPQKIEASTITRRAPDDQDVAINIKFAGICHSDIHTVRSEWKEVEYPLVVGHEIAGIVSAVGKNVTK # FKVGDRVGVGCMVNSCRECDNCKDGEEQYCADMVGTYNAKDPKDGTITQGGYSQYVVVDQAFVLNIPENLPLDKAAPLLCAGITVFSPLNHWKAGPGK # RVGVIGLGGLGHVGVKIAKLVSCIIGVHDPQKLIFVQSLGCRGDPKAFDGLDRKFDIILNTVSAKIPLDKYLSSLRRDGSLVQVGAPSDPLQITPFSL # LPQRIGIHGTLIGGIAETQKMLDFCAKKQIFPEIEVVSASYINEAYDRVVKSQVKFRFVIDVSTM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g21 ### # start gene g22 7 AUGUSTUS gene 99634 99945 0.75 - . g22 7 AUGUSTUS transcript 99634 99945 0.75 - . g22.t1 7 AUGUSTUS stop_codon 99634 99636 . - 0 transcript_id "g22.t1"; gene_id "g22"; 7 AUGUSTUS CDS 99634 99945 0.75 - 0 transcript_id "g22.t1"; gene_id "g22"; 7 AUGUSTUS start_codon 99943 99945 . - 0 transcript_id "g22.t1"; gene_id "g22"; # protein sequence = [MATQQSLVLESKQGNFIISERPIPHLEPGELLVKVQAAGLNPVDWKIQAAGFLVESYPAVLGSDVAGDVEQVGEGVEG # WAKGDRVLVLLGRGNPVLFISNIIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g22 ### # start gene g23 7 AUGUSTUS gene 102347 104140 0.82 + . g23 7 AUGUSTUS transcript 102347 104140 0.82 + . g23.t1 7 AUGUSTUS start_codon 102347 102349 . + 0 transcript_id "g23.t1"; gene_id "g23"; 7 AUGUSTUS CDS 102347 104140 0.82 + 0 transcript_id "g23.t1"; gene_id "g23"; 7 AUGUSTUS stop_codon 104138 104140 . + 0 transcript_id "g23.t1"; gene_id "g23"; # protein sequence = [MDEPSEVSMDITRSPFHSIIGTNCSLSQVERASLKEFLVAPQLEKSRLEAELSRVQAHLKSTEEYIHAHQMLLSPIRK # LPPETLAEIFMHCVLAADAVRSLQEAPLLLTIICRDWRRVAIDTPLLWKSLHFYLPPHLNQDALSLRLAGISLWLERSGSLPLSISFHGRTAYSSPLV # GEFDEHQTKKNMESCIRTLMRFADRIATLSLSLPLSDFALFDELSPPKFPALIYLRLRDANLHEGSYGHLSETPAIAFLPSLLGRMPVLSTLKVHEFH # LRRNAALSFGLGSLTNIDLSTGGITTFGVLLTTNEGLALLAQTPLVQSVKITIHLGNSNNNPNDTSSPARTEVHLNQLVEMRLVFIRVSRLVELSSDM # QTHMTLFFDSIQCPLLESFSVSWQGLLITQLPFRALPLNRLDSLDLDISMDSTTLLECLSLVTNIKSLRFNATSGRGGPGNAMITCSFEESHLLGLTQ # SSKDVVPLCPRLQKLQLIMKTTDGGLNMNTTALINLIQSRRNTLTYCDLFFRNRPPFSPEQLINLRKLKDDGLSLRLHCAKPLLPPNLDPPTMGLPDL # PYMHRRPLLHQMYTVPDVMEGLYGTEVII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g23 ### # start gene g24 7 AUGUSTUS gene 113256 113915 0.93 + . g24 7 AUGUSTUS transcript 113256 113915 0.93 + . g24.t1 7 AUGUSTUS start_codon 113256 113258 . + 0 transcript_id "g24.t1"; gene_id "g24"; 7 AUGUSTUS CDS 113256 113915 0.93 + 0 transcript_id "g24.t1"; gene_id "g24"; 7 AUGUSTUS stop_codon 113913 113915 . + 0 transcript_id "g24.t1"; gene_id "g24"; # protein sequence = [MVKYYKTGHAAVSAFAEHPAVKTIQYTDHYARTRSMIKYSLVLSSEGTVVPLPITVPSPPNHGHPNHHLHHPTVADIP # QDLHEIFTHRLPDEIYFYLSRGLLGPQALVWLTSGQIVENPPLDNGETTEYKRFVKEVITDGQTGPRATALALISSVAHSFWSSRKVHGYFWFESQAL # HNQKPVQHNSAQTAQLAERVSGWNVTYSVVEEELRRQNVSSPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g24 ### # start gene g25 7 AUGUSTUS gene 120881 121474 0.99 - . g25 7 AUGUSTUS transcript 120881 121474 0.99 - . g25.t1 7 AUGUSTUS stop_codon 120881 120883 . - 0 transcript_id "g25.t1"; gene_id "g25"; 7 AUGUSTUS CDS 120881 121474 0.99 - 0 transcript_id "g25.t1"; gene_id "g25"; 7 AUGUSTUS start_codon 121472 121474 . - 0 transcript_id "g25.t1"; gene_id "g25"; # protein sequence = [MEAEIRKLTKRRDGGDDDSDDERKKKKPKTSYLEAELGKYASSRGIKTKGSKGKGRAKDERDVLNVLNAFRGKLQMAL # PAAPEDDSEGKIGADGTENNLLKHEEAKETQPPPANFPVGEDPGIEIDNDRGFLGHSLHFPKDDGEESRKAERDYEVIDPRQRGARAKEEEKARKAKA # KYRDGGRGSRGRGSSGGGYQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g25 ### # start gene g26 7 AUGUSTUS gene 127635 128615 0.86 + . g26 7 AUGUSTUS transcript 127635 128615 0.86 + . g26.t1 7 AUGUSTUS start_codon 127635 127637 . + 0 transcript_id "g26.t1"; gene_id "g26"; 7 AUGUSTUS CDS 127635 128615 0.86 + 0 transcript_id "g26.t1"; gene_id "g26"; 7 AUGUSTUS stop_codon 128613 128615 . + 0 transcript_id "g26.t1"; gene_id "g26"; # protein sequence = [MALFETFSNTSTESLLGTQYLSVSRRGSAPASPMSSTFFDSDLLARSISPVPSNYALYTRSRPTSTDSSFFDFQSFVP # VTSNQPQVSAAANNSTGLMDQLAGALRRVEENNQISPLIDDKASFMSKQTTRSRVIRRSDVVVEAITDGEQGLLDVVPVTEDQAENKKNRRFLPKFLR # RAMSTSGALNAQILDRKTAFSKPGHSPLTPSSRANTVPTSVSKGKGKAHSMFRFRGHQGEKPVQAPPPLVLPDEIVQRRRQVRRSGSFAGFSTSPFAP # SSPIVFRHHGLFSNTCAEPVGADGDEDELDALTFEATALSAQIGQRWMYAED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g26 ### # start gene g27 7 AUGUSTUS gene 132243 133142 0.52 - . g27 7 AUGUSTUS transcript 132243 133142 0.52 - . g27.t1 7 AUGUSTUS stop_codon 132243 132245 . - 0 transcript_id "g27.t1"; gene_id "g27"; 7 AUGUSTUS CDS 132243 133142 0.52 - 0 transcript_id "g27.t1"; gene_id "g27"; 7 AUGUSTUS start_codon 133140 133142 . - 0 transcript_id "g27.t1"; gene_id "g27"; # protein sequence = [MCVCVILSAGTILERRVYVRILGSLLILCFSGRLPLEIKRLERPTFKLGSLGRDGHALPQDLSTLGVCTLRPYIYVMS # HPVYRCGNGLLTHILISEGYEGHGIDLRERMSWKSYPSDTQNHLHVHVFNPLDFSFDKNPVFLPSGVFIIANHADELTPWTPVLSTLCSASGYLSIPC # CAWDFDARYERSATTMFPIPKTNSVLDTDTDLERISMNNFIKTLNLGGDGSNTSGYSMYRIWLATLSVYTGWEVECETLRIPSTRNWAIIGMCICVIV # REEGYEDCVSTQGVNDLGLYLKRKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g27 ### # start gene g28 7 AUGUSTUS gene 134346 136322 0.55 - . g28 7 AUGUSTUS transcript 134346 136322 0.55 - . g28.t1 7 AUGUSTUS stop_codon 134346 134348 . - 0 transcript_id "g28.t1"; gene_id "g28"; 7 AUGUSTUS CDS 134346 136322 0.55 - 0 transcript_id "g28.t1"; gene_id "g28"; 7 AUGUSTUS start_codon 136320 136322 . - 0 transcript_id "g28.t1"; gene_id "g28"; # protein sequence = [MYSTAKPFLALQKYRPQSVTDIQLLQRFPKRNCWISKYIKRRTGHDRSPKQVGSRLQQLRDSCRDERSKWIFPRWDGR # MPEYFSVLQLLSRKQYDDNDDNDSVTSCSTSLDSFGSTPPSESTGSPHNSSPISVPSPGTDTEVYTNDVSALEAKRHTLVRIELTSPLSHFICSPISF # DTISSDREIGPTIVCVDLKLASLVTTLFSWKNPMISLHSARVLDVTEHHCLFKVFLDGMMVHLDRTEIGLQSTLAQTRNGTTRQMYLYETKFLPKYWT # ECFSSVGQYQLTESIVIDSIDVPSLDLACCEVHQCLIKRRLISDNDTDFLSLKEHHEDEVVHTVRYTFVDLRSTPPSTPSDEPVELWKPPLEETSYES # PLNGSVTHASDALGLDAPAVHPKAESSRDGRAHFPVKEESHTPPSEFSPLSQDLSNGMPEPPVQSTQCLYELADHTQPTTYEFDFSITSSSANDMPAL # VYPSAYTATTFTPQCNHPLTISSTEWLQQGQWTAQGYRPQHPETMSSPHNKRYAYFWEQPISYAHISSYLGQADPLSYNSTASETQETQEPYAYAQPD # YMMTPVGSAHSDYANDLYQRQDDRKMREGPCVVYENVSHSPCSDSSSELAYAPETLMTKSTYSHLPPPPYVCAPNNENGYQMCSSTQVWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g28 ### # start gene g29 7 AUGUSTUS gene 137307 137588 0.43 + . g29 7 AUGUSTUS transcript 137307 137588 0.43 + . g29.t1 7 AUGUSTUS start_codon 137307 137309 . + 0 transcript_id "g29.t1"; gene_id "g29"; 7 AUGUSTUS CDS 137307 137588 0.43 + 0 transcript_id "g29.t1"; gene_id "g29"; 7 AUGUSTUS stop_codon 137586 137588 . + 0 transcript_id "g29.t1"; gene_id "g29"; # protein sequence = [MDPLAGMDDSSTDDDNASQTTEDDPQIPEHAPAPPPPPLAVPPPQPQPGSAPAPREKPHYESRHILNGHTMSISAVKF # SPDGTLLASCGLFRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g29 ### # start gene g30 7 AUGUSTUS gene 139234 139530 0.99 - . g30 7 AUGUSTUS transcript 139234 139530 0.99 - . g30.t1 7 AUGUSTUS stop_codon 139234 139236 . - 0 transcript_id "g30.t1"; gene_id "g30"; 7 AUGUSTUS CDS 139234 139530 0.99 - 0 transcript_id "g30.t1"; gene_id "g30"; 7 AUGUSTUS start_codon 139528 139530 . - 0 transcript_id "g30.t1"; gene_id "g30"; # protein sequence = [MRHSASKSSLRSSPSSSSLRPSSPSQGLTVKVPSSKDFQEPASAVGYSPMVQAANAALLARPAFTIDDSKDDDDDAED # ELEAGDNDDQVMDEVGLSSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g30 ### # start gene g31 7 AUGUSTUS gene 142738 142983 0.59 - . g31 7 AUGUSTUS transcript 142738 142983 0.59 - . g31.t1 7 AUGUSTUS stop_codon 142738 142740 . - 0 transcript_id "g31.t1"; gene_id "g31"; 7 AUGUSTUS CDS 142738 142983 0.59 - 0 transcript_id "g31.t1"; gene_id "g31"; 7 AUGUSTUS start_codon 142981 142983 . - 0 transcript_id "g31.t1"; gene_id "g31"; # protein sequence = [MSTISTALRDFKEPTKEQITQNFFSLASLPAAIGKDAREADDEVEKMDINAVLSLGVEGEEDSYVGCTALVVLDIALI # TTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g31 ### # start gene g32 7 AUGUSTUS gene 149073 151009 0.22 + . g32 7 AUGUSTUS transcript 149073 151009 0.22 + . g32.t1 7 AUGUSTUS start_codon 149073 149075 . + 0 transcript_id "g32.t1"; gene_id "g32"; 7 AUGUSTUS CDS 149073 149633 0.47 + 0 transcript_id "g32.t1"; gene_id "g32"; 7 AUGUSTUS CDS 149684 150123 0.41 + 0 transcript_id "g32.t1"; gene_id "g32"; 7 AUGUSTUS CDS 150538 151009 0.99 + 1 transcript_id "g32.t1"; gene_id "g32"; 7 AUGUSTUS stop_codon 151007 151009 . + 0 transcript_id "g32.t1"; gene_id "g32"; # protein sequence = [MRPQEILGMVEEAAGTRMFEERKEAARKKMSKKDKRMQEVTSILNEEITPKLNKLREEKRSFLEFQKSEKELEQLNRV # LTAWEFQTLTQDVENAKGEIEQAKENAKMSKKEAEKQIKEVERAEQDMHKVQKQRDAEMKKGGKLSQLEEEKAASEKEMVKLSTQEELMRGTIRDEEA # KIGTSEEAVKKAEDSLKLKKAEADRLETSYNAIKSEHNASQAKLTSDEELLQTLLTGLSSKSATHPGSGGGYMGQIADARARIAQGAAEEEQARMNLE # MSNNELQSLETQFKRVEKDAGDGKKRIETTRRALADAQKRLAACGWTAETEQEGESRGAHEPQKVKAATQISQGKARPALDLLKYDPRLDNAVSHVFG # GTFICDDTESAQRVTFDKSIGQRSVTLQGDVYDPSGTLSGGSAPSSSGILIKVQELLDIEDNLATVEAHFNEFERTWNGDSTKRKREAYKNISKEVQI # KEHELKLAEEQNEESNAERV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g32 ### # start gene g33 7 AUGUSTUS gene 153278 153661 0.9 + . g33 7 AUGUSTUS transcript 153278 153661 0.9 + . g33.t1 7 AUGUSTUS start_codon 153278 153280 . + 0 transcript_id "g33.t1"; gene_id "g33"; 7 AUGUSTUS CDS 153278 153661 0.9 + 0 transcript_id "g33.t1"; gene_id "g33"; 7 AUGUSTUS stop_codon 153659 153661 . + 0 transcript_id "g33.t1"; gene_id "g33"; # protein sequence = [MSESSVATAPIADTTIAPPTAEETVSEVVAEGASAEPPTTIAAVEDELEAKDEQSAEKEAKETKAPSRRSTRISSKSQ # PETKETPKLKRAPSTKKRAVEDGSEGSKATKKVCSKLKTLLGFFFAVNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g33 ### # start gene g34 7 AUGUSTUS gene 154617 154727 0.28 + . g34 7 AUGUSTUS transcript 154617 154727 0.28 + . g34.t1 7 AUGUSTUS start_codon 154617 154619 . + 0 transcript_id "g34.t1"; gene_id "g34"; 7 AUGUSTUS CDS 154617 154727 0.28 + 0 transcript_id "g34.t1"; gene_id "g34"; 7 AUGUSTUS stop_codon 154725 154727 . + 0 transcript_id "g34.t1"; gene_id "g34"; # protein sequence = [MEESIEKADVESAAPATNGSEDKDVVMEAAAPIVEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g34 ### # start gene g35 7 AUGUSTUS gene 155902 156381 0.45 - . g35 7 AUGUSTUS transcript 155902 156381 0.45 - . g35.t1 7 AUGUSTUS stop_codon 155902 155904 . - 0 transcript_id "g35.t1"; gene_id "g35"; 7 AUGUSTUS CDS 155902 156381 0.45 - 0 transcript_id "g35.t1"; gene_id "g35"; 7 AUGUSTUS start_codon 156379 156381 . - 0 transcript_id "g35.t1"; gene_id "g35"; # protein sequence = [MDQIDSLGSKLSFLIEQGKRALGREIVVMSEVEEDAVDDGSGAWIEEDQEGEGEFGKRGRGRLSRSGSVSRRRAAGSA # SSATVNLGRRTGAGMNVNPPPYGTGLGVPSALPSSSPSTPPASLPTFESSWESPELKETMERARAIVRQRKSMNFRTDIES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g35 ### # start gene g36 7 AUGUSTUS gene 158685 159234 0.31 + . g36 7 AUGUSTUS transcript 158685 159234 0.31 + . g36.t1 7 AUGUSTUS start_codon 158685 158687 . + 0 transcript_id "g36.t1"; gene_id "g36"; 7 AUGUSTUS CDS 158685 158915 0.87 + 0 transcript_id "g36.t1"; gene_id "g36"; 7 AUGUSTUS CDS 158983 159234 0.33 + 0 transcript_id "g36.t1"; gene_id "g36"; 7 AUGUSTUS stop_codon 159232 159234 . + 0 transcript_id "g36.t1"; gene_id "g36"; # protein sequence = [MFSFVVLISLFASSALALYIPPSNLLLDQDSTEYIVASLAASNNHGAPIPPESAGSTPGWYYGDEPGSADGLPWMKDD # LCAVLAQTPNALRCPTATPTPTKSLPKRSAAVAAATASASATASATPSYYTVFSGLTGAISASGYLTYGLVDTVASKLPLCR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g36 ### # start gene g37 7 AUGUSTUS gene 164561 165289 0.59 - . g37 7 AUGUSTUS transcript 164561 165289 0.59 - . g37.t1 7 AUGUSTUS stop_codon 164561 164563 . - 0 transcript_id "g37.t1"; gene_id "g37"; 7 AUGUSTUS CDS 164561 165289 0.59 - 0 transcript_id "g37.t1"; gene_id "g37"; 7 AUGUSTUS start_codon 165287 165289 . - 0 transcript_id "g37.t1"; gene_id "g37"; # protein sequence = [MDTPNHLGSDILKSANPIISVIGAGAMGSQIAHRLFQAGAGPILTNLDGRSPETCKRAIEWGMKDTSYADIVSRTTYI # LSVVPPKDAFAIAEIIADTVKISNAEETTSSQARTKLVFIDCNAVNPSSAKQMAKLFVNTSATFIDGAIVGGPPSEVYNPGLYICANPNDEAVLDEVE # VTLKKYGLQPFSLKGEGTGIGDASAVKMANSVRSTQSTLVSDFLANVFIIGNRQGCYCIVHFHDSW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g37 ### # start gene g38 7 AUGUSTUS gene 166905 167715 0.35 - . g38 7 AUGUSTUS transcript 166905 167715 0.35 - . g38.t1 7 AUGUSTUS stop_codon 166905 166907 . - 0 transcript_id "g38.t1"; gene_id "g38"; 7 AUGUSTUS CDS 166905 167423 0.48 - 0 transcript_id "g38.t1"; gene_id "g38"; 7 AUGUSTUS CDS 167494 167715 0.68 - 0 transcript_id "g38.t1"; gene_id "g38"; 7 AUGUSTUS start_codon 167713 167715 . - 0 transcript_id "g38.t1"; gene_id "g38"; # protein sequence = [MLRKLMFVSFVFTCRTCPDHAILFQAGEEGQLDLPGSDVPQGVLPRIIATLVNRRKQVKSLMKDRTATDAQLAQKALK # LTANSMYGCLGFEYSRFYARPLAALTTHMGREILQHTKELAETMHLDVSSVAVIGRSPHLFTILYIQVLYGDTDSLFVNSNASELSEALRISNEFKKV # VNERYRKLEIDLDAIFQRLLLLQKKKYAAVKVENGAETSIEVKGLDMKRREYCTLSKNVSQCVNSRSYQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g38 ### # start gene g39 7 AUGUSTUS gene 169300 170446 0.44 - . g39 7 AUGUSTUS transcript 169300 170446 0.44 - . g39.t1 7 AUGUSTUS stop_codon 169300 169302 . - 0 transcript_id "g39.t1"; gene_id "g39"; 7 AUGUSTUS CDS 169300 170369 0.98 - 2 transcript_id "g39.t1"; gene_id "g39"; 7 AUGUSTUS CDS 170422 170446 0.44 - 0 transcript_id "g39.t1"; gene_id "g39"; 7 AUGUSTUS start_codon 170444 170446 . - 0 transcript_id "g39.t1"; gene_id "g39"; # protein sequence = [MEETKKKKSKKNSKEKSKTKAKAPAPPPVAPSFNDYRKKVTADQENDFMLNLFGELDALPTNAPSLTKSRKRKTSPDY # DTSGNSSPAPYRKRPSYTDASSDGPDDFYGAPSSDDFLSSPRKRVKTEPEGLLPATERLAQIDVKTDEDDFPGDESFDDIDMDAFMAVEDDVDMKPVA # SVPVETPGMEHLDEKKPASWLAVYDSLTVSSEDPLGPLATNTFSIKSSDVSALEPDGSLRFFWVDYLEHQGELFFIGKLKDKKSGAWVSCCVAVKNLE # RNLFILPREKRAEQGEDDEWYDTDEVPELTDVYKDFDAIRSKRDIKKFKGKFVERQYAFGDPNIPRKKTTWMKVAYHFTGKTIWFLPLQC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g39 ### # start gene g40 7 AUGUSTUS gene 171098 171400 0.42 - . g40 7 AUGUSTUS transcript 171098 171400 0.42 - . g40.t1 7 AUGUSTUS stop_codon 171098 171100 . - 0 transcript_id "g40.t1"; gene_id "g40"; 7 AUGUSTUS CDS 171098 171400 0.42 - 0 transcript_id "g40.t1"; gene_id "g40"; 7 AUGUSTUS start_codon 171398 171400 . - 0 transcript_id "g40.t1"; gene_id "g40"; # protein sequence = [MMCRIGSPYGPEPSPKDMRFSRDKIWVDRSWRCGVWNERRLLLSEDRCLWILPIMFWYIELARTRDFTLPNPGTEGAS # EAVGEDVEGTMATVNPGLGFEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g40 ### # start gene g41 7 AUGUSTUS gene 172493 172924 0.46 - . g41 7 AUGUSTUS transcript 172493 172924 0.46 - . g41.t1 7 AUGUSTUS stop_codon 172493 172495 . - 0 transcript_id "g41.t1"; gene_id "g41"; 7 AUGUSTUS CDS 172493 172924 0.46 - 0 transcript_id "g41.t1"; gene_id "g41"; 7 AUGUSTUS start_codon 172922 172924 . - 0 transcript_id "g41.t1"; gene_id "g41"; # protein sequence = [MHQQGSKPVFTIQQRTPIGQTCFNSNIIHHILRIDPIETCTLENRYNARRNAPGKDLGVKLGQDEVDVKILDLVCETA # KLVFEIKEETSKDVGGFYHGDFTSRYLDQGGIPALERVEVTFAQPGALGRKHETRIRSSMSNTIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g41 ### # start gene g42 7 AUGUSTUS gene 174210 174938 1 + . g42 7 AUGUSTUS transcript 174210 174938 1 + . g42.t1 7 AUGUSTUS start_codon 174210 174212 . + 0 transcript_id "g42.t1"; gene_id "g42"; 7 AUGUSTUS CDS 174210 174938 1 + 0 transcript_id "g42.t1"; gene_id "g42"; 7 AUGUSTUS stop_codon 174936 174938 . + 0 transcript_id "g42.t1"; gene_id "g42"; # protein sequence = [MLARDLQRHIVQRAHFSTTTNNEVKKRLRSLLRESAQPVAVVTSLLHYNDTSPNDYHGATLSSFSSIALDPYPLVAFS # LRIPSRMATSLRSAHPDPPSDMVVNILSATQAPTAVLFSRPDLHPNPFQEVEFTLNREGIPVLEGCLGALSCKLATNPILLDDPGFSGRDFENDSRSG # SGDAESENEISPPSITSELFIARVTNIERLALDEADTNDPQTMPLLYHRRNYLTCSSKYLLDYQKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g42 ### # start gene g43 7 AUGUSTUS gene 178972 179883 0.66 + . g43 7 AUGUSTUS transcript 178972 179883 0.66 + . g43.t1 7 AUGUSTUS start_codon 178972 178974 . + 0 transcript_id "g43.t1"; gene_id "g43"; 7 AUGUSTUS CDS 178972 179883 0.66 + 0 transcript_id "g43.t1"; gene_id "g43"; 7 AUGUSTUS stop_codon 179881 179883 . + 0 transcript_id "g43.t1"; gene_id "g43"; # protein sequence = [MSWRRWWVSLKSLIISTHLNDVQFTTILSLRILNDHYIFVFKTRSIELYPTTHSASPSVPPPFLPSLRHVFPSYSFRD # VQIAEVESETLTEEESSSSGYDGTRYTLKMLASDVIQGLFYFVANITIPSARHEQSQPPILDVHLAAVYAMANHIPLYSRAHQRQRNTLQTSRSSHAA # VHDRAVQKRLSTPRSDSVNSVRSSSFVSTYALGPQGMRAVWIERRRGSTWKQIVSCRLNPSSSNGQEMISDLDLEMWNSDSSEEEGSISQDDNLDFIT # QALDGHIIYSVQSYDLRGKFPFMAEICGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g43 ### # start gene g44 7 AUGUSTUS gene 181014 182698 0.82 + . g44 7 AUGUSTUS transcript 181014 182698 0.82 + . g44.t1 7 AUGUSTUS start_codon 181014 181016 . + 0 transcript_id "g44.t1"; gene_id "g44"; 7 AUGUSTUS CDS 181014 181331 0.82 + 0 transcript_id "g44.t1"; gene_id "g44"; 7 AUGUSTUS CDS 181394 182698 1 + 0 transcript_id "g44.t1"; gene_id "g44"; 7 AUGUSTUS stop_codon 182696 182698 . + 0 transcript_id "g44.t1"; gene_id "g44"; # protein sequence = [MFGYGAWKDGKHIVGGRNMRMEKEIYGEADDPSKQHTGINFEKYDDIPVEATGADVPEPVTSFTSPPLDPVLLENITY # ARYTTPTPVQKYSIPIVANGRDLMACAQTGSGKTGGFLFPILSASFTMGPRAVIGEPTGYGGRRRATPTALILAPTRELVSQIHDEARKFAYRSWVRP # AVVYGGADISQQIRLIERGCDLLTATPGRLVDLIERGKISLANVKYLVLDEADRMLDMGFEPQIRRIVQGEDMPGVHDRQTLMFSATFPRDIQILAKD # FLKDYVFLSVGRVGSTSENITQKFEYVEDNDKRSVLLDILNSHSNESAGLTLIFVETKRMADMLSDFLIHNQWHATSIHGDRTQREREMALQTFRNGQ # TPIMVATAVAARGLDIPNVTHVVNYDLPSDIDDYVHRIGRTGRAGNTGVSTAFYNKGNKNIVKEMVELLREANQEIPGWLEVSAHEASFGGSFRGRGR # GRGRSGGRDYRAGGGSSYGGGGGGYGNHTSHSTSGGGYGGRAGGPPSYGSGGGYGGGYGGSSGGGGGGWW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g44 ### # start gene g45 7 AUGUSTUS gene 184260 186496 0.69 + . g45 7 AUGUSTUS transcript 184260 186496 0.69 + . g45.t1 7 AUGUSTUS start_codon 184260 184262 . + 0 transcript_id "g45.t1"; gene_id "g45"; 7 AUGUSTUS CDS 184260 185388 0.69 + 0 transcript_id "g45.t1"; gene_id "g45"; 7 AUGUSTUS CDS 185550 186496 0.95 + 2 transcript_id "g45.t1"; gene_id "g45"; 7 AUGUSTUS stop_codon 186494 186496 . + 0 transcript_id "g45.t1"; gene_id "g45"; # protein sequence = [MCRNVSSPIFDVPEFPTLRRVKPLPKRRRTSSTHFSVLDSSTTNNIDSGSRNTPRMLVAEANGVPHSLHMPGLPPIPL # SLPGPDATAEELLAHADALQSYYFPILDAAAANINAVADGFANAVEPGYIHPGSDILSDLEPGNLASSPGVGLAGLGIHNLSLRDRDEHSDRGDGDYI # DQPGNAKKRKVPANTSHLQGARDATSGEEDAEDPDGPLMIGIPTGTLEAGANDSNTGQGDGGGEGAGEGGKSSMSTFRRLLGRRKTRLSAVTLAGLQH # KETLKVRKRQLAAVLGALSLGDTLALDQALSSNSAYPFSSSSSAPDDALVPLPVGGKPSLKIRLSKRAGPRMARSVSSRLKDDEETHVQVPGSDFTFV # CYSATADRLSATKKEVATLRRRFEDELARQASNAASLAAATRAVASPLSSRSSRQKRSGKARTDKKLRNQPPEFLDPALDGQTYGAGGMQNNPDNIPS # FNAKSSRNGKKKKRSALANASNPHHLRNYVPSRLPYTAGGCPSNANGMNQANGNDLGPFPIRFLSAEIPPRRSNRSKRSQAQEQQQLSTSLTNPADEW # LCVFCEYELFFGDEGEYRKALRRRKTVLKRRRRARERAAAAASGQSKLSTAKKSQQPAPVAATHDSEEEGDDEDNYEDDAGYEPMGTGGQTVGNGVNG # MLPKQTKWRGDNREKGAGEAKSSYG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g45 ### # start gene g46 7 AUGUSTUS gene 187446 189784 0.55 + . g46 7 AUGUSTUS transcript 187446 189784 0.55 + . g46.t1 7 AUGUSTUS start_codon 187446 187448 . + 0 transcript_id "g46.t1"; gene_id "g46"; 7 AUGUSTUS CDS 187446 188159 0.68 + 0 transcript_id "g46.t1"; gene_id "g46"; 7 AUGUSTUS CDS 188245 188608 0.75 + 0 transcript_id "g46.t1"; gene_id "g46"; 7 AUGUSTUS CDS 188708 188733 0.82 + 2 transcript_id "g46.t1"; gene_id "g46"; 7 AUGUSTUS CDS 189260 189784 0.99 + 0 transcript_id "g46.t1"; gene_id "g46"; 7 AUGUSTUS stop_codon 189782 189784 . + 0 transcript_id "g46.t1"; gene_id "g46"; # protein sequence = [MAADSRYLYHPTHQGLAPQYNYQYQNPPPPTNYEPSPVQHPPPLRNPRTSQPPPHSPHAQYHPQPPLPPPSQSAAYTS # AHPSYGSQGHYITHGQPAPPQSAPAQHTPPPPPQPQQQWSNESWTNQYSHYPSHVPQHHHQQQQQLSPPLTSTVAPENTYNSAPGRLEDSPALSSNDG # SIRGYDDRTASMHSHHQPSPPQSSFNGPPTIKYRPREEESPSSYTNSQPASPNLFTGLDYDQLMKQIKFVESPLRETLSTFRSPHRNTLEQMMQAATY # AAQVLNSAAGIITPTATTTISPPPSVTYHQSHTMPPSQGYGINRLSSPTSRDRIENNTQSPHTHTFANENSPPLSASTPGSLKRVPYGAAMEGISPPL # GGSNLGLSTVPQALNQQHPVPSSSLAQPPSGQQQHSFSPSQPLSQPPSQPQPGVVGGMTSSNPPPAQQDGQTCLGCGATSTPEWRRGPMGKFKAFPVP # LASPLGFWIVIRSLSFYVLRYSLLESLTFYVTVNSPFEITSAVTNRASCLLFEQPFVSVTHRLYCHRSTNTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g46 ### # start gene g47 7 AUGUSTUS gene 197885 199396 1 - . g47 7 AUGUSTUS transcript 197885 199396 1 - . g47.t1 7 AUGUSTUS stop_codon 197885 197887 . - 0 transcript_id "g47.t1"; gene_id "g47"; 7 AUGUSTUS CDS 197885 199396 1 - 0 transcript_id "g47.t1"; gene_id "g47"; 7 AUGUSTUS start_codon 199394 199396 . - 0 transcript_id "g47.t1"; gene_id "g47"; # protein sequence = [MQYVTGNRGNGAQTPVILNTQPHHSPSPQPHVTAYPNPQASASVDSQLKRTPTPAQRFSPSPHVSHMQPHPVAPQNHH # PHVNLPQHGTPRVQPQPLPSAARASPRPPSTHPQQPLPPPSHPQPAHSVQVPQQPLQPHLPQQPIQQSFQPSAPGANFLQQPPPSRNGQTKVPNSAQA # QTQAYNSAYPPHANHTNQIQHSAAQMMMQQQRIGLAAAHQAQSQTQAHSPQGQQQVAGLSAPIQPMQQGAIPRASPMIPNAIATRSPIPSSLTTPNGI # HSSNPNQNQNQNNGGSASPHTSHLSPPAAAGATNSPRSRSRATGPPAVGVNSPRIANQAQPRPVQPIQTPKMQHSQLHPNLQAQQQLHANFQAQQQQR # RTTPSQATSNVVQAAQQQQQSQQHGAAQYPMYAYGVPAQAAGYPAGQLPQQYFAAMSAMRIPHQQSMHVPGVQAIPAMKGLQSVQMTQQQMRAMQQHF # VQQQQQYAMAQAQQAQQQAQQAQQQAQHKAPGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g47 ### # start gene g48 7 AUGUSTUS gene 204645 207361 0.15 + . g48 7 AUGUSTUS transcript 204645 207361 0.15 + . g48.t1 7 AUGUSTUS start_codon 204645 204647 . + 0 transcript_id "g48.t1"; gene_id "g48"; 7 AUGUSTUS CDS 204645 205203 0.23 + 0 transcript_id "g48.t1"; gene_id "g48"; 7 AUGUSTUS CDS 205416 205716 0.56 + 2 transcript_id "g48.t1"; gene_id "g48"; 7 AUGUSTUS CDS 206554 207361 0.72 + 1 transcript_id "g48.t1"; gene_id "g48"; 7 AUGUSTUS stop_codon 207359 207361 . + 0 transcript_id "g48.t1"; gene_id "g48"; # protein sequence = [MQMPMMLQELMLVPVLLLQVSSEAHRVLSSSKLIGTTVAGTIGTNTTTAGTTSTGATGATTNSTTAGTTTSDTGVGAT # TNSTAAGTTAANSTAGCTTAAGTDTNSTAVGTTTTGTAANVTDAGTTTGATAGTTGNSTTADSTGATANSTTAACTTANSTTADATGATTNSTTAATG # NVAKAKHHHKAAGAAGAAAAGTTGTTNSTTTTGTASTTGTTTNTTTGTTGADSTSAGTSASGTTVNATTAGTTDTSANSTAAGTGTTGADTTAVGSTT # ADSTTALKIRALKRLSQFLTAHNCVWSTVDSGRGISTRAIAKNFATTFFTFYALSILFIIGMSLTVQSWPGIALILWAYLIRITIGAPIPVTSEVSYS # RYNLSLKTDFFYLSINQGLGKIGSLSSIAPMAFAFAVEASGDFMDFVLESESGLGLESLENSREDILDAFDVQMNINDAERILALGEPEPFYLDFDLD # CDSDTDAFEDEDYVVIDFDDYIDVDGDEVYDGDEDYVDIREDESYVATDSGDNDLLGLGDEDNIVADLDWDKVRTETLKFNQVNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g48 ### # start gene g49 7 AUGUSTUS gene 208355 212048 0.3 - . g49 7 AUGUSTUS transcript 208355 212048 0.3 - . g49.t1 7 AUGUSTUS stop_codon 208355 208357 . - 0 transcript_id "g49.t1"; gene_id "g49"; 7 AUGUSTUS CDS 208355 209727 0.5 - 2 transcript_id "g49.t1"; gene_id "g49"; 7 AUGUSTUS CDS 209795 212048 0.31 - 0 transcript_id "g49.t1"; gene_id "g49"; 7 AUGUSTUS start_codon 212046 212048 . - 0 transcript_id "g49.t1"; gene_id "g49"; # protein sequence = [MQSQPTKSVKLIASLRVHKYLPAVWHSEDEDEDVDVEWDDESYEGEDAALAAEEEQEELRLAEERKKLGTIGIPMTME # PDDGMRWDDSAVEGMRARQMAPRSVAEPPSNIRPIPSDALQHQQQLPQQQQVQQRQQALAQQQPQVLVASPEPQILRTSGSRERLAQPQDSPTSSNSA # HRRDPLEQQDTVRMTMTPSIVRDPEGTSTPVPLQKQEEERKRLREEESEDSLRKRAKGKEPQKMAPPVSSASYAKSVSAGGSGSKLRKERDTEGDDGK # KKKSSVFGGIFGRKKDKDKKDKNGSVSSFDVSDSGRPSQTSDESSGRVSGTDTLASSPTTQTAMQQQQQQQVAALRNSMDPRRLNNQPPQTPPGKSTI # PPEVSQQLRQRDQQQQLLYQQYLNRSPSSPPELQPSYGLQSVSALNSYSSSSSGLGPPTQRTRPGSLILNQGITDGHIPELSVIRVFAGKNLQTEATF # KTVLLASSTTSSELVKQALQRFRLPAAEDSNDYYLTVKQVEGSSAILHDTEKPLVVFESLVEAAMEVPKVKRSSMGSISSISSNLSMHPAIKKLPMND # FSDDSVVKFYLNRRGDPDGDSDVGHNGAEEDTTLIAADTSTISELEVGASPRHLTVSTQGNVSVERFSSPSFRFAMQVIIYPEDLPDDMVFDPLTEAI # VFKHTLRDRQQSSQSQSSGILMNLRRKVFVFPKNVTVAEVIEIGLERFGILEGVVDGGDEVEDKLAKRRSSSRVRYGLSVDMGGQEKELAPSSKVIDA # YSRPPTYKAVDRRFQDSKRRSVDSAQLLGTLEDVSSDDPVFVLRRATSYRNSTSRHRMSAPLDELALRNLHRESQSSNASSDQLSPRTSEMQLQQQSQ # FQPSRKEIIAAQREASRANQRAMLSTQTNSVRGVDILLPGNVRLRSSRYDTDDRLRYSYVLPDGVAYDISDIVEEEWKDGTGHKRDLLEGVVGRGGVN # EKLDRVLNKIKVGKGQGNLLLQKRVQSPSLRSDSVSSRYSYDDSVTVDAHAQVRSRSATPVSAARPGTTTPTNIPSNRRNPSVASVLSDGSGYITANS # HGITSPIERERSTPTPTSALISAPPLTPLTSPSTSAPVPTLPHQQRKTPTPTTKRPPPIHTKEDFGVSHMLSVIEFRAMKPKTLNKPGGRNDSDVDSV # NDMLFGRPIDLDSLHPKIRELYADSFKRMAEMDEVNYCPFYMFCSVPCLTCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g49 ### # start gene g50 7 AUGUSTUS gene 212180 212593 0.54 - . g50 7 AUGUSTUS transcript 212180 212593 0.54 - . g50.t1 7 AUGUSTUS stop_codon 212180 212182 . - 0 transcript_id "g50.t1"; gene_id "g50"; 7 AUGUSTUS CDS 212180 212593 0.54 - 0 transcript_id "g50.t1"; gene_id "g50"; 7 AUGUSTUS start_codon 212591 212593 . - 0 transcript_id "g50.t1"; gene_id "g50"; # protein sequence = [MELDAHADAANFVGTDDEEHSVLEDDSEGEEREDYIDEVDDGSSSLSIPNESIDFDLVYSLHSFAATVEGQANVVKGD # SLFLMDDSNSYWWLVRVLKTQEVGYIPAENIETPFERLARLNKHRNVDVSAHILTLINN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g50 ### # start gene g51 7 AUGUSTUS gene 213462 213824 0.59 - . g51 7 AUGUSTUS transcript 213462 213824 0.59 - . g51.t1 7 AUGUSTUS stop_codon 213462 213464 . - 0 transcript_id "g51.t1"; gene_id "g51"; 7 AUGUSTUS CDS 213462 213824 0.59 - 0 transcript_id "g51.t1"; gene_id "g51"; 7 AUGUSTUS start_codon 213822 213824 . - 0 transcript_id "g51.t1"; gene_id "g51"; # protein sequence = [MHKHKEALGRYTMAASIAVQRPPWESNQLMREELSTVLSNRSASYFESEDYISALADAETVIAIRRNWSKGHFRKARS # LVGLGKLDEAVEALQVGLAFEPNNAVRRRVLFTFPLELNVIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g51 ### # start gene g52 7 AUGUSTUS gene 216576 217106 0.54 + . g52 7 AUGUSTUS transcript 216576 217106 0.54 + . g52.t1 7 AUGUSTUS start_codon 216576 216578 . + 0 transcript_id "g52.t1"; gene_id "g52"; 7 AUGUSTUS CDS 216576 217106 0.54 + 0 transcript_id "g52.t1"; gene_id "g52"; 7 AUGUSTUS stop_codon 217104 217106 . + 0 transcript_id "g52.t1"; gene_id "g52"; # protein sequence = [MAAIRLRQGNSRKFQVWLRFRVAFQALTIFAILGGLYKYGQANLEENQRIMEQINQQRGEKHLAMERAELEQRIADAT # KAHEEQQLLKKEIEKNTKVTPAPGGILSMVSWGKRPAVSEPPEQAETAQLPSLLPPLSPISSGSKSSPSSNAGGSWWNVFGWGSSNTKSDSDSPKKDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g52 ### # start gene g53 7 AUGUSTUS gene 225336 225641 0.84 + . g53 7 AUGUSTUS transcript 225336 225641 0.84 + . g53.t1 7 AUGUSTUS start_codon 225336 225338 . + 0 transcript_id "g53.t1"; gene_id "g53"; 7 AUGUSTUS CDS 225336 225641 0.84 + 0 transcript_id "g53.t1"; gene_id "g53"; 7 AUGUSTUS stop_codon 225639 225641 . + 0 transcript_id "g53.t1"; gene_id "g53"; # protein sequence = [MSTRAPAHGVHTKDMIREAEQITEPIAITVRDQGLDGVKIISWYISELDGDGQKVEGTQMDTESFASQFIDAEEALRT # LTFKGDQDIAAKALEIVRHTGTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g53 ### # start gene g54 7 AUGUSTUS gene 226567 227961 0.52 + . g54 7 AUGUSTUS transcript 226567 227961 0.52 + . g54.t1 7 AUGUSTUS start_codon 226567 226569 . + 0 transcript_id "g54.t1"; gene_id "g54"; 7 AUGUSTUS CDS 226567 226668 0.62 + 0 transcript_id "g54.t1"; gene_id "g54"; 7 AUGUSTUS CDS 226790 227168 0.81 + 0 transcript_id "g54.t1"; gene_id "g54"; 7 AUGUSTUS CDS 227231 227961 0.97 + 2 transcript_id "g54.t1"; gene_id "g54"; 7 AUGUSTUS stop_codon 227959 227961 . + 0 transcript_id "g54.t1"; gene_id "g54"; # protein sequence = [MSRSGEWSNPCGLSDSLSKLQSSASGNRIAGMELQKPPPTNKAFNEQESKRSTSNSESSQIIDSDQSSPTTSTTTSRP # APSLSKPSSLANSDSEDRRPRSLDELKEKLLKWVNDRAFHFRRRADNFTGATKVRLSGLGAELNKVTGYEEIDALKRQVVEQEARIETTRQAARTAKV # NHDEAVVRRSKSQREVNDLLQRKSSWTDEDVIRFTSLVREDHLLEQEEARAKLAVEEAENAVENEFTELMRSILARYHEEQVWSDKIRSASTYGQLAV # LGLNMFVFILAIVLVEPWKRKRLAQTFEKKVEELNEEYKEMLGNNLQILQKQLEDQAVIIAALTAAVAKVDFQTQHPVEEVVQDQDEPVLNSTGIWTK # AMKDRNFGEAVAMGALTASVLSAIGWIWLGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g54 ### # start gene g55 7 AUGUSTUS gene 229183 229740 0.6 - . g55 7 AUGUSTUS transcript 229183 229740 0.6 - . g55.t1 7 AUGUSTUS stop_codon 229183 229185 . - 0 transcript_id "g55.t1"; gene_id "g55"; 7 AUGUSTUS CDS 229183 229613 0.83 - 2 transcript_id "g55.t1"; gene_id "g55"; 7 AUGUSTUS CDS 229662 229740 0.68 - 0 transcript_id "g55.t1"; gene_id "g55"; 7 AUGUSTUS start_codon 229738 229740 . - 0 transcript_id "g55.t1"; gene_id "g55"; # protein sequence = [MQTPTNVEVGGATLYVHEVATKCAPQIAAPPWFAPIAAQLIHLTTNVDNLNNTVNNLSDNYNNLNHIVNNNYNNLNNA # VDNLKNTVNNLSDNYNNLHNTVNENYHNLSNAVNNLSNTVTNLEATVDARFTGLERSMAILQNFTKGYGLLTPYNNILNDAGAPLPLVCDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g55 ### # start gene g56 7 AUGUSTUS gene 233425 233949 0.83 - . g56 7 AUGUSTUS transcript 233425 233949 0.83 - . g56.t1 7 AUGUSTUS stop_codon 233425 233427 . - 0 transcript_id "g56.t1"; gene_id "g56"; 7 AUGUSTUS CDS 233425 233949 0.83 - 0 transcript_id "g56.t1"; gene_id "g56"; 7 AUGUSTUS start_codon 233947 233949 . - 0 transcript_id "g56.t1"; gene_id "g56"; # protein sequence = [MKIEGRTFIVSGGCVLFTVFRKTDAHPLCSSSGLGFATVQMLVQAKSYISILDREPPPSDIIGAQVKFYPTDITVVND # IEKAVDETVNWTKQTGAALGGVINCAGVAAGAKIIDAQNEPHSLDLWDFVLAVNLTGTFNLTRLALKHMVHNEPEEGPDAERGVIVLVSSSAAVCE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g56 ### # start gene g57 7 AUGUSTUS gene 248810 249175 0.91 - . g57 7 AUGUSTUS transcript 248810 249175 0.91 - . g57.t1 7 AUGUSTUS stop_codon 248810 248812 . - 0 transcript_id "g57.t1"; gene_id "g57"; 7 AUGUSTUS CDS 248810 249175 0.91 - 0 transcript_id "g57.t1"; gene_id "g57"; 7 AUGUSTUS start_codon 249173 249175 . - 0 transcript_id "g57.t1"; gene_id "g57"; # protein sequence = [MRNSCDIFIFINVPKALAAGITFFLSDNGVVLTEGNDKGFLEPAFFLSVQNAKREALAGWEGESAVTSLSTLTENTLG # ALDPSNSDPVLAVPLAVPATSTLVPSEVIDGIEHKLGAVEIRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g57 ### # start gene g58 7 AUGUSTUS gene 252496 255511 0.3 + . g58 7 AUGUSTUS transcript 252496 255511 0.3 + . g58.t1 7 AUGUSTUS start_codon 252496 252498 . + 0 transcript_id "g58.t1"; gene_id "g58"; 7 AUGUSTUS CDS 252496 252785 0.3 + 0 transcript_id "g58.t1"; gene_id "g58"; 7 AUGUSTUS CDS 252841 255511 1 + 1 transcript_id "g58.t1"; gene_id "g58"; 7 AUGUSTUS stop_codon 255509 255511 . + 0 transcript_id "g58.t1"; gene_id "g58"; # protein sequence = [MFPYDFDSNVPQNNSSSSSSSSSSLTAAMDMPISHAGQSNSGFSHSVRLHIPQFMQTGVPMLAPGGGAEVLPVGLFSD # NPAANSAWFVNNGITSNLSYSDSAAKSYVYPIDQQQQQQHQAPSSSSSPSPSSHSSPSPFDFDFNSQSPSIHESEPNAQSPTALSVHINSGLINPQNR # LTPHQLNAIGAGAAMGSSSLNAPSPLGLPVYSRSGFDLLSVLARVAARPDPKIALGPVDFSSSFVVIDVRRYDNPIIYCSRSFCRLTGYEEHEVIGKN # CRFLQSPNGVQPKGEYRRFTSNEAVSYLKKHLVADKECQTSIINYRKSGDAFINLVTVIPIKGGDISSPHEDDKVIYHVGFQVDLTEQPNAILEKLKD # GSYIANFAANNPLTINPPSISFQGGGSLGSGAMHSLMSRDRRMQSISAPMMTSEFKAMIEDPLFMSNHPISMGANADSLPSSSVISSNIGSINGDNSD # LVNVGSPGNHPLSLLLLEYAPDFIHVVSLKGTFLYVGPSVRRVLGYEPEELVGKALSDICHPADVQPLTRELKESSATGSTAPGSGTSPPGEDALTSR # QSHPVKPRAVNLLFRARTKSDQYVWVECRGRLHVEPGKGRKAIMLSGRAKEMSMLLWSAIASAGGISHPQTVAKSLSGEDGKTRLVTVDVSTEFWGTI # TRTGSLLIVSKGVKDILGWDETELMGKQVWSYLLDEEARRNVGKELANIGCAMGTMDAPGSLPRKIFCRMTRQDGSAAEVELILYPSAIDSSILHSSQ # AISPAPIIYQIRLYDRATSSTGIRSSEAAIMHPLRENVFKILEISRESSWQYELQQMRYMNERLREEIMSLEGDEIEHSHAHSTSSTLSQPSAPASHG # LVHVNPSVGTMSSSMNTMLPSTGYDRHAHQGIGSASFNAPHIMYPTSGQYTAHTQYPQHVQHAQHTQPQAWPPPTSNVSSTTAISMPMPFMSPPLNNT # GYDVSNTVSSSLKRHWNTTDRNGNGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g58 ### # start gene g59 7 AUGUSTUS gene 256023 257081 0.56 - . g59 7 AUGUSTUS transcript 256023 257081 0.56 - . g59.t1 7 AUGUSTUS stop_codon 256023 256025 . - 0 transcript_id "g59.t1"; gene_id "g59"; 7 AUGUSTUS CDS 256023 256913 0.88 - 0 transcript_id "g59.t1"; gene_id "g59"; 7 AUGUSTUS CDS 257061 257081 0.56 - 0 transcript_id "g59.t1"; gene_id "g59"; 7 AUGUSTUS start_codon 257079 257081 . - 0 transcript_id "g59.t1"; gene_id "g59"; # protein sequence = [MALDLFTTLQSPVSPISEGANIFTSLSTPPPATGPPASGEASTSPIATESPHTLPVNASASVFPAIFSFAGATFRTGD # TPVRHTTPTSEEGKGKGVVEQHGEESGAATVGSSEPMNEPEHAAPARNPIASSGAINFTSISGDQNTSWVNDQSRRWNYGNIYNADEGPRLGNNRRTN # GGGPSTRRDQREEHGNQRGSDRVEDDEYDDEVRFGRQLNRFVASQPRGNLADETHEWDKGYDSHDVPVVSMNNRPQIGFIPPQTYYDENGVPTAIPRG # RGKSGRRWRNERDHWDSYGGGRGGDYRYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g59 ### # start gene g60 7 AUGUSTUS gene 259888 261333 0.16 + . g60 7 AUGUSTUS transcript 259888 261333 0.16 + . g60.t1 7 AUGUSTUS start_codon 259888 259890 . + 0 transcript_id "g60.t1"; gene_id "g60"; 7 AUGUSTUS CDS 259888 260341 0.52 + 0 transcript_id "g60.t1"; gene_id "g60"; 7 AUGUSTUS CDS 260436 260601 0.22 + 2 transcript_id "g60.t1"; gene_id "g60"; 7 AUGUSTUS CDS 260728 261004 0.3 + 1 transcript_id "g60.t1"; gene_id "g60"; 7 AUGUSTUS CDS 261070 261333 0.87 + 0 transcript_id "g60.t1"; gene_id "g60"; 7 AUGUSTUS stop_codon 261331 261333 . + 0 transcript_id "g60.t1"; gene_id "g60"; # protein sequence = [MFAISHSSSTVQQITTSSSVRDSSFNPSQTSGKAGDLKHVLIPPTPTSNTHLAQTSKHPDITQTPLTPYLRSTVTVSL # PNSGVCCDQCSSRVPSLQLKLLINDTRLQEQGLRCSQVITVPYIDEPKHGSKEYNVKFSDIYESLQQTHTALDDYGQILMKGDFHTTVPSTDVLVVPP # SKILKLNVTLVCVLRDAFICSTNVTLVSNLSATRIPMMVASDVLTSQHMSQLLNDPNSKPLEIAESRKRKGPKSAMVKELAIQASQLPGYETFKAGHH # RVLQYEQVAAHWEFAATFSATHFRQRNVKSKKSIADALGIRTTSLAAAEQGHELIQLYGPRGSHESSVVVLELASGKTGAVALMDFLREWEAAHPVTG # TKAEMRRLKRHSVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g60 ### # start gene g61 7 AUGUSTUS gene 263797 264339 1 - . g61 7 AUGUSTUS transcript 263797 264339 1 - . g61.t1 7 AUGUSTUS stop_codon 263797 263799 . - 0 transcript_id "g61.t1"; gene_id "g61"; 7 AUGUSTUS CDS 263797 264339 1 - 0 transcript_id "g61.t1"; gene_id "g61"; 7 AUGUSTUS start_codon 264337 264339 . - 0 transcript_id "g61.t1"; gene_id "g61"; # protein sequence = [MSSQTFAPPISESTQAVQIPNIDSFSLDPRCTFPAQMEMDTASPPQELPVSPSKRRRTCSTSPSPNNEDISISALSPD # DLADLQTELDEEDLDYETHAIRRALQETMQASNSKKDNYSRHVLHYVTFIETECERRSREHPTRKSNLTAEPVTIAKVALFLNFETTRPKVSINIANY # ASNH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g61 ### # start gene g62 7 AUGUSTUS gene 265935 267380 0.2 + . g62 7 AUGUSTUS transcript 265935 267380 0.2 + . g62.t1 7 AUGUSTUS start_codon 265935 265937 . + 0 transcript_id "g62.t1"; gene_id "g62"; 7 AUGUSTUS CDS 265935 266388 0.59 + 0 transcript_id "g62.t1"; gene_id "g62"; 7 AUGUSTUS CDS 266483 266648 0.26 + 2 transcript_id "g62.t1"; gene_id "g62"; 7 AUGUSTUS CDS 266775 267051 0.4 + 1 transcript_id "g62.t1"; gene_id "g62"; 7 AUGUSTUS CDS 267117 267380 0.81 + 0 transcript_id "g62.t1"; gene_id "g62"; 7 AUGUSTUS stop_codon 267378 267380 . + 0 transcript_id "g62.t1"; gene_id "g62"; # protein sequence = [MFAISHSSSTVQQITTSSSVRDSSFNPSQTSGKAGDLKHVLIPPTPTSNTHLAQTSKHPDITQTPLTPYLRSTVTVSL # PNSGVCCDQCSSRVPSLQLKLLINDTRLQEQGLRCSQVITVPYIDEPKHGSKEYNVKFSDIYESLQQTHTALDDYGQILMKGDFHTTVPSTDVLVVPP # SKILKLNVTLVCVLRDAFICSTNVTLVSNLSATRIPMMVASDVLTSQHMSQLLNDPNSKPLEIAESRKRKGPKSAMVKELAIQASQLPGYETFKAGHH # RVLQYEQVAAHWEFAATFSATHFRQRNVKSKKSIADALGIRTTSLAAAEQGHELIQLYGPRGSHESSVVVLELASGKTGAVALMDFLREWEAAHPVTG # TKAEMRRLKRHSVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g62 ### # start gene g63 7 AUGUSTUS gene 269845 270387 0.99 - . g63 7 AUGUSTUS transcript 269845 270387 0.99 - . g63.t1 7 AUGUSTUS stop_codon 269845 269847 . - 0 transcript_id "g63.t1"; gene_id "g63"; 7 AUGUSTUS CDS 269845 270387 0.99 - 0 transcript_id "g63.t1"; gene_id "g63"; 7 AUGUSTUS start_codon 270385 270387 . - 0 transcript_id "g63.t1"; gene_id "g63"; # protein sequence = [MSSQTFAPPISESTQAVQIPNIDSFSLDPRCTFPAQMEMDTASPPQELPVSPSKRRRTCSTSPSPNNEDISISALSPD # DLADLQTELDEEDLDYETHAIRRALQETMQASNSKKDNYSRHVLHYVTFIETECERRSREHPTRKSNLTAEPVTIAKVALFLNFETTRPKVSINIANY # ASNH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g63 ### # start gene g64 7 AUGUSTUS gene 271983 273428 0.27 + . g64 7 AUGUSTUS transcript 271983 273428 0.27 + . g64.t1 7 AUGUSTUS start_codon 271983 271985 . + 0 transcript_id "g64.t1"; gene_id "g64"; 7 AUGUSTUS CDS 271983 272436 0.52 + 0 transcript_id "g64.t1"; gene_id "g64"; 7 AUGUSTUS CDS 272531 272696 0.32 + 2 transcript_id "g64.t1"; gene_id "g64"; 7 AUGUSTUS CDS 272823 273099 0.4 + 1 transcript_id "g64.t1"; gene_id "g64"; 7 AUGUSTUS CDS 273165 273428 0.88 + 0 transcript_id "g64.t1"; gene_id "g64"; 7 AUGUSTUS stop_codon 273426 273428 . + 0 transcript_id "g64.t1"; gene_id "g64"; # protein sequence = [MFAISHSSSTVQQITTSSSVRDSSFNPSQTSGKAGDLKHVLIPPTPTSNTHLAQTSKHPDITQTPLTPYLRSTVTVSL # PNSGVCCDQCSSRVPSLQLKLLINDTRLQEQGLRCSQVITVPYIDEPKHGSKEYNVKFSDIYESLQQTHTALDDYGQILMKGDFHTTVPSTDVLVVPP # SKILKLNVTLVCVLRDAFICSTNVTLVSNLSATRIPMMVASDVLTSQHMSQLLNDPNSKPLEIAESRKRKGPKSAMVKELAIQASQLPGYETFKAGHH # RVLQYEQVAAHWEFAATFSATHFRQRNVKSKKSIADALGIRTTSLAAAEQGHELIQLYGPRGSHESSVVVLELASGKTGAVALMDFLREWEAAHPVTG # TKAEMRRLKRHSVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g64 ### # start gene g65 7 AUGUSTUS gene 275893 276435 1 - . g65 7 AUGUSTUS transcript 275893 276435 1 - . g65.t1 7 AUGUSTUS stop_codon 275893 275895 . - 0 transcript_id "g65.t1"; gene_id "g65"; 7 AUGUSTUS CDS 275893 276435 1 - 0 transcript_id "g65.t1"; gene_id "g65"; 7 AUGUSTUS start_codon 276433 276435 . - 0 transcript_id "g65.t1"; gene_id "g65"; # protein sequence = [MSSQTFAPPISESTQAVQIPNIDSFSLDPRCTFPAQMEMDTASPPQELPVSPSKRRRTCSTSPSPNNEDISISALSPD # DLADLQTELDEEDLDYETHAIRRALQETMQASNSKKDNYSRHVLHYVTFIETECERRSREHPTRKSNLTAEPVTIAKVALFLNFETTRPKVSINIANY # ASNH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g65 ### # start gene g66 7 AUGUSTUS gene 278078 278584 0.42 - . g66 7 AUGUSTUS transcript 278078 278584 0.42 - . g66.t1 7 AUGUSTUS stop_codon 278078 278080 . - 0 transcript_id "g66.t1"; gene_id "g66"; 7 AUGUSTUS CDS 278078 278584 0.42 - 0 transcript_id "g66.t1"; gene_id "g66"; 7 AUGUSTUS start_codon 278582 278584 . - 0 transcript_id "g66.t1"; gene_id "g66"; # protein sequence = [MSRLLFKARIKVDVWIRFQQMTHNMEEKVPILAHREYLHVQQIQVRIRRVKVFRNSDIHNDLQPLGRQTVVVSDVLKD # SSGINELPTRPLDKLLNNPIAWPVGFYMSHGTAVFLSDSPKFISEIISDILPGLKGVAKVVTVQNEAKAWMAESVAYARLGPTAYEEMEW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g66 ### # start gene g67 7 AUGUSTUS gene 282573 284288 0.33 - . g67 7 AUGUSTUS transcript 282573 284288 0.33 - . g67.t1 7 AUGUSTUS stop_codon 282573 282575 . - 0 transcript_id "g67.t1"; gene_id "g67"; 7 AUGUSTUS CDS 282573 284288 0.33 - 0 transcript_id "g67.t1"; gene_id "g67"; 7 AUGUSTUS start_codon 284286 284288 . - 0 transcript_id "g67.t1"; gene_id "g67"; # protein sequence = [MDIVLEPLKVTARIGCMMSDPVGQLRVCYTPLASAIVDTPEASLIACTGGKDSPFTKAIYKNYGDFLRHPPRLSSTTL # DAIDSIQARNIFPQDLPAYQRAAVTAHTNGVVYPFWRDWALAEPCEFLTPEPLHHWHKMFWDHDAKWAIQAVGASHIDFRFSIHQPTVGYRHFQEGIS # SLKQVTGRTHQDIQRYLIPVISGAISAKFVTALCALLDFRYSGQAQRFSQASSLQVQTALKEFHENKSVILKLKARVNPKGKPIDHWEIPKLEFMQSV # EPSICASDPIMQWTADITEHAHITLVKDPARSGNNHDFEIQICQSLDRLDRVRRFDLMTAMKDASVDFRLEDVEGDEGQEQGAEGLQVDEEEDTELEI # TKISSTEKLVTHLNPVSKKLFRSFRPKQNFFLKVCLLKRAPSAPLPHCSFVNNVTGKISAFSLVCDPDLKTQTIEEASRLYSLSDFRGACSDLIDRIK # SGTKIFAVGGRRTGNTQSPLPFYRVKLWSRLRIQSRTYFNLDLLMDPHTIFSAPPGPGWEFGRQNAVIVNIDQSFQWPRSSLEGELSFHCFLLLLSNS # RIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g67 ### # start gene g68 7 AUGUSTUS gene 286824 287855 0.99 - . g68 7 AUGUSTUS transcript 286824 287855 0.99 - . g68.t1 7 AUGUSTUS stop_codon 286824 286826 . - 0 transcript_id "g68.t1"; gene_id "g68"; 7 AUGUSTUS CDS 286824 287855 0.99 - 0 transcript_id "g68.t1"; gene_id "g68"; 7 AUGUSTUS start_codon 287853 287855 . - 0 transcript_id "g68.t1"; gene_id "g68"; # protein sequence = [MARNLDESLHGVSSPVPASLNNPGGQGGYYNPGGFNIPGVSRSPQPPSQGWTPSLPYPNPTPNPNPHRSYYGGYGGPV # DAGYGQQQQQHPQRMVSPSPTISQHITHPPSSSSSLTASLPTIPSLSSSTPTPTSDPALKVAWSRDVLFLIERAYTLASGSPPGKPISGPVLITDKPL # LDLANIAIPFILEIASLPPSLSNPYIAESIYHRASLLASGAFPEYTPKNPRSAFRDFETATRAGYGKAWFRIGRDYEGFGDTTHAWECFERGVRAGVA # GCLYHLGMAHLLGQLSRCTEFDLTDDDSRRDTVRENKRRGDKQTKEEKVCRVPSGSCLTELLSSSWNHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g68 ### # start gene g69 7 AUGUSTUS gene 289310 289957 0.57 + . g69 7 AUGUSTUS transcript 289310 289957 0.57 + . g69.t1 7 AUGUSTUS start_codon 289310 289312 . + 0 transcript_id "g69.t1"; gene_id "g69"; 7 AUGUSTUS CDS 289310 289459 0.57 + 0 transcript_id "g69.t1"; gene_id "g69"; 7 AUGUSTUS CDS 289526 289957 0.68 + 0 transcript_id "g69.t1"; gene_id "g69"; 7 AUGUSTUS stop_codon 289955 289957 . + 0 transcript_id "g69.t1"; gene_id "g69"; # protein sequence = [MSTLKLTETQALALQALLYREEQLPPALQEVLAALPLSRDLDTGIHSSSETSTKRKESESLPTSTHTFPSPPPTLTSL # LTPTSVSASTSTSTKSLTFLSLSPTATATVTGTTTATPTATATATGTTTATPSPTATATPSLTGTTTVTPTATATATGTGTGTTTATPSATATTTPSA # TATFTATPSTTATSRAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g69 ### # start gene g70 7 AUGUSTUS gene 307412 308371 0.75 + . g70 7 AUGUSTUS transcript 307412 308371 0.75 + . g70.t1 7 AUGUSTUS start_codon 307412 307414 . + 0 transcript_id "g70.t1"; gene_id "g70"; 7 AUGUSTUS CDS 307412 308371 0.75 + 0 transcript_id "g70.t1"; gene_id "g70"; 7 AUGUSTUS stop_codon 308369 308371 . + 0 transcript_id "g70.t1"; gene_id "g70"; # protein sequence = [MPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNN # TPNTTTGVSPFFANKGYHPKLSITLEQVQEAEVNEYASNLKELHAYLQERIEVANKVYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKW # TGPYTVLSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGKTEHFVEDILDSKPKKGRPEEVEYLVKWEGYNDEFNSWVGW # EGMVGLIELLRSWHKHHPRKRQPSHLQWASLEREAREDEEEGSGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g70 ### # start gene g71 7 AUGUSTUS gene 308611 310750 0.63 - . g71 7 AUGUSTUS transcript 308611 310750 0.63 - . g71.t1 7 AUGUSTUS stop_codon 308611 308613 . - 0 transcript_id "g71.t1"; gene_id "g71"; 7 AUGUSTUS CDS 308611 309742 0.88 - 1 transcript_id "g71.t1"; gene_id "g71"; 7 AUGUSTUS CDS 309906 310750 0.63 - 0 transcript_id "g71.t1"; gene_id "g71"; 7 AUGUSTUS start_codon 310748 310750 . - 0 transcript_id "g71.t1"; gene_id "g71"; # protein sequence = [MVTWRQYDAALHERTSSTSTLLELNMLDDQDAADVDQQELRDFLALQQEEAAVAAKRKRDLSPLPVAGPSSKKVQSNA # SKKRPRRRSPVQETAEESPRRVRLVVPPVRSLPVTTSTPLPPRAFPSSMEVPDADLSVQGHSNLVRLAAVAGAQSGLVQQPAVSSSIKGTGQDLLSSN # MPPVPRPTLVPRALATHPYRAENQRLAARVRLLESQLSDSQRENSSLTSALRDTSHALESRQREVEQLRSSSREVREQQVEYRRVLDQFRALDEALPG # PPDRVRILLLYQQGVVDESNALATRQRRLVEELQEEVHRARGRAAFVEQMIKEYPDEGYYEVVLPPLSQLEGDLHKAREDLRRVATFAHRLYRSEPAT # VLHHHYRYLGAIIEAVVAFLRRGLDSDDLDTVVHNFQLGLDYMQAARGVHGDMYMRSLSSIQWFFNNAVDEDEGLYRMVLEHSRFDNDGPFLTAAQHA # GFAPPPDSSLEPPLHRRMFALSTALPHSDGAGRWDDIVPALPSIDQLTADWEQLMLQYIHHITDTPLPVPDPPVPMSSMGPVPESSGEANVEQSLEAP # IVQVSSPSAGSHPSVPLFLLEQESPTSPSPPPCSPVPPLLFGSVASLSIDLTGDDDELYETEESYAGRIAVAREGTELAVGQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g71 ### # start gene g72 7 AUGUSTUS gene 312642 316316 0.54 + . g72 7 AUGUSTUS transcript 312642 316316 0.54 + . g72.t1 7 AUGUSTUS start_codon 312642 312644 . + 0 transcript_id "g72.t1"; gene_id "g72"; 7 AUGUSTUS CDS 312642 316316 0.54 + 0 transcript_id "g72.t1"; gene_id "g72"; 7 AUGUSTUS stop_codon 316314 316316 . + 0 transcript_id "g72.t1"; gene_id "g72"; # protein sequence = [MGINEWLAFASESTEEEVEEILEAGRSAMERVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYP # DLPTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTVQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASDS # SATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKRSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSL # KEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRY # GSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEVSHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDP # EKVKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGI # LSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGR # LGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTSVIEALKRIARNEEESLVWEDGLLKRGGRIYVPDIGT # LRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRAKPYGNLRPLPIGQRPWSSISLDHITQLPVTAGPEKYDAIL # VVVCRLTKQAIYVPCHTTDNAEDFANLFMTHVFSKHGMPSDITSDRGSLFVSQFWRELCRVLGIEARLSMAYHPQTDGQTERVNQSVEAYLRIYCAYD # QDDWDLLLPIAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLERVQGAEVNEYASNLKELHTYLQGRIRVANEAYAKYANQKRQDAPDWKEGDHVWLN # MENVRTRRPMKKLDHKWTGPYSILAKIGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRRNSPPPPVFIKGKTEHFVESVLDSKPIRGRPEEIEY # LVKWEGYGDEFNSWVEWEGMVGSIELLRDWHQQHPRKRQPSRPHWASLEREAQEDEGEDREDSRERSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g72 ### # start gene g73 7 AUGUSTUS gene 319228 319933 0.39 + . g73 7 AUGUSTUS transcript 319228 319933 0.39 + . g73.t1 7 AUGUSTUS start_codon 319228 319230 . + 0 transcript_id "g73.t1"; gene_id "g73"; 7 AUGUSTUS CDS 319228 319438 0.39 + 0 transcript_id "g73.t1"; gene_id "g73"; 7 AUGUSTUS CDS 319497 319933 0.99 + 2 transcript_id "g73.t1"; gene_id "g73"; 7 AUGUSTUS stop_codon 319931 319933 . + 0 transcript_id "g73.t1"; gene_id "g73"; # protein sequence = [MMRLAPSKDLDVFASLRGKVSPAVTSKITTPSPPLEIKPSTPAPKAPVAPPRLIRRNRELENLKTDASSFLASPRSAR # SKDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRSRKVAPAASKGKARQIVVTDEDSASNEVESED # EDEEEDSAPPPKRLKTTSSISGKVYSSFISFYFTNLMGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g73 ### # start gene g74 7 AUGUSTUS gene 322265 323719 0.19 + . g74 7 AUGUSTUS transcript 322265 323719 0.19 + . g74.t1 7 AUGUSTUS start_codon 322265 322267 . + 0 transcript_id "g74.t1"; gene_id "g74"; 7 AUGUSTUS CDS 322265 322432 0.38 + 0 transcript_id "g74.t1"; gene_id "g74"; 7 AUGUSTUS CDS 323075 323210 0.84 + 0 transcript_id "g74.t1"; gene_id "g74"; 7 AUGUSTUS CDS 323292 323719 1 + 2 transcript_id "g74.t1"; gene_id "g74"; 7 AUGUSTUS stop_codon 323717 323719 . + 0 transcript_id "g74.t1"; gene_id "g74"; # protein sequence = [MPIHPKKDLDIARVAEPHLGALQQLLASYKGKKTNSPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKEEKS # AVNDVPPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKS # RQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g74 ### # start gene g75 7 AUGUSTUS gene 323980 326349 1 - . g75 7 AUGUSTUS transcript 323980 326349 1 - . g75.t1 7 AUGUSTUS stop_codon 323980 323982 . - 0 transcript_id "g75.t1"; gene_id "g75"; 7 AUGUSTUS CDS 323980 326349 1 - 0 transcript_id "g75.t1"; gene_id "g75"; 7 AUGUSTUS start_codon 326347 326349 . - 0 transcript_id "g75.t1"; gene_id "g75"; # protein sequence = [MFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKK # KFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSR # ITPGGWQTKRPEVNSEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVF # SRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLSEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHM # LNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEAR # AVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDISKWFYFLKMILWAD # RVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLV # QVRNSGIEKSLDKKMYPRYRGPMVVIRRTKGGSYIIAEMDGTILKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDY # IFDAIPRLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g75 ### # start gene g76 7 AUGUSTUS gene 326557 327246 0.7 - . g76 7 AUGUSTUS transcript 326557 327246 0.7 - . g76.t1 7 AUGUSTUS stop_codon 326557 326559 . - 0 transcript_id "g76.t1"; gene_id "g76"; 7 AUGUSTUS CDS 326557 327246 0.7 - 0 transcript_id "g76.t1"; gene_id "g76"; 7 AUGUSTUS start_codon 327244 327246 . - 0 transcript_id "g76.t1"; gene_id "g76"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY # ILRDEIPHVTIPYIDDVPVKDHQLDMNYQKEVMKLFQKILELDDLFGNISKHE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g76 ### # start gene g77 7 AUGUSTUS gene 327301 329033 0.87 - . g77 7 AUGUSTUS transcript 327301 329033 0.87 - . g77.t1 7 AUGUSTUS stop_codon 327301 327303 . - 0 transcript_id "g77.t1"; gene_id "g77"; 7 AUGUSTUS CDS 327301 328250 0.94 - 2 transcript_id "g77.t1"; gene_id "g77"; 7 AUGUSTUS CDS 328325 329033 0.89 - 0 transcript_id "g77.t1"; gene_id "g77"; 7 AUGUSTUS start_codon 329031 329033 . - 0 transcript_id "g77.t1"; gene_id "g77"; # protein sequence = [MFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDE # EIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSE # ITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEI # IDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPIRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTS # ETIRDDNWNKPKNSQRTRKRIVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPINKLEERIKLNQQDRSPINLIDE # TNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIRQRYQMNFELRDTFMVIRYWNYLNCRNILNRLLLREDIRKKGKRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g77 ### # start gene g78 7 AUGUSTUS gene 329081 329755 1 - . g78 7 AUGUSTUS transcript 329081 329755 1 - . g78.t1 7 AUGUSTUS stop_codon 329081 329083 . - 0 transcript_id "g78.t1"; gene_id "g78"; 7 AUGUSTUS CDS 329081 329755 1 - 0 transcript_id "g78.t1"; gene_id "g78"; 7 AUGUSTUS start_codon 329753 329755 . - 0 transcript_id "g78.t1"; gene_id "g78"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKLLCARYAIGESDQGLKRITTYQLYPKMEKLKFWTIRLGYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g78 ### # start gene g79 7 AUGUSTUS gene 329785 332776 0.31 - . g79 7 AUGUSTUS transcript 329785 332776 0.31 - . g79.t1 7 AUGUSTUS stop_codon 329785 329787 . - 0 transcript_id "g79.t1"; gene_id "g79"; 7 AUGUSTUS CDS 329785 331754 0.43 - 2 transcript_id "g79.t1"; gene_id "g79"; 7 AUGUSTUS CDS 332761 332776 0.42 - 0 transcript_id "g79.t1"; gene_id "g79"; 7 AUGUSTUS start_codon 332774 332776 . - 0 transcript_id "g79.t1"; gene_id "g79"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIQPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQVLKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ # SHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPKSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLR # DNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g79 ### # start gene g80 7 AUGUSTUS gene 333656 336212 0.47 - . g80 7 AUGUSTUS transcript 333656 336212 0.47 - . g80.t1 7 AUGUSTUS stop_codon 333656 333658 . - 0 transcript_id "g80.t1"; gene_id "g80"; 7 AUGUSTUS CDS 333656 334861 0.47 - 0 transcript_id "g80.t1"; gene_id "g80"; 7 AUGUSTUS CDS 334911 336212 0.77 - 0 transcript_id "g80.t1"; gene_id "g80"; 7 AUGUSTUS start_codon 336210 336212 . - 0 transcript_id "g80.t1"; gene_id "g80"; # protein sequence = [MPSSPSKAPTAAGPSRLPLPRSSSGREVASDGEVEQDQLAFTIESPSLPQLQLFENIFNTGKSLAVYCRDDPLWPILA # AVALPCSNCTKHPETCKVPEGSPRCSFCTGKKTCSLGKLLRYRYFARRCNQDLAYSRRFLELHGTPAQRVSWTIPEDVWHRYDKLLHSSTSATKVLVE # LNMLDDQDSQAVDRSELRRFQEAQEQEALLAARRKRVNASPPPKVRSKKRRLTKVVEEPVIEEVPRLVRLVIPPSRPAPSAPGSAPSTFARSSAALPL # TSVQATGQLGSVQGPSPLARLADLVDQQTDSQAEASTRSLGPGSSPIKASLGDSNLPKMSPVVRPPLVPRILSQHPYRVENERLAARIRLLESQLASS # RQENATLTSALRDTSVSLEARQGELDQLRESVSSAAQQQELYDRLLDQVQTLKRALPGPPNESLVDRFRGLEEDLRLARESRAKYLSRFESSNRRNEE # LETSLIQQQSLVDESNALAVRQRKKIETLQEEVHLFRERALFAEKMIREYPDEGSYSVSLPPLAEVQGDLNDTLASLRRVSTFAHRLYRCDPASVLHQ # HNRYVGVIIDAVISFLRRGLDTSDEDVLARNFQLALQYLEAAHFIHAELHLRSLSSIQWFFANAAEREEGIYRLILAHSRFSDDAPFLNVAQHAGFVA # PFDDSLEPPLHRRMFALDTALPHHGAGNWEDLVPALPSLDRLTQEWEAMMSSYIRFVTDTPLPPVDLQEEGSADHEEVSVLQEGESGGTAAVPLFLPD # SLSATPVASAASPSPLPPRFGSVANLAIDMTADEDEEDIYESSGSVERRNRVEGNPGGDGPMEGAPVGQGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g80 ### # start gene g81 7 AUGUSTUS gene 337459 340668 0.98 + . g81 7 AUGUSTUS transcript 337459 340668 0.98 + . g81.t1 7 AUGUSTUS start_codon 337459 337461 . + 0 transcript_id "g81.t1"; gene_id "g81"; 7 AUGUSTUS CDS 337459 340668 0.98 + 0 transcript_id "g81.t1"; gene_id "g81"; 7 AUGUSTUS stop_codon 340666 340668 . + 0 transcript_id "g81.t1"; gene_id "g81"; # protein sequence = [MHNPVIDWKELCLTFQDRNVRISAALVSEIVQPGAEGGTEELGRGVNGEEIHEGTLQPPPEAPQQPPEAPQPPPEVPQ # QSLEAPLRAPRMGVKLEEVKDEEYEASQPGPHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEESLEAGRSAMEKVTPKPAKDSEEAYQKWKSR # DTERSSSWPGAKQKVRWRKKRREHGPYPDLPTLDIESLNIPKIPSRSGLTPKGSMRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLR # EGTPAYFLHISPTKEESPTEEMLRASDSSATEGVQQPKDPERGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPY # DIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIF # TKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEVSHVEHVRKVLERLRANHLHA # KPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKVVMDWPKPRTVKELQAFLGFTNFYRRFIDNYLGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFS # EAPVLGHYNPDLPVILECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSQHQIQVYSDHNNLQYFTT # TKQLTARQAWWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALRRI # ARNEEESLVWEDGLIKRGGRIYVPDVGTLRREVLQLYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIG # QRPWSSISLDHITQLPVTAGPEKYDTILVVVCRLTKQAIYVPCHTTDNAEDFATLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLST # AYHPQTDGQTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g81 ### # start gene g82 7 AUGUSTUS gene 340744 341493 0.99 + . g82 7 AUGUSTUS transcript 340744 341493 0.99 + . g82.t1 7 AUGUSTUS start_codon 340744 340746 . + 0 transcript_id "g82.t1"; gene_id "g82"; 7 AUGUSTUS CDS 340744 341493 0.99 + 0 transcript_id "g82.t1"; gene_id "g82"; 7 AUGUSTUS stop_codon 341491 341493 . + 0 transcript_id "g82.t1"; gene_id "g82"; # protein sequence = [MAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIRVANKVYAKYADQKRQEAP # DWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTILSKVGCHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEDILDSK # PKKGRPEEVEYLVKWEGYNDEFNSWVGWEGMVGSIELLRSWYKHHPRKRQPSRLQWASLEREAWEDEEEGPGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g82 ### # start gene g83 7 AUGUSTUS gene 341769 343545 0.16 - . g83 7 AUGUSTUS transcript 341769 343545 0.16 - . g83.t1 7 AUGUSTUS stop_codon 341769 341771 . - 0 transcript_id "g83.t1"; gene_id "g83"; 7 AUGUSTUS CDS 341769 342161 0.21 - 0 transcript_id "g83.t1"; gene_id "g83"; 7 AUGUSTUS CDS 342946 343545 0.16 - 0 transcript_id "g83.t1"; gene_id "g83"; 7 AUGUSTUS start_codon 343543 343545 . - 0 transcript_id "g83.t1"; gene_id "g83"; # protein sequence = [MEEDLRDAVRERKVAVEKLSSSTRKSSQLTTTLLYQQGRVDKSNALATRQRRLVEELQEEVHRARDRAAFVEQMVKEY # PDEGYYEVVLPPLSQLEEDLNKAREDLRRVATLAHRLHCSDPATLLHHHHRYIGAIIEAVVAFLRRGLESEDPAVATHNLHLALDYMQAAQGVHGDLY # VRSISSIQWFFNNTVDEDEGLYRLLTADWEQLMLRYIHHITDVPLSGTDTQVPMSSVEPGTESLAEGTVEQLPEAPPLFLPEQESPTSPSPPPPSPTL # PPPFGSVVNLAIDLTGDDDELYETEESRVARVSMTGEVGEVVDLAPDQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g83 ### # start gene g84 7 AUGUSTUS gene 343613 344383 0.52 - . g84 7 AUGUSTUS transcript 343613 344383 0.52 - . g84.t1 7 AUGUSTUS stop_codon 343613 343615 . - 0 transcript_id "g84.t1"; gene_id "g84"; 7 AUGUSTUS CDS 343613 344383 0.52 - 0 transcript_id "g84.t1"; gene_id "g84"; 7 AUGUSTUS start_codon 344381 344383 . - 0 transcript_id "g84.t1"; gene_id "g84"; # protein sequence = [MLDEQDAADADQQELQEFLALQQGEAVVAAKRKRDRSPMPMAGPSVKRVRQDASKKRSRRRSPEEEVVQEAPLRVRLV # VPPGRSVAASTSTPLPPRASPSLMEVSGGDLPVQGHSNLVRLAAVAEAQSGSVQRPVVPPSIKGAGPDLLSSNMPPASRPTLVPRALAAHPYRTENRC # LAARVRLLESQLADSQRENSSLTSALRDTSHALESRQREVEQLRSSRHEVLEHETEYRRVLDQFVALDGALPGTPGQVST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g84 ### # start gene g85 7 AUGUSTUS gene 346678 349725 0.97 - . g85 7 AUGUSTUS transcript 346678 349725 0.97 - . g85.t1 7 AUGUSTUS stop_codon 346678 346680 . - 0 transcript_id "g85.t1"; gene_id "g85"; 7 AUGUSTUS CDS 346678 349725 0.97 - 0 transcript_id "g85.t1"; gene_id "g85"; 7 AUGUSTUS start_codon 349723 349725 . - 0 transcript_id "g85.t1"; gene_id "g85"; # protein sequence = [MKAQDSKDRKENVQPDLWNEPPTNKLEERIKLNQQDRSPINLIDETNKQVVNEAIGVEKPINLNTEEVFMKYKPVDKK # VNPIKATLPDEFRIERHIHGYPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKV # PVILHEPWVERNIPILPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDDKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLD # LYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEH # FQNMNRVIQQMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCCDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFE # WNEKCDKAMDELKDGIRDCSALRPINFDWDVYLAVDTSYKAVGWYIYQIDPSEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCR # RLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGWQTKHPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDP # RSAYLYETAQEADDIELDVQEALDEERSYKIRRNHMLKAKNATCEVFSRNLFPTFDEEFVQNNLYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLEE # MSKDEWIKFIRLIKKFQVDDQGRLYYRNTDQPDQPQLVVEKEKHMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLL # KAPLTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICHWGCPEEVVTDNAGQMKNMLAWLEEKYGIKG # IRISACKTWVKMGLRVGLVYEVLCCSVLGAGWSSKGATRTATEDGNDLVVPGTTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g85 ### # start gene g86 7 AUGUSTUS gene 350272 351180 0.77 - . g86 7 AUGUSTUS transcript 350272 351180 0.77 - . g86.t1 7 AUGUSTUS stop_codon 350272 350274 . - 0 transcript_id "g86.t1"; gene_id "g86"; 7 AUGUSTUS CDS 350272 351180 0.77 - 0 transcript_id "g86.t1"; gene_id "g86"; 7 AUGUSTUS start_codon 351178 351180 . - 0 transcript_id "g86.t1"; gene_id "g86"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPLVTIE # DVNESDDEDAIKLIPSSRPMNQINSEHRPYDHVQPRTYHPIQINTPTKVSRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTKSRNDIPVGSIVQKDIVKSFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVAN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g86 ### # start gene g87 7 AUGUSTUS gene 351210 351530 0.5 - . g87 7 AUGUSTUS transcript 351210 351530 0.5 - . g87.t1 7 AUGUSTUS stop_codon 351210 351212 . - 0 transcript_id "g87.t1"; gene_id "g87"; 7 AUGUSTUS CDS 351210 351530 0.5 - 0 transcript_id "g87.t1"; gene_id "g87"; 7 AUGUSTUS start_codon 351528 351530 . - 0 transcript_id "g87.t1"; gene_id "g87"; # protein sequence = [MPEGGDSKRYKLRDNTRMPRDDPNIPRYKKIEQMVKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEE # LSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g87 ### # start gene g88 7 AUGUSTUS gene 352044 352870 0.46 + . g88 7 AUGUSTUS transcript 352044 352870 0.46 + . g88.t1 7 AUGUSTUS start_codon 352044 352046 . + 0 transcript_id "g88.t1"; gene_id "g88"; 7 AUGUSTUS CDS 352044 352054 0.71 + 0 transcript_id "g88.t1"; gene_id "g88"; 7 AUGUSTUS CDS 352147 352870 0.56 + 1 transcript_id "g88.t1"; gene_id "g88"; 7 AUGUSTUS stop_codon 352868 352870 . + 0 transcript_id "g88.t1"; gene_id "g88"; # protein sequence = [MKGNGGENIIDYGGNHEQGSGGEQAEYACKHSGNFDNDPGNYEGEYNSFYGGGYRGRGGYGRGGYGGYGVGSYGYGYG # GGGYGGRGGGYGGGGYGGGGYGGGGGGGYGGGGGGGGDGGGVYAGDYAHGYREGHTGNYGGSHGGGAEGEGYMGGYARQGFQGVQEDSKGSYGGSYLG # NEDSGRAFGGGYKRHEGALVGNQRNIDSNNAGEQGGHIPSSSEDRMETTGGTGCFKLLSLKFEADVFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g88 ### # start gene g89 7 AUGUSTUS gene 353045 353209 0.69 + . g89 7 AUGUSTUS transcript 353045 353209 0.69 + . g89.t1 7 AUGUSTUS start_codon 353045 353047 . + 0 transcript_id "g89.t1"; gene_id "g89"; 7 AUGUSTUS CDS 353045 353209 0.69 + 0 transcript_id "g89.t1"; gene_id "g89"; 7 AUGUSTUS stop_codon 353207 353209 . + 0 transcript_id "g89.t1"; gene_id "g89"; # protein sequence = [MVEENWEEEEQAEFEHDPEADNDEDEDDENDEADYEEDEATTNSREYKRKLFLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g89 ### # start gene g90 7 AUGUSTUS gene 358798 360588 0.95 - . g90 7 AUGUSTUS transcript 358798 360588 0.95 - . g90.t1 7 AUGUSTUS stop_codon 358798 358800 . - 0 transcript_id "g90.t1"; gene_id "g90"; 7 AUGUSTUS CDS 358798 360588 0.95 - 0 transcript_id "g90.t1"; gene_id "g90"; 7 AUGUSTUS start_codon 360586 360588 . - 0 transcript_id "g90.t1"; gene_id "g90"; # protein sequence = [MDVNARLALAHRQIEAVRALDALRAQRQRILTEEEKRAREIRAQRNGRSAVEFAPTRSDELEHELDKVATKRARKRRM # EKGKGKEEEDDVIEKALARIIRLERMERRKFNQRLQLARQNGSSRRRALDQGLALPNAETSSERTTTTTTAPPSSFFPTVALERPNGSIPFSFVYPPK # SDPDSTSGESSSFPSHGSNFDSQSSSPSSAPSISPSTSPVPNFASTAYVGPPPLIPTVISSSNTSISRPGTPIRRPPLPTTLPSSPGSGTSSPSVKTP # LASPNLATYRAPEELVNSDNEDYFAGPSTSALAPVSEQAVEADDEDDDTETLDGHEVDEGEDSTSPLIPDHGEMDEEIRTYFREEATDGSDEGESDTE # PELVIDLPEPEARNAEQHEEPHVVDLQDGNEVAGAEVDEDEEDDEEEDEEEDEEGEDEIAEEFQVRPQLREGAAVAFNAGVRRAVQLDANAPPPLALA # PIPGFPARPQPQQGPLVLNADDALLDELEAGVDDDMDGAMEGQSIFTSEVCDVLLRRFSPVLSYWAKRSNIWSGTKCCSDDFHHGFCYWLSNVDTLYA # WQINGLPHGKCHLSTFSPLIKHKLLDHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g90 ### # start gene g91 7 AUGUSTUS gene 368437 368625 0.56 + . g91 7 AUGUSTUS transcript 368437 368625 0.56 + . g91.t1 7 AUGUSTUS start_codon 368437 368439 . + 0 transcript_id "g91.t1"; gene_id "g91"; 7 AUGUSTUS CDS 368437 368625 0.56 + 0 transcript_id "g91.t1"; gene_id "g91"; 7 AUGUSTUS stop_codon 368623 368625 . + 0 transcript_id "g91.t1"; gene_id "g91"; # protein sequence = [MARSASLVSDSEDKPEDAPAPDDDDVVKSVDMNGDEGENDEEEEEFEIEEILKHNKGQFPEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g91 ### # start gene g92 7 AUGUSTUS gene 371291 371659 1 - . g92 7 AUGUSTUS transcript 371291 371659 1 - . g92.t1 7 AUGUSTUS stop_codon 371291 371293 . - 0 transcript_id "g92.t1"; gene_id "g92"; 7 AUGUSTUS CDS 371291 371659 1 - 0 transcript_id "g92.t1"; gene_id "g92"; 7 AUGUSTUS start_codon 371657 371659 . - 0 transcript_id "g92.t1"; gene_id "g92"; # protein sequence = [MIQNGTHPSPPIDPLVPALDKLQLELEDAKNGFDTRVRTLSAQIHHVLSPPQKEEQEGEASSEEPVSGEGEKFSILPI # DPVPTSPVMDGQEELEAANIIIGKSKEQVEEAIRIAQESVHEEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g92 ### # start gene g93 7 AUGUSTUS gene 372037 373971 0.53 - . g93 7 AUGUSTUS transcript 372037 373971 0.53 - . g93.t1 7 AUGUSTUS stop_codon 372037 372039 . - 0 transcript_id "g93.t1"; gene_id "g93"; 7 AUGUSTUS CDS 372037 373971 0.53 - 0 transcript_id "g93.t1"; gene_id "g93"; 7 AUGUSTUS start_codon 373969 373971 . - 0 transcript_id "g93.t1"; gene_id "g93"; # protein sequence = [MVVNKKQNFPVAPTMGSRTNSTQPLPRAKATSNSKSLSTAGPPQKKTKPKKPSKTPKLRTKSSIMDRFLVIMLAIFST # YALWTCPSDIHLSNPICRSLSQYRTHVLDPYVLPPVQKALLHPYVAPAVTKFYAVEHAVAPIVIRAHAVAQPYITKATQLTQATALTAYAKLVTPMYN # KHIQPLYQKYVDPLYMGYVYPRLHLLRSRVLDPYLRPLMLKTHLYANKLFWTLHRIYLAAAPRIHSAYVRARPLMDRAWEVAKPYVVQSVDTGLKLFG # LLLEKTAEARRQFVDPHVIKIWEKVVELSGSSGTTTSSTAFSVPTPVSETKATSAEAEVETVQSGSSSVSSASISTSLSVPLEPSEASPVPEESSLPL # ETLTSEDPTLSSIITELEASTISEIFSASTSSLTSSEHESTTASYDSALTPDIASPVETLLAVTEPESEFEVPIEAEQGTSGEENLDSEYASSTSEDD # LDNFFADLGLLENEENETGDFTEASVVETEQDTAISPEESAAARRVATAKKRAELEARMEKWHADLDGLMKRRTKEFRKELVRVRKGAVRSLFPDPEK # DNGDLEEALTHIRGEDVAGILERFDKESEKLLKGLESYLKKEEKLVSGMFNSLSFGDRSSTEMYVEIPLMWMLMIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g93 ### # start gene g94 7 AUGUSTUS gene 374690 376012 0.95 + . g94 7 AUGUSTUS transcript 374690 376012 0.95 + . g94.t1 7 AUGUSTUS start_codon 374690 374692 . + 0 transcript_id "g94.t1"; gene_id "g94"; 7 AUGUSTUS CDS 374690 376012 0.95 + 0 transcript_id "g94.t1"; gene_id "g94"; 7 AUGUSTUS stop_codon 376010 376012 . + 0 transcript_id "g94.t1"; gene_id "g94"; # protein sequence = [MNIDTRQKLKRNISLDAQQDPPIKKPKMRKPLETRYETPYPSSLSESQVYKLPSSIGPYLSPSKFSPIPKAHLRRNHR # RTSSTNLKENASVLCSPFPKGKNPQKLKKYGKAAKRTSKKRADPRSNGTPSDSCSSSASSPDRRNQELTLAEKIHNSSISRSRASQSTTNSPAETTTR # VRRPSAPTPPKKFDWKDLVPTHPVDLRAPISGYPQSHFDPDANEFIRPSPNHSQIDFNRPPSQLSLYDYNRSVTYHDMDVDDVASTDQDAFFTDVQGT # STPFKNLSSLSVADRRFGGTVDPAALSGSALLLLQSNTDGQETDTDNDSCGFDSDEAIDDPGPHRSFRALKLASRNKSKSGSGYITPSCDSGDEEMGR # RSPWISDSLISPPKTIDWKLVAQQTEDGAYSQVNSGDHMVTDEEDRVSEPALQDLFDNMILSEFVSLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g94 ### # start gene g95 7 AUGUSTUS gene 376053 377213 0.98 + . g95 7 AUGUSTUS transcript 376053 377213 0.98 + . g95.t1 7 AUGUSTUS start_codon 376053 376055 . + 0 transcript_id "g95.t1"; gene_id "g95"; 7 AUGUSTUS CDS 376053 377213 0.98 + 0 transcript_id "g95.t1"; gene_id "g95"; 7 AUGUSTUS stop_codon 377211 377213 . + 0 transcript_id "g95.t1"; gene_id "g95"; # protein sequence = [MDAHSSPPDDTESYCVRLPLRTRSLDTAHPLSTDQEEESFNPVAPGARRTRSGTIIPGTSAVPVVTSNVPPALPGRTR # SGTVVPGNFGTLYPAPLDDEKQNTLGAALSVYGRRARSGTIVYSSSLAPSLPIVEEKNTTESSSAIPVMSQARRARSGSIMAASSIPEGVVANSTVGP # TAAAAVPRSRIRSGSIVALGNTLGSLSSHATGLIKRPRSGTVVRASADPDPMIAVEKAIDIDYLQKSPADMNTVSVAHLQGEDVEMSLASEDRHNPIP # CSPDDPVDLLEPMVFARPVQSSPPHTATLSAAFHVRSSSGLRARAKAAASKAKGLSKTLTGKSGGAKVRVLIGPEAGAAALARARARAERRSINDDDF # VNEEDLSDDELLLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g95 ### # start gene g96 7 AUGUSTUS gene 381019 382434 0.85 + . g96 7 AUGUSTUS transcript 381019 382434 0.85 + . g96.t1 7 AUGUSTUS start_codon 381019 381021 . + 0 transcript_id "g96.t1"; gene_id "g96"; 7 AUGUSTUS CDS 381019 382434 0.85 + 0 transcript_id "g96.t1"; gene_id "g96"; 7 AUGUSTUS stop_codon 382432 382434 . + 0 transcript_id "g96.t1"; gene_id "g96"; # protein sequence = [MNALRSTLSELASQADALQSAEDFSYVGVTDDLSTPSFTHGDTSTSRSGSETSQQPFSTPLGFLQAAFPELQTQKLDR # ALLDAKMDDDADLDMWDIVSRLLSEELIQEMEERGLDGLDDVDGYPAEIEASWETVGKTRSVNNERRKKKQGNSRHKIALVDIRQRHHSKSTDYTSPN # HPQSFPAPDPWTQIYSLSTHLETLLAPYDASFFTSYFHSPKYSTPYIALVEALQEISKKRSTDVDLEPLIISLLDILLPPYEDLDPEQRSRLVSDIEL # SLSATQGHADEALDLVKLLRDLDEDSSSGYLEMGIYHQPIASKPPSNDIRPSGTPLSRASSRKSQLPSGPPEIPSPPLLKNNATPTRSGNQASPYQWQ # VVPKRKTRKTPHPLAPFIPAYSRDVNGIKVRGSGNGFGKGGKGDVGELRKRIGDSVRKRDEMLREASRMWQKGNAKSRGGEVALYFADRVRRRLSIVR # V] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g96 ### # start gene g97 7 AUGUSTUS gene 385384 386427 0.86 - . g97 7 AUGUSTUS transcript 385384 386427 0.86 - . g97.t1 7 AUGUSTUS stop_codon 385384 385386 . - 0 transcript_id "g97.t1"; gene_id "g97"; 7 AUGUSTUS CDS 385384 386427 0.86 - 0 transcript_id "g97.t1"; gene_id "g97"; 7 AUGUSTUS start_codon 386425 386427 . - 0 transcript_id "g97.t1"; gene_id "g97"; # protein sequence = [MSTAPKNAEFAHLFELFEKLASRRTRATDVGESLVTDDTHILSIPLDLQPVFRNLATLVTPRTISASGRRGRRNTVAV # PSGSSDIDADTDTESVAKFPMGKQYPFKFKMMLHKLYELDDWGKKVREVLERSQKEYKPLAETVSHPESGDNAMGENGGVEGVHIGVESGVNSPPKRT # GRPRGHTVASSSGGKWKEAVPRSVGVQSRDDERAVKKRCVGRRKSMSGMIGDCPNWVFNATVASSEINERVDPTGPPTVTFYSSSHQYDRNKVPPRRR # VSSTATAAPAIALQVPSFHRYGVLQQDGRKRVPPRRRVSSVATPAPAIEGVQLVDDKNFKKRRATSIVVVKRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g97 ### # start gene g98 7 AUGUSTUS gene 391656 392262 0.47 - . g98 7 AUGUSTUS transcript 391656 392262 0.47 - . g98.t1 7 AUGUSTUS stop_codon 391656 391658 . - 0 transcript_id "g98.t1"; gene_id "g98"; 7 AUGUSTUS CDS 391656 392101 0.76 - 2 transcript_id "g98.t1"; gene_id "g98"; 7 AUGUSTUS CDS 392208 392262 0.48 - 0 transcript_id "g98.t1"; gene_id "g98"; 7 AUGUSTUS start_codon 392260 392262 . - 0 transcript_id "g98.t1"; gene_id "g98"; # protein sequence = [MTAQRKSSSSPLSLLGTLLNEFPSGGGFSRLFAQPSYQTSAVSAYLAKIGSTNAGLFNASGRAYPDVAAQGEGFQVVV # GGRVESVGGTSCSSPTFAGVIALLNDFKLAKDGTTLGFLNPLLYANPSALNDITSGSNPGCGTNGFTTSTGWDPVRIFPPIKWGRLFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g98 ### # start gene g99 7 AUGUSTUS gene 392338 393632 0.61 - . g99 7 AUGUSTUS transcript 392338 393632 0.61 - . g99.t1 7 AUGUSTUS stop_codon 392338 392340 . - 0 transcript_id "g99.t1"; gene_id "g99"; 7 AUGUSTUS CDS 392338 392584 0.64 - 1 transcript_id "g99.t1"; gene_id "g99"; 7 AUGUSTUS CDS 392643 392893 0.99 - 0 transcript_id "g99.t1"; gene_id "g99"; 7 AUGUSTUS CDS 392943 393632 0.95 - 0 transcript_id "g99.t1"; gene_id "g99"; 7 AUGUSTUS start_codon 393630 393632 . - 0 transcript_id "g99.t1"; gene_id "g99"; # protein sequence = [MFFPSAVFALLPLTVLATPLSSRSVVYADFATKHSWGDSTPSSTWVHHSTPDPSTLLKLRFGLRPSNFDTLLEHLSET # SDPFHERYGKHLSKAQVDEFMKPTDETLQEVKEWLNWHGIEDDALISTSDRVITVAIPVSLAETLLNTKYHVYAHTDSDEKIIRTLEYSLPRHLHDHI # DLVSPTTYFGTTRSMKVTSHLEPDRPVLSLGSDVTPSSSCKTTITPTCLKDLYNTINYTPTETAVNKIGITGYLEQFASNSDLATFVKSFLPQATNAT # FTLTEINGGLNTQNDPGVEANLDVQYATGMSWPTPMIFYSTGGEPPFIADSNEPTNTNEPYLNWLDFIATVADNDLPNTFSTSYGDDEQTVPADFATE # VCNAFATLGARGASVMFSSGDAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g99 ### # start gene g100 7 AUGUSTUS gene 398711 399112 0.38 - . g100 7 AUGUSTUS transcript 398711 399112 0.38 - . g100.t1 7 AUGUSTUS stop_codon 398711 398713 . - 0 transcript_id "g100.t1"; gene_id "g100"; 7 AUGUSTUS CDS 398711 399112 0.38 - 0 transcript_id "g100.t1"; gene_id "g100"; 7 AUGUSTUS start_codon 399110 399112 . - 0 transcript_id "g100.t1"; gene_id "g100"; # protein sequence = [MNSSAPYTVHTHELNPPLPQPISGPSTASPMDLLILQVKAFLDAAEDVEVGPETIQELLQLIADRQTTNVVDLEPTPD # VEDEDDEWLPGQEHNDVELDISALFTNAHDGAGVHQLIYQAVAYCADRNLDKGGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g100 ### # start gene g101 7 AUGUSTUS gene 399866 400467 0.28 + . g101 7 AUGUSTUS transcript 399866 400467 0.28 + . g101.t1 7 AUGUSTUS start_codon 399866 399868 . + 0 transcript_id "g101.t1"; gene_id "g101"; 7 AUGUSTUS CDS 399866 399942 0.28 + 0 transcript_id "g101.t1"; gene_id "g101"; 7 AUGUSTUS CDS 400104 400467 0.96 + 1 transcript_id "g101.t1"; gene_id "g101"; 7 AUGUSTUS stop_codon 400465 400467 . + 0 transcript_id "g101.t1"; gene_id "g101"; # protein sequence = [MEVLPRLHCEYRFLTAPFSLCAHTRDSATASANASASAGADNGSTSASASSSSEADTSSASSSASSSLSADAGSASAS # ASASSSGDVDSVSASASVSSANNDNGNSTAAASASTSSTAGAETGSSAASASVKNLSSADSDSNSTSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g101 ### # start gene g102 7 AUGUSTUS gene 405023 405487 0.91 + . g102 7 AUGUSTUS transcript 405023 405487 0.91 + . g102.t1 7 AUGUSTUS start_codon 405023 405025 . + 0 transcript_id "g102.t1"; gene_id "g102"; 7 AUGUSTUS CDS 405023 405487 0.91 + 0 transcript_id "g102.t1"; gene_id "g102"; 7 AUGUSTUS stop_codon 405485 405487 . + 0 transcript_id "g102.t1"; gene_id "g102"; # protein sequence = [MDRFLDESYDWWDPLSDLIGILEGRGDVIERVCEELGADWKEVCAAWGIFVDTRLRRQDLPYVSPPVIILLNVLTPSR # DVVADVLETMPPDPTNLEDMMLSSLFSGHADQVLKHASDFDLWLSAHLADIMEPLGLLDAELDFEYHYHPASFRLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g102 ### # start gene g103 7 AUGUSTUS gene 418347 419171 1 - . g103 7 AUGUSTUS transcript 418347 419171 1 - . g103.t1 7 AUGUSTUS stop_codon 418347 418349 . - 0 transcript_id "g103.t1"; gene_id "g103"; 7 AUGUSTUS CDS 418347 419171 1 - 0 transcript_id "g103.t1"; gene_id "g103"; 7 AUGUSTUS start_codon 419169 419171 . - 0 transcript_id "g103.t1"; gene_id "g103"; # protein sequence = [MPTLTPAAALASAYTSAATGKPIVSSQDGEERTENETSGGPKRLAFTSSSSLLPGKQLQGGITRYGGTTKEWSRGGGM # EGAETEPQTTYSDMFMNSLHAAISKSTPDTLPVLTTQPICSREAPMAEQTTSSQRLLSHTTSQASSLTTTNLTPQLNAASTALLNALLMNLNRSDPSH # GHPMTNGTPKKKGAYSPPLSTLGSRPATSNYPTAISLPVNTVATRSVCPYPVNLTPIISALRPHCAARERLIQWKPASKRNFQDTTGLPLDLPDGFID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g103 ### # start gene g104 7 AUGUSTUS gene 420981 422583 0.26 - . g104 7 AUGUSTUS transcript 420981 422583 0.26 - . g104.t1 7 AUGUSTUS stop_codon 420981 420983 . - 0 transcript_id "g104.t1"; gene_id "g104"; 7 AUGUSTUS CDS 420981 422193 0.26 - 1 transcript_id "g104.t1"; gene_id "g104"; 7 AUGUSTUS CDS 422312 422583 0.27 - 0 transcript_id "g104.t1"; gene_id "g104"; 7 AUGUSTUS start_codon 422581 422583 . - 0 transcript_id "g104.t1"; gene_id "g104"; # protein sequence = [MEARVAARPPQTLSRTHGNPPIECAKLPIPPHPPAKLADKLITVNQTPLASNVPFGTQTNHRSHDVTDVSDGTNMTYA # AAPEHQSGTENAIIFAQDALTADTELAAALTENKIAVRTPLQAKEWKLAITSLNLTHKYPTLAEYGFNVGIPRIKHTFSLPNKLNNPESIAAFHEIMR # NEIDTGRWLGPYSKETIEKTIGPFQTSPISMIPKSGKPGKFRLLENLSYPYRPTLIPSIPAVISSINSHINSTLYPCLWGTFATTCRLIWTLPPNSQG # AVRDISEAYRLIPLHPSQWAGVVVRTSQEEYCIDTRDMFGLKSAGGSFGHLADCGMDICRGYGLGPLTKWVDDHLWLRVLTQYIDQYNALQEQLRECT # ARTGVIHRKGRLLYQGHTLPNGQLEEFDDDFTFPIQDLSRLSPRSQEDSRYAYSFQDIDRITLPLGYTWSAKKDIPFCYDPITSLPRFCVKEKGRNLM # GTPTNQSNTQYASSLLSNLFNSKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g104 ### # start gene g105 7 AUGUSTUS gene 427630 428193 0.71 + . g105 7 AUGUSTUS transcript 427630 428193 0.71 + . g105.t1 7 AUGUSTUS start_codon 427630 427632 . + 0 transcript_id "g105.t1"; gene_id "g105"; 7 AUGUSTUS CDS 427630 428193 0.71 + 0 transcript_id "g105.t1"; gene_id "g105"; 7 AUGUSTUS stop_codon 428191 428193 . + 0 transcript_id "g105.t1"; gene_id "g105"; # protein sequence = [MQQVVALDRFIRALKYSGEPQTVWTNLGCLEVTRSELRNSRVYILKIEDEIAEGRKYRTQSIIRNQRHSYMIDELRLQ # VSESYAEAEIQSRQEQLKLLKRIEELELRLSKDEWMKQAKRIKELEIQVAREKLVRGKAAHILHNNHDLFAAKDEVLMLLKPALVPRPQTHYGELSSG # SQEVISEANST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g105 ### # start gene g106 7 AUGUSTUS gene 431311 432030 0.88 - . g106 7 AUGUSTUS transcript 431311 432030 0.88 - . g106.t1 7 AUGUSTUS stop_codon 431311 431313 . - 0 transcript_id "g106.t1"; gene_id "g106"; 7 AUGUSTUS CDS 431311 432030 0.88 - 0 transcript_id "g106.t1"; gene_id "g106"; 7 AUGUSTUS start_codon 432028 432030 . - 0 transcript_id "g106.t1"; gene_id "g106"; # protein sequence = [MNETRSPEKTIQTLRSIFTSSQKYNGKTQSKKIVTQTGVKDTFLESFSQQIVSFVAKIPGNTSAPQKQRLVDNFVAEN # IPSDPNVFSPVWRIKGVLLAQLEMKLRVNNLSQGLDPHRDTPVEILHVILLGFVKYYWQDVIAHLSDPQKEILTNQLASVDVSSMGLAQLAGETLVKY # AQSLTGRDFRAIAQVAPFVLYDLISKECYEAWLSLSALIPLVWQPVINHLDEYLVGFQFTFMP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g106 ### # start gene g107 7 AUGUSTUS gene 432438 434291 0.13 - . g107 7 AUGUSTUS transcript 432438 434291 0.13 - . g107.t1 7 AUGUSTUS stop_codon 432438 432440 . - 0 transcript_id "g107.t1"; gene_id "g107"; 7 AUGUSTUS CDS 432438 432852 0.62 - 1 transcript_id "g107.t1"; gene_id "g107"; 7 AUGUSTUS CDS 432915 432949 0.59 - 0 transcript_id "g107.t1"; gene_id "g107"; 7 AUGUSTUS CDS 433148 433273 0.77 - 0 transcript_id "g107.t1"; gene_id "g107"; 7 AUGUSTUS CDS 433322 433512 0.28 - 2 transcript_id "g107.t1"; gene_id "g107"; 7 AUGUSTUS CDS 433598 434291 0.6 - 0 transcript_id "g107.t1"; gene_id "g107"; 7 AUGUSTUS start_codon 434289 434291 . - 0 transcript_id "g107.t1"; gene_id "g107"; # protein sequence = [MELVWQAGSGINYKKWTCLVCEDQLWRDSTAVHRHEDRQNHQQAVRYRQENSDYTPPNPFSPNPETSSRVSPPLRELL # VELSEAPYRSSFEEVPAGEFFDFDTIEVDNHGPDLSRQSIDYSAHFNLGEDTELQASDEQRGMARLAEELHAWLLEDGESDDSEPEIQEQNEVDVGGM # CNDFLLIPYTIHCCLVSDELGTLLNFGAPRPRRRQRTNNPAWFPWSDKEVRGHQFYAQMDIILWGIASFRVDNAPSTDTAKSVGEYLQTLCGIKTEHQ # KGPLGHIYYINQLAGLIRQVREMGNPKIRPHIRHYPEDSRQHVEHAWQADAWRTLDPDLSSPMTIQFPISRLLSLFCNILLKPCSSISLWLPTGVYTT # NSNDNQGIQPWTLTSAEHGFTNHWRVLAQGHEVLNFAMWLYCNDTSGNVSKKWNKHNSFLFTAAGLPQEYAHQEGNVHFLCTSNLAPLLEMLDGITKQ # LEYVLINAANGYCTTY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g107 ### # start gene g108 7 AUGUSTUS gene 437259 438416 0.95 + . g108 7 AUGUSTUS transcript 437259 438416 0.95 + . g108.t1 7 AUGUSTUS start_codon 437259 437261 . + 0 transcript_id "g108.t1"; gene_id "g108"; 7 AUGUSTUS CDS 437259 438416 0.95 + 0 transcript_id "g108.t1"; gene_id "g108"; 7 AUGUSTUS stop_codon 438414 438416 . + 0 transcript_id "g108.t1"; gene_id "g108"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVCKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVCLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGLGRDRGRCQQSRRQQISATAAPFTLFPNESVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRAN # AMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g108 ### # start gene g109 7 AUGUSTUS gene 438467 440518 0.98 + . g109 7 AUGUSTUS transcript 438467 440518 0.98 + . g109.t1 7 AUGUSTUS start_codon 438467 438469 . + 0 transcript_id "g109.t1"; gene_id "g109"; 7 AUGUSTUS CDS 438467 440518 0.98 + 0 transcript_id "g109.t1"; gene_id "g109"; 7 AUGUSTUS stop_codon 440516 440518 . + 0 transcript_id "g109.t1"; gene_id "g109"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFACLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGQLPVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHTIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISQLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNVIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLHPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELQGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDTSGFATGGALMQKQDDGQWHPVAFRLASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQLFDII # TDHSNLEFWRRAQDLTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g109 ### # start gene g110 7 AUGUSTUS gene 442771 443037 0.66 + . g110 7 AUGUSTUS transcript 442771 443037 0.66 + . g110.t1 7 AUGUSTUS start_codon 442771 442773 . + 0 transcript_id "g110.t1"; gene_id "g110"; 7 AUGUSTUS CDS 442771 443037 0.66 + 0 transcript_id "g110.t1"; gene_id "g110"; 7 AUGUSTUS stop_codon 443035 443037 . + 0 transcript_id "g110.t1"; gene_id "g110"; # protein sequence = [MTASCTITTTSSSSTTGPLTTCPVPLLPANLEDDDQEEERIMREAKEMIWRVKEKKAEEAAKKKAEEERKKAAALWAA # AARMKVAQEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g110 ### # start gene g111 7 AUGUSTUS gene 446680 447156 0.72 + . g111 7 AUGUSTUS transcript 446680 447156 0.72 + . g111.t1 7 AUGUSTUS start_codon 446680 446682 . + 0 transcript_id "g111.t1"; gene_id "g111"; 7 AUGUSTUS CDS 446680 447156 0.72 + 0 transcript_id "g111.t1"; gene_id "g111"; 7 AUGUSTUS stop_codon 447154 447156 . + 0 transcript_id "g111.t1"; gene_id "g111"; # protein sequence = [MSTSRTLTTTTTNSSTAGPSRSRPVPPPPVDSSAHEEEGLEDKDEDNIIRRAQERVERVRARKAAEAARKATEEKAAR # AAAAREKVAQEAQERAQQQEEEVSERRRLLAAAATARSQRGTSPSEVSVSLRRPMVEISKKSKGKGKAKTQVHLPITITR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g111 ### # start gene g112 7 AUGUSTUS gene 449984 451309 0.91 - . g112 7 AUGUSTUS transcript 449984 451309 0.91 - . g112.t1 7 AUGUSTUS stop_codon 449984 449986 . - 0 transcript_id "g112.t1"; gene_id "g112"; 7 AUGUSTUS CDS 449984 451309 0.91 - 0 transcript_id "g112.t1"; gene_id "g112"; 7 AUGUSTUS start_codon 451307 451309 . - 0 transcript_id "g112.t1"; gene_id "g112"; # protein sequence = [MVIRFRPGKLSEKPDSITRRWDIYPKEGNIGYAQVTPHNFRPIFTNEQLTTSLRATFLEGPMLRASIIMDIKALHQAI # ILTLPKDPSSVVGLELAKDPSNERWSLGSDGLLHLDDCIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVCDYVSSCTTCGR # NKPRHHRPYSLLKPLPVPVRPWDSISMDFIEQLPMSNGYTATLVIVDRSSKQAIFIPTFDTITSEQLAELFVIYVFSKHGVPNHVTSDCGSKFVSAFF # WALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSHLLPIAEFAYNNAPNASTGITPFFAKKGYHPNITVWPEVDMKSDLARDFV # INLNELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIQSTRPTEKFSEKYLGPFKVIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g112 ### # start gene g113 7 AUGUSTUS gene 451712 454164 0.44 - . g113 7 AUGUSTUS transcript 451712 454164 0.44 - . g113.t1 7 AUGUSTUS stop_codon 451712 451714 . - 0 transcript_id "g113.t1"; gene_id "g113"; 7 AUGUSTUS CDS 451712 453366 0.97 - 2 transcript_id "g113.t1"; gene_id "g113"; 7 AUGUSTUS CDS 453508 453527 0.96 - 1 transcript_id "g113.t1"; gene_id "g113"; 7 AUGUSTUS CDS 453599 453942 0.53 - 0 transcript_id "g113.t1"; gene_id "g113"; 7 AUGUSTUS CDS 454015 454164 0.69 - 0 transcript_id "g113.t1"; gene_id "g113"; 7 AUGUSTUS start_codon 454162 454164 . - 0 transcript_id "g113.t1"; gene_id "g113"; # protein sequence = [MKETENIQKYKIWFNTLAASTNWDSAALKWAYGRGLAEHIKDEMVRLPEPKHEAGKPFIARNPKKGSSDFKAGPTNQQ # NNSQPSGSSAPFMPKPKPFSGGKPNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKQKAREKLVHSSSVLAE # PISALLEFPTVVDSGSTDSFINTCYVSQNSIPTTKISPVNLHLFDGSLSSKPITNMANITIWFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLI # DWASRNITFRNTSPQTSVPSATNTVDAKVVVPLPEPLLLVSLTILETPPGDSPRSRSRSCSWMLRVKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDI # ALVSAAVFNRACKDAGMEPILLRAIHSEVAARAAGCSSTAPTVPPLPHSIPAEYAEFADIFDEIAADALPEHRPYDLKIDLEEGASPPLGQIYPLSEK # ELVALKDFIDKQLATGAITPSSLPHGAPVLFVPKKDGKLRFCVDFRSLNCITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTT # FWTLYGSYEWKVMPFGLTNAPAAFQCFVHDIFSDMLDVCVIVYLDDILIYSDMPEEHQEHVKEVLRRLRKHWLYANPDKCEFNMDTVEYLGYILSPDG # LTMSKEKVQTILEWPVPRKVKDIQSFLGFANFYCRFIYDYSDIIVPMTRLTQKGAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g113 ### # start gene g114 7 AUGUSTUS gene 454261 455193 0.96 - . g114 7 AUGUSTUS transcript 454261 455193 0.96 - . g114.t1 7 AUGUSTUS stop_codon 454261 454263 . - 0 transcript_id "g114.t1"; gene_id "g114"; 7 AUGUSTUS CDS 454261 455193 0.96 - 0 transcript_id "g114.t1"; gene_id "g114"; 7 AUGUSTUS start_codon 455191 455193 . - 0 transcript_id "g114.t1"; gene_id "g114"; # protein sequence = [MPPRTQAQFRANSKENTFFTTAQSFAPFSESISAIGQPCCHNRGFGPATVPTMSTLPETMEEDQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPAWGRSTTRIESPILQAIAHRTGKQPQRRATSESPRDPPPHFDLDTGDHDDQDPPVNPDDPGADNDNLDDDSGGLPHGESGNP # SGPGGPGGPGGPGGLGGPRSPISPDIPNEQRAMLELLLGFKGSIETLGSILATLGQPSDNSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDCPKY # FTDQQKVNYTLSYLSGSAKEWFVPDILDLDLDLLPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g114 ### # start gene g115 7 AUGUSTUS gene 470200 471317 0.26 - . g115 7 AUGUSTUS transcript 470200 471317 0.26 - . g115.t1 7 AUGUSTUS stop_codon 470200 470202 . - 0 transcript_id "g115.t1"; gene_id "g115"; 7 AUGUSTUS CDS 470200 471026 0.62 - 2 transcript_id "g115.t1"; gene_id "g115"; 7 AUGUSTUS CDS 471128 471317 0.26 - 0 transcript_id "g115.t1"; gene_id "g115"; 7 AUGUSTUS start_codon 471315 471317 . - 0 transcript_id "g115.t1"; gene_id "g115"; # protein sequence = [MTATAAASKELNYMFANIEDNKLVEDPDDPMFDYGGPGDNFTSFITPIRKQRPQIHRKWVLLVQCPPVEYKTGYWRVW # VSGPLPAPVPPIDPVSISVFIVPRSQYAQLNEARDKLTDLRVKNIFQRPQKAPSKGATASTFINDHKSNPIAIGRPKQDDFYHVPISLFHAEFAQFKE # DIVSGALDQELSPLAYRWSKELSGFFEDENKRESKFHELLSDLLDGYKVVKKRIDSFETDGGIDPKDSDLPDLLVKPLLVEVKIEFTQGSCDAVFEIV # LYDQEGVRHILSNDKYKGDWRKTRIPSVLVIHNGMSRTEPLLLVCLIPACHRPQCSGSRCCLSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g115 ### # start gene g116 7 AUGUSTUS gene 480780 481628 0.55 + . g116 7 AUGUSTUS transcript 480780 481628 0.55 + . g116.t1 7 AUGUSTUS start_codon 480780 480782 . + 0 transcript_id "g116.t1"; gene_id "g116"; 7 AUGUSTUS CDS 480780 481628 0.55 + 0 transcript_id "g116.t1"; gene_id "g116"; 7 AUGUSTUS stop_codon 481626 481628 . + 0 transcript_id "g116.t1"; gene_id "g116"; # protein sequence = [MPSPASEISSRKRSNSSSFVKRKRLRVDQNLVEHPLPTVGRTVAVTASPIRTRNLSTSFTRPHHIIANIGRKQSQKAQ # ITYRPPLAELPLKNYRASPYSSSNLPEQTNILEHVPRPETPVIIPQTPFIKSSDLISQFRQGYVQPPLKQVTERSPTVSIADASSSHLPSSPYVSTNS # VQIGPRVQARRTIGSKSKFKPAINVLAHASRLQNAVAVHTPSRPTTFSKTNTALAAAPILFTPTPLAIASTTDVEPISTNTNLELDITPLAPPTLRQR # RSPFVSEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g116 ### # start gene g117 7 AUGUSTUS gene 483650 484472 0.25 - . g117 7 AUGUSTUS transcript 483650 484472 0.25 - . g117.t1 7 AUGUSTUS stop_codon 483650 483652 . - 0 transcript_id "g117.t1"; gene_id "g117"; 7 AUGUSTUS CDS 483650 483878 0.8 - 1 transcript_id "g117.t1"; gene_id "g117"; 7 AUGUSTUS CDS 483976 484472 0.31 - 0 transcript_id "g117.t1"; gene_id "g117"; 7 AUGUSTUS start_codon 484470 484472 . - 0 transcript_id "g117.t1"; gene_id "g117"; # protein sequence = [MVCTYWLNYCFFWRSPDYILHSPVVLHSDHCAEKLLPWFDGMLEADEAYYKEHGEPLFSSHMLDLSEEPKEQNIATCV # KYFKRMAPMGIWLEMEIGITGGEEDGVDNTSVDNSRLYTQPEDIWDVYSALSAIAPHFSIAAGFGNVHGVYKPGNVKLQPTLLGKHQAYLVFHGGSGS # TKEEIKTAVESGVVKMNVDTDTQWAYLVGIRVCESLSKYFASKVDIHAFLFRTLSPTNLDTFKVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g117 ### # start gene g118 7 AUGUSTUS gene 488466 488828 0.7 - . g118 7 AUGUSTUS transcript 488466 488828 0.7 - . g118.t1 7 AUGUSTUS stop_codon 488466 488468 . - 0 transcript_id "g118.t1"; gene_id "g118"; 7 AUGUSTUS CDS 488466 488828 0.7 - 0 transcript_id "g118.t1"; gene_id "g118"; 7 AUGUSTUS start_codon 488826 488828 . - 0 transcript_id "g118.t1"; gene_id "g118"; # protein sequence = [MPTNVQDSSPPENSSVSQSEIASSDSEQPNLLSVGMIELHTNSQNDSNHYMPTNVQDSSLPESPSVPESQIARITANV # LVGTRIVRPHLIELDGQKHLVFVFSVSYKASSMSRPEIQAFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g118 ### # start gene g119 7 AUGUSTUS gene 498687 499347 0.32 - . g119 7 AUGUSTUS transcript 498687 499347 0.32 - . g119.t1 7 AUGUSTUS stop_codon 498687 498689 . - 0 transcript_id "g119.t1"; gene_id "g119"; 7 AUGUSTUS CDS 498687 498926 0.79 - 0 transcript_id "g119.t1"; gene_id "g119"; 7 AUGUSTUS CDS 499093 499347 0.32 - 0 transcript_id "g119.t1"; gene_id "g119"; 7 AUGUSTUS start_codon 499345 499347 . - 0 transcript_id "g119.t1"; gene_id "g119"; # protein sequence = [MFWFDVSRCSKVPPALTSCSGSAELERDTTGPIVFLASSATDRIPISLQHLGCVTYAEHVCMCCRFYCADCGFIVEYY # GLFSVITKYEDQLHNPDIITPETQLQIVLKDEMYGTGMYIGTCHGSATGIESVNLFSAFSLQLGMLIDFALSYGLRSFELPQMATE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g119 ### # start gene g120 7 AUGUSTUS gene 513692 514390 0.92 - . g120 7 AUGUSTUS transcript 513692 514390 0.92 - . g120.t1 7 AUGUSTUS stop_codon 513692 513694 . - 0 transcript_id "g120.t1"; gene_id "g120"; 7 AUGUSTUS CDS 513692 514178 0.92 - 1 transcript_id "g120.t1"; gene_id "g120"; 7 AUGUSTUS CDS 514257 514390 1 - 0 transcript_id "g120.t1"; gene_id "g120"; 7 AUGUSTUS start_codon 514388 514390 . - 0 transcript_id "g120.t1"; gene_id "g120"; # protein sequence = [MPTVVFKAKSTTELLDIRAREQPNDPAIYTGIPEPDGSLKLRSLTAVDRIAWYYSSLGIAPKVVAGETPPTRTIAVFV # TSSVDETLLELALAKMGLTALLLSVNNSVAAVAHLSKITNATHLIYSPKFVEEAKEAQALLKRQGVEIGIIEDMRFPLWGPQGAAKSAIKPFFPVLTP # DQEVSRPAIYLHSSGSVGYCVFVFMKTLIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g120 ### # start gene g121 7 AUGUSTUS gene 519759 520088 0.59 + . g121 7 AUGUSTUS transcript 519759 520088 0.59 + . g121.t1 7 AUGUSTUS start_codon 519759 519761 . + 0 transcript_id "g121.t1"; gene_id "g121"; 7 AUGUSTUS CDS 519759 520088 0.59 + 0 transcript_id "g121.t1"; gene_id "g121"; 7 AUGUSTUS stop_codon 520086 520088 . + 0 transcript_id "g121.t1"; gene_id "g121"; # protein sequence = [MSIHGIQNGGPEGHLSATISFRAASVALSTIITSDFGSDPVARGPNPKNSRNRSTGASQSEGNDSIPSTPSTTSHSRV # DVESQPHPEPTMKSESSTESVKEGKKRVQYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g121 ### # start gene g122 7 AUGUSTUS gene 522219 523150 0.33 - . g122 7 AUGUSTUS transcript 522219 523150 0.33 - . g122.t1 7 AUGUSTUS stop_codon 522219 522221 . - 0 transcript_id "g122.t1"; gene_id "g122"; 7 AUGUSTUS CDS 522219 522577 0.52 - 2 transcript_id "g122.t1"; gene_id "g122"; 7 AUGUSTUS CDS 522633 522757 0.39 - 1 transcript_id "g122.t1"; gene_id "g122"; 7 AUGUSTUS CDS 522816 523150 0.35 - 0 transcript_id "g122.t1"; gene_id "g122"; 7 AUGUSTUS start_codon 523148 523150 . - 0 transcript_id "g122.t1"; gene_id "g122"; # protein sequence = [MAPTALMSSDSTTSTHINGIKELKQSTQSAQSKALIDFQLQRKTAGRPQLNPNPVIREQFSFDSIEDALQAYKEGEFL # VVMDDENRENEGDLIIAGCHCTTEKMAWMIRHTSGFICVSLPGERLAELDLPMMVSEENQDPHRTAYTISTDYRHGTTTGISAHDRALTAFALSSSSS # VSSDFTRPGHVMPLRTRSGGVLTRRGHTEAGVDLCKLTGLPEAGALCELVNDLDEDINGGMMRRDQCREFADKWGVKMISIEMLAEYRRKLEQVKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g122 ### # start gene g123 7 AUGUSTUS gene 529495 530910 0.58 - . g123 7 AUGUSTUS transcript 529495 530910 0.58 - . g123.t1 7 AUGUSTUS stop_codon 529495 529497 . - 0 transcript_id "g123.t1"; gene_id "g123"; 7 AUGUSTUS CDS 529495 530014 0.78 - 1 transcript_id "g123.t1"; gene_id "g123"; 7 AUGUSTUS CDS 530066 530099 0.7 - 2 transcript_id "g123.t1"; gene_id "g123"; 7 AUGUSTUS CDS 530168 530399 0.66 - 0 transcript_id "g123.t1"; gene_id "g123"; 7 AUGUSTUS CDS 530488 530910 0.97 - 0 transcript_id "g123.t1"; gene_id "g123"; 7 AUGUSTUS start_codon 530908 530910 . - 0 transcript_id "g123.t1"; gene_id "g123"; # protein sequence = [MPFEAISLPNKPVAIQFGAGNIGRGFIGAVLSQAGFHVVFADVQEKIVNALNEKGHYDVHILNGDTQIERIQPVSAVI # STDLKAIEKIAREPLSIITTAVGPSTSLLILSCCTFQPLFTRYFTSAGEAYRANNPNKKGGGHNATDKLREAIESELSDEQERLYLQDNIGFAICSVD # RIVPPFSSENILDVGVEPFFEWTVDSNSLKKTDPDVVIDGMHDAYVQRKLFTLNTGHAITAYLGFLDKKDTILDAISDDSIHNVVSKALHESGAALIA # KHHSFFSKEQHEDYIKKILKRFSNHNLKDEVSRVGREPLRKLRRGDRLLGPVEMCRERNLEHDTLLLGISAALLFHPTGVHEDEEANELQDRIRREGI # EAVVADLTGWEKEDEDLRKVIREYYRMKKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g123 ### # start gene g124 7 AUGUSTUS gene 535927 543867 1 - . g124 7 AUGUSTUS transcript 535927 543867 1 - . g124.t1 7 AUGUSTUS stop_codon 535927 535929 . - 0 transcript_id "g124.t1"; gene_id "g124"; 7 AUGUSTUS CDS 535927 543867 1 - 0 transcript_id "g124.t1"; gene_id "g124"; 7 AUGUSTUS start_codon 543865 543867 . - 0 transcript_id "g124.t1"; gene_id "g124"; # protein sequence = [MSKNSNHYNLRRGPSNYRRNDKEHSTINNDGHRSAGLANSQTTFQNIATSDEESNAGTVTGDRQENYNADSSESEHEE # NPNPWVKVGPRRRAVSLDSARSQNEYQLRPAQFTAKKQREAKKPPVMTIAQGALIREAEKKLSQAERKAIRHRMKIIGQSPAQGDNGTDSSLSDGERP # SNDKGKGVDPKNWGNINLPNNEVDIDQQRAVLENFVALHEAQQQAKVATEPEPLTKKPKKPSKKSKQSKNRAGSEALTDLIESHVRDIVEQRPRKTRT # LSNRLNKSDPAQYVMRPSDMLAPTNHLSKLLTPAKKKKRAVEHRHRKHHSEPSEPSSSSSSSESSSSESETSSDTDSTSSESDSSDGHGSQKRRKHSK # RRRPHKKSTRMILKPDPPEDYDGATDVGSYIKFVTEGTAYVRDGRVPKNRRVLKLSKYLTGKAYQFYLTTVANSPFDWRLKKFFTELYNYCFPLTFRM # DQRKKLKRCFQNGKPVRDHLSELNEFFNTIGMIDEREKVHKLWSSLDKKIQKGLWSEKLNPEFSSYKEIASKAELVELIENVDLTNESNKSKTDRTEK # SKSGKMNRNNENRNSGPSLSGKKFGNKSHQKNNSTYRRSNGTNSGKHGLQGSKPSNPKPRTQHRELSDKEKDEYRAAGRCFRCGGQGHMARQCPDGKT # VPSSSNGPPGFASHHISLDLDVESLQALAETTEEITELGLGMMNIDSADYESYPSDSNEFYQTNPGPECSSEQLEYIPPKAGPKYRHPWLYHELDHPN # YGYTSHSLPSCIDDILAQRAMYLLDTAGPYPTDTDKAKNNRGRFFVYAIDCKNYCISDSNYFGIDHPEYENFEWVYIPRIQLEDPKFPLPYYYAVERA # KMERKYIRPHRLDVFKTYHMHDAYAEGIEKWLSRIDYLPGNTPSDTLNDDPRFTARRLNSENYQIFDTYREFQTLLPLKYLRNVHFDLSRWYQKQLSR # GYRDLREILERLSTDSEPLHGCLYDPIEQTDLQEQLDSLHHQFPIQLNGVQIPRGTYPAIQRNAAITKDFSRRIPKPLVVVVKINGHPARALIDTGSL # GDFISSTFADQLGAQKLELTKPIPLQLAVQGSRSKINWGVKTQFQYQGISEQRYFDVANLSSYDIILGTPFLFQHKVMAGFNEPRIIIGSNESLPVQG # ENVSKLSSRAMDLFQDRIDTVRKELTDYAKPLCRSMAETDLPPLRAINHTIPLIDESKILPWRPSKCPEKFRAQWSEKRDAYLKSGRWKMTSSGNTVP # MMLIPKPGSTKMRVVVDLRARNANTRKLSSPMPDIEGIKRRVARAKFCSIIDGKDAYEQIRIIPEHVPRSAVTTPDGNMVSLVIQQGDCNAPATYQAL # MNYLFSEYIGRFMDVYLDDIVIYSESLEDHIKHVKFIIDILKREKLYLSEEKLNFMPKEFKVLGCIIDDKGIRMDPHKVDAIVRWPTPTNRDLLRGFL # GSVGYLADDIAQVRIPMGHLSAITGDTVPFRWTYIEQRAFENVKQLANGAKDHHRVPLDYSEGAPPVWMITDGSATGIGGAICQGPSWRNARAAAFYS # AKLNSAQQNYPVHEIEMLAGVETMLRHRDILQGVDFTWITDHKGLEHLVKQKDLSGRQARWLEKISEFNYKVEYVPGIENVLADALSRLYSNDRPGTV # RARSEYTYHDVVDNDTLFSHNITMPVHVDIEAAGAIPELFAMTTRNTGKRVETSWEFARRMKNKRFVLHGPREQRKEGGSIPQTDTLPNESPNLDRDS # GENMPEKTAQNDLPESWPEKEKTPEVSTDMSLIAALAASRSKLDLEFVLRNQYKNDTMFKKIIEKPKEFRNFEIVNGLVYLKMQDRKVLCIPMVTVNG # RNVRESIIDEAHSLLAHLGAKKTIDYLRDYVWWKDLVPDVNTYCETCKTCKRTKPNNTRPYGLLNPLPVPSYPWESMALDFVGPLPESKDRNGTYDMI # TVVIDLLTGMVHLVPSKTTYKAKQIAELVFSEIYKHHGLPKNIISDRDSYFTSTFWTHLHNLIGTKLKMSSAYHPETDGSTERANRTVTQMLRQCVAI # DQKDWVIKLPAVEFAINSARSETTGFSPFFLNTGRMPRSFLWNAADKNEYPGIRVYAQRMKQAIMQAHDSILAARVKQTRDANRRRRLAPFKEGDLAY # ISTQNITFPKGYARKLVPKFIGPYKILKDFGNSTYKMDLPNRLKQRGVHDAFHASLLRIHIPNDDRLFPGRLETQVADFGETEGEWAVDRILAHSGTR # MNSLFQIKWKSGDITWLSYHQINHLDALGDYFEAIGISDISELTSGGRENVPDPNLGPNLGMNSAPAAMISLMRLALDLDEESAGSDQEKDLKGTEKS # SYHPSNMSDTQTSPAIYSPPYIQRVREDKVLLRSSIGVNYTTTPKEFVQCLETDIKLRKPNASVRRIDVPMAYSYIAGKLNSDANIHPQKMAEFNPAS # GIITVAGPIIDRRMFHHITSGADAPNAVVEALGLANLAQRDQVLYAELLRERAMRPMSDAPSSYHTEKANGRKGKPFNPAHVRRKNGTWKPNLNAPSP # SSSSTSSSRSHTPAANLPQVTTTQSDTSNLDPASQAGTLHSGPQIVSAPQASSSDMTLAITDDFFKSLSIPYENSAPLTAPTPVNFDILFEAPPIEAD # SLPGPSSSVKNANEGDVAMN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g124 ### # start gene g125 7 AUGUSTUS gene 544856 546510 0.25 + . g125 7 AUGUSTUS transcript 544856 546510 0.25 + . g125.t1 7 AUGUSTUS start_codon 544856 544858 . + 0 transcript_id "g125.t1"; gene_id "g125"; 7 AUGUSTUS CDS 544856 545233 0.82 + 0 transcript_id "g125.t1"; gene_id "g125"; 7 AUGUSTUS CDS 545377 545555 0.25 + 0 transcript_id "g125.t1"; gene_id "g125"; 7 AUGUSTUS CDS 545616 546510 0.94 + 1 transcript_id "g125.t1"; gene_id "g125"; 7 AUGUSTUS stop_codon 546508 546510 . + 0 transcript_id "g125.t1"; gene_id "g125"; # protein sequence = [MVQFTDALFLALLAATTRAAPLSLNKRIAQTTIDSVTPWEDACVRFILIDVSSIDEFSPCILQNSAGGGSQCNPIAVT # AASTLLAAAGNCDQQNSADAMITLAKTLNNNADMISLAQVFAQQPRNSFQGSDQTSFVGGLSVGDAGTIPFGLSAAVNPAGSCPANPSGPVADGQQLN # TITQNPGTPSSGSTASGSTGSTASSASVAPAAASSAASSSSSTSDNDGSGAAVGASASSSSTSTAGTTTSSSTSTSSGFALSNGQAAQALNAQFATLT # ASSTCTDGQNACVNGAFAQCVGGKFETTQCAGGTTCAALPLVNSAGTSITCTTTADAEARIAATGATGGITGDGSTAAASSAGSDTSATDSAAVSTST # AAASTNQAAAAPSSTSSFALSNGQAAQKLNAQFATLTASSSCTEGQNACVNGAFAQCVNGSFETTQCAGGTTCAALPLVNSAGTSITCATTADAEARI # AATGATGGLTGSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g125 ### # start gene g126 7 AUGUSTUS gene 548123 549441 0.26 + . g126 7 AUGUSTUS transcript 548123 549441 0.26 + . g126.t1 7 AUGUSTUS start_codon 548123 548125 . + 0 transcript_id "g126.t1"; gene_id "g126"; 7 AUGUSTUS CDS 548123 548559 0.29 + 0 transcript_id "g126.t1"; gene_id "g126"; 7 AUGUSTUS CDS 548685 549441 0.61 + 1 transcript_id "g126.t1"; gene_id "g126"; 7 AUGUSTUS stop_codon 549439 549441 . + 0 transcript_id "g126.t1"; gene_id "g126"; # protein sequence = [MSHKGTTFDTDQTLRTKKLRGNGQLAQDLGSSGFASKHVKQSHKPSIGSRSSKERVERGSPSGSKHKKPVEDYNEEPD # ELDFLSGMDSENELDTKSSMPLVSSQLSTHDPEHQLARSNTLKGLKFNKNKSENDNASIPSKPRGPSSKPSVEKASSRSVLRVVGSSSSSDKDDARSI # RRTKGERKGLERSTPAEPLPSKKARPRPKPLPAKSSSSSVSSALLKPPVGKLQPAPPADLPVSLSPEHTPRMNPKSLLSKPERFPLAASPERENTPKN # HKSLLNVRPAAFPLSPSLSGRRKDVQKKSASNQYELMRQDSDDDEALSKTKTNAVSKAAPFPLNSPYPKSMISIPNKSVGKRSSNVSPQEDDSPLKRQ # RRDDDMYVVLISMAVLSHGSIQRLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g126 ### # start gene g127 7 AUGUSTUS gene 550352 551437 0.46 + . g127 7 AUGUSTUS transcript 550352 551437 0.46 + . g127.t1 7 AUGUSTUS start_codon 550352 550354 . + 0 transcript_id "g127.t1"; gene_id "g127"; 7 AUGUSTUS CDS 550352 551437 0.46 + 0 transcript_id "g127.t1"; gene_id "g127"; 7 AUGUSTUS stop_codon 551435 551437 . + 0 transcript_id "g127.t1"; gene_id "g127"; # protein sequence = [MFPEDAGERVEGASAKLYTKGKRKGKGKEKAKETERYHSEDTEIETTEMSVADKMVREKARRRRLELEKETEQEEMIH # QEQTKRHRKGKSKRKNPVVQTPSPQNPKPKPRPKPKAIQKNASSASLAGMDVGSEPEAGWRSTFSDGPAEYSDNNGMDMEASDVDASNELVNWALDDP # ANMDAFFLTTENNRSPPNSISGLSFSSKLRDVGFPPSSSSSKPDSAGSTSHTMIISSSEDSDSNIRTRKSRKQTRKMFTRTRSPSIEISSPDTKPISV # LARPPPSSFDMDDTPKASRSQLSLFPVVPSTSFSRRNGGGAVDRNSGGTHNTDSDVVLNRWHNDPDSAPLAFIRQSRSRPNVQKAPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g127 ### # start gene g128 7 AUGUSTUS gene 553084 554131 0.66 + . g128 7 AUGUSTUS transcript 553084 554131 0.66 + . g128.t1 7 AUGUSTUS start_codon 553084 553086 . + 0 transcript_id "g128.t1"; gene_id "g128"; 7 AUGUSTUS CDS 553084 553600 0.66 + 0 transcript_id "g128.t1"; gene_id "g128"; 7 AUGUSTUS CDS 553678 553838 1 + 2 transcript_id "g128.t1"; gene_id "g128"; 7 AUGUSTUS CDS 553913 554131 1 + 0 transcript_id "g128.t1"; gene_id "g128"; 7 AUGUSTUS stop_codon 554129 554131 . + 0 transcript_id "g128.t1"; gene_id "g128"; # protein sequence = [MYNRSDGLRASHSLNTSLPLTPESDLVMKFSTILSCSALIFSSAARALPRGFSDHVSRRSNPSSRIEGPQPQTAGTSS # NATIQYSGNWSGAVLVSPPTGETFNSAVGTFTVPSMPSVNGDGAAAAWVGIDGDTFATAILQAGVFFSVTDETVEYGAWYVFFSKNTYGSDYAQDYAT # DIDTDDFPVSAGDVITVNIDASSNSEGSVTLTNESAGKTFVINLTSPTKLNAEWIIEDYTQNGGLVPLANWGTVTFVNASASTSANNTLGLEEATIFD # IEQYNDIMTFVTIESDSSVSISYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g128 ### # start gene g129 7 AUGUSTUS gene 554639 556152 0.92 - . g129 7 AUGUSTUS transcript 554639 556152 0.92 - . g129.t1 7 AUGUSTUS stop_codon 554639 554641 . - 0 transcript_id "g129.t1"; gene_id "g129"; 7 AUGUSTUS CDS 554639 555459 0.97 - 2 transcript_id "g129.t1"; gene_id "g129"; 7 AUGUSTUS CDS 556038 556152 0.97 - 0 transcript_id "g129.t1"; gene_id "g129"; 7 AUGUSTUS start_codon 556150 556152 . - 0 transcript_id "g129.t1"; gene_id "g129"; # protein sequence = [MHRIRTDTSCILAWLIEQGYEVYAFMADVGQEEVSFKLXFYHRFAGRKDLLAYAAEKSIPVTQTTAKPWSTDENLFHI # SYEAGILEDPNTTPPVDMWKLTTSPENAPQTPEQITIEFKAGLPVKVIVPDSSKTHTDPVDIFLALNTLGRKHGIGRIDIVENRFIGVKSRGCYESPG # ATILRAAHIDLEGLTLDRNVRALRDQFVTIEFSKILYNGHFFTPEREFITAAIPASQRTVNGVVKLKLYKGNVIIEGRESSEVCIVLRKFLIGPVLIC # FLQGLYDEQQASMDELGGFEPSDTTGFIAIESIRIKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g129 ### # start gene g130 7 AUGUSTUS gene 556415 557017 0.5 + . g130 7 AUGUSTUS transcript 556415 557017 0.5 + . g130.t1 7 AUGUSTUS start_codon 556415 556417 . + 0 transcript_id "g130.t1"; gene_id "g130"; 7 AUGUSTUS CDS 556415 557017 0.5 + 0 transcript_id "g130.t1"; gene_id "g130"; 7 AUGUSTUS stop_codon 557015 557017 . + 0 transcript_id "g130.t1"; gene_id "g130"; # protein sequence = [MDSARRNPSSSNHSTSRRSRNPHAPRRGPEELLSNSMNAFITSQRSKSRSPSRAVRNDPFAALNASMTTVKGYSSGNR # SSKSSGSASVRQSTSSYDSDMITDSGQRLRSNVTIAAFQRPNGSRPTTPAAPNLQKKDKGKERQSKSHGSTDASFSGPIAVAEFERMRIEIETLKSTL # NDHKKNARKQAKVTFIFIYCTYPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g130 ### # start gene g131 7 AUGUSTUS gene 557390 558286 0.82 + . g131 7 AUGUSTUS transcript 557390 558286 0.82 + . g131.t1 7 AUGUSTUS start_codon 557390 557392 . + 0 transcript_id "g131.t1"; gene_id "g131"; 7 AUGUSTUS CDS 557390 558286 0.82 + 0 transcript_id "g131.t1"; gene_id "g131"; 7 AUGUSTUS stop_codon 558284 558286 . + 0 transcript_id "g131.t1"; gene_id "g131"; # protein sequence = [MDLDIDDPDYVMYRQKSCPACRAVVLGRPLPVYPVRDLISALQKAKVSGNAAATVSTRRSSSPYVSEDPWEGLFPDND # EDEEDEEEDGLEVGAMPFGFLYSESDSEMEMHDDDSEYDSNGEPEEEEDNSAIDEEEEGESGEDVEGEGYSEGDEDYYVSPQWEPPCYPYPGNVAPGP # QSQLVRRGCPPWLSSTYRIRYSHNNGLVGHLNSLDPDDVGAPPRGPTSRMHRLFLGWNIRNIDDQSSELSQRFFMAQILEDFRNEPYKFSIHQRANGC # LDVRVLVPADEVTQYYSTESEGWD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g131 ### # start gene g132 7 AUGUSTUS gene 562700 564253 0.55 + . g132 7 AUGUSTUS transcript 562700 564253 0.55 + . g132.t1 7 AUGUSTUS start_codon 562700 562702 . + 0 transcript_id "g132.t1"; gene_id "g132"; 7 AUGUSTUS CDS 562700 564253 0.55 + 0 transcript_id "g132.t1"; gene_id "g132"; 7 AUGUSTUS stop_codon 564251 564253 . + 0 transcript_id "g132.t1"; gene_id "g132"; # protein sequence = [MDLPNSSLPTLAIIAPTPRAFTFPTSHNLDISPYSTPSNSPFEPDLNNPFGIPSPTSSYLSTPSPLNRTLSPDSSVSV # CSPRSDSLDAERRPRKGDKDYIKRPENAFMLFRRKCCEDGQQVEEESNGATTRKKQRQADLSKAISRKWKSLSKNDRQYWEDLAKEKKKVHQEKYPGY # VFRPQRVRDKDGRARNKKYTKRNRAAKRKQGEADIERETAYLVPFPGRSTSASGTIPAMSYHTVHIPVISTISPHPSSASSSSLPMPQISQTFSGTVG # NITSNFEYLPSPNSMLHSERGLQVMSQSTSWTAGAQADALHRQSSELMRSLFNLPAHETPDSTTRSVARLQMPSSPLSSAASSPISGPFTPSSDPLDQ # SSYNNAQLYPSTFNPAETCGSDHTPWVPMPADIQAGLIPQPDAVQNYSPWESHNSIWQTESSMLAGDDFDLQIIPPIELSQSSQSMMMMPEYGDGAAF # GIAPSATLNNFALYDFPQEYFLPVDRFAMNEDSSPHFAIEDECMPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g132 ### # start gene g133 7 AUGUSTUS gene 565528 567088 0.32 + . g133 7 AUGUSTUS transcript 565528 567088 0.32 + . g133.t1 7 AUGUSTUS start_codon 565528 565530 . + 0 transcript_id "g133.t1"; gene_id "g133"; 7 AUGUSTUS CDS 565528 566331 0.52 + 0 transcript_id "g133.t1"; gene_id "g133"; 7 AUGUSTUS CDS 567065 567088 0.57 + 0 transcript_id "g133.t1"; gene_id "g133"; 7 AUGUSTUS stop_codon 567086 567088 . + 0 transcript_id "g133.t1"; gene_id "g133"; # protein sequence = [MSPSRLVDELGVLLQALQLPLTLKSPTDLTPSLLLAILESILSSRLPLSHNIRNGLLSKSSSSKEAKDAKIQCMKIFL # GVIETDVLKKDVGLNRIDPRKLANGDWDEVVFVGEILCWIGRESGITNAHDDREEPAWRLTPSTAPDISDNSTSHRSTSSVPTADTSHSLHDLDHLRS # FRSLSVPSSPRLSPLVLPRPIRPHCIHEVPSFYALDDVATTTSGSEPSSSSVRYTGHIQPVDEELELSYFENSRHSRTLGNPEDTGLDVSHQSLVGDL # V] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g133 ### # start gene g134 7 AUGUSTUS gene 569447 570301 0.39 - . g134 7 AUGUSTUS transcript 569447 570301 0.39 - . g134.t1 7 AUGUSTUS stop_codon 569447 569449 . - 0 transcript_id "g134.t1"; gene_id "g134"; 7 AUGUSTUS CDS 569447 570301 0.39 - 0 transcript_id "g134.t1"; gene_id "g134"; 7 AUGUSTUS start_codon 570299 570301 . - 0 transcript_id "g134.t1"; gene_id "g134"; # protein sequence = [MTEFQGMFSKTVIIKLEDESEWVVQLRDNEIDTTKVALARSKLGDVVPFVHRASPLKAHFAFIAPFVHGKVWCKKDKE # LSGAERVSIATQLGGMLARCAINEDSSAMIDSYVIPRLRYILDHSFVDGTHPQLRARIEDLANQAPSTHVLPLAVIHEDVNSMNIILDDESNGIAALI # DWEAASLLPLGSNAWCIRFLATVNRNRIDYETDDTLPMTRGFWTGLVDSLPLHLKGRKDVLEALLSAMQIGLVMFIFWPGYDVIDNADMEQSLKRLNW # FEDTLRPMVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g134 ### # start gene g135 7 AUGUSTUS gene 571135 573794 0.44 + . g135 7 AUGUSTUS transcript 571135 573794 0.44 + . g135.t1 7 AUGUSTUS start_codon 571135 571137 . + 0 transcript_id "g135.t1"; gene_id "g135"; 7 AUGUSTUS CDS 571135 572493 0.45 + 0 transcript_id "g135.t1"; gene_id "g135"; 7 AUGUSTUS CDS 572601 573794 0.98 + 0 transcript_id "g135.t1"; gene_id "g135"; 7 AUGUSTUS stop_codon 573792 573794 . + 0 transcript_id "g135.t1"; gene_id "g135"; # protein sequence = [MSVPDELRNVLEQCLAEDATPENLEVYLPNVRLIITGLLQGLRNKQSLYRHLVSDHKHRSDQSGGDRVQSRSTRSSKS # HRKQPSKGPAENERDSISRRSAASSSSRRRDTSSSQAADSEASFVGGFSPMISEAPSIPDPNDLPNPYDSRQLSSSDYPTTRSPPPQTVSPPPPASTV # PANVKRYSLVDKPIPSPPTVVVVEPASPDPERNGIQQPQPQTNGFPPPPPPPPDSPPLDASQVPAMASSLAALQKSDALERRASKRFSTYNITKMTGA # VGRDRSLRNQSNRRSLAVSSALTPGELAVLTEVDDEEESSPVASLKREGSFRSRAATPETRISTPPVPPLPSTPSRTPEASPSPGSTSAHRSDSNIKR # GSDSKMTVFLQLGREVKKASLEPGISSSSLRMLFVDKFSYNPGQENFPAIYIRDPSSGVQYELEDTDEVKEKCLLSLNIERDIKELRSAVASNQRHSQ # IPNIVSSPIAESTPAPSRPTDRQFQTVARRLSRFVSSANEISASSARPASPNPILPQMTGSTLQAQMTGGSIISEYSTRVVSDLKTQFDEVQNLRRDL # GIMRQLYIEFMKQTKESLGTLRTQTQSVKQLATANVGGSRAFIDSGKQKLDVRTQNVLTEVERLQDTVEALKDDVLKRHITPKALQLKAVKKDMDTVA # VELESLKEHIKTVKPMWKKTWAEELQNIVEEQQFLTHQEEFLGDLLEDHKGVLEIYGHVEQVINLRSAGSGRRLNGRGFKPPAPEESTQSLSNVMMEI # RTASVDPEKRMKAIEASHKNRQKELANRGDEMLGELTDFVAGKKLKMTGGAEEAERVRQKRNDMTLKAMFTGSSAADISPMGGDVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g135 ### # start gene g136 7 AUGUSTUS gene 575809 576681 0.9 - . g136 7 AUGUSTUS transcript 575809 576681 0.9 - . g136.t1 7 AUGUSTUS stop_codon 575809 575811 . - 0 transcript_id "g136.t1"; gene_id "g136"; 7 AUGUSTUS CDS 575809 576681 0.9 - 0 transcript_id "g136.t1"; gene_id "g136"; 7 AUGUSTUS start_codon 576679 576681 . - 0 transcript_id "g136.t1"; gene_id "g136"; # protein sequence = [MAANFSATDMSITHWQFFTDSASSVDAIFDTSPKPGQIYCSNFYRKIVDFLDSDPSHTVEVAWVPSHVGIHGNERADF # LAKEGTEQKNEAVWNRSLSNARRMNKVRAEREWKKLWEVRPVQGRFAISNQIPPSLKPTARLKDTPRELFGRLMQCRTGHAYTGEYYSQFVPNENVNC # PCGEELQTREHILRACPKYRDHRYILQKASDDICLKDILGTSKGIEALTEFLDESGAFTRTGGRRPTPTEPSYTPLGIWEELEIISHETEEDNITLEA # DWRNEIVDSTDSGTET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g136 ### # start gene g137 7 AUGUSTUS gene 580109 581488 0.46 - . g137 7 AUGUSTUS transcript 580109 581488 0.46 - . g137.t1 7 AUGUSTUS stop_codon 580109 580111 . - 0 transcript_id "g137.t1"; gene_id "g137"; 7 AUGUSTUS CDS 580109 581488 0.46 - 0 transcript_id "g137.t1"; gene_id "g137"; 7 AUGUSTUS start_codon 581486 581488 . - 0 transcript_id "g137.t1"; gene_id "g137"; # protein sequence = [MFAGLPLTRDDSDSRSEKMSASDQRSSPRKPHSPSKRFQINIGKATRRTTRVGSTRRRSSSSSISLSPSKGSKDAEPA # FETEVIPRLPPPLSIGASILPLMSTSSSTESLLPTAFVLPPPSPCASLPPPKPALLLSGASTLPLLMPTFQTSQEQEPSENNKYISQPSLQSHVPPSA # TPTDPVDSVPQTHLAGARRAFPYPVAKPLATHMIHAYSPVRPSPLSRILMLGNSPGSPSNVALDPNSNSRGLEVLMETDELENDFPGDGLLKTELFPP # TPQSRASSDDEGGLTLAQQLGVSESPPESPVYARPESLLREKKVQSNVVRRSHSSKTITNKARIPSSKPTFGVSKPRTSSTVEKGPGMKVKARSMGTL # PVTKNTTRMSDRLTSVGIGGNEKENSSHASGSAESNVNNDKGIAERSSTKSVDANSRKVDFGRGVSGPRRVPIDSAEAPPIGRRRKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g137 ### # start gene g138 7 AUGUSTUS gene 581820 582407 0.38 - . g138 7 AUGUSTUS transcript 581820 582407 0.38 - . g138.t1 7 AUGUSTUS stop_codon 581820 581822 . - 0 transcript_id "g138.t1"; gene_id "g138"; 7 AUGUSTUS CDS 581820 582407 0.38 - 0 transcript_id "g138.t1"; gene_id "g138"; 7 AUGUSTUS start_codon 582405 582407 . - 0 transcript_id "g138.t1"; gene_id "g138"; # protein sequence = [MERWHRISDAQAKLGATASGMRFIGSVNTVVEPVVPIVGRGKSYLEIALEEAEKAREQLSKDNLGLKKMLLKAVNEIR # NIAFEMTPSLREPTNEIEFVSSCNTSLSYRPDFSHWQPVPMTLPDLFPLSPPDFTTMTLSSSLARLRDILGVLSFSTSSMSTSSSVSPAPQPMPSPSE # LEQLHQVIEQLKNELRDYP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g138 ### # start gene g139 7 AUGUSTUS gene 590071 593634 1 - . g139 7 AUGUSTUS transcript 590071 593634 1 - . g139.t1 7 AUGUSTUS stop_codon 590071 590073 . - 0 transcript_id "g139.t1"; gene_id "g139"; 7 AUGUSTUS CDS 590071 593634 1 - 0 transcript_id "g139.t1"; gene_id "g139"; 7 AUGUSTUS start_codon 593632 593634 . - 0 transcript_id "g139.t1"; gene_id "g139"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINPVVAKVAV # PLPEPSPSVSPTIQETPPGDSPRSRSRCRSRTSRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAAGRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGHIYPLSEKELVALKDFIDKQLATGAIIPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKYRLYANPDKCEYNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTQLTQKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRMLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLCLDDRIYVPNHGDLHLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHLEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKCCPLCYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g139 ### # start gene g140 7 AUGUSTUS gene 593967 595658 1 - . g140 7 AUGUSTUS transcript 593967 595658 1 - . g140.t1 7 AUGUSTUS stop_codon 593967 593969 . - 0 transcript_id "g140.t1"; gene_id "g140"; 7 AUGUSTUS CDS 593967 595658 1 - 0 transcript_id "g140.t1"; gene_id "g140"; 7 AUGUSTUS start_codon 595656 595658 . - 0 transcript_id "g140.t1"; gene_id "g140"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSNSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPCRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGVDNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPSGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSSNQHNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSLNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g140 ### # start gene g141 7 AUGUSTUS gene 597139 599301 0.18 + . g141 7 AUGUSTUS transcript 597139 599301 0.18 + . g141.t1 7 AUGUSTUS start_codon 597139 597141 . + 0 transcript_id "g141.t1"; gene_id "g141"; 7 AUGUSTUS CDS 597139 599301 0.18 + 0 transcript_id "g141.t1"; gene_id "g141"; 7 AUGUSTUS stop_codon 599299 599301 . + 0 transcript_id "g141.t1"; gene_id "g141"; # protein sequence = [MGYAQPASSPMGGFTYSPTWGTRGPPPGPVPQLDMESASNAGGRVSGQVAAIKRIQGGSTDPLTVRQQEKLPERRVSP # AVSEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGI # EILGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLKLLEAEARYGRSFRNSRGILPFLPHTHGREKEFCGEAGLC # ILYRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTP # MRHMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRCRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQ # KHSSPRNIEVPELLNPGNTATRSPQLRSGTSPTVHALAQNSTPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRL # SNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAPFGTPFVTGAQMNRPGMAFESAHSQELVAMIQQQARVIEMLQEQLREVKKGFT # AGEVLTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQATEPISFN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g141 ### # start gene g142 7 AUGUSTUS gene 602723 604003 0.84 + . g142 7 AUGUSTUS transcript 602723 604003 0.84 + . g142.t1 7 AUGUSTUS start_codon 602723 602725 . + 0 transcript_id "g142.t1"; gene_id "g142"; 7 AUGUSTUS CDS 602723 604003 0.84 + 0 transcript_id "g142.t1"; gene_id "g142"; 7 AUGUSTUS stop_codon 604001 604003 . + 0 transcript_id "g142.t1"; gene_id "g142"; # protein sequence = [MSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKIMKKNRYPLPLIGTLVDQLRKAKI # FTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEASHVGHVRKVLERLRANHLH # AKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTSQCSSAFELLKSAF # SEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFT # TTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPRRELQGTRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g142 ### # start gene g143 7 AUGUSTUS gene 604057 605583 0.46 + . g143 7 AUGUSTUS transcript 604057 605583 0.46 + . g143.t1 7 AUGUSTUS start_codon 604057 604059 . + 0 transcript_id "g143.t1"; gene_id "g143"; 7 AUGUSTUS CDS 604057 605583 0.46 + 0 transcript_id "g143.t1"; gene_id "g143"; 7 AUGUSTUS stop_codon 605581 605583 . + 0 transcript_id "g143.t1"; gene_id "g143"; # protein sequence = [MNEDLLVNRVREAPKDTTIIEALKRIARNEEESFVWEDGLIKRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTK # KLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPATAGPEKYDAILVVVCRLTKQAIYVPCHTTDKAEDF # ANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNNTPNTTTG # VSPFFANKGYHPKLSITLEQVQEAEVNEYASNLKELHTYLQERIEVANKVYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTVL # SKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGKTEHFVEDILDSKPKKGRPEEVEYLVKWEGYNDEFNSWVGWEGMVGSI # ELLRSWHKHHPRKRQPSRLQWASLEREAREDEEEGSGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g143 ### # start gene g144 7 AUGUSTUS gene 605831 608463 0.59 - . g144 7 AUGUSTUS transcript 605831 608463 0.59 - . g144.t1 7 AUGUSTUS stop_codon 605831 605833 . - 0 transcript_id "g144.t1"; gene_id "g144"; 7 AUGUSTUS CDS 605831 607081 0.81 - 0 transcript_id "g144.t1"; gene_id "g144"; 7 AUGUSTUS CDS 607138 608463 0.66 - 0 transcript_id "g144.t1"; gene_id "g144"; 7 AUGUSTUS start_codon 608461 608463 . - 0 transcript_id "g144.t1"; gene_id "g144"; # protein sequence = [MSPTPTRPFSRTPSPLLPPLTALGEVPSPAPESDGEVEADQLAFTIESPSRPQLQLFETVFNTGKSLSAYCQDDPLWP # ILAEVASPCTNCLKTPGKCKVLPSSPRCTNCSSKKTCSLGKILRFRYFARRCNQDLAYSRRFLELHGTPAHKSTWGIPLTAWREYDSALHARTSSTSI # LLELNMLDEQDAVDADQQELQQFMTLQRDEAAVAAKRKRNRSPKPVAGPSSKKIRSDAPKTDAPKKRSRRKSPAVEVNVEPFRRVRLVVPPVRSAAPT # SLPVPPPSSPSLMGVLNRDLPMQGPSDLVRLADAAEVHPGLVQQAGSSSPVRTPIKGTGQDLLSSTMPPILRPALVPRNPASHPYRAENQRLAARVRL # LEAQLADSQRENSSLTSALRDTSHALESRQREVEQLRSSSQEFLQRQEEYRHIIDQFNTLDRALSGPSDQSLLERFQKVEEELRITRKDRDDATGKLS # TSSSRISELTTALLYQHGITDEGNALSTRQRARLEELQEEVHRTRGRAAFVERMIKEYPDEGYYEVVLPPLSQLEGDLVKVRADLRRVATLAHRLYRS # DPATVLHHHNRYIGAIIEAVVAFLRRALETEDPDIMEHNIRLALDYMQTARGVHGDLHIRSTSSIQWFFNNAVDQDEGLYTLMLENSRFDSDRPFLTA # AQHAGFTSPPPDSLEPPLHRRMLSLSTALPHRGGAGRWDDLVPAIPSDDQLTQDWEQLMLQYMHHITDTPLPVPDPPVPMSSTGPVPESSDETNVEQS # FEAPIVPVSSPSGGSHPPVPLFLSEQESPTSPSPPPRSSVPPLLFGSVASLSIDLTGDDDELYETEEAYASRIGVAMEGTELAVDQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g144 ### # start gene g145 7 AUGUSTUS gene 609684 611816 0.97 - . g145 7 AUGUSTUS transcript 609684 611816 0.97 - . g145.t1 7 AUGUSTUS stop_codon 609684 609686 . - 0 transcript_id "g145.t1"; gene_id "g145"; 7 AUGUSTUS CDS 609684 611816 0.97 - 0 transcript_id "g145.t1"; gene_id "g145"; 7 AUGUSTUS start_codon 611814 611816 . - 0 transcript_id "g145.t1"; gene_id "g145"; # protein sequence = [MGINEWLAFASESTEEEVEEILEAGRSAIERVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYP # DLPTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASDS # SATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSL # KEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRY # GSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEESHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDP # EKVKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGI # LSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGR # LGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERVRPGSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g145 ### # start gene g146 7 AUGUSTUS gene 611918 612421 0.71 - . g146 7 AUGUSTUS transcript 611918 612421 0.71 - . g146.t1 7 AUGUSTUS stop_codon 611918 611920 . - 0 transcript_id "g146.t1"; gene_id "g146"; 7 AUGUSTUS CDS 611918 612288 0.75 - 2 transcript_id "g146.t1"; gene_id "g146"; 7 AUGUSTUS CDS 612376 612421 0.73 - 0 transcript_id "g146.t1"; gene_id "g146"; 7 AUGUSTUS start_codon 612419 612421 . - 0 transcript_id "g146.t1"; gene_id "g146"; # protein sequence = [MLHRQNCRYATPRKFDQFCGWNNSQGGVPSNSITPTAPIVLGLPWLRTHNPVIDWKELCLTFQDRNVRISAALASEIV # QPGAEGGTEELGRGVNSEEIHAGTLQSPPEAPQRPPEAPQPPPEASQQPPEAPLELQGRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g146 ### # start gene g147 7 AUGUSTUS gene 628533 629484 0.43 - . g147 7 AUGUSTUS transcript 628533 629484 0.43 - . g147.t1 7 AUGUSTUS stop_codon 628533 628535 . - 0 transcript_id "g147.t1"; gene_id "g147"; 7 AUGUSTUS CDS 628533 629318 0.98 - 0 transcript_id "g147.t1"; gene_id "g147"; 7 AUGUSTUS CDS 629368 629484 0.43 - 0 transcript_id "g147.t1"; gene_id "g147"; 7 AUGUSTUS start_codon 629482 629484 . - 0 transcript_id "g147.t1"; gene_id "g147"; # protein sequence = [MLFHVHDMVSPAQFQLIQSVGELGAMLWIHEINNMESYLKDLKIIIGNTLDAFAAVDPAKIMNKVKIHLLNHVIPDVR # RFGPIIRSSTEVFECFNAIFRMCSVFSNGQAPSHDIACQFAGMDRVKHILSGGYWLSSSGEWVQAGPRVREVLITHPIIQRHLGWIPKEAIKIGILFN # GFQKYTQIFVLGYMKPLSQKKTQTVLWSTTKAALVLEQEWRFWHNNTSVIAKSGDCCKIGSWVAVQKTSSTVSKKLFIGFSETSFQVQDFHIGRIAEL # LSPFSPTSNSAPERPGVRPGSKWVLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g147 ### # start gene g148 7 AUGUSTUS gene 629717 629959 0.53 - . g148 7 AUGUSTUS transcript 629717 629959 0.53 - . g148.t1 7 AUGUSTUS stop_codon 629717 629719 . - 0 transcript_id "g148.t1"; gene_id "g148"; 7 AUGUSTUS CDS 629717 629959 0.53 - 0 transcript_id "g148.t1"; gene_id "g148"; 7 AUGUSTUS start_codon 629957 629959 . - 0 transcript_id "g148.t1"; gene_id "g148"; # protein sequence = [MQRATGTKDKVAQYWIDILLEKSIKMKKEDPNISADELTATLEAWLDNQPGDKVNPLLDIAGGFGFKNVLVVELTHFT # RS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g148 ### # start gene g149 7 AUGUSTUS gene 630318 630611 0.49 - . g149 7 AUGUSTUS transcript 630318 630611 0.49 - . g149.t1 7 AUGUSTUS stop_codon 630318 630320 . - 0 transcript_id "g149.t1"; gene_id "g149"; 7 AUGUSTUS CDS 630318 630611 0.49 - 0 transcript_id "g149.t1"; gene_id "g149"; 7 AUGUSTUS start_codon 630609 630611 . - 0 transcript_id "g149.t1"; gene_id "g149"; # protein sequence = [MPNPDRKLVPIGYDLYDVFIPLWADDVSGNKSKQYNKHINMYSVNSNLPGHLLHQEYFVQFVSTSPNATSPEQFSALK # DMIKYVSQLIVKNNSVFLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g149 ### # start gene g150 7 AUGUSTUS gene 635402 639836 0.27 + . g150 7 AUGUSTUS transcript 635402 639836 0.27 + . g150.t1 7 AUGUSTUS start_codon 635402 635404 . + 0 transcript_id "g150.t1"; gene_id "g150"; 7 AUGUSTUS CDS 635402 637302 0.34 + 0 transcript_id "g150.t1"; gene_id "g150"; 7 AUGUSTUS CDS 637431 637620 0.47 + 1 transcript_id "g150.t1"; gene_id "g150"; 7 AUGUSTUS CDS 637776 639836 0.68 + 0 transcript_id "g150.t1"; gene_id "g150"; 7 AUGUSTUS stop_codon 639834 639836 . + 0 transcript_id "g150.t1"; gene_id "g150"; # protein sequence = [MSTTSMVNIPRLPDEKQLIGEENWRPFKREILFAVQARGLTGYMDRMTPKPTPTTENYPRPIYQAAPTPAYSVTPCLE # EWVLRDRLVAGAIVSNIADPIGLGIDETKRASEIWQNLIKRFEKRDEQRIHLAETSLRHEVFDPLTDTMEAHEKKTRNLLKKVHDLGGTTTDAQFCRI # TIFSMPPDWRQDVRTVPGTTSAEAFTYLQTLWYQREEERKEEERDTKRVKALMAAHAHTQTPNSQPRDQARTGGRSSTICHNCNKAGHIAKKCWAKGG # GMEGQGPRQNTKAKGDPNANATTMTDEVDFTLPMATYVMSVKTNSKQGMSQNNQSPVPDADPTNRQNHTILKGGDQREETGNATEDVHSFLIVAPKDC # TICSNRTSLYSPPLPAIKTFLDSGASEHCWVNKTDFVKYTEVLGQGGNSAVSGEAGRFQIMGVGTVQFVTRIGDEERVIQLREVKHTPSFGHNLISLT # TLDGRGMRGEWGRGTMTVKSSDGQTIMEGHGQSKMYKIKVLESGKTIANYLRSRDRPVNILTWHRRLGHVAIRRILRMANRRLVDGLNITKGEVLGMC # EDCLYGKATKRPFDEVLTHETEILERVHVDLFGPARTQTRGGASYLMESHHSGSCTSSTTRGKRPDIIIEKVLHDSSAGNGVAERAFRMVMEGTRTLL # EDAKLPYSFWGEAASTFIYVDNFIPSARFPDTGLPYLDTGDQTDRRVSRRYIRGRCTAQDEKEDEGEDDVEDRTPTTPDDRNTRSDTGLGVNTNNPDI # PAEGNLPPTTTTDDVPLAATRPQQTPVPPEATRCSERGHIPSRRYLESAEYEGREDEARTRGEQWSTEQPVDGTFALVVQSPFSFAATSGDLWIPQSF # KQAMKRPDLWLLLMEKEYQTLLAKQCWELVPLPPGANLTGGRWTYAIKFDAEGHLLKRKACYVAQGYTQIQGQDYDKTYGGVARMESVRLVLAIVATL # RLSIFQVDFTAAFLNSPITHDVYMKQPEGFVKLGTEHLVCKLKKSIYGTMQGSHDWQETLAAGYIADGYTASRANPCIRYRRVDDEYTITSTYGDDVC # GGSSTGTGRDKAVADLGRRWEANEVKSEVLLGMTIQQNPETKSINLSQKTYFLRMLTTFNLENVRHRYTPLPPGVKLTDSPSPLPDDELAFMKDKPYR # SIVGCIMWGQVCTRPDLAFAAGLLARYQLNPGHPHWECIEWVAGYILHTIDYSITYRAPGRLDSTPGAGLKTYAYVDSDHAGCRDTYRSTSGYVFFMA # GAPVSWSSKRQATVALSTTESEYIGLSRATQQAVWLASFMAEVDLTQDGPINLLGDNFGSVCLTENSKRHALVKHIEMRHHYVREKVSSGEITIQRIR # SGDNVADIFTKPLSGVIHSKLVSQLGLDRTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g150 ### # start gene g151 7 AUGUSTUS gene 643018 643840 0.58 - . g151 7 AUGUSTUS transcript 643018 643840 0.58 - . g151.t1 7 AUGUSTUS stop_codon 643018 643020 . - 0 transcript_id "g151.t1"; gene_id "g151"; 7 AUGUSTUS CDS 643018 643638 0.69 - 0 transcript_id "g151.t1"; gene_id "g151"; 7 AUGUSTUS CDS 643718 643840 0.59 - 0 transcript_id "g151.t1"; gene_id "g151"; 7 AUGUSTUS start_codon 643838 643840 . - 0 transcript_id "g151.t1"; gene_id "g151"; # protein sequence = [MGLGYLDHRHQGLYLGIYVVPGGFRADRRKTILDTQVRIGDSSTNSPNGELHSMMMYTLTELMFTRGVDFIKLDFITP # GSPDNGVHLPLNTSDDVIAYHKAIKNASRPMRLDISWKLARDEKHFHIWSKNADSFRTDQDINERGSNLTLAAWATVQRAIDNYRQYIVMHTGKDQTL # NLFPDMDNLYIGNSLGEDYDGLSKAQRFTIMNHWMGAASNLMLGNDLTKLDGEFPRAALISISSRLRYEQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g151 ### # start gene g152 7 AUGUSTUS gene 648438 648941 0.6 - . g152 7 AUGUSTUS transcript 648438 648941 0.6 - . g152.t1 7 AUGUSTUS stop_codon 648438 648440 . - 0 transcript_id "g152.t1"; gene_id "g152"; 7 AUGUSTUS CDS 648438 648941 0.6 - 0 transcript_id "g152.t1"; gene_id "g152"; 7 AUGUSTUS start_codon 648939 648941 . - 0 transcript_id "g152.t1"; gene_id "g152"; # protein sequence = [MVLNTEKDDFADEWKIYPGKRVGFGAVRDSAEVPFTSSNWPWRSHRFSELRKCKNDPTEVWEKLAEVPLKTWNPLNKT # ELFEHFENRIPVEGRFRYPDAIMQHLWQIKIIQDSDIQKWNQRVGEMLQMEMSEVYVKKMKEIKDEAEKRQKSRLAEEPSQNSLDTFGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g152 ### # start gene g153 7 AUGUSTUS gene 653340 654359 0.95 + . g153 7 AUGUSTUS transcript 653340 654359 0.95 + . g153.t1 7 AUGUSTUS start_codon 653340 653342 . + 0 transcript_id "g153.t1"; gene_id "g153"; 7 AUGUSTUS CDS 653340 654359 0.95 + 0 transcript_id "g153.t1"; gene_id "g153"; 7 AUGUSTUS stop_codon 654357 654359 . + 0 transcript_id "g153.t1"; gene_id "g153"; # protein sequence = [MFRHVHRICSSLHSAPYSTRHAPSALAARTASVPLAVRERREKQLGLTPGPGETDATPDGLSPSDLARYKRHKALGTL # PKSEDGKVQSPKEWIQRRDARRSRIRGFRTIRRTVPTKEDPDVTKTVQEVDVVGQPVYLPNIIFRLVRNHTPEGQDYNPFEATFRVPPSVTKTDIRSY # LFAVYGVKTTYIRTDLYYGRSKPRGLSNRKMRSTYKRAVVGLVHPFYYPHRMEDMPQEERDKREDFIEQQYFVKEAHKMFAQNRFRSAATSARGDESK # QWKFDEGSVKGRGKILKEVARRRQLKEQMVADLVGQWQKTRMEGKTMNVEFPRNRKPKKEVEANA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g153 ### # start gene g154 7 AUGUSTUS gene 659183 660714 0.46 - . g154 7 AUGUSTUS transcript 659183 660714 0.46 - . g154.t1 7 AUGUSTUS stop_codon 659183 659185 . - 0 transcript_id "g154.t1"; gene_id "g154"; 7 AUGUSTUS CDS 659183 660620 0.54 - 1 transcript_id "g154.t1"; gene_id "g154"; 7 AUGUSTUS CDS 660710 660714 0.47 - 0 transcript_id "g154.t1"; gene_id "g154"; 7 AUGUSTUS start_codon 660712 660714 . - 0 transcript_id "g154.t1"; gene_id "g154"; # protein sequence = [MRVSWPHSNFLISSTPIPSITITHVTAVSVALPSFSGSNFETLIGGLSPSTDVASSATTPEIITNSQDPSHTITHAAL # ATVAETSIGSDTEATSSSTWIFLATSGITLSPTPIVDPTPHSIPLPATSGDSSNSNGHDQSIQQTMSQPGAIAGVTIGAVILAIALSLLIALCLIKHR # RKRRFFDRDARKSLNPFFKYQAVSPPGSLPHSRDRSMTDMLPDLESASVSQTMEADRQSRRGWNLKAQLRKWRSSNGVIEPFITSRYRLDPDMVESGS # RRMNEARRFSDEDIQNVFTRTQEERLLLRSSSVMSVATTMTAQMRSAMLQPSSSDVEYQINRLHGPLSHRRHDRTQSPSGNSSDSHYHQVSRSNGRHG # NASTETGSSSNTSSKADYQVTLPKATSSTHPRSPLPSYNSFNSPLARASSSEPPQLKRMSFQSTWANDPFLSNEEIERLAADEQEADWAMDGFLEPVA # HDDLPPAYAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g154 ### # start gene g155 7 AUGUSTUS gene 667452 667751 0.64 - . g155 7 AUGUSTUS transcript 667452 667751 0.64 - . g155.t1 7 AUGUSTUS stop_codon 667452 667454 . - 0 transcript_id "g155.t1"; gene_id "g155"; 7 AUGUSTUS CDS 667452 667751 0.64 - 0 transcript_id "g155.t1"; gene_id "g155"; 7 AUGUSTUS start_codon 667749 667751 . - 0 transcript_id "g155.t1"; gene_id "g155"; # protein sequence = [MQMDISFGTELTLGISRGLQNKASLEALLTGVTQARDSLPPSYLTSQRPRLVLKIAPDLDQSQIEDIANVIKNTGIDG # VIVSNTTIQRPSHLLSGEAPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g155 ### # start gene g156 7 AUGUSTUS gene 675617 677050 0.18 + . g156 7 AUGUSTUS transcript 675617 677050 0.18 + . g156.t1 7 AUGUSTUS start_codon 675617 675619 . + 0 transcript_id "g156.t1"; gene_id "g156"; 7 AUGUSTUS CDS 675617 676574 0.37 + 0 transcript_id "g156.t1"; gene_id "g156"; 7 AUGUSTUS CDS 676656 677050 0.47 + 2 transcript_id "g156.t1"; gene_id "g156"; 7 AUGUSTUS stop_codon 677048 677050 . + 0 transcript_id "g156.t1"; gene_id "g156"; # protein sequence = [MKMLPLEYVVIDAYIYGILLTILNQSALRIIDGLATNLPPMQVFPALRTLIVQYFSSQDPAQRRGAMLALGIAVEGCS # EFMTPLMGEVWPIIEAGLQDIDASVRKATCIAVSCFCEWLEEECVAKHTVLIPVRLPNFVTRISLIFVQAIMNLINDSATQRSACTALDALLEILADV # IDQYLQLIMERLSGLLETAPIPVKSVVTGAIGSAAHASKEKFIPYFEPTMQRLQHFLVLTGEGEEIELRGITMDAVGTFAEAVGKDHFRPYFPTMMTQ # AFEGIEMGSARLRECSFLFFGVMARVFGDEFAGYLPQVVPPLIASFTTSDPNSAFNSGLSASNAIPVSDEADVNGLPTEELEDVDLDKLLDVNSAIAV # EKEIAADTIGMLFNATQAHFLPYVEQCTLELVKLLAHYYEGIRKSALDSLLEIVRTFYDLSDHQEWEAGATVVCLLPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g156 ### # start gene g157 7 AUGUSTUS gene 678708 681498 0.75 + . g157 7 AUGUSTUS transcript 678708 681498 0.75 + . g157.t1 7 AUGUSTUS start_codon 678708 678710 . + 0 transcript_id "g157.t1"; gene_id "g157"; 7 AUGUSTUS CDS 678708 680696 0.75 + 0 transcript_id "g157.t1"; gene_id "g157"; 7 AUGUSTUS CDS 680752 681498 1 + 0 transcript_id "g157.t1"; gene_id "g157"; 7 AUGUSTUS stop_codon 681496 681498 . + 0 transcript_id "g157.t1"; gene_id "g157"; # protein sequence = [MLSHFLSFFLASALIPLSASLSVQIPLDNQFPPVAHVGQPYSWTFSNNTFDYASDSTPPTHTVSPLPDWLSFNPVTRT # FSGTPSQADQGEPEITVTAHIGDASNSTKCNILITTSPALTLNQPISAQLYEGNPSLSSVFTVSNNSAIYTGNPTIRVPHKWSFSVGFSSETFMNSQD # NAHYTVLQSDKSPIPYKMEFTQGPDTLGGTAPLLEEVGSTATFHLELIGIVSGGYSDGSLPFDMVIADHELSMDSNSLPIVNITRDANFTLNFGSTGD # LAGVLVDGEAINPSDILELSIDTSSCGWLQWDGVSRLLTGSTVGQDFNSSTGPHLPVTLTTTFNQTIRTILPLAIEPSFFTTGTFPAYAIPETGLASF # DIHPYLSNVTGEKPADVNMSIAVEPSSAASCLTFNSTSLVVEGTVTGDCQVSNISVTIAAYSHVTHSTSHATLPMTDSFKKSSGTPHHPGSLSFSAHK # KLILGISIAFGIVGGLSALGTFLASVRRCLRVQDPVLATEQCQRNLSESDQRWYGLVAEKSHAGWNHESTLPTEKRRPGMELLRSPRNYGNIGLGLDP # SKRSYTQEFMSPSSAAGSKYQSPGVMKKGDFMNRIRETVRNVSDKLGTQSSKKSTPIRRGIIGKPILLNAQEGQIPRANANATDPFVAPSTGNVSTPA # SVHFADLTRQLSTDSAHSLDSIRTHANEAVVQTATRHPSMPDATQSRPRLKQVTSAMRVPPPKLVTSSSGTDGSTSGSILSARVTSQKAKIWTGEDAI # PTTGTGDELSMGIRYVTALGGDSYLMSDADVRPGSSYTVSTHLQSTYSLDAPDHDRSGVNRLIIRADERFEVLISVGSAKKLEARLISGDNTPDWMEF # DLRPNKGKIELYGLPSIADVGDWDVRIIDTQNGSWVGEVGLQVVPKSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g157 ### # start gene g158 7 AUGUSTUS gene 682234 683426 0.53 + . g158 7 AUGUSTUS transcript 682234 683426 0.53 + . g158.t1 7 AUGUSTUS start_codon 682234 682236 . + 0 transcript_id "g158.t1"; gene_id "g158"; 7 AUGUSTUS CDS 682234 682537 0.72 + 0 transcript_id "g158.t1"; gene_id "g158"; 7 AUGUSTUS CDS 682957 683426 0.99 + 2 transcript_id "g158.t1"; gene_id "g158"; 7 AUGUSTUS stop_codon 683424 683426 . + 0 transcript_id "g158.t1"; gene_id "g158"; # protein sequence = [MSQKWNEDKTKSPPPYNGPSPRPYRESSQRRPGAAPLQSEDPKSTVSGAFFAGAHNFDINGGAFQNASGDINHTVNND # HSQKSDFNNNYSGSTNYNGNAMHMEDREGYYNNNTGCEFPSVLFFAETFLKAFCIDKPKRASSQHELDYRDGFKDGRGDPEDTDSLKHQEPAEESVEF # EASEELEEPGVAQLRQCVETFLAGPKMKAMPDLADTLVKAGWDREALAHSEWGDIKDSYKGSGWIAPMFVKLRKICKEWNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g158 ### # start gene g159 7 AUGUSTUS gene 684558 684905 0.99 - . g159 7 AUGUSTUS transcript 684558 684905 0.99 - . g159.t1 7 AUGUSTUS stop_codon 684558 684560 . - 0 transcript_id "g159.t1"; gene_id "g159"; 7 AUGUSTUS CDS 684558 684905 0.99 - 0 transcript_id "g159.t1"; gene_id "g159"; 7 AUGUSTUS start_codon 684903 684905 . - 0 transcript_id "g159.t1"; gene_id "g159"; # protein sequence = [MSACDKLHKIYGTSSGPLVQLRSVGLEVLNELDSIKAAIMMSAGSVSQTNDKYLSYNGNFRTMVFNVAAKGVENINTV # AQVAQIIRGGLGGLAVNAIQNLAKATSSYQLPRKDVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g159 ### # start gene g160 7 AUGUSTUS gene 685001 685762 0.7 - . g160 7 AUGUSTUS transcript 685001 685762 0.7 - . g160.t1 7 AUGUSTUS stop_codon 685001 685003 . - 0 transcript_id "g160.t1"; gene_id "g160"; 7 AUGUSTUS CDS 685001 685762 0.7 - 0 transcript_id "g160.t1"; gene_id "g160"; 7 AUGUSTUS start_codon 685760 685762 . - 0 transcript_id "g160.t1"; gene_id "g160"; # protein sequence = [MVSQIGADGPNSPVRSFAKIPSYGWSYDTQAIVCTMEHPPKGPFLGPNTTAYQRFLPTGPIAFLPISATVSSLVWSTK # PALSTALKACDPSVLARMINAAFRLPDVSIRYLHGRILEAHEAGNPMTDEEINAEIVWREKSHSIDATSAYSSITPDVSSNTRVPPSDSEMVPPIVTS # IQAGTIASFPLRYAHTETYTGEGLGSRTVLVGDAAHTIHPLAGQGLNLGLGDVECLARCITEAVLRGGDIGSSLFNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g160 ### # start gene g161 7 AUGUSTUS gene 686703 687463 0.79 + . g161 7 AUGUSTUS transcript 686703 687463 0.79 + . g161.t1 7 AUGUSTUS start_codon 686703 686705 . + 0 transcript_id "g161.t1"; gene_id "g161"; 7 AUGUSTUS CDS 686703 686988 0.79 + 0 transcript_id "g161.t1"; gene_id "g161"; 7 AUGUSTUS CDS 687078 687463 0.97 + 2 transcript_id "g161.t1"; gene_id "g161"; 7 AUGUSTUS stop_codon 687461 687463 . + 0 transcript_id "g161.t1"; gene_id "g161"; # protein sequence = [MAATPVSAAQAIGEYLQSPDDLVKVSAYRKKLEKEKASIDARLKSGVKEQLQATREGLRKLLSTRANVQAIKDEMVSI # DRECSDPQTQVATFDQIKEMVNNLLDMESKLSEIGYMLDDDSANITGPAPNLLVIHYYLKQLEAFRNQTMHQAKKASSDARIYLVRRFERLHTVIEQF # DQYIIDLAGNVLDIVREGNGHVIVRLIKIAEMEGREDEKVDLEYLYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g161 ### # start gene g162 7 AUGUSTUS gene 687552 689023 0.49 + . g162 7 AUGUSTUS transcript 687552 689023 0.49 + . g162.t1 7 AUGUSTUS start_codon 687552 687554 . + 0 transcript_id "g162.t1"; gene_id "g162"; 7 AUGUSTUS CDS 687552 688155 0.49 + 0 transcript_id "g162.t1"; gene_id "g162"; 7 AUGUSTUS CDS 688230 689023 0.68 + 2 transcript_id "g162.t1"; gene_id "g162"; 7 AUGUSTUS stop_codon 689021 689023 . + 0 transcript_id "g162.t1"; gene_id "g162"; # protein sequence = [MLANARVIKHYRSKITKAIADSIKAKFERAYKQDENDPMAFLENIQWMYADIIRIQSDVVPCFPPEYDIYSLYIREYH # KALNVQINKIVASEPGANVLLALFEWLKQYKKDMRELEVPPDLLEPPLLDGKEQSLIEDYLQVIIKKLDEWSSNMMKTELEEFVSRQDPLEVDADGQY # ATQGGAGILFQMVNQQIDLATESGQVEQEYKKQVEKPEEIAPGLVEYVIALANDMLKSADYAEALLARLEPLVSEKYRVQMNEKLNDAIDGYLDVAKK # CTQTLIDMIFNDLKPVTKNLFQPPWYDGILAQIVETIRDYMDDYKEFLNPSLFELLVEDLIDAFLLVYLNALANSPKLKIPAATERIKDDVDDAFRLF # LNYKSQKDMEEYFEVLDLILGILEASKEIVFLSYWSFAKKHGPNLAFVEGLIKARGDLDRSGVSEVMDTIKRKVKDETWLIVRFSIPLLISVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g162 ### # start gene g163 7 AUGUSTUS gene 689791 690341 0.58 - . g163 7 AUGUSTUS transcript 689791 690341 0.58 - . g163.t1 7 AUGUSTUS stop_codon 689791 689793 . - 0 transcript_id "g163.t1"; gene_id "g163"; 7 AUGUSTUS CDS 689791 690057 0.85 - 0 transcript_id "g163.t1"; gene_id "g163"; 7 AUGUSTUS CDS 690147 690341 0.63 - 0 transcript_id "g163.t1"; gene_id "g163"; 7 AUGUSTUS start_codon 690339 690341 . - 0 transcript_id "g163.t1"; gene_id "g163"; # protein sequence = [MSQSDIHEFQNPADIDIPKTGAGMGSVAGGGSSTTGDSRTEEQKEADNKLAERLSALIEDANSRVHIENMDARKDDDK # DEDELIRQVKPLLQQAEKILGETEGMVKGADPDNRLSNRAKRHAESHTATPEEQRLAAALKVVLSCLPQQSRSGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g163 ### # start gene g164 7 AUGUSTUS gene 690894 691322 0.96 + . g164 7 AUGUSTUS transcript 690894 691322 0.96 + . g164.t1 7 AUGUSTUS start_codon 690894 690896 . + 0 transcript_id "g164.t1"; gene_id "g164"; 7 AUGUSTUS CDS 690894 691322 0.96 + 0 transcript_id "g164.t1"; gene_id "g164"; 7 AUGUSTUS stop_codon 691320 691322 . + 0 transcript_id "g164.t1"; gene_id "g164"; # protein sequence = [MSDPTGPHSRSPSSGPPPARQQQRSQSRRRGRSQTARSLSASGDDSDASSASSLARRRRRGGGRKGGGLPGVEEVEDT # GNQVANTAKNAVGQVGQVAGGGKKQDDDEGSGGDKPLKLRLDLNLDVAVELKARVHGDLTLSLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g164 ### # start gene g165 7 AUGUSTUS gene 692408 692821 0.29 - . g165 7 AUGUSTUS transcript 692408 692821 0.29 - . g165.t1 7 AUGUSTUS stop_codon 692408 692410 . - 0 transcript_id "g165.t1"; gene_id "g165"; 7 AUGUSTUS CDS 692408 692614 0.36 - 0 transcript_id "g165.t1"; gene_id "g165"; 7 AUGUSTUS CDS 692666 692821 0.77 - 0 transcript_id "g165.t1"; gene_id "g165"; 7 AUGUSTUS start_codon 692819 692821 . - 0 transcript_id "g165.t1"; gene_id "g165"; # protein sequence = [MSSSTSSHHNPNLNNWGNSNTGSGLGSSTLGTSSFGDSLSQSRNHYQSGYLMSASQANVRIEFLCTRTRSRLTLPDQN # LPQGNQRVDELPVVQTKAKINQALLRGSADDFGMDSMFENKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g165 ### # start gene g166 7 AUGUSTUS gene 701367 701978 0.97 + . g166 7 AUGUSTUS transcript 701367 701978 0.97 + . g166.t1 7 AUGUSTUS start_codon 701367 701369 . + 0 transcript_id "g166.t1"; gene_id "g166"; 7 AUGUSTUS CDS 701367 701978 0.97 + 0 transcript_id "g166.t1"; gene_id "g166"; 7 AUGUSTUS stop_codon 701976 701978 . + 0 transcript_id "g166.t1"; gene_id "g166"; # protein sequence = [MATPEDLKVNAEYIRMADRYIEVPGGSNNNNYANVDLIVDVAERAGVHAVWAGWGHASENPRLPESLAASKNKIVFIG # PPGSAMRSLGDKISSTIVAQSANVPTMPWSGTGITDTALSEAGYVIVPDKAYQDACVTSVEEGLVKAEEIGWPVMIKASEGGGGKGIRKVEQPEAFKN # AYHAVAGEIPGRQICNLSYSHVHPFWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g166 ### # start gene g167 7 AUGUSTUS gene 702161 704276 0.76 + . g167 7 AUGUSTUS transcript 702161 704276 0.76 + . g167.t1 7 AUGUSTUS start_codon 702161 702163 . + 0 transcript_id "g167.t1"; gene_id "g167"; 7 AUGUSTUS CDS 702161 703375 0.76 + 0 transcript_id "g167.t1"; gene_id "g167"; 7 AUGUSTUS CDS 703431 704276 0.99 + 0 transcript_id "g167.t1"; gene_id "g167"; 7 AUGUSTUS stop_codon 704274 704276 . + 0 transcript_id "g167.t1"; gene_id "g167"; # protein sequence = [MERAAVRLAKLVGYVSAGTVECTSCLRYCPFPSIYLFSDLYSHADDSFHFLELNPRLQVEHPTTEMVSGVNLPAAQLQ # VAMGIPLHRIRHIRQLYGVAPNAASEIDFDMIKPDANQLQRKPRPKGHVVAVRITAENPDAGFKPSSGSLQELNFRSSTNVWGYFSVSSAGGLHEFAD # SQFGHIFAYGEDRGESRKNMIIALKELSIRGDFRTTVEYLIKLLELDDFKDNTITTGWLDSLISDKLTAERPDATLAVICGAVTKAYLASEACWTEYK # RILDKGQVPARDVLKTVFVIDFIYENVRYSFTAARSSSTAWTLYLNGGSTMVGARPLADGGLLVLLDGRSHSIYWREEVGALRLMVDAKTCLIEQEND # PTQLRSPSPGKLIRFFVDSGEHINAGEQYAEIEVMKMYMPLVASEDGIVQLIKQPGVSLEPGDILGILTLDDPGRVKHAKPFEGLLPTMGTPAVTGSK # PHQRFIRCLGVLNDILDGFDNQAIMASTVKDLIDILHDPELPYSELTAILSSLSGRIPAKLDDSIHAALETAKAKGEFPAARIKKVLENFVESSVLPQ # DRPMFRTQLGAIYDVLDRFTGGLKGHEIKVWSNLLEKYEATERMFGGSIEARILTLREQNKDDLDKVISLVLSHIKVSSKAKLVLTILNHIKTKGISV # SNAESPLYKVLQDLASLEAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g167 ### # start gene g168 7 AUGUSTUS gene 705099 707711 0.87 + . g168 7 AUGUSTUS transcript 705099 707711 0.87 + . g168.t1 7 AUGUSTUS start_codon 705099 705101 . + 0 transcript_id "g168.t1"; gene_id "g168"; 7 AUGUSTUS CDS 705099 707711 0.87 + 0 transcript_id "g168.t1"; gene_id "g168"; 7 AUGUSTUS stop_codon 707709 707711 . + 0 transcript_id "g168.t1"; gene_id "g168"; # protein sequence = [MPEDAWFEKLTAFVNEQSSTLRERGVGRVSIMLCRPSQYPVYLTLREVDRVWTEEQSIRNIEPALAFQLELSRLSNYK # LKPVFVESKQIHIYHAVARENQLDNRFFVRALVRPGRLRGSMSTAEYLISETDRLVTTVLDALELVTAEQRNTDCNHIFLNFIYNLAVTYEDVLAAIS # GFIERHGKRLWRLHVTGSEIRIALEDDEGNVTPIRCVIENVSGFIVNYHGYQEITTDKGTTILKSIGEKGPLHLQPVHQAYSTKESLQPKRYQAHLIG # TTYVYDFPDLFSKALQNLWDSARATSPTLVKPRVLLESKELVLDEHDQLAEVDRAPGNNTFGMIGWVFTMRTPEFPQGRRVVVVANDITYKIGSFGPI # EDQFFYLVTQYARELGLPRIYLSANSGARIGLAEELIPLFSAAWNEAGHPEKGVHYLYLTHENYLKLEEQGHDSIKTVDVEVAGELRHKITDIIGLQD # GLGVESLKGSGLIAGETSRAYDDIFTITLVTARSVGIGAYLVRLGERAVQVEGQPIILTGAGALNKVLGREVYTSNLQLGGTQIMFKNGVSHLTASSD # LEGATHILKWLSYVPEVKDGALPVLESSDSWDRDIGYTPPKGAYDPRWFIEGKTDEATSEWMSGFFDKGSFQETLSGWAQTVVVGRARLGGIPMGVIA # VETRTIERIVPADPANPASFEQRIMEAGQVWYPNSAYKTAQAIFDFNREGLPLIIFANWRGFSGGQQDMYDEVLKQGSKIVDGLSSYKQPIFVYIVPN # GELRGGAWVVLDPSINSEQMEMYADVDARAGVLEPEGIVEIKFRQNKITALMERLDTEYASLKRESKDATKTAESRSAATAALERREAILQPTYKQIA # LLYADLHE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g168 ### # start gene g169 7 AUGUSTUS gene 707773 708180 0.81 + . g169 7 AUGUSTUS transcript 707773 708180 0.81 + . g169.t1 7 AUGUSTUS start_codon 707773 707775 . + 0 transcript_id "g169.t1"; gene_id "g169"; 7 AUGUSTUS CDS 707773 708180 0.81 + 0 transcript_id "g169.t1"; gene_id "g169"; 7 AUGUSTUS stop_codon 708178 708180 . + 0 transcript_id "g169.t1"; gene_id "g169"; # protein sequence = [MEAKGCAKPAIWKDARRKFYWAVRARVARSAALAELTEASPGSTTEYRSHLLDSLASIDAAMNDREMSETLEKLDLSQ # TVSQLKADYLMRRMVELTKEDRKAAMNGFARLADNLSDEERNSLISVLQNATRSPGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g169 ### # start gene g170 7 AUGUSTUS gene 722521 723327 0.79 - . g170 7 AUGUSTUS transcript 722521 723327 0.79 - . g170.t1 7 AUGUSTUS stop_codon 722521 722523 . - 0 transcript_id "g170.t1"; gene_id "g170"; 7 AUGUSTUS CDS 722521 723327 0.79 - 0 transcript_id "g170.t1"; gene_id "g170"; 7 AUGUSTUS start_codon 723325 723327 . - 0 transcript_id "g170.t1"; gene_id "g170"; # protein sequence = [MLSNSHPFHMKSSRHSVELANADISRLMDPSYHPSNNHGVSSTEPARVYIDRRGQMHDPDFYYFPVYEGAGKNNKRGR # RISDHSDSRKTQFGDEDLEEDDDVEERPRQYHRRQSTRRPRSSQSHTYPISSSDSYTSSIPSSSSTSSSPSSITSPLPFSPYTSVFEDKPRHHHHSIL # PKKFRRHSSDSSSLPSPLSFDPPESDDFSDVEYVDEDHESSVEEQDLSSHQQNALSYSQAMKKQWLAVSLSLRFRLFRARRRASSSYCSKRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g170 ### # start gene g171 7 AUGUSTUS gene 733191 734210 0.57 - . g171 7 AUGUSTUS transcript 733191 734210 0.57 - . g171.t1 7 AUGUSTUS stop_codon 733191 733193 . - 0 transcript_id "g171.t1"; gene_id "g171"; 7 AUGUSTUS CDS 733191 734210 0.57 - 0 transcript_id "g171.t1"; gene_id "g171"; 7 AUGUSTUS start_codon 734208 734210 . - 0 transcript_id "g171.t1"; gene_id "g171"; # protein sequence = [MSLVTRENASQRAGWKVMPSGRVVRTMKMRPGKPLPPLPAHMKESKDGKKKKKVKTPDARARSKTIDVTKWDGSYVTG # VFLGGDEVLPITQSREGLHGVGEERVQDKEKEERERKQKKKEKQEKKQQDKDREEKKKNVKILDKIVNVQALPDPLVPGPQSKPLPAPTVTTTTTPSH # EDPSHSVDLLTEKAQTLSLLNSFLFSSSSSSKSKHDNIPVDWDSDVDLDEANVIEVRNPAKDVDEGYEIVPRVDENEMDVDVNQGPDNDEREDEEESD # DSDSSDDPQEETPVQVEEKTQPPRPKINPLKDLFAPREDEGANFYPYDVLLYPLFSNSTHSVYLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g171 ### # start gene g172 7 AUGUSTUS gene 735515 737305 1 + . g172 7 AUGUSTUS transcript 735515 737305 1 + . g172.t1 7 AUGUSTUS start_codon 735515 735517 . + 0 transcript_id "g172.t1"; gene_id "g172"; 7 AUGUSTUS CDS 735515 737305 1 + 0 transcript_id "g172.t1"; gene_id "g172"; 7 AUGUSTUS stop_codon 737303 737305 . + 0 transcript_id "g172.t1"; gene_id "g172"; # protein sequence = [MFPGGKGPARGSPALAVHNGELWCLWLDKNDGLLYHATSDNQSWGPKTAFVGNYWTGLVPDNPTAGPALADCNGVLHA # AYSVDGSLVHYQYDDIAKKWGKRSLFARSSATPSLQAFDGRLFCAFQGDGNSLNWTTWDPEDGWMRPMSANEKTWGSPALYLLLDRLCLLFAENNDDR # HTTNTTFNTSTKSWSRTFGSPSQKTAYGVSATGFNKNIALMAFQSHDDNDKGLVLVDTFNNGAWQHNESIGSSSSDTPAIAILNNVITVVYNAHTDAR # DLLWSQATLTDYTPDSWMTALANIKPNLRITDITIPGTHDTCAISAVPWVATQSMTVIAQLNAGIRYLDLRCRLVDRSLMMYHGPYALDLYLQHVMDD # IYSWLRSHPAEGLIIQLSDEVKDNPDFASFSLAVTTLIGQDLNKDLWNTGTTVPFLSGIKGKIQLIRRYRADAASQQIGINATSWADNHDSPRFIIPT # QDGNLVIQDKFKFFGSPSEIIPQKFGIVTTLMDQARADESHLNLYINYTSMIHTLPFRSGPVAPWQLAIGYWDTWSEFTPGINRHLGHKLAADGFAHH # GVIVMDYPELPYDLIDYLITSNFEAAAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g172 ### # start gene g173 7 AUGUSTUS gene 737942 738505 0.53 - . g173 7 AUGUSTUS transcript 737942 738505 0.53 - . g173.t1 7 AUGUSTUS stop_codon 737942 737944 . - 0 transcript_id "g173.t1"; gene_id "g173"; 7 AUGUSTUS CDS 737942 738279 0.96 - 2 transcript_id "g173.t1"; gene_id "g173"; 7 AUGUSTUS CDS 738337 738505 0.53 - 0 transcript_id "g173.t1"; gene_id "g173"; 7 AUGUSTUS start_codon 738503 738505 . - 0 transcript_id "g173.t1"; gene_id "g173"; # protein sequence = [MPYLRALSTFRDGVRRLAIDKGDSALKDILALCDKLRDEELIPLGVALDDQEGIAIHGKALLKLAPPSELLKARDEKR # AIALAKQAKKEAAKEAERLKRLERLTKGRVDPKEMFRPPNVKEGLYGSYDESGVPMTDGEGKELSKSARKKLGKERETQVKLHEEYLTSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g173 ### # start gene g174 7 AUGUSTUS gene 743480 744640 0.17 + . g174 7 AUGUSTUS transcript 743480 744640 0.17 + . g174.t1 7 AUGUSTUS start_codon 743480 743482 . + 0 transcript_id "g174.t1"; gene_id "g174"; 7 AUGUSTUS CDS 743480 743738 0.21 + 0 transcript_id "g174.t1"; gene_id "g174"; 7 AUGUSTUS CDS 744231 744640 0.9 + 2 transcript_id "g174.t1"; gene_id "g174"; 7 AUGUSTUS stop_codon 744638 744640 . + 0 transcript_id "g174.t1"; gene_id "g174"; # protein sequence = [MSSNKQSASGERSPRSMDTSQSEQSEHTTTISGVFFAGSRNFEITGGSFNHAARDMHQTVNNDNSKQSDFNNDHRDAA # TYNGAAMHNAENTRIQAQQKLYFERQKQDGFEVCVITERTLPRVNNKQMTMKGPGDRSTADVNMETAAAEVEDSGKAELRQCVQTLLANAKQKDLPGL # ADALIDAGWDRETLMDAHWDDIKGSYPEWQPATFVKLRTICVRWVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g174 ### # start gene g175 7 AUGUSTUS gene 748578 749750 0.43 - . g175 7 AUGUSTUS transcript 748578 749750 0.43 - . g175.t1 7 AUGUSTUS stop_codon 748578 748580 . - 0 transcript_id "g175.t1"; gene_id "g175"; 7 AUGUSTUS CDS 748578 749750 0.43 - 0 transcript_id "g175.t1"; gene_id "g175"; 7 AUGUSTUS start_codon 749748 749750 . - 0 transcript_id "g175.t1"; gene_id "g175"; # protein sequence = [MRVEKAHDRIEERLRQQKEHEEKAKILRAKAKLQQQSQPEQHQPYPQQPRPHLPPQQAANPPPMPSPLVFHVTPPQPS # PKPPRQPPSESIRREWARQEEILQEHRARRAHQNRIAAGEIPPNTPLPQALRPQWSLWEKARIGLDKVYQEVAEERKMREKKEREQREARRKQEEEAA # RAAWAQQAQARAEEERRRKYTAEQQEQARMKAEWEDKIRRETALAEELKKAEEEKARRRAQASRETGSAGVQRSASIPFIPPQTDDPELFHWEMYDRR # WAAIRREGVEFVPFPLRFDQLPWPVFHFKPTSVITIDDLSEDDIRFFVLDTKRPGYGGKEAKERLRAELLRYHPDKFGARVLPYVLEVNEEREKVMEG # AKRVTEVLYQLLKTLPAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g175 ### # start gene g176 7 AUGUSTUS gene 755243 757799 0.36 + . g176 7 AUGUSTUS transcript 755243 757799 0.36 + . g176.t1 7 AUGUSTUS start_codon 755243 755245 . + 0 transcript_id "g176.t1"; gene_id "g176"; 7 AUGUSTUS CDS 755243 756544 0.65 + 0 transcript_id "g176.t1"; gene_id "g176"; 7 AUGUSTUS CDS 756594 757799 0.36 + 0 transcript_id "g176.t1"; gene_id "g176"; 7 AUGUSTUS stop_codon 757797 757799 . + 0 transcript_id "g176.t1"; gene_id "g176"; # protein sequence = [MPSSPSKAPTAAGPSRLPLPRSSSGREVASDGEVEQDQLAFTIESPSLPQLQLFANIFNTGKSLAVYCRDDPLWPILA # AVALPCSNCTKHPETCKVPEGSPRCSFCTGKKTCSLGKLLQYRYFARRCNQDLAYSRRFLELHGTPAQRVSWTIPEDVWHRYDELLHSSTSATKVLVE # LNMLDDQDSQAVDRSELRRFQEAQEQEALLAARRKRVNASPPPKVRSKKRRLTKVVEEPVIEEVPRLVRLVIPPSRPAPSAPGSAPSTFARSSAALPL # TSVRATGQLGSVQGPSPLARLADLVDQQTDSQAEASTRSLGPGSSPIKASLGDSNLPKMSPVVRPPLVPRILSQHPYRVENERLAARIRLLESQLASS # RQENATLTSALRDTSVSLEARQGELDQLRESVSSAAQQQELYDRLLDQVQTLKRALPGPPNESLVDRFRGLEEDLRLARESRAKYLSRFESSNRRNEE # LETSLIQQQSLVDESNALAVRQRKKIETLQEEVHLFRERALFAEKMIREYPDEGSYSVSLPPLAEVQGDLNDTLASLRRVSTFAHRLYRCDPASVLHQ # HNRYVGVIIDAVISFLRRGLDTSDEDVLARNFQLALQYLEAAHFIHAELHLRSLSSIQWFFANAAEREEGIYRLILAHSRFSDDAPFLNVAQHAGFVA # PFDDSLEPPLHRRMFALDTALPHHGAGNWEDLVPALPSLDRLTQEWEAMMSSYIRFVTDTPLPPVDLQEEGSADHEEVSVLQEGESGGTAAVPLFLPD # SLSATPVASAASPSPLPPRFGSVANLAIDMTADEDEEDIYESSGSVERRNRVEGNPGGDDPMEGAPVGQGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g176 ### # start gene g177 7 AUGUSTUS gene 758048 762340 0.81 - . g177 7 AUGUSTUS transcript 758048 762340 0.81 - . g177.t1 7 AUGUSTUS stop_codon 758048 758050 . - 0 transcript_id "g177.t1"; gene_id "g177"; 7 AUGUSTUS CDS 758048 762340 0.81 - 0 transcript_id "g177.t1"; gene_id "g177"; 7 AUGUSTUS start_codon 762338 762340 . - 0 transcript_id "g177.t1"; gene_id "g177"; # protein sequence = [MRHPENLVDLTDSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGVEGGTEELGRGVNSEEIHAGTLQSPSEEIHAGTLQSPPEAPQRPPEAPQPPPEASQQPPEAPLRAPRTRVKLEE # VKDEEYEASQPGPHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMERVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWR # KKRREHGPYPDLPTLDIESLNIPKIPSRSGLTPKGSIRRNNFQRKQLIAGTHVVERKSDPTVQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESP # TEEMLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKRSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLY # NMSKKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGH # EWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEVSHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVI # ISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLEC # DASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGY # DFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTSVIEALKRIARNEEESLVWEDGLLKRG # GRIYVPDIGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRAKPYGNLRPLPIGQRPWSSISLDHITQLPVT # AGPEKYDAILVVVCRLTKQAIYVPCHTTDNAEDFANLFVTHVFSKHGMPSDITSDRGSLFVSQFWRELCRVLGIEARLSTAYHPQTDGQTERVNQSVE # AYLRIYCAYDQDDWDLLLPIAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLERVQGAEVNEYASNLKELHTYLQGRIRVANEAYAKYANQKRQDAPD # WKEGDHVWLNMENVRTRRPMKKLDHKWTGPYSILAKIGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRRNSPPPPVFIKGKTEHFVESVLDSKP # IRGRPEEIEYLVKWEGYGDEFNSWVEWEGMVGSIELLRDWHQQHPRKRQPSRPHWASLEREAQEDEGEDREDSRERSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g177 ### # start gene g178 7 AUGUSTUS gene 762553 763485 0.58 - . g178 7 AUGUSTUS transcript 762553 763485 0.58 - . g178.t1 7 AUGUSTUS stop_codon 762553 762555 . - 0 transcript_id "g178.t1"; gene_id "g178"; 7 AUGUSTUS CDS 762553 763485 0.58 - 0 transcript_id "g178.t1"; gene_id "g178"; 7 AUGUSTUS start_codon 763483 763485 . - 0 transcript_id "g178.t1"; gene_id "g178"; # protein sequence = [MKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLR # NLHGEKVLQGWLSRFPGLELAPEAPYKSPLRREREPADVWTSNPKPAATGRFPNRSNWKEGRQRASAAWGEGESYDSENREEDEDCCHCRDGGEWTEA # VLRAGVTDTGRKWTPEERAEKWRRRRQELCMRCGRKEHWAKDCPNPESLERPVENQGSSERASKADSTRERGTANQGGGRKDDSTRPLERIRAGIVVE # EREGMDDLWNVHILDSPKGGEQKLLDEVGNGQGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g178 ### # start gene g179 7 AUGUSTUS gene 763549 766859 0.54 - . g179 7 AUGUSTUS transcript 763549 766859 0.54 - . g179.t1 7 AUGUSTUS stop_codon 763549 763551 . - 0 transcript_id "g179.t1"; gene_id "g179"; 7 AUGUSTUS CDS 763549 764169 0.89 - 0 transcript_id "g179.t1"; gene_id "g179"; 7 AUGUSTUS CDS 764301 766859 0.59 - 0 transcript_id "g179.t1"; gene_id "g179"; 7 AUGUSTUS start_codon 766857 766859 . - 0 transcript_id "g179.t1"; gene_id "g179"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETVSNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRASSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEV # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMR # HMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGELHGSDGRFLAQKH # SSPRNTEVPELLNPGNTATRSPQLRSGTSPNVHALAQNATPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSQISGQDLTARLAPNPVHVPPRLSN # PSVIPYQGSVSMQSQAVGTESHRGPNQRRTLAVHEEAVPPQGAPFGTPFVTGTQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTAG # KVPTGGPLPKTGNTAGLSGRAPRVRREYTRGGPSPVVPQPRSWQAMEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARSIERSRTTS # ESRGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPN # EGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEF # K] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g179 ### # start gene g180 7 AUGUSTUS gene 769484 770329 0.64 - . g180 7 AUGUSTUS transcript 769484 770329 0.64 - . g180.t1 7 AUGUSTUS stop_codon 769484 769486 . - 0 transcript_id "g180.t1"; gene_id "g180"; 7 AUGUSTUS CDS 769484 770329 0.64 - 0 transcript_id "g180.t1"; gene_id "g180"; 7 AUGUSTUS start_codon 770327 770329 . - 0 transcript_id "g180.t1"; gene_id "g180"; # protein sequence = [MRSLLARLGIKSDLTSGYRPQSNGQTECANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGY # LPLFNIPIGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKQKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYR # LDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKK # HPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g180 ### # start gene g181 7 AUGUSTUS gene 771448 773733 0.97 - . g181 7 AUGUSTUS transcript 771448 773733 0.97 - . g181.t1 7 AUGUSTUS stop_codon 771448 771450 . - 0 transcript_id "g181.t1"; gene_id "g181"; 7 AUGUSTUS CDS 771448 773733 0.97 - 0 transcript_id "g181.t1"; gene_id "g181"; 7 AUGUSTUS start_codon 773731 773733 . - 0 transcript_id "g181.t1"; gene_id "g181"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEIITAMEESPIHRIRANHKTRQAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDCEIHAQPLTQNPTEPKGYYDRIIVIGGWDYIYHMY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g181 ### # start gene g182 7 AUGUSTUS gene 773784 774851 0.93 - . g182 7 AUGUSTUS transcript 773784 774851 0.93 - . g182.t1 7 AUGUSTUS stop_codon 773784 773786 . - 0 transcript_id "g182.t1"; gene_id "g182"; 7 AUGUSTUS CDS 773784 774851 0.93 - 0 transcript_id "g182.t1"; gene_id "g182"; 7 AUGUSTUS start_codon 774849 774851 . - 0 transcript_id "g182.t1"; gene_id "g182"; # protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFSAENPP # FGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPTLKEAIKRAI # SVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVKQNCPHKETTCRYCGRRGHLESVCQDKFMGL # SRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRANAMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g182 ### # start gene g183 7 AUGUSTUS gene 779115 779478 0.73 + . g183 7 AUGUSTUS transcript 779115 779478 0.73 + . g183.t1 7 AUGUSTUS start_codon 779115 779117 . + 0 transcript_id "g183.t1"; gene_id "g183"; 7 AUGUSTUS CDS 779115 779133 0.8 + 0 transcript_id "g183.t1"; gene_id "g183"; 7 AUGUSTUS CDS 779183 779478 0.85 + 2 transcript_id "g183.t1"; gene_id "g183"; 7 AUGUSTUS stop_codon 779476 779478 . + 0 transcript_id "g183.t1"; gene_id "g183"; # protein sequence = [MALKKMESLCLDEATRLTSELKPQMEKFIRDEIFLPIWEPSFDSPHLKIPENHKKFIHDLKIPRARGPHKHLPDMLRY # ELGRFQQEDKLKERIVGLFTKEPTHK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g183 ### # start gene g184 7 AUGUSTUS gene 779658 781563 0.28 + . g184 7 AUGUSTUS transcript 779658 781563 0.28 + . g184.t1 7 AUGUSTUS start_codon 779658 779660 . + 0 transcript_id "g184.t1"; gene_id "g184"; 7 AUGUSTUS CDS 779658 780565 0.45 + 0 transcript_id "g184.t1"; gene_id "g184"; 7 AUGUSTUS CDS 780624 781563 0.6 + 1 transcript_id "g184.t1"; gene_id "g184"; 7 AUGUSTUS stop_codon 781561 781563 . + 0 transcript_id "g184.t1"; gene_id "g184"; # protein sequence = [MSNIRKVLRTSSLPRAPNLLVTSADIAAYCHGKDPETKDVTEQDILKERYSQFRKDIPQSEKFRLALEKNQHLAGSEL # LLPLLARLLVLKQYIAAVKNINGDLSQMQQKRRWLHLQLHPHLLSDNGREDLFKKLAGDLNKWFERQSLNLPQKIDIIESLSQSTVNGIMEALGLYNG # ENPLYVVIDECQFAVTDMEDHFRSADWTAKRGILREIARWWDSILNQGSATLVGALIFTGTGLSRELISDVLSSVVMKPDYCTSVYDTGAFDDSKAQT # AYLKRFFPPDIWQSSERLRNRMYYWMRGRYRFTAEYMSLVLQCGYQDMHQLLDQYIRSVACFRPADFEEPEKDFFGIVTLPTPAFGFDKLDQRMREKV # KTIAHEYLFTSKLETCLGQDERAYIELGLARISGYNGQLSLKIDEPLVLLSCSVWFNEQRSHTVYKTLANRIQIHNPTTGRDGFEEFIAYYLLKVFEK # LRKLNDVFDFEGADDNGLQNREAQLVTLHLDENQRLVEGKVSLARGTSSLFGPIGLAIGPEDHSTLYEWLNWKKQATFCFPMNCMGPDIMCFLKLKGQ # GPGKNWGKFTYVCLAIQCKFYRAESLRPCTLRGAISTTTPGLFFAVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g184 ### # start gene g185 7 AUGUSTUS gene 784539 786071 0.61 - . g185 7 AUGUSTUS transcript 784539 786071 0.61 - . g185.t1 7 AUGUSTUS stop_codon 784539 784541 . - 0 transcript_id "g185.t1"; gene_id "g185"; 7 AUGUSTUS CDS 784539 785272 0.98 - 2 transcript_id "g185.t1"; gene_id "g185"; 7 AUGUSTUS CDS 785356 785511 0.67 - 2 transcript_id "g185.t1"; gene_id "g185"; 7 AUGUSTUS CDS 785618 786071 0.89 - 0 transcript_id "g185.t1"; gene_id "g185"; 7 AUGUSTUS start_codon 786069 786071 . - 0 transcript_id "g185.t1"; gene_id "g185"; # protein sequence = [MLKSKISEGFLSDEDLDEAITHSWDEIQSFWNSPEMSTAGDSFYIAIDEANVASRKHDEAFEDQHGRYPILKEIIRGL # RRQIGSSKLPIRFVVAGTMIPEDHFQSTVGEWDDFRWCSDTGSFNDPEDHRRYVSQFMPDSFSSSVTGQALIAPSFLAVLLRHNYQSPHTLLGNYIGN # FTEYVPDDNEEYSRGEEPRYNNWYSPLGSLSMVEMHRAVVTFLTTSEGSVDCSTKDRTLVTEDYGYFTDPDCSHIALDEPLTVTYGAGWLKQNSYFSF # AKFIQIFHNNKRDDIQDIQPTPTHFALFLALSFSSILDHYCEPSSAFTIIGLPASLPQVKLVTFTRIAHRLQAVDVCPWREDAYDKLVLMASTPEETL # SWFKHERDEPFCVLLSSSSNQLILVFCLQLADARCFWTFVWISSTNEDELDFAQDIKNLHPNELFRDQVCVVTFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g185 ### # start gene g186 7 AUGUSTUS gene 788459 790692 0.09 + . g186 7 AUGUSTUS transcript 788459 790692 0.09 + . g186.t1 7 AUGUSTUS start_codon 788459 788461 . + 0 transcript_id "g186.t1"; gene_id "g186"; 7 AUGUSTUS CDS 788459 789624 0.18 + 0 transcript_id "g186.t1"; gene_id "g186"; 7 AUGUSTUS CDS 789720 789910 0.69 + 1 transcript_id "g186.t1"; gene_id "g186"; 7 AUGUSTUS CDS 789974 790692 0.48 + 2 transcript_id "g186.t1"; gene_id "g186"; 7 AUGUSTUS stop_codon 790690 790692 . + 0 transcript_id "g186.t1"; gene_id "g186"; # protein sequence = [MNQLLMGISSNGKINLVANGEWRRPFWTPPKSLSDDSHAESETTAYIESLHIPLGNPNKEIPLIILHELGSFQYNVKL # RNRLDQIFSPSSHTYEGFSQATKSLTLIIRRFLVNTSGTGKTKLLFEGLCMHWGFYMTCAIDSFNLGAADFPLAVSNLNRNSTWTAYLPSTSSANHVS # LLQTNIRLVYRAVSEVLLTRLLIFRMYLEACAKEGFCLQQRQRWLELQISPKNTISSSDAFGMLKYKITRAGLSDDDLDKAIRHSWDEIQSFWDSPEM # STVGDFLYIALDEANVASRKYDEAFEDHHGRYPILKELIRGLRRQLGHLPIRFVVAGTIIPENQFQSLVGEWDDFRWCSDTGSFNDPEDHRRYVSQFM # PVSFASSVTGQALIDRMHRYTASFLAVLLHSNFTSPHTLLGNYIRNFTEYAPHDNEEYSRGEEPRYNNWYSPLGSKGLLERSLSTAEMHRAVIAFLTT # ARGIIDCSTKDRILITEDYGYFMDPECSQIALDEPLTVTYGAGWLKKNLYFSTRKFISFFCNHKRDDIKEVTPSHYALYLALTFVSTLDHLCDTSDVF # TVIGLPPTSLPQVKLVTFTATRRLKAVDVHPWGEEPHDRLVLMASSQEETLSWFKHERDEPFCVLQHPSSIGLILVFCLQLADARCFWVFVHISSTHT # NKEDPNIIQDIQDLHPNEVFRDQVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g186 ### # start gene g187 7 AUGUSTUS gene 790845 791492 0.7 + . g187 7 AUGUSTUS transcript 790845 791492 0.7 + . g187.t1 7 AUGUSTUS start_codon 790845 790847 . + 0 transcript_id "g187.t1"; gene_id "g187"; 7 AUGUSTUS CDS 790845 791492 0.7 + 0 transcript_id "g187.t1"; gene_id "g187"; 7 AUGUSTUS stop_codon 791490 791492 . + 0 transcript_id "g187.t1"; gene_id "g187"; # protein sequence = [MKDSIPQELFPAGLLNIEGLDEADKKVSHDMLMRRLSQIIAQKIKNDPQVVSPGMVDENDSHQKGKRQRGRSSTVVDD # TGVAPSGTVSGTRKTKSIKLDKGDDIAGPSTSGNRRTKGPKSTNVDSVTLGSSARTGKQFYQLSEADSETPRYSPARQFRCFEVFKISSLKMLIRTIE # NLTCSFSFLSSSSPAGPAIIIRFVLPATQNFPQVSLCVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g187 ### # start gene g188 7 AUGUSTUS gene 793258 793503 0.94 - . g188 7 AUGUSTUS transcript 793258 793503 0.94 - . g188.t1 7 AUGUSTUS stop_codon 793258 793260 . - 0 transcript_id "g188.t1"; gene_id "g188"; 7 AUGUSTUS CDS 793258 793503 0.94 - 0 transcript_id "g188.t1"; gene_id "g188"; 7 AUGUSTUS start_codon 793501 793503 . - 0 transcript_id "g188.t1"; gene_id "g188"; # protein sequence = [MIKALSIAQDKLRDEADDLLEEERALDSQIEEYARLMRLVDGSSESDRAGFAQIVEDYIRVEKETEECRRDLRRLGWT # GPD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g188 ### # start gene g189 7 AUGUSTUS gene 799866 800894 0.97 + . g189 7 AUGUSTUS transcript 799866 800894 0.97 + . g189.t1 7 AUGUSTUS start_codon 799866 799868 . + 0 transcript_id "g189.t1"; gene_id "g189"; 7 AUGUSTUS CDS 799866 800894 0.97 + 0 transcript_id "g189.t1"; gene_id "g189"; 7 AUGUSTUS stop_codon 800892 800894 . + 0 transcript_id "g189.t1"; gene_id "g189"; # protein sequence = [MEYRTDETNVFHSTHPDGQTGLSYSLEVPETSHSQDSLPTSNLFTGNLSGQLPEYPFDYSQQYEPSSHTHSTVTSPLT # LPHATFSPSPPHVSPTDSPISLNTLEQPTPSNAPVSPIACMWGNCHARFSAADELIEHVNAEHLMLMSSAANSKHNVACQPNEEHHEYFSCLWRDCHE # FFPELVDAPSNDKPHLPYDQFTVHILSHLGYPGPNQSTLPKYPDDYPKEYIDMYAHSFPNTSESAAERASDSSRSESASSRSVTPPFSMEGQEHLHQC # KGSHMCRWNGCGLTFDSCDDLTTHLTQAHVGSGKPHYDCYWGECVRNGQSGFTSKQKICRHLQVGLIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g189 ### # start gene g190 7 AUGUSTUS gene 802309 802656 0.88 - . g190 7 AUGUSTUS transcript 802309 802656 0.88 - . g190.t1 7 AUGUSTUS stop_codon 802309 802311 . - 0 transcript_id "g190.t1"; gene_id "g190"; 7 AUGUSTUS CDS 802309 802656 0.88 - 0 transcript_id "g190.t1"; gene_id "g190"; 7 AUGUSTUS start_codon 802654 802656 . - 0 transcript_id "g190.t1"; gene_id "g190"; # protein sequence = [MDASSLSDDLSDYDVVSDPGRHSLESSIADLTPNPAPTNEPSPVQEAYDKFATIRLTANDIEVNTRTSLGLAPASSST # KAARTGNDNRTKRVYVDGLFDIFNAGYVAKFSAQSLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g190 ### # start gene g191 7 AUGUSTUS gene 804247 806718 0.86 - . g191 7 AUGUSTUS transcript 804247 806718 0.86 - . g191.t1 7 AUGUSTUS stop_codon 804247 804249 . - 0 transcript_id "g191.t1"; gene_id "g191"; 7 AUGUSTUS CDS 804247 806718 0.86 - 0 transcript_id "g191.t1"; gene_id "g191"; 7 AUGUSTUS start_codon 806716 806718 . - 0 transcript_id "g191.t1"; gene_id "g191"; # protein sequence = [MAAIKIIPKNLLASRVEGLNLAGAEAERQEQSLRREVVLMKLIEHPNIMKLYDVWDLPDELFLVLEYVQGGELLEYLS # KAIESGQKSIPLSQALSYFQQIILAVSYCHRFNVSHRDLKLENILVDSDNNIKIADFGLASFQPDSIVRTACGSLHYCAPEVVTGYGNYNGPMADVWS # CGIILFALLTCSLPFNPENDDDLKDEIIHAEVPFPTGLDSDAQDLISRMLTKNVQERITMSKIQRHPFFLSEKPKITYGGIPSLETISVPLKSIDDID # LELLRSLRTLWREAPDEELKNSLVNPDRNWQKGAYYLLFEYRRKRLEEYDEQVAEIERKRMHKEARARAEANRAAKFKKEKAGIQTFPSPVPSCDGPP # TPRRATRHGRYVESLPSPSSMPSRDGPPTPRRAARGGRPREATSAASSDASFIPRERPSHLVPSTFSEDDIKSSLDENALRPQSITRNASPLLPLTVP # ETEDPKVQAFYTQVLEHLSVLHARTGGPINTNTSASPQGVISPNLALMQEIFEDRTMSGESESSPVPTPFAPMNFGLTQLNHINKETCAASPPITIRF # PTRPLSLKRKETVQRPKRPTIKTGNDTANKENGQLLTATYGGVELMKKSSLRKGGLHGTGKRVQIVDPGIPPDKPSKLKKKRSLRGPPSSPAPSSTSS # VLSSSSPFLSPMSTGSAWFTNVFKFSRPEVFTLHSTHSVHVTRNECRRLLMAMDVRVVLEDAEGLGILKCKLDEVRNSNGIMSVLKAVKFKIDVRQTE # EELFLILVHEKGSTDSFREVCKRLRRQWVLDAVESRIPEQLIPSPLGMATRRMELLSPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g191 ### # start gene g192 7 AUGUSTUS gene 810689 811120 0.94 + . g192 7 AUGUSTUS transcript 810689 811120 0.94 + . g192.t1 7 AUGUSTUS start_codon 810689 810691 . + 0 transcript_id "g192.t1"; gene_id "g192"; 7 AUGUSTUS CDS 810689 811120 0.94 + 0 transcript_id "g192.t1"; gene_id "g192"; 7 AUGUSTUS stop_codon 811118 811120 . + 0 transcript_id "g192.t1"; gene_id "g192"; # protein sequence = [MSSSRYFIDASKSGVETDGYKADEPVQDDQDEDMPEGDESSSTVVRAETEARSQTAATEIKEEYEQDEKHADWFHLDT # TDTQNLEIGKESDSETEDDSDNADVAGEDIADDNIDDWDKLYADDLPSAPLPMDEDIDVASLFIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g192 ### # start gene g193 7 AUGUSTUS gene 812785 814901 0.66 + . g193 7 AUGUSTUS transcript 812785 814901 0.66 + . g193.t1 7 AUGUSTUS start_codon 812785 812787 . + 0 transcript_id "g193.t1"; gene_id "g193"; 7 AUGUSTUS CDS 812785 814269 0.67 + 0 transcript_id "g193.t1"; gene_id "g193"; 7 AUGUSTUS CDS 814320 814901 0.7 + 0 transcript_id "g193.t1"; gene_id "g193"; 7 AUGUSTUS stop_codon 814899 814901 . + 0 transcript_id "g193.t1"; gene_id "g193"; # protein sequence = [MVRSRVHAGLAHLLINLLQVVPKVESPVQTPVLSQQLAPQQPKPFYPLPDTVSLTALQTFQASVSGPPVTPHIRRVQT # LNEIAERSPLPPSSPFLNSPQSSPVRPIVNLVSSPGPMGPPPEEESYGKLPYTLPSGPYSPNKPDLSYAALLGQAILSSSDHRLTLQEIYDWITIVYP # FFKRGETTWMNSIRHVLSTTACFRKVTRDRALGRTQWAIWDEDLECFKGGGFRKQFCKDMNGGKTGSEAKTKRGRKQVEDSDGSAEPKPKKVKKDNNL # KDSDKGHQRAIAPATAIFPPTRPAPPLQPYRGASVAKNLTSEVVFPPLPAESGFRLLPVHPSSSSNSRANSHFDTDDGMRPSSPTPSVLESQCTDPSS # TSSVPDLTPNLSSSSPPQSSNEMELEAPIEIIDGPLCLAPSATVAGLDSEEEDGFQNMFSSSKSSTKLTPVQFWGDSPRIKELSSLGGKLNFTVPALS # QYDDDSEDEGILFNAVRNKNKSMLAEPFDRLPPSPTNRRPATKGRKSKVAASKARNLRPMRLSTPPPRDNLTTPPPNQTLEISPVRTPLSHKGLHMSP # TASLAHYKSHLDPPPTLQFAQSSSGGAPSTPKRSLAFPLLDDSPFRTSLIGMSPFRTPGSSGLFDPHDPRALLDEEFRRMGPGGFGETSPASGLFGKE # RQLLYDSPSGLDSSPGKYKRWW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g193 ### # start gene g194 7 AUGUSTUS gene 815656 817423 0.37 + . g194 7 AUGUSTUS transcript 815656 817423 0.37 + . g194.t1 7 AUGUSTUS start_codon 815656 815658 . + 0 transcript_id "g194.t1"; gene_id "g194"; 7 AUGUSTUS CDS 815656 816161 0.38 + 0 transcript_id "g194.t1"; gene_id "g194"; 7 AUGUSTUS CDS 816213 816639 0.6 + 1 transcript_id "g194.t1"; gene_id "g194"; 7 AUGUSTUS CDS 816854 817423 1 + 0 transcript_id "g194.t1"; gene_id "g194"; 7 AUGUSTUS stop_codon 817421 817423 . + 0 transcript_id "g194.t1"; gene_id "g194"; # protein sequence = [MFIPHVIYLGILSRNIPSDQEDLNAQNIEPISIVVCNLYPFTSTISQPNCTLADAVEEIDIGGVTLLRAAAKNHERVS # VLSDPADYAEFLEAWNNGQGDVGKAIRNKLALKAFEMTAKYDDAISGYFREQYASGDLPEEKLAGPVQRIPLRYGANPHQKPAQAYVTEGDNTHFVAL # RGSPGYINLLDALNSYALVKELQEALNLPAAASFKHVSPAGAAVGISLDETEKKVYGVDDLKESLTPLACAYARARGADRMSSFGDFIALSAPCDLAT # AKIISREVSDGIIAPGYSPEALDVLSKKKGGKYCVLESYPTYQLPSSAQTDLILATLALKYTQSNSVAYARNGAIIGLGAGQQSRIHCTRLAGGKADL # WWLRHHPHVLALPFKKGVKRAEKANAIDLFVSGEILEGGEKEHWESLFEGSVQGLTDAERKEWASKLEGVACSSDAFFPFPDNVHRAKKSGVKYLAAP # SGSVMDTECIKAADEHGMVFAHTSLRLFHH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g194 ### # start gene g195 7 AUGUSTUS gene 822751 824389 0.43 - . g195 7 AUGUSTUS transcript 822751 824389 0.43 - . g195.t1 7 AUGUSTUS stop_codon 822751 822753 . - 0 transcript_id "g195.t1"; gene_id "g195"; 7 AUGUSTUS CDS 822751 822865 0.81 - 1 transcript_id "g195.t1"; gene_id "g195"; 7 AUGUSTUS CDS 822975 824389 0.43 - 0 transcript_id "g195.t1"; gene_id "g195"; 7 AUGUSTUS start_codon 824387 824389 . - 0 transcript_id "g195.t1"; gene_id "g195"; # protein sequence = [MDSFKKAESLNGEVFNGRKIKISRNSRLKKQTHFPLRVEGLAVTTEKQKLMDFFKNSVLVEMIAPTYTDNPTHQLENL # LQTCGELEEFSVEVSPTNTARAMVFARFSDAAVASRAIATLNDTEHAFLGGGRLKVQETFYSCYCLPQEKASSVRADINSLQTIHGPGIKVQEHLNSA # DDFELRIYGSDSILFARARLEFDQLMEGEIILDDDNKPLWDDYFDLPSSTKQIDLMNTRNAGSFFIERDFRNRHVLAFGSKERRTRAKDLLYKFLAKV # QSCVLTMGVSDACMGHMIRAGYTNEAALSDKLHFDFSSRTITIRGSVDEREKEWATISKLTRENDASPTVVNEQSCRLCLSTVAEPVLLGCEHKFCQP # CLGLWFKSLINPNFTQMACVAAIDLDNSNDGEAETPRCSAPIPYSLIRKVLSNQEENDLLEHSFLSHVWERSEEYKLCPTHDCTMVYRVGSPGTLIHC # PATTDLSKIRVVIRIYELRVKLLPELAYMISDSTRSADL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g195 ### # start gene g196 7 AUGUSTUS gene 824906 827066 0.37 - . g196 7 AUGUSTUS transcript 824906 827066 0.37 - . g196.t1 7 AUGUSTUS stop_codon 824906 824908 . - 0 transcript_id "g196.t1"; gene_id "g196"; 7 AUGUSTUS CDS 824906 826973 0.92 - 1 transcript_id "g196.t1"; gene_id "g196"; 7 AUGUSTUS CDS 827062 827066 0.37 - 0 transcript_id "g196.t1"; gene_id "g196"; 7 AUGUSTUS start_codon 827064 827066 . - 0 transcript_id "g196.t1"; gene_id "g196"; # protein sequence = [MIITLDNESHGSSPSIKQQDTQVSSPFQSADDTDATEVHADRYPQPGSPYKQPVRNDHPSTFYSQYPPTVIPPGFVMH # AAPYFDPNVYTRTIPMIPSYAPISYLPPTTTLPPNLSGSSNLLTQSVPPVVSAPLSDHANARIPWCQRYFVDGNCPLGRSCRFRHRLTDEELQKLHAE # PAQEVPKVYLTPTHNEHGANSLQNKRECHFWKTNSCKKGANCPFLHSAVNKPGPIPSIIVDQEDHTHQEDPENNDFGWGSGSDSAVKWGETEETAEPA # NTSEWDNKAPSAESWGEDVESWGNAISSEPELSTKKGSEKRTSKAHDNNRRKDHLGPKGAYSKSSSRSRETQSSSSSRSREPRGTGSQRRGMETPPHL # WAKDRKSRWDNDGTLDSDKTRSTSSARSTVGAISADLSRRLDENEITSKPSSRAHNNNENYPVSPNGSNLLSTVPKEGSDADLGVLQELDSPEDTNDN # IDSPLPDAPDDADGDLTETAEISRDFNAYTGGNRPIDSGVTEGTIVTENIRDTRVDRERTTDEEEVEVVEGQPGSNDSDDSGLTHDANGQEGTSNRLH # EHVQEVVAEEDNRGIASGNTHSSMNWDAADDAWNGPNWGPTDPETYSHKPHSKLPCKAFGQGYCPFGENCEFSHISVDNDERQSSEVTVGIDDTIDVS # FKLDFPVGRHRHLSDISSKWLRSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g196 ### # start gene g197 7 AUGUSTUS gene 833974 835590 0.57 - . g197 7 AUGUSTUS transcript 833974 835590 0.57 - . g197.t1 7 AUGUSTUS stop_codon 833974 833976 . - 0 transcript_id "g197.t1"; gene_id "g197"; 7 AUGUSTUS CDS 833974 834889 0.87 - 1 transcript_id "g197.t1"; gene_id "g197"; 7 AUGUSTUS CDS 835445 835590 0.57 - 0 transcript_id "g197.t1"; gene_id "g197"; 7 AUGUSTUS start_codon 835588 835590 . - 0 transcript_id "g197.t1"; gene_id "g197"; # protein sequence = [MYIPRAATLAAVTSVPLHSLTITQTPNGFTNSARGWNSFGIQANAATDPGVDFIKLDFITPGSPDNGVSLPQNESLAV # VNYHNAIVKSGRQMRLDISWKLARDPSDFSIWEDNADSFRTDQDINNSGADSDSFTAWATVQRAIDNYRQYIVLHTSQDETLSIYPDMDNLYVGNSAP # EDGVTDDERFTIMSHWLGAGSNLILGNDLTQLDGSYFPQFLIVNCIDICVLDTGKAILTNAAAHSVADFAAKNPMRPRNPGTGEGDAQQLQAWIGGPD # DTGKVIVLLANYGPDEGQGGFNTTLTGVQNLTVTWQDLGISGSFDIQEVWNGQDLGSSSQQLNASLDEGQSLLVVMTPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g197 ### # start gene g198 7 AUGUSTUS gene 838957 841560 0.95 - . g198 7 AUGUSTUS transcript 838957 841560 0.95 - . g198.t1 7 AUGUSTUS stop_codon 838957 838959 . - 0 transcript_id "g198.t1"; gene_id "g198"; 7 AUGUSTUS CDS 838957 841560 0.95 - 0 transcript_id "g198.t1"; gene_id "g198"; 7 AUGUSTUS start_codon 841558 841560 . - 0 transcript_id "g198.t1"; gene_id "g198"; # protein sequence = [MSPPGSPRLIDSYTAPKEILQEFADLAEEENVDPFAETAKTRQIAARQSDYHNRRFERVAVDSADAFQEGGSEEGGYK # DAMRLARLEQEEVRVKRAIEEKERQEREEGKMKMDLDKTPPAAELQDVEMELASAKELAMSREQPGAKRKRRWDNPEPSDENADPNKMDTGEWSKEAL # EASAPKKRRSRWDATPAETPVAETPKRSRWDQTPVVQDTPMVPIIMNAPGLSQDDKHNRYLTDEELDAILPATGYVIVTPPPGYAPMVQPRKLQAPSV # TEVGGFHIQESSDAAAVAAAAGLAPELPTEIPGVGNLAFFKPEDAQYFAKIMKEEDETELSVDEMKERKIMRLLLKIKNGTPPVRKTALRQITDKARE # FGAGPLFDKILPLLMERTLEDQERHLLVKVIDRVLYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLSKAAGLAHMISTMRPDIDHADEY # VRNTTARAFSVVASALGIPSLLPFLKAVCRSKKSWQARHTGIRIVQQIAIMMGCAVLPHLRNLVDCIAHGLSDEQQKVRTMTALGLAALAEAAAPYGI # ESFDNVLKPLWLGIRLHRGKGLAAFLKAIGFIIPLMDPEYASYYTKEVTVILIREFQTSDEEMKKIVLKVVKQCAATEGVTPAYIKHDILPDFFKSFW # VRRMALDRRNYRQVVETTVELAQKAGVSEIVGRIVNELKDEAEPYRKMVMETITKVVATLGASDIDERLEVRLVDGIIYSFQEQTTEDQVMLDGFGTV # VNALGIRVKPYLTQIVSTILWRLNNKSAKVRQQAADLTTRLAVVIKQCGEDQLLSKLGLVLFEQLGEEYPDTLGSIIAAEGAIANVVGMTQMNPPVKD # LCECH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g198 ### # start gene g199 7 AUGUSTUS gene 842676 845476 0.27 - . g199 7 AUGUSTUS transcript 842676 845476 0.27 - . g199.t1 7 AUGUSTUS stop_codon 842676 842678 . - 0 transcript_id "g199.t1"; gene_id "g199"; 7 AUGUSTUS CDS 842676 844759 0.8 - 2 transcript_id "g199.t1"; gene_id "g199"; 7 AUGUSTUS CDS 844849 845476 0.29 - 0 transcript_id "g199.t1"; gene_id "g199"; 7 AUGUSTUS start_codon 845474 845476 . - 0 transcript_id "g199.t1"; gene_id "g199"; # protein sequence = [MQPSTYDIQREVEALRDIRRRSTTPGALTIDPDLPNQTSPASSTYSWSGGSTADDSSSSSNEDGSSSSTGHTTVETDN # PTDDPFHLFWVPASVHPEIAPAEFREFLREHSRSPPPVDGAPVSRSGSLSSLSAGGLGRKKSMLSRQYRPSENDGVEEQDERIVPLSRTRSTRYVNQG # PQLTISDLQKLEQLAEEASESDDPSKLRNILRRKQMKNMPDMGDEADAPIIIPPRGQILRRTNRTKIRKPALPGDGGGHRFGASRRGGRSAAAAAAAI # TTTTTSERTSSDYSSSDHEPEVRPRLLSNEFPPVRPESFSEETSIYDAYVNEEEEVYPSTVVVTTSPPPQEAPRVSLQQTPAANPPPEPEPMSVQPLP # DVDVEAVLVQPAPDAVLHQPQPQRLLSPQVISEPSPPPVTPSPPSSPITEPPAAPLSFLSSPPPPHQHHRKEKDKKGLFGKWGSDKGGKKAKDHARSE # SAEKEKEKDSGFFGSLFGGKKSKDSESFASTSSAHGHTAGREAAQALLGASKSSKSYQPPPSPGAQAINNYSRYPIHVERAIYRLSHIKLANPRRPLY # EQVLISNLMFWYLGVINKAQNPTANGQTGVGQTAAGGAPNPTDKEQQEKEQREAEQKEKERLEQERQEREQREQREREMEMKKQKEALPKRGPLTKPA # PMGTGGGRRAEIPIRGPQYEMQHREMEQAYGGYAGYNSGPTSQQGMPQGRRSPGQGQRASPSPQSAPRLVQPADSQTPDNFYYSPDAAQSQPQQSVYA # QQHQQQRLPPGAMPPVEKSNWATPGSPRQSNSSPPPILGSNPQRRSQSPPNAYSQQGAYGNNMSTGGGRTPGRSLSATAVPSPSPPNANGRIRKGVSA # HAVPSKARPRTPESPLLAYPTNGVAEEEDVPLAVWQQQRKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g199 ### # start gene g200 7 AUGUSTUS gene 848229 848999 0.28 - . g200 7 AUGUSTUS transcript 848229 848999 0.28 - . g200.t1 7 AUGUSTUS stop_codon 848229 848231 . - 0 transcript_id "g200.t1"; gene_id "g200"; 7 AUGUSTUS CDS 848229 848848 0.42 - 2 transcript_id "g200.t1"; gene_id "g200"; 7 AUGUSTUS CDS 848969 848999 0.33 - 0 transcript_id "g200.t1"; gene_id "g200"; 7 AUGUSTUS start_codon 848997 848999 . - 0 transcript_id "g200.t1"; gene_id "g200"; # protein sequence = [MKQSGTETNSTRLVLFHILCSVSKTADSYARQTIQPRAEPADLILLDPKIVASILRRAISTPETQDCKPELITTRQEL # SSTFGGTITQFVTGYPVVYSSMLRKVKTIPNATQHKQRYFIFPNKTPEFNAHFPSRPGAHGLMFGMRPRMEHLLEDKNASIFELFVPVNRAQCGVNMF # TVPTSKVPVEYYGTYKLVKQGSMLAQDFARQPQSVYIPKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g200 ### # start gene g201 7 AUGUSTUS gene 851516 852343 0.68 + . g201 7 AUGUSTUS transcript 851516 852343 0.68 + . g201.t1 7 AUGUSTUS start_codon 851516 851518 . + 0 transcript_id "g201.t1"; gene_id "g201"; 7 AUGUSTUS CDS 851516 852343 0.68 + 0 transcript_id "g201.t1"; gene_id "g201"; 7 AUGUSTUS stop_codon 852341 852343 . + 0 transcript_id "g201.t1"; gene_id "g201"; # protein sequence = [MLTDAANIVFQAAKRRCFVDVQPEQGEVIDLDDDDEAWDAVFELEGRPSEARQSTNKGKGKATGKRPGWLPKEIHPVL # EELPKWSLLAEIIEEIEVEIVRMESTVSSRPVKDPPGTNVTLIMCSSTATCTLLNDFLSSMDNTRPKGEWGRRMMLKKLRSWIWWEKRRKMMQEVTQS # ANSSGKKGGSNIAQEMVRGGSTSGNGNEGLSEAMRKKDRERAAQAASRRRVRGGAPVNNSGRGSTVPRDTPAPGASTSELGLGQTISDDLCVVHALRV # S] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g201 ### # start gene g202 7 AUGUSTUS gene 855300 856203 0.83 - . g202 7 AUGUSTUS transcript 855300 856203 0.83 - . g202.t1 7 AUGUSTUS stop_codon 855300 855302 . - 0 transcript_id "g202.t1"; gene_id "g202"; 7 AUGUSTUS CDS 855300 855551 0.84 - 0 transcript_id "g202.t1"; gene_id "g202"; 7 AUGUSTUS CDS 855700 856203 0.89 - 0 transcript_id "g202.t1"; gene_id "g202"; 7 AUGUSTUS start_codon 856201 856203 . - 0 transcript_id "g202.t1"; gene_id "g202"; # protein sequence = [MSLHNQPNKEKSTIVIVGGGAGGLSLLNNLSTTIDPDKQRVILIDARPTMIHLPSTLRLIVSNADDLLKRSIHPYGDH # TFRNKLTGTGIFIHASVKEIDFGKPGDGGILTLDNGETVAYDVLVFATGSTWPRPIAFPTENMKEITEHIQAMRAEFDTAQDILLVGGGSLKPITIIH # RENHLLNATYPDKYRIAVQKQLEGRGITVLTGDAISASDASKVSGSQIPKDGFITEQGKTLKADLVVSNLVSEYY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g202 ### # start gene g203 7 AUGUSTUS gene 863657 864274 0.91 + . g203 7 AUGUSTUS transcript 863657 864274 0.91 + . g203.t1 7 AUGUSTUS start_codon 863657 863659 . + 0 transcript_id "g203.t1"; gene_id "g203"; 7 AUGUSTUS CDS 863657 864274 0.91 + 0 transcript_id "g203.t1"; gene_id "g203"; 7 AUGUSTUS stop_codon 864272 864274 . + 0 transcript_id "g203.t1"; gene_id "g203"; # protein sequence = [MWNTFTKNKVGLPLQEFILKVGYDFGQSFLMRRGERDDEDGVELELYVGHEINERYYMWLCPVQDSYFSHNFRHYTLY # IFFSTPYIQLSMATLPRPTKSPAASVIRPHSEFDAGINASNAWTQYHLSGDLSDEELNLENAGNDHPDRRPARALYDFEGKPEFRELSVHAGDELEVV # REELADGWSLVCDVDGEIGLLPRSYFIVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g203 ### # start gene g204 7 AUGUSTUS gene 871933 872700 0.53 - . g204 7 AUGUSTUS transcript 871933 872700 0.53 - . g204.t1 7 AUGUSTUS stop_codon 871933 871935 . - 0 transcript_id "g204.t1"; gene_id "g204"; 7 AUGUSTUS CDS 871933 872700 0.53 - 0 transcript_id "g204.t1"; gene_id "g204"; 7 AUGUSTUS start_codon 872698 872700 . - 0 transcript_id "g204.t1"; gene_id "g204"; # protein sequence = [MKLDTSAKTAHDMRRSPWNQTVISLLAAKASEYALEKSKYYGNNGEEVDWRGLFNNRVYRLLLEVVKAKAGVWDNLYE # AQKHESKKRRVREYVHIFDSVSSHVQTQFLCSQTHQRRMQISSVMSDIARRTDDNEEYNCWSDILYSLDVLGVAGMSDTEEVFDTQGQQGIIKYEPGF # RHPQFNVLFDTVDKVPQVATHLFRQIGRKWLPRIRGIVPVTRNPPENLPSSYYQIEYLETMKNDPSNVITMAKGRPILR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g204 ### # start gene g205 7 AUGUSTUS gene 873260 873739 0.68 - . g205 7 AUGUSTUS transcript 873260 873739 0.68 - . g205.t1 7 AUGUSTUS stop_codon 873260 873262 . - 0 transcript_id "g205.t1"; gene_id "g205"; 7 AUGUSTUS CDS 873260 873739 0.68 - 0 transcript_id "g205.t1"; gene_id "g205"; 7 AUGUSTUS start_codon 873737 873739 . - 0 transcript_id "g205.t1"; gene_id "g205"; # protein sequence = [MIKVCREHGNQAGVEFWSYALNVNELLGDQGQSDEEDTTRDVEIEGVVVEQSVKKVLRVYWQHPWLEALFRIMNQAPA # LEKLIFHRAGAKRIPRIYSDTISHRALITGYPREFFREAFLSALLPHKVAALNLSEYSFPLADFSGYDPSTTFSGEPMQTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g205 ### # start gene g206 7 AUGUSTUS gene 882043 882712 0.77 - . g206 7 AUGUSTUS transcript 882043 882712 0.77 - . g206.t1 7 AUGUSTUS stop_codon 882043 882045 . - 0 transcript_id "g206.t1"; gene_id "g206"; 7 AUGUSTUS CDS 882043 882262 0.83 - 1 transcript_id "g206.t1"; gene_id "g206"; 7 AUGUSTUS CDS 882370 882479 0.86 - 0 transcript_id "g206.t1"; gene_id "g206"; 7 AUGUSTUS CDS 882527 882712 0.93 - 0 transcript_id "g206.t1"; gene_id "g206"; 7 AUGUSTUS start_codon 882710 882712 . - 0 transcript_id "g206.t1"; gene_id "g206"; # protein sequence = [MEEDSTLTFQNPQQHLGSSPVPSTISMFIHFVIQMRLMVFQSDVDMHNSSVIIRDPASTQHERRPLAHSRTIYMDVDV # NVPHIHEHATQLNTKRSRDLRDQRLYSSGAEMTIKNHEIANLRAQVSRLESDAQDLQDSLSAQKHQNEGAWASASAKESINQEVRNCQLLTLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g206 ### # start gene g207 7 AUGUSTUS gene 885102 885611 0.83 + . g207 7 AUGUSTUS transcript 885102 885611 0.83 + . g207.t1 7 AUGUSTUS start_codon 885102 885104 . + 0 transcript_id "g207.t1"; gene_id "g207"; 7 AUGUSTUS CDS 885102 885611 0.83 + 0 transcript_id "g207.t1"; gene_id "g207"; 7 AUGUSTUS stop_codon 885609 885611 . + 0 transcript_id "g207.t1"; gene_id "g207"; # protein sequence = [MSSTGPQRTQKVSPRASPYSGPSLGVERSSTPVSPSSSLSSVHSLLSISSELEYDTDRERLARRQRTWHRQSLAYDSD # DGVQLSRANGTKQSSNSLADVTTNVCHNADTQSTKPGRKHGPPALVFEDDSDDDLIPKPPGEVGRLNRGGYSLFLVLGWPKKKYNKVKVCA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g207 ### # start gene g208 7 AUGUSTUS gene 888014 889765 0.56 - . g208 7 AUGUSTUS transcript 888014 889765 0.56 - . g208.t1 7 AUGUSTUS stop_codon 888014 888016 . - 0 transcript_id "g208.t1"; gene_id "g208"; 7 AUGUSTUS CDS 888014 888696 0.98 - 2 transcript_id "g208.t1"; gene_id "g208"; 7 AUGUSTUS CDS 889072 889765 0.56 - 0 transcript_id "g208.t1"; gene_id "g208"; 7 AUGUSTUS start_codon 889763 889765 . - 0 transcript_id "g208.t1"; gene_id "g208"; # protein sequence = [MDPLSGKCFFDPTQDKNSPTVIAYCIALAARVLERTAQCGATFILKMIKIFGYTLATLGGRTLNTDQEIALAGIPESI # ERLEKKFNLDVDCVPYAVCPKCSMTYAPSFPNGASHPVYPPICLERQTSSEEPCNASLLSYGKPAKIFKYYPFFDWFGKFISLPGIEEYGDKFCEAVE # SHQNVPIRKVDQTDGCLVHEFLGADARLFIADRGSEGRWLFTLNADFFNTEGNRIRRTDYEEWKSADDAFLRKGAELWRDAPDTKKRKILEDMFGTRA # SEFWRLLYWKASIQLGIDPMHTMFLILLQRYFRDILGLDNPDDPKRTLKKPKFKFAFYHNFTPPPPLSSLVSQEDSTRLRTSIIGYESQPIDDNLLSL # LEWPHLSTEHSAYRCARLQSLQVQISNDSRARQAVLDILNDLSERAPVTEAQKHQLYSRIQRHKWSAILYVCNNLAIFPNERPPDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g208 ### # start gene g209 7 AUGUSTUS gene 891823 892182 0.87 - . g209 7 AUGUSTUS transcript 891823 892182 0.87 - . g209.t1 7 AUGUSTUS stop_codon 891823 891825 . - 0 transcript_id "g209.t1"; gene_id "g209"; 7 AUGUSTUS CDS 891823 892182 0.87 - 0 transcript_id "g209.t1"; gene_id "g209"; 7 AUGUSTUS start_codon 892180 892182 . - 0 transcript_id "g209.t1"; gene_id "g209"; # protein sequence = [MTSYRDLLGSLKDEPSKLSSLSSPPDLSSKSTSSPDNAKPKLHWPSAAAASDLRSKYQTLLRHADEASNYNMSVMAAA # ISSSMQSATPQLPSIECSLHKFQAEITKQTVRPFNQFQCIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g209 ### # start gene g210 7 AUGUSTUS gene 901121 901966 0.58 + . g210 7 AUGUSTUS transcript 901121 901966 0.58 + . g210.t1 7 AUGUSTUS start_codon 901121 901123 . + 0 transcript_id "g210.t1"; gene_id "g210"; 7 AUGUSTUS CDS 901121 901966 0.58 + 0 transcript_id "g210.t1"; gene_id "g210"; 7 AUGUSTUS stop_codon 901964 901966 . + 0 transcript_id "g210.t1"; gene_id "g210"; # protein sequence = [MSMRGFSHLATQLLIHNFQHSLGDNSRPVMDVDELDGIGRLSGWINESLRIGNPQLYSKSQCSLHTLRKNEIRKSATR # HPAKGMSLPKERVVRSHPDNVPKGGLPVPLPGEEPPRRIIPRGNDSETLQCPEVGRVLIGVDQALAGTGISVRQAISSRCVNVIGNASELVGSSEQLV # RLVASPPNTQPLAGCLSRIPRCKLDNAGPVGIGRPSQGALVPSNVVAERAECSRLDNPCRELFIELFSGLFSRHDLSNEFYFHFAWGLYTGKNPVEDV # SKLAHVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g210 ### # start gene g211 7 AUGUSTUS gene 905867 907258 0.29 - . g211 7 AUGUSTUS transcript 905867 907258 0.29 - . g211.t1 7 AUGUSTUS stop_codon 905867 905869 . - 0 transcript_id "g211.t1"; gene_id "g211"; 7 AUGUSTUS CDS 905867 906695 0.48 - 1 transcript_id "g211.t1"; gene_id "g211"; 7 AUGUSTUS CDS 907158 907258 0.38 - 0 transcript_id "g211.t1"; gene_id "g211"; 7 AUGUSTUS start_codon 907256 907258 . - 0 transcript_id "g211.t1"; gene_id "g211"; # protein sequence = [MGATLVVKPEGEDTKEEKIKELGTMLQRLPRVHLLSTGIDAKQLLAAQHAAQGRTKSPPPVPPMPSMTSIPAPPPILS # PQPMPPPPPLPQAVSPPAPAPPPAAESLEDLAPPTIPPPPPLTSTPAIDDVPPRPSFKTPPPEDEDLPPRPAFKEPSPEPEELETPPRPHFAEPSAEP # TPDAPPIPSPPAVSPPTPQPVRATEVKRSSRITSRSPSPADQSLSSVKSTISRSSSGGVRGPRMTRGPRAPGGPNRNSIGSGAGSPPSGVSPTSPSYK # RLSGGSGSRPSSVLGRSSAFSRRTMASDAEDEVVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g211 ### # start gene g212 7 AUGUSTUS gene 907508 908671 0.46 - . g212 7 AUGUSTUS transcript 907508 908671 0.46 - . g212.t1 7 AUGUSTUS stop_codon 907508 907510 . - 0 transcript_id "g212.t1"; gene_id "g212"; 7 AUGUSTUS CDS 907508 908671 0.46 - 0 transcript_id "g212.t1"; gene_id "g212"; 7 AUGUSTUS start_codon 908669 908671 . - 0 transcript_id "g212.t1"; gene_id "g212"; # protein sequence = [MQLNSPLPMSPPLPPRVDASPVPPMPAESVLLAGLSLPPAAISQLLTRAASELNLRPVRFPLLGEYKDCFTGEEFVAW # LKDNVQGLGGSLDRAEQAAKDLTERDGLLRRIGELGNDFEHSEEAFYQFRPKVCSLFIIAIIPNLSSQAFELPDKSTDTTSPIKLQPDELLKRTNTIF # NAVSKALQTNQSSEPTHMKARHEAEDADKAYRVAVRQLDRQRLGLEERLEDTLKTLQRWEFERLRAVKTGKFASPLTFYPPVDMRNQVLLQYQGTLAN # LPKSLEPVIERQGLLIAAFQPENDLNALIERYRTGPFRPDAQVYESVAHDESDVVFGIDLRKWSEGGWSMLMSPNEEHKETIPPVVEALLNAITAAYD # KLPNDAGLCAASSMC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g212 ### # start gene g213 7 AUGUSTUS gene 911354 912235 0.33 + . g213 7 AUGUSTUS transcript 911354 912235 0.33 + . g213.t1 7 AUGUSTUS start_codon 911354 911356 . + 0 transcript_id "g213.t1"; gene_id "g213"; 7 AUGUSTUS CDS 911354 912235 0.33 + 0 transcript_id "g213.t1"; gene_id "g213"; 7 AUGUSTUS stop_codon 912233 912235 . + 0 transcript_id "g213.t1"; gene_id "g213"; # protein sequence = [MNQDMNAFTSAAASMTMRGCDRTSSSCVRQREDIIAKYLRKGTDDEHDLQKSWHYYERNYTPSYSTCSPITIPTLPLL # SPLSNPPSQAPCVMPTKYRSRRPSSVLFDSHHDLPRSVPLLRSLHSSYPLHNALEPSTTIIPASQPFTNTTRNYVQPMSSLETANDLPMQDSNLSTDQ # RAVPSTVLPSVFSFDSSLLEVDEHEQPYRTPDKGQYRDLSSNSPFPSSYMHQSSMGAEHRYPNNVLLGDSSSTMMYNFLHGSPFLNVNSEVSSRSSTE # IPPPMEKELFQIYHPQAMQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g213 ### # start gene g214 7 AUGUSTUS gene 920205 920597 0.71 - . g214 7 AUGUSTUS transcript 920205 920597 0.71 - . g214.t1 7 AUGUSTUS stop_codon 920205 920207 . - 0 transcript_id "g214.t1"; gene_id "g214"; 7 AUGUSTUS CDS 920205 920597 0.71 - 0 transcript_id "g214.t1"; gene_id "g214"; 7 AUGUSTUS start_codon 920595 920597 . - 0 transcript_id "g214.t1"; gene_id "g214"; # protein sequence = [MFNVMARLDVPTYDDPLVQRQLEQAFPSNSRQTVIWRTVVGVINMGSTAIMLLSQLSVLSTVLKNQQDGTLIALLSFS # HSILSSNSDTQSLFTRGMSLFSFGFKGMTFAQYGLLLLTMLTLSNCLVSGRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g214 ### # start gene g215 7 AUGUSTUS gene 922458 923060 0.36 + . g215 7 AUGUSTUS transcript 922458 923060 0.36 + . g215.t1 7 AUGUSTUS start_codon 922458 922460 . + 0 transcript_id "g215.t1"; gene_id "g215"; 7 AUGUSTUS CDS 922458 923060 0.36 + 0 transcript_id "g215.t1"; gene_id "g215"; 7 AUGUSTUS stop_codon 923058 923060 . + 0 transcript_id "g215.t1"; gene_id "g215"; # protein sequence = [MYKVMEDRHSRLATEFDDEDLQGITKNGGGCDLVGFANIELTKFFTLWPGLLRFARNQPETESICASPMSLSVWADKD # VLRSTPTSAVSPLAYGKKVFRSIVLCIVLLIAVLSTNVFTWSSPINYCKAFLLSNLNKYGNEQLCSQYDVLVPKNLLWNTVGEVVGTEEFKDRAVNWL # AGAIRIPYVHTVHNASLHANISTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g215 ### # start gene g216 7 AUGUSTUS gene 931330 932545 0.56 + . g216 7 AUGUSTUS transcript 931330 932545 0.56 + . g216.t1 7 AUGUSTUS start_codon 931330 931332 . + 0 transcript_id "g216.t1"; gene_id "g216"; 7 AUGUSTUS CDS 931330 931345 0.56 + 0 transcript_id "g216.t1"; gene_id "g216"; 7 AUGUSTUS CDS 931644 932545 1 + 2 transcript_id "g216.t1"; gene_id "g216"; 7 AUGUSTUS stop_codon 932543 932545 . + 0 transcript_id "g216.t1"; gene_id "g216"; # protein sequence = [MPEEHDRASHREDRHRSSKHEERDGHREREHRDRGDRSDRYGGRRGDDRRDGRGDRDRERYSRGPREFDERRPRDDDR # RRGREDDGYGPPRDRGDRGERRGRGGGGGGEGRGGGGGGGGGGGGRREATPPERRSPTPEGAVPLTQRRRKASGWDVHAPGYEQYSAMQAKQTGLLNH # AVSHLLFPNDFAGLFNLPGANRTQIPPILGIAGLPPPMPVQTFGMGIGANPNLSRQSRRLYIGSITPEVNEQNLAEFFNQKMAEMNIGTSTPGPPVLA # VQCNYEKNYAFVEVIYDQFYLLCCLMSVLVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g216 ### # start gene g217 7 AUGUSTUS gene 932950 933513 0.75 + . g217 7 AUGUSTUS transcript 932950 933513 0.75 + . g217.t1 7 AUGUSTUS start_codon 932950 932952 . + 0 transcript_id "g217.t1"; gene_id "g217"; 7 AUGUSTUS CDS 932950 933513 0.75 + 0 transcript_id "g217.t1"; gene_id "g217"; 7 AUGUSTUS stop_codon 933511 933513 . + 0 transcript_id "g217.t1"; gene_id "g217"; # protein sequence = [MELGDRYLVVQRASVGAKPDTPGMIPNLPYDQFPEIPRPIMPAGESTGSDARILLMLNMVTPEDLIDDEEYGDLFDDI # KEECSNFGAVEDLRIPRPVKKDKTKWTPGEGLDPQAIARIDEAAGVGRVYVKYVDSHSASAALKSLAGRSFAGRSIIATLLSEESQTTPPLNLIFAPQ # PDAPPPLPADS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g217 ### # start gene g218 7 AUGUSTUS gene 938349 942182 0.98 - . g218 7 AUGUSTUS transcript 938349 942182 0.98 - . g218.t1 7 AUGUSTUS stop_codon 938349 938351 . - 0 transcript_id "g218.t1"; gene_id "g218"; 7 AUGUSTUS CDS 938349 942182 0.98 - 0 transcript_id "g218.t1"; gene_id "g218"; 7 AUGUSTUS start_codon 942180 942182 . - 0 transcript_id "g218.t1"; gene_id "g218"; # protein sequence = [MTTRAEEKPVRYEPNTPEWVAQRLQMDKLPMAIGILRAWMPESRVREASEETVLAVRNLSHATATEAVTNLKSRKRFV # RGTRGRELKLRTTIENIDNGVQVETEALLDSGATGSCINKDFVEQHQLTIKELPVKMPVYNADGTLNKNGSIEGYVQVRMVIGDHAERIDMAVTNLGK # TDIFLGIDWLRYHNPSIDWKESTLTFERCPDKCGYLPHYESPEDDGTEEKLVDGERIFWFDWDGYLSDQGHIKVQTATTDAATPYLAEYADVFSKKDF # DQMPERHPWDHAIELTPGSKPVDCKVYPLSPPEQKALDEFLEENLRSGRIRPSRSPMASPFFFVKKKDGTLRPVQDYRKLNDMTVKNRYPLPLIQELI # DKLKNSKIFTKMDVRWGFNNIRIKEGDEWKAAFRTNRGLFEPTVMFFGLTNSPATFQAFMNHILRELIDQGHVIVYMDDILIFTDNIEEHRIIVRKVL # DILKANKLYLKPEKCTFEAREVEYLGIIVGNGQIRMDQKKVEAVRTWQPPQKKRELQSFLGFCNFFRRFIRDFSKIAKPLTRLTGNATWEWTSLEQDA # FNQLKDRIIEDVTLIIPRETGKFRIEADSSDYANGAVLSQNVDGKWRPVAFRSRSLNEVERNYEIYDKEMMAIMDSLADWRQYLLGAKEPVEVFTDHQ # NLQYFRKPQKLNRRQARWVVEIAEYHIELFHKPGKSMGKADALSRMSGLEKGENDNTDVTLLKPEFFISQVTDQTSAPEDDLLNLIRRKKNQRDKLVQ # VALESKDKEWLETEDGLAVWQGRIYVPKDKELRGRIIQAHHDAQTAGHPGRYKTVELITRNYWWPGISRDVRIYVEGCEKCQATKTHRTKPVGPLHPH # DVPSEPWEIIGTDMIGELPESGGYNAISVFVDHFTKRLRLFATHTTITSEGMARVYRDKVFPIHGMPRKIVHDRGPQYHARFMKELYKLLGIESNYTT # AYHPQTNGQTERINQEIEHYIRLFVNHHQSDWHEWLPMMEFAYNDRVHSATKVSPFYADNGRHPYKGTTPKMTSQNPTAQEFADSMKRIREEVGSALR # KAAEDMKCQYDKHRNEAIEYKAGDKVWLEGTNITTDRPMKKLGDKRFGPFKVLEKIGSSSYKLDIPRTWKRVHNVFNETHLSPYHEPQFPTQPRNTEP # PPEVVGEEEEYEVEEVVDARKYRNGIQYKVKWRGYGPHEMTWEPAANMTNAKEAVQDFHKKYPNKPRPRTLKRIEIPIAQFPTELFRQIPTPDIEPVP # STMPSEALVNRLARHGIRALKGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g218 ### # start gene g219 7 AUGUSTUS gene 942308 943261 1 - . g219 7 AUGUSTUS transcript 942308 943261 1 - . g219.t1 7 AUGUSTUS stop_codon 942308 942310 . - 0 transcript_id "g219.t1"; gene_id "g219"; 7 AUGUSTUS CDS 942308 943261 1 - 0 transcript_id "g219.t1"; gene_id "g219"; 7 AUGUSTUS start_codon 943259 943261 . - 0 transcript_id "g219.t1"; gene_id "g219"; # protein sequence = [MSNPTPAPTTTTSNIHGKSLLREPSIFDGDKAQFKEWRRTLFAYIRDPRNRIVTDSERIDIAVSYMRGPKVSSWVQNY # TDDNFNDDEEEWKVTWKGFKDALNASFLDKGLTENAQEKLEHLRQGPNERAEDFFKEFEVIMRDAGYAKDAPYVIRLIEMNVKPKLIDQVYGTSNERI # EKFDELKQKIISIDDMWWRREEMRRNWSSRYQRNAGQGPSNQRWQPQTTQAPATKAPTPAVPTQDRKDSTRITFKGAGRPMDIDAARRNKECFHCGKQ # GHIAKFCPEKALKPQFVRGMWSRMTQEDQEAIAKELGFVLPQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g219 ### # start gene g220 7 AUGUSTUS gene 946100 947881 0.63 + . g220 7 AUGUSTUS transcript 946100 947881 0.63 + . g220.t1 7 AUGUSTUS start_codon 946100 946102 . + 0 transcript_id "g220.t1"; gene_id "g220"; 7 AUGUSTUS CDS 946100 946870 0.93 + 0 transcript_id "g220.t1"; gene_id "g220"; 7 AUGUSTUS CDS 946928 947288 0.69 + 0 transcript_id "g220.t1"; gene_id "g220"; 7 AUGUSTUS CDS 947442 947881 0.98 + 2 transcript_id "g220.t1"; gene_id "g220"; 7 AUGUSTUS stop_codon 947879 947881 . + 0 transcript_id "g220.t1"; gene_id "g220"; # protein sequence = [MLDEKDTAETDHQELQKFLALQQGEAVIAANRKRDRSPSPVAGPSSKKVRSDSSKKCSRRRVPVEGAAQESPHRVRLV # VPPGRSMGASTSTPALPRALPSSMEVSVRDESVQGPSSLVQLAAAAEAQSGVAQRFVSPSPVMSPIKGTGSDSLPSNMPPTSRSLLVPRTLIAHPYRA # ENQRLLARVRSLESQLADSQRENSSLTTALRDTSHALDARQREVEQLRSSSHEVLQHEVEYRSVLDQFHAMDRALSGFPGQTVVQRLQALEEELRVVK # RDRDVAVEELSTASHKASELKTALLQQQGLVDETNALATHQRRRLEEVHRTRDRAAFVEQMIKEYPDEGFYEVVLPPLSQLEEDLKRAQEDLRRVATY # AHRLYPRGIHGDLYMWSISSIQWFFNNAVDEDEGLHRLVLEHSWFDNDGPILTAAQHAGFAAPPEGSLEPPLHRWMLALSTAFPHRDGSGRWDDIVPA # IPSLDQSMVVWEQLMLEYLHHITDTPMSLPVPSDEPPAAVGEGVSDKTVPTGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g220 ### # start gene g221 7 AUGUSTUS gene 951231 951806 1 - . g221 7 AUGUSTUS transcript 951231 951806 1 - . g221.t1 7 AUGUSTUS stop_codon 951231 951233 . - 0 transcript_id "g221.t1"; gene_id "g221"; 7 AUGUSTUS CDS 951231 951806 1 - 0 transcript_id "g221.t1"; gene_id "g221"; 7 AUGUSTUS start_codon 951804 951806 . - 0 transcript_id "g221.t1"; gene_id "g221"; # protein sequence = [MSFGSDSGSFLEYALSLPDPVGPDPETSDSSDQSSPSDHNSEQESVQSGTISDPDQSSYDSEFPGPFDYDYLHESSDF # DSDHPGPYDLRYLHSYPSSSASDSVESFHSFASDNSEAPELRPGDDRSGHPYLGPDGRLLDSERERRRVLGLCFYCGGEHMKVDCLKLQARTGQNYDA # DNSESDVPGSDDGSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g221 ### # start gene g222 7 AUGUSTUS gene 956398 957426 0.57 - . g222 7 AUGUSTUS transcript 956398 957426 0.57 - . g222.t1 7 AUGUSTUS stop_codon 956398 956400 . - 0 transcript_id "g222.t1"; gene_id "g222"; 7 AUGUSTUS CDS 956398 957426 0.57 - 0 transcript_id "g222.t1"; gene_id "g222"; 7 AUGUSTUS start_codon 957424 957426 . - 0 transcript_id "g222.t1"; gene_id "g222"; # protein sequence = [MVTCGGYWDWSGCSQGMTMGAKLEEVKNEEYEASQPGPHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILE # AGQSAMEKVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDLPTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHV # VERKSDPTIQGKPISLIGAAGMDRLLREGTPVYFLHISPTKEESPTEEILLASNSNDPERVQQPKDPENGNPGPEQGGVVKELDEEVSKRQETEELKK # SIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g222 ### # start gene g223 7 AUGUSTUS gene 960106 961509 0.65 - . g223 7 AUGUSTUS transcript 960106 961509 0.65 - . g223.t1 7 AUGUSTUS stop_codon 960106 960108 . - 0 transcript_id "g223.t1"; gene_id "g223"; 7 AUGUSTUS CDS 960106 961509 0.65 - 0 transcript_id "g223.t1"; gene_id "g223"; 7 AUGUSTUS start_codon 961507 961509 . - 0 transcript_id "g223.t1"; gene_id "g223"; # protein sequence = [MDGEQHSSRISGHDLTARLVPNPVHVPPRLSNPSVVPYQGSVSMQSQVVGMENQRVPNQRRMRAVHEEAAPPQGAPFG # TPFVTGAQTNQPGMVVDSARSQESVAMIQQQARVIEMLQEQLREVKKGFTAGEVPTGGPLSKTGNTAGLFGRAPRVIREYTREGPSPVVPQPRSWQAT # EPISFNRNTPTGAKDGNPQVEQAGQIPDTLSVDRRRIHEWGARVQRAELGEYGRPEGGVYALENEGGGKGSFNPPPRVPPPHFSSQSRDRERPLSQGG # QGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPEVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRS # TWESNKEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLKGEYTCLEDWTEFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g223 ### # start gene g224 7 AUGUSTUS gene 984668 985090 0.39 + . g224 7 AUGUSTUS transcript 984668 985090 0.39 + . g224.t1 7 AUGUSTUS start_codon 984668 984670 . + 0 transcript_id "g224.t1"; gene_id "g224"; 7 AUGUSTUS CDS 984668 985090 0.39 + 0 transcript_id "g224.t1"; gene_id "g224"; 7 AUGUSTUS stop_codon 985088 985090 . + 0 transcript_id "g224.t1"; gene_id "g224"; # protein sequence = [MYSEDLPMDSTDLVVISDIDGTITKYAGFCQTCMVYFADFDRNLPNLFIDRRSDGLGHVFAMIGRDWTHLGVAKLYTD # ITRNGYKIMYLTSRAIGQADATRGYLKGIKQNDYQLPEGPVIMSPDSLWLRYIGGFFVALEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g224 ### # start gene g225 7 AUGUSTUS gene 985907 986113 0.76 + . g225 7 AUGUSTUS transcript 985907 986113 0.76 + . g225.t1 7 AUGUSTUS start_codon 985907 985909 . + 0 transcript_id "g225.t1"; gene_id "g225"; 7 AUGUSTUS CDS 985907 986113 0.76 + 0 transcript_id "g225.t1"; gene_id "g225"; 7 AUGUSTUS stop_codon 986111 986113 . + 0 transcript_id "g225.t1"; gene_id "g225"; # protein sequence = [MPGSLEDMNFGNDDDEEYVHDDPNDDYNEEYDPHGEDEVDEVAADDAFDEDLLAAGEMKNVHFYNTVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g225 ### # start gene g226 7 AUGUSTUS gene 1004154 1008392 0.76 + . g226 7 AUGUSTUS transcript 1004154 1008392 0.76 + . g226.t1 7 AUGUSTUS start_codon 1004154 1004156 . + 0 transcript_id "g226.t1"; gene_id "g226"; 7 AUGUSTUS CDS 1004154 1008392 0.76 + 0 transcript_id "g226.t1"; gene_id "g226"; 7 AUGUSTUS stop_codon 1008390 1008392 . + 0 transcript_id "g226.t1"; gene_id "g226"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLLWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEKIHAGTLQSPPEAPQRPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEGSPTEEILRASGSNG # PERVQQPNDPENGNPGLEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIRKLYNMSEKELKSLKE # YIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGS # FEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEASHVGHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEK # VKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILS # QLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLG # AKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDATIIEALKRIARNEEESFVWEDGLIRRGGRIYVPDVGTLR # REVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPATAGPEKYDAILVV # VCRLTKQAIYVPCHTTDNAEDFANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCKALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQD # NWDLLLPMAEFIYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKAYAKYANQKRQEAPDWKEGDQVWLNME # NVRTRRPMKKLDHKWTGPYTILSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEDILDSKPKKGRPEEVEYLV # KWEGYNDEFNSWVGWEGMVGSIELLRSWHKHHPRKRQPSRLQWASLEREAREDEEEGPGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g226 ### # start gene g227 7 AUGUSTUS gene 1008642 1010890 0.85 - . g227 7 AUGUSTUS transcript 1008642 1010890 0.85 - . g227.t1 7 AUGUSTUS stop_codon 1008642 1008644 . - 0 transcript_id "g227.t1"; gene_id "g227"; 7 AUGUSTUS CDS 1008642 1009841 0.91 - 0 transcript_id "g227.t1"; gene_id "g227"; 7 AUGUSTUS CDS 1009949 1010890 0.91 - 0 transcript_id "g227.t1"; gene_id "g227"; 7 AUGUSTUS start_codon 1010888 1010890 . - 0 transcript_id "g227.t1"; gene_id "g227"; # protein sequence = [MSPTPTRPSSRTPSPLLPPLTALGEVPSPAHDSALHARASSTSILLELNMLDEQDAVDADQQELQQFLTLQRDEATVA # AKRKRNRSPVPVAGPSSKKIRSDASKKRSRRKSPAVEVNVEPFRRVRLVVPPVRSVAPVPPVRLVAPTSPPVPPPASPSLMGVLHRDLPMQGPSDLVR # LADAAEVHPGLVQQAGSSSPARTPIKGTGQDLLSSTMPPILRPALVPRNPASHPYRAENQRLAARVRLLETQLADSQRENSSLTSALRDTSHALESRQ # REVEQLRSSSQEFLQRQEEYRRIIDQFNTLDRALSGPSDQRDRDDATGKLSTSSRRISELTTALLYQHGITDEGNALSTRQRARLEELQEEVHRTRGR # AAFVERMIKEYPDEGYYEVVLPPLSQLKGDLVKVRADLRRVATLAHRLYRSDPATVLHHHNRYIGAIIEAVVAFLRRALETEDPDVMEHNIRLALDYM # QTARGVHGDLHIRSISSIQWFFNNAVDQDEGLYTLMLENSRFDSDRPFLTAAQHAGFTSPPPDSMEPPLHRRMLSLSTALPHRGGAGRWDDLVPAIPS # DDQLMQDWEQLMLQYMHHITDTPLPVPDPPVPMSSTGPVPESSVEANVEQSLEAPIVQVSSPSGGSHPPVPLFLSEQESPTSPSPPPRSPVLPLLFGS # VASLSIDLTGNDDELYETEESYASRVDVAMEGTELAVGQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g227 ### # start gene g228 7 AUGUSTUS gene 1012090 1013244 0.28 + . g228 7 AUGUSTUS transcript 1012090 1013244 0.28 + . g228.t1 7 AUGUSTUS start_codon 1012090 1012092 . + 0 transcript_id "g228.t1"; gene_id "g228"; 7 AUGUSTUS CDS 1012090 1012515 0.28 + 0 transcript_id "g228.t1"; gene_id "g228"; 7 AUGUSTUS CDS 1012597 1013244 0.89 + 0 transcript_id "g228.t1"; gene_id "g228"; 7 AUGUSTUS stop_codon 1013242 1013244 . + 0 transcript_id "g228.t1"; gene_id "g228"; # protein sequence = [MTNSRTQTTTTSSSTAGPSRSRPIPPPPIDLTNHEEDDLVEEEEDEDEIIRRAQARVERVRARKAAAAAKKAAEEKAA # KAAAARERAAQEARERAIRARQQEEEVAERRRLLAEAATARSQRGTSPSEMSASPRRPVVEVRRPVGGDPDDGDDGDEDDDDEEEREPCERCKAKKIP # CLQQASKRSSVICKPCHDSKVRCSFSGRPSTVKREGGSGERIAVMESQMAQSLADLRALREANSKSHQYLRQLLRRQEDDHARLIAMETRMAMMGMGE # GPAVAGPSSRRTERRRPLKRRRVVEESAEEEEEEKEVEEEVEKDGEGEAEEMEAEEEGEGEAPAPLTAKTVASEKGKEKEVVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g228 ### # start gene g229 7 AUGUSTUS gene 1013609 1017172 1 - . g229 7 AUGUSTUS transcript 1013609 1017172 1 - . g229.t1 7 AUGUSTUS stop_codon 1013609 1013611 . - 0 transcript_id "g229.t1"; gene_id "g229"; 7 AUGUSTUS CDS 1013609 1017172 1 - 0 transcript_id "g229.t1"; gene_id "g229"; 7 AUGUSTUS start_codon 1017170 1017172 . - 0 transcript_id "g229.t1"; gene_id "g229"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINTVVAKVAV # PLPEPSPSVSPTILETPPGDSPRSRSRSRSRTSRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTAPTVPLLPPSIPAEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVLVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g229 ### # start gene g230 7 AUGUSTUS gene 1017505 1019196 1 - . g230 7 AUGUSTUS transcript 1017505 1019196 1 - . g230.t1 7 AUGUSTUS stop_codon 1017505 1017507 . - 0 transcript_id "g230.t1"; gene_id "g230"; 7 AUGUSTUS CDS 1017505 1019196 1 - 0 transcript_id "g230.t1"; gene_id "g230"; 7 AUGUSTUS start_codon 1019194 1019196 . - 0 transcript_id "g230.t1"; gene_id "g230"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFIARNPKKGSSDFKTGSTNQQNNCQPSGSSAPFTPKPKPFS # GGKPNNNGKSQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g230 ### # start gene g231 7 AUGUSTUS gene 1023861 1025729 0.96 - . g231 7 AUGUSTUS transcript 1023861 1025729 0.96 - . g231.t1 7 AUGUSTUS stop_codon 1023861 1023863 . - 0 transcript_id "g231.t1"; gene_id "g231"; 7 AUGUSTUS CDS 1023861 1025729 0.96 - 0 transcript_id "g231.t1"; gene_id "g231"; 7 AUGUSTUS start_codon 1025727 1025729 . - 0 transcript_id "g231.t1"; gene_id "g231"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNLLIDWASRNITFRNTSHLVSPQTSVPSAINPVVAKVAV # PLPEPSPSVSPTILETPPGDSPHSRSRSRSRMLRAKPLSFKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHHSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHSAPVLF # VPKKDGKLRLCIDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHTYHLVRIAEGDEWKTTFRTRYGSYKWKVMPFGLTNAPAAFQRFVNDI # FSDMLNVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETNTSDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKGCRHYLEGSGDPVDVNELAWFLCERERKESNGHSNQPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g231 ### # start gene g232 7 AUGUSTUS gene 1026062 1027726 1 - . g232 7 AUGUSTUS transcript 1026062 1027726 1 - . g232.t1 7 AUGUSTUS stop_codon 1026062 1026064 . - 0 transcript_id "g232.t1"; gene_id "g232"; 7 AUGUSTUS CDS 1026062 1027726 1 - 0 transcript_id "g232.t1"; gene_id "g232"; 7 AUGUSTUS start_codon 1027724 1027726 . - 0 transcript_id "g232.t1"; gene_id "g232"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQTFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRCGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHNDQDPLVDPDDPGADNNHDDLDDDSGGLPRGEPG # DPSGPGGPGGPSGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPQKLKTFFVNLALVFNDRPKYFTDQ # RKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSATLKWAYG # QGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKHEAGKPFIARNPKKGSSDFKTGSTNQQNNCQPSGSSAPFTPKPKPFSGGKPNNNGK # PQNSSNSSQSGGQRPVFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g232 ### # start gene g233 7 AUGUSTUS gene 1030174 1030467 0.8 + . g233 7 AUGUSTUS transcript 1030174 1030467 0.8 + . g233.t1 7 AUGUSTUS start_codon 1030174 1030176 . + 0 transcript_id "g233.t1"; gene_id "g233"; 7 AUGUSTUS CDS 1030174 1030467 0.8 + 0 transcript_id "g233.t1"; gene_id "g233"; 7 AUGUSTUS stop_codon 1030465 1030467 . + 0 transcript_id "g233.t1"; gene_id "g233"; # protein sequence = [MFPYQSFESKFVDMSGYNGRSLQNFDIGGPTERLPPPLIKAFGILKKAASIVNVGYGLDAKIGEAIQQAADDVRCFSF # IRWKADFYGFNQGHFGTTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g233 ### # start gene g234 7 AUGUSTUS gene 1030575 1030859 0.65 + . g234 7 AUGUSTUS transcript 1030575 1030859 0.65 + . g234.t1 7 AUGUSTUS start_codon 1030575 1030577 . + 0 transcript_id "g234.t1"; gene_id "g234"; 7 AUGUSTUS CDS 1030575 1030859 0.65 + 0 transcript_id "g234.t1"; gene_id "g234"; 7 AUGUSTUS stop_codon 1030857 1030859 . + 0 transcript_id "g234.t1"; gene_id "g234"; # protein sequence = [MSYYLQVISNRAIEILGGELGSKKPVHPNDHVNMSQSSNDTFPTAMHIAAVTELNISLIPALSGLRDALDAKSKAFEH # IVKIGRTHLQVRIRAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g234 ### # start gene g235 7 AUGUSTUS gene 1032316 1033059 0.54 + . g235 7 AUGUSTUS transcript 1032316 1033059 0.54 + . g235.t1 7 AUGUSTUS start_codon 1032316 1032318 . + 0 transcript_id "g235.t1"; gene_id "g235"; 7 AUGUSTUS CDS 1032316 1033059 0.54 + 0 transcript_id "g235.t1"; gene_id "g235"; 7 AUGUSTUS stop_codon 1033057 1033059 . + 0 transcript_id "g235.t1"; gene_id "g235"; # protein sequence = [MHPQSRFFYRFSQSWNHPGMDYGFSRRHWHRRPSRLLWFTIGAASATWYIMRHDAEQSDKANYWKNCYRPPVQQPRPQ # NNGDFSRVLGDPLPTVPGNDSGAPPSPSPYPYSHPHHHSHWGWGFAKERSFQYPPSPPPPPPPPPPPSAAHPPNGPANLRNYGQAPSDSALPTVPTES # LSGPASTPGAELAPTPTPTPVAAAIHTQTVPWGFESSYEHQKKEWEQEREKLLAKAQDTVILLCLNCLSFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g235 ### # start gene g236 7 AUGUSTUS gene 1039233 1043562 0.56 - . g236 7 AUGUSTUS transcript 1039233 1043562 0.56 - . g236.t1 7 AUGUSTUS stop_codon 1039233 1039235 . - 0 transcript_id "g236.t1"; gene_id "g236"; 7 AUGUSTUS CDS 1039233 1042786 0.95 - 2 transcript_id "g236.t1"; gene_id "g236"; 7 AUGUSTUS CDS 1043121 1043562 0.92 - 0 transcript_id "g236.t1"; gene_id "g236"; 7 AUGUSTUS start_codon 1043560 1043562 . - 0 transcript_id "g236.t1"; gene_id "g236"; # protein sequence = [MTSTSNSSAPSLIGSVFERKPSIPKPPSSSSQSRFTSTLNSKTGFPPVQHRSQKSSAFLKNIENGRRKPELSSERSTQ # VPSIVPQSATPGPGPSTIQSQNQKQNGVSSTDDWRSHVSAENEAKVQAMTEEERADETREILERFGPSVNQVHVYPSAPSSPKKALLALPPPDEDSNA # VSLGTFKGRMKPIDLEDATASQTQVEQVKEEAAETHVEKGTAEIQVEQAEEGTTEIQGEQIEKGTAETQIEQVEEGTAEYIRQKYFPSAPADNPDLAW # MSSSLDPPPQEQTPDLRFDLNGTPIPSSKILSLPTHLGLHHHAEGTRAGYTLDDIFLLTRSTVRAQRAAMLEVLVGVTRWLRTSGTKEDVDIEAARKS # LLNLPNPEGSGIPPLLKRILFAGLEALPERGAVGVRAMDVVWECVVGQTNVTEDLGDLEFEFGGMEEGKTDEGVLITALPLADVLPQFLGLLLSPPDS # DLGDERPSTLTLNQPEFRSLRTTPAQQQILSILTRLAMYSNAYAETIVQEKGLMEGLLRVFIIPPATSTYASTPDLATIRLLTILASASRTNAEALCQ # KIGAGDVLLRFVVLSTNDNVLVEIMIFYTILARYGMYSRVAADAKEVWWKIGDHVVALSSSYSQSNMRLVRAYVGLIEAWLICATDPHRTTPSHELLW # SQVKSWEWGAGLATLLTKVSSLAVERTGTVDNRIRIAVSSASLWRSLGAYLEGAKVNGIRGGEGERTEVGLVLKRVFDSGAVQTFRNLIEDLKTKLDT # VGTEMKTTVASIEIASLASILSSAIRLWLGCCPPSPSDGSPPFELPFADISDLCAILVRHDLWHQNFNPLLIRPLSTLLVLFLRLSPHLPGSHLDLWL # AQAFGVIKTLRRGDEEHALQIISQILDMLTSEWAAQRGGVGAPDFVWKEKGGLKAVLIPFLRYEISPERDPYTYVAPLIPSSRSIGMCTTLRIPSSYP # RDVTMEWRPLGLPLHSDWTLSPFNHLLRSGSDYSVFKQSGALPDSWDASEIDVVRAALALAMVEREVLQRFAPSMISLVGPKEEDIIFACMKVFMLEH # DVGNGDSKTHSDGEGLQEVFRDEVVARQLHEILEPYTVKALSSSSTSYVPSSRSSSAPLELASLPLLGTAVPFYQFYTDFLSLYDSISFSHPLFSRIL # LPPTSMLYAADYRKLLWNDYSHVLRGIRVEVDDVIAGAGGIEQWLYPVETAPDVLGAYLRALIKYGEGVQGFLRLLAVHHVAANIWPDFYVGTHIEEL # VFDERRSKLLRVVVEQGGMEVVKDVLRYRQSPQLRRILCSPACFQEVDESCKRLRCDLIANWIGEGTLERVRGVFER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g236 ### # start gene g237 7 AUGUSTUS gene 1046251 1046805 0.69 + . g237 7 AUGUSTUS transcript 1046251 1046805 0.69 + . g237.t1 7 AUGUSTUS start_codon 1046251 1046253 . + 0 transcript_id "g237.t1"; gene_id "g237"; 7 AUGUSTUS CDS 1046251 1046805 0.69 + 0 transcript_id "g237.t1"; gene_id "g237"; 7 AUGUSTUS stop_codon 1046803 1046805 . + 0 transcript_id "g237.t1"; gene_id "g237"; # protein sequence = [MIQHHNLSSDDLAKIMDDLTLLVRKLWTIRQRDYPSAPQGFVSCSASGHGLPDYAVGYELRGPRTIFEQYKERTYHLA # YDITAWDNGELRRQEPQKAALVTNDEIVWVHCDLRSTNIMIHDGRVSGVIDWENSGWQPRHWQLLVVRPWCGTNGPRIANAWKQIPFDDDVEQAYEAG # LSLLNEFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g237 ### # start gene g238 7 AUGUSTUS gene 1050305 1051402 0.88 + . g238 7 AUGUSTUS transcript 1050305 1051402 0.88 + . g238.t1 7 AUGUSTUS start_codon 1050305 1050307 . + 0 transcript_id "g238.t1"; gene_id "g238"; 7 AUGUSTUS CDS 1050305 1051402 0.88 + 0 transcript_id "g238.t1"; gene_id "g238"; 7 AUGUSTUS stop_codon 1051400 1051402 . + 0 transcript_id "g238.t1"; gene_id "g238"; # protein sequence = [MNTLISNISRLESFVLEIPEGADDLASTLPPIPPAGAPNMRSIEFYNVNSSEPSRTSAWISELLYRSPNLRSLHLRPA # EEIKLKGTVGVRLQNFKASHGIQLQDLFALLVNCAGLRTCEVQFRAPIRLGVVPPTRILLKYLHTLILTDARRDDLEAVFGWLALPSLKKLALSGFRS # AEWPDELFSNFLSRSRFSLKSLSLTALSVTEAQLLSYLHLSSIHDSLEELAICQWRPSSASFLDHLSFKLPSSDATHNPPPFLPKLSSIFITVDAITQ # AVALRRFVASRWYDTAAYEVPLPVASLKDIHVCLTIPYAPNVNVSIDDIKLVFSRIARSRGTSLRLETITMAPPSSNQYAGIERLTSHLVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g238 ### # start gene g239 7 AUGUSTUS gene 1054946 1056064 0.37 + . g239 7 AUGUSTUS transcript 1054946 1056064 0.37 + . g239.t1 7 AUGUSTUS start_codon 1054946 1054948 . + 0 transcript_id "g239.t1"; gene_id "g239"; 7 AUGUSTUS CDS 1054946 1055040 0.37 + 0 transcript_id "g239.t1"; gene_id "g239"; 7 AUGUSTUS CDS 1055128 1056064 0.8 + 1 transcript_id "g239.t1"; gene_id "g239"; 7 AUGUSTUS stop_codon 1056062 1056064 . + 0 transcript_id "g239.t1"; gene_id "g239"; # protein sequence = [MFLSFIDGLNLAIVASPPLRIVNVVGQLVGFVIIVTTSAQVGMRVLSKTLTDRYLRAANLNIFKPRGLSVRLCTTPAM # LRLVAPPGSHSTDDESKTRATINKIGRGVGTIFLKVPLPIIGPIAARVIHSLADKPPPIAPTGYPGDPVNSPVLMRRLALLEHTFPGATLPVLTQGLP # PPAKPDGVMEMINSWGLKFDEMRENKAERKNEERRRAWAQIQAAGVANGGYPYGGGYQAIPRNRSPSPSPVAMPTPMIAGAAMGMSYGGSDVGYMDYR # DARRAGRRAAKAERKAYRRMQKGQRKGLLSGMSRAERRATAADLLEHWATNRVLWVVVMPAEKGKHDRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g239 ### # start gene g240 7 AUGUSTUS gene 1057054 1058283 0.34 + . g240 7 AUGUSTUS transcript 1057054 1058283 0.34 + . g240.t1 7 AUGUSTUS start_codon 1057054 1057056 . + 0 transcript_id "g240.t1"; gene_id "g240"; 7 AUGUSTUS CDS 1057054 1058283 0.34 + 0 transcript_id "g240.t1"; gene_id "g240"; 7 AUGUSTUS stop_codon 1058281 1058283 . + 0 transcript_id "g240.t1"; gene_id "g240"; # protein sequence = [MLHGTSQLELVECILERSRLLPLHVVVSSRDNGKRAYMDNFLRAMNTLISNISRLEKLALFIFNGADDFPPALPPIPP # AGAPNMRSIQFHNLNSPEPSKTTAAWLSELLHRSPNLHSLYLRSAEKIQLEGAAWVHLQHFKASHGIRLQDLFALFVYCAELRTCEVQLHAPIQLDIA # PTTEIALQHLDTLTLTNARGDDLKAVFRWLTFPSLKKLTLSGFRGAEWPDELFLNFLSRSRFSLKSLSLATLLFTEANLVSYLHHPSIHDSLEELIIC # QWGEKINASFLDYLTFKLPSSSDAMHNPPPFLPKLFSISLTVNAIDHAVALRRFVASRWYDIAAYEVPLPVASLKYIHVRFIVPYAPNVNVSIDEIKH # VFSRIARSRGTGLRFETIAVLSDQYNGIERLTSQSVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g240 ### # start gene g241 7 AUGUSTUS gene 1060334 1061842 0.29 + . g241 7 AUGUSTUS transcript 1060334 1061842 0.29 + . g241.t1 7 AUGUSTUS start_codon 1060334 1060336 . + 0 transcript_id "g241.t1"; gene_id "g241"; 7 AUGUSTUS CDS 1060334 1061842 0.29 + 0 transcript_id "g241.t1"; gene_id "g241"; 7 AUGUSTUS stop_codon 1061840 1061842 . + 0 transcript_id "g241.t1"; gene_id "g241"; # protein sequence = [MQCEALFRGSGFRKLPLELVMEIFIHCLEPASWPYADSSHRMYTGYTQYSAIPFVLSQVCRQWRIVALSTPALWTCLS # VDISHSNDAGTVHTDLINCCLERSRLLPLHIALTAFDRGDEETGRKDLQNTSRTINRLIPECFRWESFELMIYSCLDVSTPSLQPIPPTGAPTLRSIR # FCNWSGRFSNLAAWISDLMRSSPNLRSIRLNSAEGIQFADISWVHLQNFEVWEKIKLKDLLILFENCPELRTCTACLISPVHLAIVSSPEIVLNHLHT # LILTYAEESDLKAAFCWLTLPALKKLILSGFRNTEWPDESFSNFLSRSGFSLEVLSLTDLAFTDAHLVSYLHHSSIHDSLEMLVIESQGEIISSFLLD # FLTFKLPSSDTNTMHAPLPLLPKLNSILFNVNAITQAVALRHFVASRWYDIATYEVPLPVASLKHIHVRLAVPDPPNVKFSIDDIKHVFSRITKSRGT # EVRLETIDMPWDSDPYAGIERMSIDLVFEGII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g241 ### # start gene g242 7 AUGUSTUS gene 1063861 1065318 0.52 + . g242 7 AUGUSTUS transcript 1063861 1065318 0.52 + . g242.t1 7 AUGUSTUS start_codon 1063861 1063863 . + 0 transcript_id "g242.t1"; gene_id "g242"; 7 AUGUSTUS CDS 1063861 1065318 0.52 + 0 transcript_id "g242.t1"; gene_id "g242"; 7 AUGUSTUS stop_codon 1065316 1065318 . + 0 transcript_id "g242.t1"; gene_id "g242"; # protein sequence = [MSEIFVHCLEPVSCPDGGESCRPHTQSSGIAFVLSQVCRQWRTVALSTPALWTFLNVVIPYTNDVGTVYLNFINCCLE # RSRILPLRIVLSAFDQGDEETDGEDTLQIISRTINRLIPECSRWESFELMIDSDLWLNVSTPSFRPIPPTGTPTLRSIHIHIQSEHFSWIVAWISELM # SSSPNLQEICLTSAEGIQFADISWDHLQIFKILEEIQMKDLFLLFMNCPGLQICEAYLDTPVHLDIVSSPEIVMDHLHTLILTCAKETDLKAVFCWLT # LPALKVLALSGFRNAEWPAESFSNFLSRSEFSLEALSLTKLAFTDAQLVSYLHHSSIHDSLEKLVIEPQEEIISSFLLDFLTFKLPSSDTNTIHAPVP # LLPKLNGILFTVNAITQAVALRHFVASRWYDTATYEVPLPVACLKHVYVRLTVPYAPNVKFSIDDIKRVFSRVCRSRGTALKLETVVTPPNPGHYAGI # ETFSVYDFPFSGDMI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g242 ### # start gene g243 7 AUGUSTUS gene 1068482 1069159 1 + . g243 7 AUGUSTUS transcript 1068482 1069159 1 + . g243.t1 7 AUGUSTUS start_codon 1068482 1068484 . + 0 transcript_id "g243.t1"; gene_id "g243"; 7 AUGUSTUS CDS 1068482 1069159 1 + 0 transcript_id "g243.t1"; gene_id "g243"; 7 AUGUSTUS stop_codon 1069157 1069159 . + 0 transcript_id "g243.t1"; gene_id "g243"; # protein sequence = [MDVDICGPSIPTILGIASEQVHSSSTGWSPVYVQDNLGVMSVGFMLPSSRDAVMWRGPKKNGLISQFLKDVDWGDLDY # LVVDTPPGTSDEHLSIVQFLKESGIDGAVLITTPQEVALQDVHREIDFCKKVGIRILGIVENMSGFVCPSCKTESQIFKPSTGGAKRLAEETGIELLG # AVPLDPRIGKSADYGVSFLDEYPDSPATTAYLDIIGRELLVTLSISVVY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g243 ### # start gene g244 7 AUGUSTUS gene 1069755 1070567 0.67 - . g244 7 AUGUSTUS transcript 1069755 1070567 0.67 - . g244.t1 7 AUGUSTUS stop_codon 1069755 1069757 . - 0 transcript_id "g244.t1"; gene_id "g244"; 7 AUGUSTUS CDS 1069755 1070567 0.67 - 0 transcript_id "g244.t1"; gene_id "g244"; 7 AUGUSTUS start_codon 1070565 1070567 . - 0 transcript_id "g244.t1"; gene_id "g244"; # protein sequence = [MDDFRNALWKEIQEYRQEVRGVNDLSGMPIRTVSGSRGTDVEKRVSGVHEHPEHPEAEIIVEEAASEGQPTTLTEEPD # ELEPEAAKLATEDSYLPPPPSSQNNRWSAPVTPTDPVVTYARRSSIMQAPRQGSTFNTPFPSSQHIPSYSESSTASSSVAFPSRGEGYVLPARSRTGS # IAGGEVTRRLLRTLSTVSIYESGEGLAGGLADLAPIGRYIVDRQTTEADAPASEMPREFGINEADEDAWDEKVRKRERKEGKFFVGDGQKVNPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g244 ### # start gene g245 7 AUGUSTUS gene 1074193 1074720 0.36 - . g245 7 AUGUSTUS transcript 1074193 1074720 0.36 - . g245.t1 7 AUGUSTUS stop_codon 1074193 1074195 . - 0 transcript_id "g245.t1"; gene_id "g245"; 7 AUGUSTUS CDS 1074193 1074720 0.36 - 0 transcript_id "g245.t1"; gene_id "g245"; 7 AUGUSTUS start_codon 1074718 1074720 . - 0 transcript_id "g245.t1"; gene_id "g245"; # protein sequence = [MQIGFSTLRGFVMQRPLMRADALNVLLELTTHPEKKIRGAAINTVKLWVPNHQPMDSMIREFALQILRKLQREPIQEA # ISESNGDSTEFNVNGDSAPTVAEEGSTTEKKKTTMVTDELEEGEEENMEDGQLPPEDLLQTPYLPERIELPAEKSHVLQHVELLFALSVKVPDLLDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g245 ### # start gene g246 7 AUGUSTUS gene 1075119 1076220 0.44 - . g246 7 AUGUSTUS transcript 1075119 1076220 0.44 - . g246.t1 7 AUGUSTUS stop_codon 1075119 1075121 . - 0 transcript_id "g246.t1"; gene_id "g246"; 7 AUGUSTUS CDS 1075119 1075556 0.97 - 0 transcript_id "g246.t1"; gene_id "g246"; 7 AUGUSTUS CDS 1075606 1076220 0.45 - 0 transcript_id "g246.t1"; gene_id "g246"; 7 AUGUSTUS start_codon 1076218 1076220 . - 0 transcript_id "g246.t1"; gene_id "g246"; # protein sequence = [MSPSSLPSASQFIPQINEALATQASRMELAASEEKKKRAAVAAGVIDTRKRPTTEADRTDVKRVKLEAEPPAPDPSLS # LLASFDFSTLPATLITDLIVANLEAFTEPALVSLVQVYRQRLGIGTVSTSVPPAPAATASGSVPVAAPTVPAVSDIKSVGKDIARPPTIEPSTTTPAP # PIKEEPVDPLQMDIDQDELEYEPDRLNEELSGPVPSLKTARQLDSAPGTEEQPINLSLSEFKLPPPKDMVNIDDRIDLISKSITRIHEGAAEMQSSTN # VGTDSDVTIGGPMDMWMLLVVRMFTRVAEPPELDLSNDGEDTPMDNEEDKSTPFYERQDRLRRILCDYIMSDFPGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g246 ### # start gene g247 7 AUGUSTUS gene 1080028 1080984 0.32 + . g247 7 AUGUSTUS transcript 1080028 1080984 0.32 + . g247.t1 7 AUGUSTUS start_codon 1080028 1080030 . + 0 transcript_id "g247.t1"; gene_id "g247"; 7 AUGUSTUS CDS 1080028 1080617 0.45 + 0 transcript_id "g247.t1"; gene_id "g247"; 7 AUGUSTUS CDS 1080702 1080984 0.66 + 1 transcript_id "g247.t1"; gene_id "g247"; 7 AUGUSTUS stop_codon 1080982 1080984 . + 0 transcript_id "g247.t1"; gene_id "g247"; # protein sequence = [MKEAIKPVFWFEAKPLRDSGNWRDKEVLIDMMASHYFATAIPQVREQVKYAFRSFDGPTQYPVFILVGLYWSMLIFDK # DKEQRAYEHEETVASQVLARQAVAANLLALKDRATSTASTTSVVDPGGAQEKSRFSSPERQIDVFDDYLLELKYFNEPLLLGTPVQEYNPVFLHALST # IMEKHEFSQQPSCFDVPHNYHGMEKLRTVYCDILNSIMVNATMEREDEEYSQSEDSKDGSYKPPGRHNAPPHWVYNEESPIQTRARTKRGRRVISPLD # SSPVEQQAPHGSGSSM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g247 ### # start gene g248 7 AUGUSTUS gene 1083287 1084371 0.23 - . g248 7 AUGUSTUS transcript 1083287 1084371 0.23 - . g248.t1 7 AUGUSTUS stop_codon 1083287 1083289 . - 0 transcript_id "g248.t1"; gene_id "g248"; 7 AUGUSTUS CDS 1083287 1083513 0.36 - 2 transcript_id "g248.t1"; gene_id "g248"; 7 AUGUSTUS CDS 1083581 1083604 0.75 - 2 transcript_id "g248.t1"; gene_id "g248"; 7 AUGUSTUS CDS 1083655 1084268 0.63 - 1 transcript_id "g248.t1"; gene_id "g248"; 7 AUGUSTUS CDS 1084361 1084371 0.74 - 0 transcript_id "g248.t1"; gene_id "g248"; 7 AUGUSTUS start_codon 1084369 1084371 . - 0 transcript_id "g248.t1"; gene_id "g248"; # protein sequence = [MKGNGGENIVDYGGNHEQGSGGEQAEYARKHSGNFDNDPGNYEGEYNSFYGGGYRGRGGYGGGGYGGYGIGSYGYGYG # GGGYGGGGGYGGGGYAGDYAHGYSEGHTGNYGGSHGGGAEGEGYMGGYARQGFQGVQEDSKGSYGGSYSGNEDSGRAFGRGYGENFVGGYKRHEGALV # GNQRNIDSNNAGEQGGYIPSSSEDRMETTGGTEINTTNSVKILKKRKRYIPKPPNPEILKRHGQSQRDTVEENWEEEERAEFEHDPEADNDEDEDDEN # DEATTNSREYKRKLFLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g248 ### # start gene g249 7 AUGUSTUS gene 1088279 1089652 0.65 - . g249 7 AUGUSTUS transcript 1088279 1089652 0.65 - . g249.t1 7 AUGUSTUS stop_codon 1088279 1088281 . - 0 transcript_id "g249.t1"; gene_id "g249"; 7 AUGUSTUS CDS 1088279 1089652 0.65 - 0 transcript_id "g249.t1"; gene_id "g249"; 7 AUGUSTUS start_codon 1089650 1089652 . - 0 transcript_id "g249.t1"; gene_id "g249"; # protein sequence = [MSASTSTSTKSLTFPSMSPTATATTTATATETATGTTTETTTGTTTVTATATATGTTAASATATTTATATANITATPI # ATATANVTANVTATPSATATPTATATPTATATPSATATPTATATTNATATPSTTTTTTATPSATTIATATTIATATTIATATTTPSATATMIATASAT # TSATTTATASATAMSPLSPLSPFLSTFPSTSTTTSSLLTSMSASSLLMSESPTTAHCRHCMHCGVSTYPLPGPRIPGQKTAPKYQEASVDTSSSFLEG # EEVRMEIHLSSPSPCHPVAPQPLNPPPRKRKKRAGTSGGGQEDPVPISCPRKSVRTTKRLRTANYDPANEVFNRFSIDNTPAEPSKDVTTDMTTELGR # ITLGTQTSVGSAEYLSWVTVLKSMMEGTLNNVRDMAVSSLVSIARRCDLASKVDGTARFVRMLNELYFAAKVNRYVVLKVYWVSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g249 ### # start gene g250 7 AUGUSTUS gene 1093884 1095551 0.5 + . g250 7 AUGUSTUS transcript 1093884 1095551 0.5 + . g250.t1 7 AUGUSTUS start_codon 1093884 1093886 . + 0 transcript_id "g250.t1"; gene_id "g250"; 7 AUGUSTUS CDS 1093884 1095551 0.5 + 0 transcript_id "g250.t1"; gene_id "g250"; 7 AUGUSTUS stop_codon 1095549 1095551 . + 0 transcript_id "g250.t1"; gene_id "g250"; # protein sequence = [MMSDPVGQLRVCYTPLASAIVDTPEASLIACTGGKDSPFTKAIYKNYGDSSRHAPRLSSSTLDTIDSIQARNIFPQDL # PAYQRAAVTARTNGVVYPFWRDWALAEPCEFLTPEPLHHWHKMFWDHNAKWAIQAVGASHIDFRFSIHQPTVGYRHFQEGISSLKQVTGRTHRDIQRY # LIPVISGAISAKFVTALRALLDFHYSGQAQRFSQTSSLRVQTALKEFHESKSVILELKARVNPKGKPIDHWEIPKLEFMQSVEPSIRASGPIMQWTAD # ITEHAHITLVKDPARSGNNHDFEIQICRSLDRLDRVRRFDLMTAMKDASVDFRLEDVEGDEGQEQGAEGLQVDEEEDAELEITKISSTEKLVTHLNPV # SKKLFGSFWPKQNFFLKACLLKRAPSAPLPHRSFVDNVTGEISAFSLVRDPDLKTQTIEEASRLYSLSDFHGACSDLIDRIKSGTKIFTVGGRRTGNT # QSPLPFYRVKLWSRLRIQSRTYFNLDLLTDPHTIFSAPPGPGWEFGRQNAVIVNIDQSFQWPRSSLEGEFSFHRFLLLLSNSRIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g250 ### # start gene g251 7 AUGUSTUS gene 1102027 1104049 0.19 - . g251 7 AUGUSTUS transcript 1102027 1104049 0.19 - . g251.t1 7 AUGUSTUS stop_codon 1102027 1102029 . - 0 transcript_id "g251.t1"; gene_id "g251"; 7 AUGUSTUS CDS 1102027 1102826 0.4 - 2 transcript_id "g251.t1"; gene_id "g251"; 7 AUGUSTUS CDS 1102879 1104049 0.19 - 0 transcript_id "g251.t1"; gene_id "g251"; 7 AUGUSTUS start_codon 1104047 1104049 . - 0 transcript_id "g251.t1"; gene_id "g251"; # protein sequence = [MRMKQVHLDRKLSATARLPKKSTIVESPAGRSVHPSNVLQSQKSQEATQPHQPHHHHPHHHHEGHQALPGQQNKSPSI # PPPLTPGYIQQQSGRPNTHLDTHDGQSHLIRPAFARNNTEVKIIDDSQPSSPAVGPEEQEEMLNISPAEDSITLADIGPLIEAAQAREQQRSLPRLNS # IPYIAELSALELAIVKYSAVLVLMRSPLKDQIDIEELLEMVEAKKPNRWKAFLGMGDKKNQKKKPGSQFPRSTITSQFPYFYVDSGTFGVLLEVLVAQ # EGVDSLLGASRATLKVPSFVDDVISAMRQMGQSLLSHREFINQVSYVDMSVEGIFRKNGNIRRLGQLTEAIDRDPLSVDLSQDNAVQLAALLKKFLRE # LPEPLMTFKLYKLWVSAQALKNDDERKRLLHMISIIMPKAHRDTMEILFVFLKWVASFAHMDEVTGSKMDLGNLATVICPSILYPRHGTVRDESFRAI # DVVTSLLENQDEFFSVPEEFLPILHDQEYFVNSLELNGKDFMKKCDTYQKVKAGNGRLPTPGPYNGPNGNTPRIGAGPAPGTSPVVPERPPPPLAAQR # PYGVTQPIPSYPSSSSQHGHIGNINSPRTPQAEEWSSPRPINPNGPSTPSRPSSYIQPRASGEYFANLNPNNYIPNPNGYPPARQRTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g251 ### # start gene g252 7 AUGUSTUS gene 1106223 1106717 0.62 - . g252 7 AUGUSTUS transcript 1106223 1106717 0.62 - . g252.t1 7 AUGUSTUS stop_codon 1106223 1106225 . - 0 transcript_id "g252.t1"; gene_id "g252"; 7 AUGUSTUS CDS 1106223 1106717 0.62 - 0 transcript_id "g252.t1"; gene_id "g252"; 7 AUGUSTUS start_codon 1106715 1106717 . - 0 transcript_id "g252.t1"; gene_id "g252"; # protein sequence = [MNNSGIPPLRPLPNPMSPNGPPLHIAVDDSFRSQRPSPTSPYSAPSSSSVKLPESTSNQITRASTTGSADQDSTVPTG # SYGMPLVRSEDLNHGMPSPRPQPAYISNSGSTSRSSTPAFNNSPNPSSESSKRRSTASLSSTSSGSSLSGKPPPTTASTSNSLASA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g252 ### # start gene g253 7 AUGUSTUS gene 1111099 1112322 0.89 + . g253 7 AUGUSTUS transcript 1111099 1112322 0.89 + . g253.t1 7 AUGUSTUS start_codon 1111099 1111101 . + 0 transcript_id "g253.t1"; gene_id "g253"; 7 AUGUSTUS CDS 1111099 1112322 0.89 + 0 transcript_id "g253.t1"; gene_id "g253"; 7 AUGUSTUS stop_codon 1112320 1112322 . + 0 transcript_id "g253.t1"; gene_id "g253"; # protein sequence = [MVQEEPDTIFLAAQRGDLSLLQALFAQGAQATDRDSQNITALHWASINAHLHICRELLERGAEVDARGGDLDATPMQW # AARNGYLYVVKLLLEWGADPTLKDGQGYNALHLITHSSAVMPLLYLLQQRKVDVDSVDLQGHTALMWAAYQGDAVSVDVLLKHGADVTTKDEGGLTPL # HWAVVRGNKAVIKKLLESGADVSAKDSGGRTPRDMAIELKSIGPWKRAMEEGGWDEYGVPRAPVFSNPKYNSIAIFILPTPLLILVFNTIAVSWLPWF # TSLILAAAECFAAGHILTRVLLGRKPQAESPFFAGIIFASLLIVVWCWATTLTNVHDHPTAHLIFIVSASLCLYNFWRAVCLDPGFVPNRLLDSVETL # ASEGRLNGQTFCVSCMVCSGILFALLTLILTRYLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g253 ### # start gene g254 7 AUGUSTUS gene 1113971 1114222 0.86 - . g254 7 AUGUSTUS transcript 1113971 1114222 0.86 - . g254.t1 7 AUGUSTUS stop_codon 1113971 1113973 . - 0 transcript_id "g254.t1"; gene_id "g254"; 7 AUGUSTUS CDS 1113971 1114222 0.86 - 0 transcript_id "g254.t1"; gene_id "g254"; 7 AUGUSTUS start_codon 1114220 1114222 . - 0 transcript_id "g254.t1"; gene_id "g254"; # protein sequence = [MTVEEALEHPYVAAYHDADDEPAANSLSPDYFQFDREPSDIIYTNPLLTLSAVEKEQLSKDDLKKLLYDEVMSFQPVI # GNTSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g254 ### # start gene g255 7 AUGUSTUS gene 1116645 1117645 0.48 - . g255 7 AUGUSTUS transcript 1116645 1117645 0.48 - . g255.t1 7 AUGUSTUS stop_codon 1116645 1116647 . - 0 transcript_id "g255.t1"; gene_id "g255"; 7 AUGUSTUS CDS 1116645 1117242 0.93 - 1 transcript_id "g255.t1"; gene_id "g255"; 7 AUGUSTUS CDS 1117320 1117645 0.48 - 0 transcript_id "g255.t1"; gene_id "g255"; 7 AUGUSTUS start_codon 1117643 1117645 . - 0 transcript_id "g255.t1"; gene_id "g255"; # protein sequence = [MYPSFLTVAKQLQAFFLVTDDLMDSSITRRGQPCWYRVPKIGLVAVNDAFMLEGAIYHLLKRHFKKEPYYVDLLELFH # EISYQTEIGQLIDLITAPEDAVDLSKFSLQKHSMIVVYKTAFYSFYLPVALAMLFCCVPTLYTPPNSASAVAPYEVAKSILIPLGEYFQIQDDFLDFA # GVPAQIGKVGTDIIDNKCSWCINTALSLATPDQRKILNENYGVKPTREETEFAKKIAEGKNGEEQGYLGEAERRVKAVFEEIGLREIYAEYEKNAYKK # LTGMIDQIDEGTSVGLKKEVFKSFLDKIHHRQK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g255 ### # start gene g256 7 AUGUSTUS gene 1118305 1119326 0.47 - . g256 7 AUGUSTUS transcript 1118305 1119326 0.47 - . g256.t1 7 AUGUSTUS stop_codon 1118305 1118307 . - 0 transcript_id "g256.t1"; gene_id "g256"; 7 AUGUSTUS CDS 1118305 1118940 0.91 - 0 transcript_id "g256.t1"; gene_id "g256"; 7 AUGUSTUS CDS 1119036 1119326 0.5 - 0 transcript_id "g256.t1"; gene_id "g256"; 7 AUGUSTUS start_codon 1119324 1119326 . - 0 transcript_id "g256.t1"; gene_id "g256"; # protein sequence = [MGLGMGRRAVHGESWPHREDSTTMKAVDYTGSMASNGGARIGINQVDSEPNWWKVKHRKDRPGETDLDWGVRRLDSVL # ETLGERAAYSAASEYHSFLKGLDGFEEFCGVRMDKLAGNHWGASPTRTGKYGELGDTEMADATFLSAEPPFTTHQHGHVHQPVLDSQTSNSSAPVSSA # SSTYIGSENQLPLLQMQKTTLPSLKSSGLLDWSSRSSLGSHPGPAPLHDHSLVQLNVGTVHPNAYTGSASPTRTSGSLINPTASSTISGPLVASEPNP # STETVDTSLCIPSAQCGTSNTQPGRSGLSWMMNE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g256 ### # start gene g257 7 AUGUSTUS gene 1123409 1124149 0.61 + . g257 7 AUGUSTUS transcript 1123409 1124149 0.61 + . g257.t1 7 AUGUSTUS start_codon 1123409 1123411 . + 0 transcript_id "g257.t1"; gene_id "g257"; 7 AUGUSTUS CDS 1123409 1124149 0.61 + 0 transcript_id "g257.t1"; gene_id "g257"; 7 AUGUSTUS stop_codon 1124147 1124149 . + 0 transcript_id "g257.t1"; gene_id "g257"; # protein sequence = [MAIFLVRSLRLQSSFDTSFDCERPSFDRWYSKLPATPSRALNRGIPNMHSPSAIRTLIVDNESEFEEDESDEGKVNPW # VNQSASNSLTSTTELLEGHECPPNCYLCSISAVIYKIEYPELYEECDNLDDEDDFEDCTASAPTTHCVPECISCARERLRAEGYKFPAYQYDHSDHIP # DDDEAKVEEKIKPWGQRISREEVDPQINIVFTTPPPDSQKAESTTLPVKLNEIFPRVFFPPPKPSSSTCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g257 ### # start gene g258 7 AUGUSTUS gene 1132142 1133431 0.33 + . g258 7 AUGUSTUS transcript 1132142 1133431 0.33 + . g258.t1 7 AUGUSTUS start_codon 1132142 1132144 . + 0 transcript_id "g258.t1"; gene_id "g258"; 7 AUGUSTUS CDS 1132142 1132512 0.66 + 0 transcript_id "g258.t1"; gene_id "g258"; 7 AUGUSTUS CDS 1133002 1133431 0.55 + 1 transcript_id "g258.t1"; gene_id "g258"; 7 AUGUSTUS stop_codon 1133429 1133431 . + 0 transcript_id "g258.t1"; gene_id "g258"; # protein sequence = [MSFPRSFNYWERKSVWVSTLRMVTRRLQSTSFVLANINELQEKIEELTTRAKALEDALAKSHNLVSPQPHPLLSDDLL # QITRTVKEESPEPNLSTDSTTVKKEENNKQEEDEALIVYKSSLGSLYTPISEVEFKTTIFEPYYEPDEGTLFEDPLVSHNLAILFLVIALGALLDLEG # PAHSQEAKWYYQLGKAALALEPVLDSSSLSTIQALVCGFRCIFIFYIAEILHQILLAYYMLLDDIHDLRWSIMGLTSKLTQTVSFSDMIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g258 ### # start gene g259 7 AUGUSTUS gene 1137466 1138717 0.58 + . g259 7 AUGUSTUS transcript 1137466 1138717 0.58 + . g259.t1 7 AUGUSTUS start_codon 1137466 1137468 . + 0 transcript_id "g259.t1"; gene_id "g259"; 7 AUGUSTUS CDS 1137466 1138157 0.58 + 0 transcript_id "g259.t1"; gene_id "g259"; 7 AUGUSTUS CDS 1138255 1138717 1 + 1 transcript_id "g259.t1"; gene_id "g259"; 7 AUGUSTUS stop_codon 1138715 1138717 . + 0 transcript_id "g259.t1"; gene_id "g259"; # protein sequence = [MKGIRESVQQGVGRFLGAVAGTNDPSYTTSHRRSLTHTPSQSSSSASTYATSSTRFSQSSQSSFGDIVPTSISEEDGD # LMSDSNIDVTSMKRARKHRPTHIGIVSDTGATPLVSPTRDFALESPPRTATPSTRAVHGGGNVRSRRKSRTFSSESPTEVTGTSASEETNRCADSDTN # TSESLSSSLVDWGMGLSSPPPVDSPVPGQGSGKRNLNKRMSLPARALSSGSGADSISKNQKRASVLLSDVSQSISQSIPQSIIQALVSPPLSASSELA # PPSGYHNRIEKQTSLASASSTSLLDEDIPPEESGGSLTPLLEPSPAPFPVLSPTKLAPSSTEPQPKSPMKNKLSSSPAGVTNAGKTNKTGSKFISAVA # SQEDDDDDDWNW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g259 ### # start gene g260 7 AUGUSTUS gene 1143598 1143918 1 + . g260 7 AUGUSTUS transcript 1143598 1143918 1 + . g260.t1 7 AUGUSTUS start_codon 1143598 1143600 . + 0 transcript_id "g260.t1"; gene_id "g260"; 7 AUGUSTUS CDS 1143598 1143918 1 + 0 transcript_id "g260.t1"; gene_id "g260"; 7 AUGUSTUS stop_codon 1143916 1143918 . + 0 transcript_id "g260.t1"; gene_id "g260"; # protein sequence = [MRYIAAYLLLQLGGNTSPSAADIKKVLSAVGIESEEERLDKLLSELSGKDINTLISEGSSKLSSVPSGGGAAAASAAP # AAGGAAPAAEKEEEKKEEEKVPFISPIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g260 ### # start gene g261 7 AUGUSTUS gene 1145195 1146406 0.77 - . g261 7 AUGUSTUS transcript 1145195 1146406 0.77 - . g261.t1 7 AUGUSTUS stop_codon 1145195 1145197 . - 0 transcript_id "g261.t1"; gene_id "g261"; 7 AUGUSTUS CDS 1145195 1146406 0.77 - 0 transcript_id "g261.t1"; gene_id "g261"; 7 AUGUSTUS start_codon 1146404 1146406 . - 0 transcript_id "g261.t1"; gene_id "g261"; # protein sequence = [MSTRSSPVAIQTAVPVPTPSKASATAPSRGSSDRTDSSDSIAETKQKTVKVKGTSSVDVDRSASTGRLKTMRNSYRVL # KNLTPKQMDDFMNSYVIYGLDWENEAQMITTLGPDYPTAVHDCLVSYYSVLNHLCALGEVEKMYIPPVMNIHAGILDNQLLYEEFVAREIELKSGDHV # LDLGCGRGRVAAHMSKYTGAHVTGLNLDADQLASARTFAAKRKLPLEFIQQDFNVLPLKLETESFDAFYQIQALSLCKDLPATFREIYRVLKPGAKLS # LLDWVSLPAYDPGNSEHAELMRRIKPLIGAVGTPTVEKFHTALEEAGFHVLKSDNASIDGLQAPLIERADGYFRRLQSLILALVKLRVLPPHFKTLML # RLTQDGQAFIQADRMRLITTSYHILAEKPRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g261 ### # start gene g262 7 AUGUSTUS gene 1149028 1149468 0.18 + . g262 7 AUGUSTUS transcript 1149028 1149468 0.18 + . g262.t1 7 AUGUSTUS start_codon 1149028 1149030 . + 0 transcript_id "g262.t1"; gene_id "g262"; 7 AUGUSTUS CDS 1149028 1149468 0.18 + 0 transcript_id "g262.t1"; gene_id "g262"; 7 AUGUSTUS stop_codon 1149466 1149468 . + 0 transcript_id "g262.t1"; gene_id "g262"; # protein sequence = [MASATYSDEKYPHQMKVNIYNINDNAITTPLSVAARPNARTKTFLRLLTVAGLAVACTIAFIHGFTKGSMPPMEDGFY # PNVVLKEPGEFTTMERNPAYLVEAQNGVVATENKRCSDMGVIALRKGGSAVDAAITATLCIGVVNSFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g262 ### # start gene g263 7 AUGUSTUS gene 1153464 1153996 0.36 + . g263 7 AUGUSTUS transcript 1153464 1153996 0.36 + . g263.t1 7 AUGUSTUS start_codon 1153464 1153466 . + 0 transcript_id "g263.t1"; gene_id "g263"; 7 AUGUSTUS CDS 1153464 1153748 0.36 + 0 transcript_id "g263.t1"; gene_id "g263"; 7 AUGUSTUS CDS 1153799 1153996 0.4 + 0 transcript_id "g263.t1"; gene_id "g263"; 7 AUGUSTUS stop_codon 1153994 1153996 . + 0 transcript_id "g263.t1"; gene_id "g263"; # protein sequence = [MTVRIPPKNPGERSKAYTIDFRGMAPSATTPTMFDNGKIALSASGGLAMLIPGELAGLQMAHDEWGAMTWKEVVVPNA # ELAMGWTVDKELARRIQWFPDLFTNDPDFREIFAPNGTLLKEGDIIERNNYARTLLEVAEGGAEVFYNGVSSPSSSVCPLVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g263 ### # start gene g264 7 AUGUSTUS gene 1155903 1157028 0.66 - . g264 7 AUGUSTUS transcript 1155903 1157028 0.66 - . g264.t1 7 AUGUSTUS stop_codon 1155903 1155905 . - 0 transcript_id "g264.t1"; gene_id "g264"; 7 AUGUSTUS CDS 1155903 1156423 0.66 - 2 transcript_id "g264.t1"; gene_id "g264"; 7 AUGUSTUS CDS 1156479 1157028 1 - 0 transcript_id "g264.t1"; gene_id "g264"; 7 AUGUSTUS start_codon 1157026 1157028 . - 0 transcript_id "g264.t1"; gene_id "g264"; # protein sequence = [MSSSEVKVPFFKKKGSRPTTSRKRSTSPSSSAAHSTLPSSSSSSKSEVVLPTKKTTSNLLSAGTKRKLTERDHDDLDA # PEKDGPDVKWTSAGSHMHAALDILAGDEAEELLAKRRKADAKDDEDEYGGPDDGLYKGQKAYKSHIKKSSEVPKAMRVGPQRNTSSTIRTVTIVDYQP # DVCKDYKETGYCGFGDTCKFLHDRGTCEFVPFFPTLTTNPNLPTPDLAGWQLDKLADTPRKQVGDEDSDDSDDDEDIPFACLICRKPYTDPIVTKCGH # FFCSACAIKRFAKTPKCLACGTPTGGMFNRADKVIAKMRKKREEKGGGDEEEAGAGVEIEGLQKEVHKSDNGSDSDADDDDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g264 ### # start gene g265 7 AUGUSTUS gene 1157464 1158753 0.37 - . g265 7 AUGUSTUS transcript 1157464 1158753 0.37 - . g265.t1 7 AUGUSTUS stop_codon 1157464 1157466 . - 0 transcript_id "g265.t1"; gene_id "g265"; 7 AUGUSTUS CDS 1157464 1157558 0.6 - 2 transcript_id "g265.t1"; gene_id "g265"; 7 AUGUSTUS CDS 1158056 1158082 0.62 - 2 transcript_id "g265.t1"; gene_id "g265"; 7 AUGUSTUS CDS 1158133 1158166 0.38 - 0 transcript_id "g265.t1"; gene_id "g265"; 7 AUGUSTUS CDS 1158271 1158753 0.91 - 0 transcript_id "g265.t1"; gene_id "g265"; 7 AUGUSTUS start_codon 1158751 1158753 . - 0 transcript_id "g265.t1"; gene_id "g265"; # protein sequence = [MFSQTIIRSATRSFSSSSVISNRCIAYTQNGDPTQVLTAFTYPKLPSPPPSTVNLKFLLSPINPADVNTIEGVYPSKP # THTSNLAASGLGSKDEPVFVGGNEGLAQVVEVGEGVKGLKKDDWVVMDRPQLGTWSTSRNVPFNSVIKLPATGLTEAHGATMTAGDWVIQNGANTTEY # LGRPAXKEELISKLAGMMKEGKVCVTDTTRSNMNSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g265 ### # start gene g266 7 AUGUSTUS gene 1159539 1159853 0.71 + . g266 7 AUGUSTUS transcript 1159539 1159853 0.71 + . g266.t1 7 AUGUSTUS start_codon 1159539 1159541 . + 0 transcript_id "g266.t1"; gene_id "g266"; 7 AUGUSTUS CDS 1159539 1159853 0.71 + 0 transcript_id "g266.t1"; gene_id "g266"; 7 AUGUSTUS stop_codon 1159851 1159853 . + 0 transcript_id "g266.t1"; gene_id "g266"; # protein sequence = [MAPYEAAVLTQIILKDLRGLLYPQIERDPTAALKDYNTKAVKILTKENAMWAWDPSNSMNRSYRARWDLDVAAKAFES # GQEVGPRIGTQIGVCLPIKLALSHPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g266 ### # start gene g267 7 AUGUSTUS gene 1160612 1161061 0.41 + . g267 7 AUGUSTUS transcript 1160612 1161061 0.41 + . g267.t1 7 AUGUSTUS start_codon 1160612 1160614 . + 0 transcript_id "g267.t1"; gene_id "g267"; 7 AUGUSTUS CDS 1160612 1161061 0.41 + 0 transcript_id "g267.t1"; gene_id "g267"; 7 AUGUSTUS stop_codon 1161059 1161061 . + 0 transcript_id "g267.t1"; gene_id "g267"; # protein sequence = [MLADRWLINLDEPSQSSPSDWSFDGDYTADDDEEMAYHREETADEDVNGGGTARRTLHDVFARRIAVGEEGLVLKAAD # SEYNEPKKPWVKLKKDYIEGLGDIVDLVLLGAACVPDRALELRGTRSAFTMSLNLTFSIFFFYFPQFLLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g267 ### # start gene g268 7 AUGUSTUS gene 1161647 1162867 0.33 + . g268 7 AUGUSTUS transcript 1161647 1162867 0.33 + . g268.t1 7 AUGUSTUS start_codon 1161647 1161649 . + 0 transcript_id "g268.t1"; gene_id "g268"; 7 AUGUSTUS CDS 1161647 1162867 0.33 + 0 transcript_id "g268.t1"; gene_id "g268"; 7 AUGUSTUS stop_codon 1162865 1162867 . + 0 transcript_id "g268.t1"; gene_id "g268"; # protein sequence = [MSLQELRKQAREAMGRVAAAEAARKDAETTFIHPNARSGRNAFVNVNHRPEGMRKRVEMWRTRVAAADRPKKNKGSGE # KSSGSLVKQRKRERSVHNDFGASPRKKRVVGNGNGGNNIIPSSLAGWCTTASSRLLLLSEVPGRCVQMETSVMLDNSLAGISDDQIVPPVVGTIPGNT # VDIVIPLVEHLASEDHGLPLQNATNMIQFAIQEDSHSKSSSSSNDENNQPFAPNPPTPSLAKTHFSQLELLRSKRRQYPSPPTSPMHSKRLDERVPPT # VCQTDPSVDLFFKDALFWVPSLKDRQHGLPSVRSIVESGSRANGLEAFLGACRWNPRKYNPMKPPPTRGIVFVDLEDEWGSRWKRNVVDGIRYLERQW # TCTDEPRVPIWIFDRRTVFQAGKDVGSQALHVFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g268 ### # start gene g269 7 AUGUSTUS gene 1167585 1169148 0.39 - . g269 7 AUGUSTUS transcript 1167585 1169148 0.39 - . g269.t1 7 AUGUSTUS stop_codon 1167585 1167587 . - 0 transcript_id "g269.t1"; gene_id "g269"; 7 AUGUSTUS CDS 1167585 1168784 0.97 - 0 transcript_id "g269.t1"; gene_id "g269"; 7 AUGUSTUS CDS 1168938 1169066 0.89 - 0 transcript_id "g269.t1"; gene_id "g269"; 7 AUGUSTUS CDS 1169125 1169148 0.43 - 0 transcript_id "g269.t1"; gene_id "g269"; 7 AUGUSTUS start_codon 1169146 1169148 . - 0 transcript_id "g269.t1"; gene_id "g269"; # protein sequence = [MGNINNSTSFEESSTVHIAFYNEESSQVQSRPGFALINYIPSSISGIRRGTTEYATLTIDHLSNLTPSAIHQAVLHPD # GIHNIRIERSASSPEPVDPQSTLESMIFPIRRSFTENRDPSVIPLNYSTPPKSQSLFSSILRRKRATPSTDVPWDSDEDVAPPTPPKDNNSVSRSNFT # YTPGARLRSIPNSDLRKSLAEFAFISHPIPSSDDEVIVEHPNPPPKTLQPLSSNKPDGALFSIPLDRKWVHDTVYISDPEERARRRKLVQQQRALEEQ # QALQQEAERQARIKEEKEELKRQEEEEEAWRKSMLEQELQEIKARRRAREQREQEEDARKKREIEARKEMDRKRRMEEHEKLEEWRQQMAWEVEAEKM # KEEDDRRRADAERKTKVQNMVKEVKMELRSSGWTTAWATLQTGDSLVWRRRYLKLVGSKIFIYRSPKVRRARSSLVFQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g269 ### # start gene g270 7 AUGUSTUS gene 1186012 1186931 0.58 - . g270 7 AUGUSTUS transcript 1186012 1186931 0.58 - . g270.t1 7 AUGUSTUS stop_codon 1186012 1186014 . - 0 transcript_id "g270.t1"; gene_id "g270"; 7 AUGUSTUS CDS 1186012 1186788 0.65 - 0 transcript_id "g270.t1"; gene_id "g270"; 7 AUGUSTUS CDS 1186875 1186931 0.71 - 0 transcript_id "g270.t1"; gene_id "g270"; 7 AUGUSTUS start_codon 1186929 1186931 . - 0 transcript_id "g270.t1"; gene_id "g270"; # protein sequence = [MSFSAGVDLDWCLTCNRHLCEPTPSQQILNLSSNVHDWTQSEELDASGDDAVIFHIVHDTSSAKGIAAWAANIPTGAP # PSGPSTLPSYSVSPPKLLRPQYARPVPPTLSMSQTTSASIPLATPPQKDVSMLSSLANHIRSFVSSSSTGFPVNKLRARTKKRLPYTTAPVQRISSLS # SDSFAEDDYEFGPSFSTVNSPHEDTKDPWWTTESDCSSAASSMVLKKSAAQLIATSESRKYQLECEMCFQPKVLPIRVEPSSKDGLSDYGEFDLRGRQ # IWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g270 ### # start gene g271 7 AUGUSTUS gene 1193441 1194883 0.22 - . g271 7 AUGUSTUS transcript 1193441 1194883 0.22 - . g271.t1 7 AUGUSTUS stop_codon 1193441 1193443 . - 0 transcript_id "g271.t1"; gene_id "g271"; 7 AUGUSTUS CDS 1193441 1193750 0.72 - 1 transcript_id "g271.t1"; gene_id "g271"; 7 AUGUSTUS CDS 1193842 1193949 0.35 - 1 transcript_id "g271.t1"; gene_id "g271"; 7 AUGUSTUS CDS 1194171 1194883 0.33 - 0 transcript_id "g271.t1"; gene_id "g271"; 7 AUGUSTUS start_codon 1194881 1194883 . - 0 transcript_id "g271.t1"; gene_id "g271"; # protein sequence = [MGYIETLFGHQDQILALDCLPSLPTLPPISLASVIRRPPSTFTVTNPSPVPASASAKTLTYARHPLTTPAETLLTVGA # RDKTARFWKVPEETQLVFRGGGATSTGAQGQEIQTKRDKLRDVLEGKMDALAADDENSGDENAKRGQKKGVQEHYRYIEGSLESVAMIDENTFLTGGD # SGSICLWSTSKKKPVFTCSVAHGVYNPLSEQVDEEEIEIPPHPRWITALASLRYSDLFASGEFLRRQYPTMEIDILLFQEECGSTVILYAPLHDPLCC # IKPQGKSVDNGSGPRKQNPDARPILLIASLGQEHRFGRWVSIKRQTIEVPSSLSEGVSVQSKDIDILMGDTGVDGGGGPTKEVPVHNGAIVWSLFPKG # WGER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g271 ### # start gene g272 7 AUGUSTUS gene 1195077 1195919 0.99 - . g272 7 AUGUSTUS transcript 1195077 1195919 0.99 - . g272.t1 7 AUGUSTUS stop_codon 1195077 1195079 . - 0 transcript_id "g272.t1"; gene_id "g272"; 7 AUGUSTUS CDS 1195077 1195919 0.99 - 0 transcript_id "g272.t1"; gene_id "g272"; 7 AUGUSTUS start_codon 1195917 1195919 . - 0 transcript_id "g272.t1"; gene_id "g272"; # protein sequence = [MPDSFFTSGKPRKRKRVESSPAGANSGKKIRHTPNPKGKKPKSKRLDEDLDSDQTSGLGDADDLRAPLDLEDEVEADD # DPNETPAEKRLRLAHLYLDGVKEDLAANQGDFDAAEIDKELISSRLRGAQYKGRVHLFVADEFAEASSSHLKVKGHRFSCTAAVASPVTSSSTTPGYY # LFTAGKEGHILKWDLQNGKQVAAMYKVKPDKGKGKGKGRANVTRTAGHTSSVTSLALTTDGTYLASGSMDSRACIWDARSCRWIAGFAHKDTISVRQI # FPLLIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g272 ### # start gene g273 7 AUGUSTUS gene 1196327 1196845 0.72 + . g273 7 AUGUSTUS transcript 1196327 1196845 0.72 + . g273.t1 7 AUGUSTUS start_codon 1196327 1196329 . + 0 transcript_id "g273.t1"; gene_id "g273"; 7 AUGUSTUS CDS 1196327 1196845 0.72 + 0 transcript_id "g273.t1"; gene_id "g273"; 7 AUGUSTUS stop_codon 1196843 1196845 . + 0 transcript_id "g273.t1"; gene_id "g273"; # protein sequence = [MHRSVGCTGHKWRRLWIHIASIAHLKSGGCSTLYGIHRAGYQPAETLISELSLARSLLETKSSTGILPVGVGYLGWLL # DKMPPKESETLLIAALSANVQAFWFAFGRNLGKWIQYVRDKSPEKCPLIFVQVNSLDEAVHAVENLKADVIVAQGEHEGFSLLFDADVGYILQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g273 ### # start gene g274 7 AUGUSTUS gene 1198397 1199402 0.2 - . g274 7 AUGUSTUS transcript 1198397 1199402 0.2 - . g274.t1 7 AUGUSTUS stop_codon 1198397 1198399 . - 0 transcript_id "g274.t1"; gene_id "g274"; 7 AUGUSTUS CDS 1198397 1198400 0.68 - 1 transcript_id "g274.t1"; gene_id "g274"; 7 AUGUSTUS CDS 1198453 1198499 0.68 - 0 transcript_id "g274.t1"; gene_id "g274"; 7 AUGUSTUS CDS 1198551 1198947 0.9 - 1 transcript_id "g274.t1"; gene_id "g274"; 7 AUGUSTUS CDS 1199091 1199107 0.48 - 0 transcript_id "g274.t1"; gene_id "g274"; 7 AUGUSTUS CDS 1199184 1199402 0.44 - 0 transcript_id "g274.t1"; gene_id "g274"; 7 AUGUSTUS start_codon 1199400 1199402 . - 0 transcript_id "g274.t1"; gene_id "g274"; # protein sequence = [MSGLTSQPSMGAVCGALEQTSLGTGIRYEDIQALNLYWSQVRVLYGCFEANVRASDSSVFDHEMPGGQYTNLMLGLGT # HVVTSSRYSKLFLLITTAQILVNQVTPSSKVVGDFAQWMTSNSFSKDDVLQRAESLDFPSSVVEFFQGYLGQPVGGFPEPLRSHVIRNKPRIDGRPGA # TMEPLDFKKIKAELRTKFGKHITDSDVTSYVMYPKVFEEYQGFIEKYGDLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g274 ### # start gene g275 7 AUGUSTUS gene 1204863 1206230 0.86 + . g275 7 AUGUSTUS transcript 1204863 1206230 0.86 + . g275.t1 7 AUGUSTUS start_codon 1204863 1204865 . + 0 transcript_id "g275.t1"; gene_id "g275"; 7 AUGUSTUS CDS 1204863 1206230 0.86 + 0 transcript_id "g275.t1"; gene_id "g275"; 7 AUGUSTUS stop_codon 1206228 1206230 . + 0 transcript_id "g275.t1"; gene_id "g275"; # protein sequence = [MSRTFQWFAFTSITLCLWALGILSRSKVNGASNTQIFVDHEVRSRNPSIPARDANIPFNSDNKSFINEHSLTAILPVT # ENSLPNLRHILEPLVHPDTASVYLREILLVSQDRITSNLRSELFTIMSQMQFTRHIQCSIRSWKDTLSESTALIQAALTSSSEWILLLEQDGLVKLDK # SIGWTLLNPPMTALPLGPRGICLSHNVSCIPPSSDTALEASYLIPPFVMPSSLAMHAGEHATSWATFGAYVSSLKFKDAQVGGIVLPQPSQTTHDISW # CSSIEHTVTHDIYPRLDFKSLFDQWPSSSPTSGEVSDGSLSLDSSPIVFGILFLTHDDLNSFAPVACRLQQRGHTLQISLYDGNSSQAPPKLGFLEHS # MCILSYRALSADEPPAAWLDGLDGHPEVIVTLSEMTDPLNGCSSTSIIRLPREDLAHTQWMSSLTSHEWRGEYCAFLTQDVHH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g275 ### # start gene g276 7 AUGUSTUS gene 1209495 1209962 0.42 + . g276 7 AUGUSTUS transcript 1209495 1209962 0.42 + . g276.t1 7 AUGUSTUS start_codon 1209495 1209497 . + 0 transcript_id "g276.t1"; gene_id "g276"; 7 AUGUSTUS CDS 1209495 1209539 0.42 + 0 transcript_id "g276.t1"; gene_id "g276"; 7 AUGUSTUS CDS 1209684 1209962 0.59 + 0 transcript_id "g276.t1"; gene_id "g276"; 7 AUGUSTUS stop_codon 1209960 1209962 . + 0 transcript_id "g276.t1"; gene_id "g276"; # protein sequence = [MDEFASISSRRAREYTFDPKKRMTVEEALEHPYLAVYHDPNEEPVGSPLAAEEFEFDRKGIFLLSIAAHTDSSVTVRK # ERLSKQELKELLYAEILSFESDFSSAAAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g276 ### # start gene g277 7 AUGUSTUS gene 1210290 1212019 0.41 + . g277 7 AUGUSTUS transcript 1210290 1212019 0.41 + . g277.t1 7 AUGUSTUS start_codon 1210290 1210292 . + 0 transcript_id "g277.t1"; gene_id "g277"; 7 AUGUSTUS CDS 1210290 1210479 0.41 + 0 transcript_id "g277.t1"; gene_id "g277"; 7 AUGUSTUS CDS 1210548 1212019 0.66 + 2 transcript_id "g277.t1"; gene_id "g277"; 7 AUGUSTUS stop_codon 1212017 1212019 . + 0 transcript_id "g277.t1"; gene_id "g277"; # protein sequence = [MGKGRKVNKAKPSVSIPISARSKSSASASSAGSSPISPVTPKTPADEGIEFFQSPVAPGEAPLHASPILMATDGCLKY # IRLPPAYVPYILRVSIDAGTPASMNGVFKTNFPLDGGKFNRARFTERKYVNCSVFCAYILTNHISRLPSDFSKPIQIDLPISHAGAFVFWVEYDGELP # SQRIKGREGYFNVDPVLRIKGRSQILSSELTPLPPSSGAVLQKDTVNLPLDGLSILTVVSKWMGPMSEWKNHFAEAKDRGYTMLHYTPLQERGESDSP # YSIRDQLKYDPSMFDGKRQADGGKEKVEAILKVAREEYGLLSLTDVVLNHTANDSLWLVDHPESGSTVFFLRILQFFANYSMIGFSPANSPHLTPALE # LDSAMIEFSSSLASRGLPSIVNTQQDVDALIGAFRTVMKDLNLWQYYVLDVAREKESIKAVLASKKASPWTGPSIAGKSVVELAEVLRGSNVIIGLAE # LSSRFGVHSDANAASGFIQAAFVELSDPDALADAWVRVLDVINVPLYQEWEEDTKIAMDNIKNRLTYARLDENGPKLGEITRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g277 ### # start gene g278 7 AUGUSTUS gene 1213276 1214894 0.37 + . g278 7 AUGUSTUS transcript 1213276 1214894 0.37 + . g278.t1 7 AUGUSTUS start_codon 1213276 1213278 . + 0 transcript_id "g278.t1"; gene_id "g278"; 7 AUGUSTUS CDS 1213276 1213765 0.42 + 0 transcript_id "g278.t1"; gene_id "g278"; 7 AUGUSTUS CDS 1213842 1214244 0.78 + 2 transcript_id "g278.t1"; gene_id "g278"; 7 AUGUSTUS CDS 1214363 1214894 0.8 + 1 transcript_id "g278.t1"; gene_id "g278"; 7 AUGUSTUS stop_codon 1214892 1214894 . + 0 transcript_id "g278.t1"; gene_id "g278"; # protein sequence = [MGASIDITSYDVPVDAKTLKGLPHKLVEMSPVVVPQGLDDESPYSEIIVPEYFPPGSIMLFETHLQDHDASLEEFLVS # NSQEVFGNLGLVELNVVLYRADGEERDATNGQFGVYDVPGLGRLTYCGLEGWMHPLRHIMRNNDLGHPLCEHLRKGTWSLDYVYDHDLPNLKNVAQWF # KDRFDRIKATAPPFLRPKYFALVISEAYKAARRSVVEQCSEFVLTGHDFTQDLALCAIQMYGLVKSASLDPSKPTPSLAAGLPHFAAGWARCWGRDVF # ISLRGLFLTTGNFEGARKHILAFAYNSRDSPWWMVQNIQDYVKMAPDGLALLSEIVPRRFPKDETWVEWDGKRAYAYSSTVAEIIQEILQRHATGIHF # REYNAGPNLDMQMRDEGFNIDIDVDWKTGLIFGGNAFNCGTWMDKMGESQKAGTKGQPGTPRDGAPVEITGLVKSALTWLDGLSSKGKFPFKGVQAIG # TLLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g278 ### # start gene g279 7 AUGUSTUS gene 1217846 1218457 0.36 - . g279 7 AUGUSTUS transcript 1217846 1218457 0.36 - . g279.t1 7 AUGUSTUS stop_codon 1217846 1217848 . - 0 transcript_id "g279.t1"; gene_id "g279"; 7 AUGUSTUS CDS 1217846 1218457 0.36 - 0 transcript_id "g279.t1"; gene_id "g279"; 7 AUGUSTUS start_codon 1218455 1218457 . - 0 transcript_id "g279.t1"; gene_id "g279"; # protein sequence = [MTQSDKDFITRIQVSQLVSQDPYADDFYAQVYGAIVRSRMGLSADDERVLKFGASGGVALGAPTKGGNRRPNAMQRMQ # QQVERIVSNARKREEEKGLHCDFFPSEIPILNLTFCKALHSLQGALGKTSGRSYKAAPRQLLQVDSNSAPSSSPTLSHAQPHAHISKADSISKSSSEA # AANAARIGRETLDNVSSLSDSKYLAHF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g279 ### # start gene g280 7 AUGUSTUS gene 1219636 1219860 0.77 - . g280 7 AUGUSTUS transcript 1219636 1219860 0.77 - . g280.t1 7 AUGUSTUS stop_codon 1219636 1219638 . - 0 transcript_id "g280.t1"; gene_id "g280"; 7 AUGUSTUS CDS 1219636 1219860 0.77 - 0 transcript_id "g280.t1"; gene_id "g280"; 7 AUGUSTUS start_codon 1219858 1219860 . - 0 transcript_id "g280.t1"; gene_id "g280"; # protein sequence = [MSFFGFEERTLERGKDRRSEQDEDLAVYTWGEENYDGLGDALQEDHDDLNDETFGAVGELGKRMLYDKIRASSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g280 ### # start gene g281 7 AUGUSTUS gene 1221235 1221705 0.72 - . g281 7 AUGUSTUS transcript 1221235 1221705 0.72 - . g281.t1 7 AUGUSTUS stop_codon 1221235 1221237 . - 0 transcript_id "g281.t1"; gene_id "g281"; 7 AUGUSTUS CDS 1221235 1221705 0.72 - 0 transcript_id "g281.t1"; gene_id "g281"; 7 AUGUSTUS start_codon 1221703 1221705 . - 0 transcript_id "g281.t1"; gene_id "g281"; # protein sequence = [MFSLSTLELTSSFRLNDVPEPDMVVRRTRKELFVDNNAAICSEPPLDNAQYIDSNPNPVFDPHASLGVGTVANIFEAP # GQIDPMDVWRTYTKRSADDKNGRAPLTCLWPIRHNEEEIIECGYGATPKLMRRHVQTTHMHIKYVPPLPPGFFSCTNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g281 ### # start gene g282 7 AUGUSTUS gene 1222411 1223595 0.89 - . g282 7 AUGUSTUS transcript 1222411 1223595 0.89 - . g282.t1 7 AUGUSTUS stop_codon 1222411 1222413 . - 0 transcript_id "g282.t1"; gene_id "g282"; 7 AUGUSTUS CDS 1222411 1223595 0.89 - 0 transcript_id "g282.t1"; gene_id "g282"; 7 AUGUSTUS start_codon 1223593 1223595 . - 0 transcript_id "g282.t1"; gene_id "g282"; # protein sequence = [MLNDIFAGVNDGRLRSPFDVVGRFLEDSRATHFSTAFAELFQGMVLRNPDDLQDGETLSNSDGSRPIVSWPLDSHPNT # AGGVRVTLDSMVCQSLLISYSSTHTFTTLSQKGDQNRTGDMPPMEPINDPRQASGQTSSPSRRVSGTNGDAAESDDSMPSLNEVSDSDDDSLEWSDDN # SEYESNIPFTSSSATHPSPRAQEPRGRFPRAILVPRRGVIRPRYLQRGTIAAGGIVNPIPSTSTSSSAPRPPTSNNDLLPLQSVSRSENDGYEKEDEG # DTHHSEEHQHEDEFHFDRTHATADLNTNVMPPLERINEGSYPQGVTASRFDPQPLYETLIPSDIAAGAGAPDAPEADDERHDMLSVPPFTTDGRGRVI # AASDEDARDARSLLTRMFGTLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g282 ### # start gene g283 7 AUGUSTUS gene 1228330 1229450 0.69 + . g283 7 AUGUSTUS transcript 1228330 1229450 0.69 + . g283.t1 7 AUGUSTUS start_codon 1228330 1228332 . + 0 transcript_id "g283.t1"; gene_id "g283"; 7 AUGUSTUS CDS 1228330 1229024 0.69 + 0 transcript_id "g283.t1"; gene_id "g283"; 7 AUGUSTUS CDS 1229381 1229450 0.69 + 1 transcript_id "g283.t1"; gene_id "g283"; 7 AUGUSTUS stop_codon 1229448 1229450 . + 0 transcript_id "g283.t1"; gene_id "g283"; # protein sequence = [MPSSSSEQGQAPDKVKADAAQNTANNNKPSADEEETVQASVRKPVGFQRELWRSVLAPRGYTWNEEETMLIKSPNKPR # HPVPVEDQEEDSHPGRNNRSVLSSSSFRRANSFAQLPPKQPLRRLLSTRMVKDLSPVGETNGFEAADMEIDTPGAGPSITRDSAPLEDVLPRTHLPPP # LHTPSIFSGLRFTALGEGNCDSVRGAIRKAGGAFVENVDLEAEAYEVDIIIVRLVRSHPAVELFETCDPSPLPVSGRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g283 ### # start gene g284 7 AUGUSTUS gene 1415072 1417420 0.98 - . g284 7 AUGUSTUS transcript 1415072 1417420 0.98 - . g284.t1 7 AUGUSTUS stop_codon 1415072 1415074 . - 0 transcript_id "g284.t1"; gene_id "g284"; 7 AUGUSTUS CDS 1415072 1417420 0.98 - 0 transcript_id "g284.t1"; gene_id "g284"; 7 AUGUSTUS start_codon 1417418 1417420 . - 0 transcript_id "g284.t1"; gene_id "g284"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQRPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPLDKDLGPDDPILMGINEWLAFANESTEEEVEEILEAGRSTMEKVTPNPAKDSEEAYQKWKSRDTKRSSSWPGAKQKVQWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPSIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASDSSA # TEGVQQPKDPESGDPSSEQGGVVNELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKE # YIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGS # FEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEVSHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEK # VKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILS # QLDPETGEIHLSPSMHDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g284 ### # start gene g285 7 AUGUSTUS gene 1417633 1421934 0.93 - . g285 7 AUGUSTUS transcript 1417633 1421934 0.93 - . g285.t1 7 AUGUSTUS stop_codon 1417633 1417635 . - 0 transcript_id "g285.t1"; gene_id "g285"; 7 AUGUSTUS CDS 1417633 1421934 0.93 - 0 transcript_id "g285.t1"; gene_id "g285"; 7 AUGUSTUS start_codon 1421932 1421934 . - 0 transcript_id "g285.t1"; gene_id "g285"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEI # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGPTVYTYMPMR # HMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKH # SSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSN # PSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAPFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTAG # EVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEY # GRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRRE # EDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIKSFAGDDRSAWKTWVLSLERMFGVRPTIYA # REKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTY # LKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLHGEKALQGWLSRFPGLELAPEAPYKSPLRREREPADVWTSNPKPAATGRFH # SRPNWKEGQQRASAAWGEGESYDSENREEDEDCCHCRDGGEWTEAVLRAGVTDTGRKWTPEERAEKWRRRRQELCMRCGRKEHWAKDCPNPESLERPA # EDQGSSERASKADSTRGRGTANQGGGRKDDSTRPLERIRAGIVVEEREGMDDLWNVHILDSPKGGEQELLDEVGNGQGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g285 ### # start gene g286 7 AUGUSTUS gene 1423008 1423826 0.85 - . g286 7 AUGUSTUS transcript 1423008 1423826 0.85 - . g286.t1 7 AUGUSTUS stop_codon 1423008 1423010 . - 0 transcript_id "g286.t1"; gene_id "g286"; 7 AUGUSTUS CDS 1423008 1423826 0.85 - 0 transcript_id "g286.t1"; gene_id "g286"; 7 AUGUSTUS start_codon 1423824 1423826 . - 0 transcript_id "g286.t1"; gene_id "g286"; # protein sequence = [MKDSVAGGDLLVCRGLQKRSLPLESAFMSSPKTPEDKEAMINIPYMSAVGSLLFLAMILRADIAFATGVLTRFNSNPG # PAHWLAVKHLLRYLKGTIDYELELGPDPTAPDLITAISDADLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRS # LLTELGYKVASPTIIHVDNQSSIQVAKNPEHHGRMKHLDRTFYWLREQVTHGKLAPSYLPTEDNPADLLTKALVKQKVEKFRTMIGLVKPSTSDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g286 ### # start gene g287 7 AUGUSTUS gene 1430067 1434245 1 + . g287 7 AUGUSTUS transcript 1430067 1434245 1 + . g287.t1 7 AUGUSTUS start_codon 1430067 1430069 . + 0 transcript_id "g287.t1"; gene_id "g287"; 7 AUGUSTUS CDS 1430067 1434245 1 + 0 transcript_id "g287.t1"; gene_id "g287"; 7 AUGUSTUS stop_codon 1434243 1434245 . + 0 transcript_id "g287.t1"; gene_id "g287"; # protein sequence = [MSSTTISTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ # VPIKAHQEDPIRMWSILEKQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALI # RALPEEYRHLSSNLLMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPSNPHNKRKG # IQANKAKVTEVDDDGVTESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRNWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEAR # QVLFSRVLHVPSLNNNLLSVLYLTKHKGFTVQILKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYG # DVSKLSKNKMVEGFKLESSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFK # RFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQDEGIEVQRTARNRPQQNGVAERLNRTLAELLTAMLLESGLPKTFWVECLAALVYVLNRCPTSA # VPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVP # PETTPKQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDEQPIAIRRPVRTRKPPGEWWKTKPSTSRVPA # NNDDSDNSNDDYYGDAELAASTTIQVEPRNYREAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLPPGAKAIGSTWVFRIKHNADGSIERFKARLCAQ # GFSQRPGFDYLETYASTLRWSSLRLVLALAAIDDMELRSVDISHAFINSDIDTTIYMKQPEGFKQGGSEKVCRLNKSIYGLKQSPRLWSEKLCSVLVK # LGFKRLESDPCVYLFQRGDIKVIVPVWVDDITLASKNSGVLNKFVIELSKELKLRDLGETTFLLGIGIRRDRPNRKLYLNAKQYIIRKLDEFGMQDSK # PVKTPLNPNVTLSKEDSPQTPEDKEAMINVPYMSAVGSLLFLSMIIRADTAYATGVLTRFNSNPGPAHWLAVKHLLRYLKGTIDYELELGPDPTAPDL # ITAISDSDLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVASPTIIHVDNQSSIQVAKNPEHHG # RMKHLDRTFYWLREQVIHGKLAPSYLPTEDNPAAYAYFHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g287 ### # start gene g288 7 AUGUSTUS gene 1446256 1449256 0.45 + . g288 7 AUGUSTUS transcript 1446256 1449256 0.45 + . g288.t1 7 AUGUSTUS start_codon 1446256 1446258 . + 0 transcript_id "g288.t1"; gene_id "g288"; 7 AUGUSTUS CDS 1446256 1447635 0.45 + 0 transcript_id "g288.t1"; gene_id "g288"; 7 AUGUSTUS CDS 1447694 1449256 0.8 + 0 transcript_id "g288.t1"; gene_id "g288"; 7 AUGUSTUS stop_codon 1449254 1449256 . + 0 transcript_id "g288.t1"; gene_id "g288"; # protein sequence = [MAPERSTSPDPLASYDISPSAPQIALDKAQIASDKPLQRSQTLPSTSSTQISLDKGKGRAQPAQSTSYIASRPSPELR # SVRIRPRTLQERLQIIPEAGTAPQVTGSEHREASIALSTHSHHSSHQIPLQDRISAAPTPPDALEQVRLTAEALGQVVEQYRNNELSPNDAFRALRSL # TDDPTVVRDFIGQIQEIQRDHLRASRERVAAAKAARVAAAAASKSRISDGPLVSTEKAVNEAAWALMERELAENALQLAAAEAEADQMEQDAHQDRSN # SLQQALLKLVGQTQSSSSPGTSSGLPPSLLEAAPHLSALTSSDILSPTVSETWKLRMLFTVDSHVDTTVSLLSAQPFTDPLPQSLLKLIVKDRYVDFE # KIHASITSYTSIFDDSTTFGSEYKLVKKEHSIRSLPVTSEAQWLRVFDAWLAPVLKIYPHRQSELSAYKASIMEFFRAAPSDPSIAFRKTSDFCCLRN # FSVLENVPAPLLALLLLQSARILLVSFGMKGNALPHVQIAASMASVVSVESPTKQLTPNPAMRSLSTVDQRVKTALAGPRSLAGTKRAAPESNSGSSN # SIPRFRRGYLWSTSSSSSEIIPPSIQSTYTAPPLPSPPEHLLNNPQIQSTLKAMAPYIKVETPFNVDRLESLLASHPNQPFVASVMRSLREGFWPFYE # AEWEVESKQKLDNYVSEPQDFAALRAHRDQEVAAGRWSEALPEDFVLLPGMKVSPMFVVWQKGKPRVVMDHTGSGLNDNIPKAEGKVKYDDMHTFGQV # LNDIMKEHPDEELILFKSDVSKAFLNLPGHPLWQLCQVVEVDGRYHIVRRLVFGTRTSPHCWCSLSSLMCWFGSEKLGIIGLHVYMDDFYGWDFKRNL # LLFHDQLRPKRQVQLLVFWDMILCPYEDKKQEHGVTLKIIGFWVDIVKGSISLSSESIQGLVADITSFLSSPKRQAALRDWQHLAGSLNWSLNVLPWA # RPALTEMYRKMSRHEGGFQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g288 ### # start gene g289 7 AUGUSTUS gene 1451417 1451941 0.18 + . g289 7 AUGUSTUS transcript 1451417 1451941 0.18 + . g289.t1 7 AUGUSTUS start_codon 1451417 1451419 . + 0 transcript_id "g289.t1"; gene_id "g289"; 7 AUGUSTUS CDS 1451417 1451434 0.98 + 0 transcript_id "g289.t1"; gene_id "g289"; 7 AUGUSTUS CDS 1451486 1451941 0.18 + 0 transcript_id "g289.t1"; gene_id "g289"; 7 AUGUSTUS stop_codon 1451939 1451941 . + 0 transcript_id "g289.t1"; gene_id "g289"; # protein sequence = [MDNISQNGDHNSSSSPLHAEQLALDPSSSTLTSSDTSTILPSATQSTNMAPVNAGPSANRGAPPVIPAGIDNMGMSID # VDRSVPIVAADVSMDGHGVPGVPVGGSGAMLNAETQSNESKKNSKAKTRTTSTGNSIVRPNTSTGMKYVFIFMSGQKVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g289 ### # start gene g290 7 AUGUSTUS gene 1459410 1460376 0.32 - . g290 7 AUGUSTUS transcript 1459410 1460376 0.32 - . g290.t1 7 AUGUSTUS stop_codon 1459410 1459412 . - 0 transcript_id "g290.t1"; gene_id "g290"; 7 AUGUSTUS CDS 1459410 1459760 0.97 - 0 transcript_id "g290.t1"; gene_id "g290"; 7 AUGUSTUS CDS 1459852 1460376 0.32 - 0 transcript_id "g290.t1"; gene_id "g290"; 7 AUGUSTUS start_codon 1460374 1460376 . - 0 transcript_id "g290.t1"; gene_id "g290"; # protein sequence = [MIQTGLITSAHSDLLTCLAYDYYGANIASCGLDQKIVVTAVNAEQSPTVKYEWRAHSAPITCVAWAHPEFGEVLASAG # MDRTVRVWERGEEKAVLLDARAGVRQVEFAPQAFGLKVATVAADGWVRVYECLDLGKLDVWALADAVEVAREEQQGGAGGKEVEGGWGCRGVRRGIGI # IQFSPSRSPQTILELKPPPPSTTTSAPATSVITTVAWAPSCGRSYHLIATGGRDGHVRIWKVSGPMVDSEEDDPEDRDLGDATNGKWSGQLVADFDDH # ARIGALEGVWWGRSSGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g290 ### # start gene g291 7 AUGUSTUS gene 1469969 1470712 0.93 + . g291 7 AUGUSTUS transcript 1469969 1470712 0.93 + . g291.t1 7 AUGUSTUS start_codon 1469969 1469971 . + 0 transcript_id "g291.t1"; gene_id "g291"; 7 AUGUSTUS CDS 1469969 1470712 0.93 + 0 transcript_id "g291.t1"; gene_id "g291"; 7 AUGUSTUS stop_codon 1470710 1470712 . + 0 transcript_id "g291.t1"; gene_id "g291"; # protein sequence = [MNYSHTLQSDLPPKPPREIRLRWDPSNPYAKYRKNDPVGGTQWSKIPPEPSTPANITRLEAVQIHIMSKDALTSRSNL # LGVIAALRALSGETEAGGGALAKGVKGVEIVLGKKQVGGWIRAGMPAGAKVTLKGSAMYDLIATLTEFVLPRLREFHGIPMPAAVSSHTSYLPASSNA # VKASDVAGVVSFGLPAPAMGFWPQIEVNQDAYPKMYGMHIHFITNAVGVGAQERARALVSGFQIPFVRKSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g291 ### # start gene g292 7 AUGUSTUS gene 1475688 1477784 0.28 - . g292 7 AUGUSTUS transcript 1475688 1477784 0.28 - . g292.t1 7 AUGUSTUS stop_codon 1475688 1475690 . - 0 transcript_id "g292.t1"; gene_id "g292"; 7 AUGUSTUS CDS 1475688 1476109 0.98 - 2 transcript_id "g292.t1"; gene_id "g292"; 7 AUGUSTUS CDS 1476161 1476298 0.96 - 2 transcript_id "g292.t1"; gene_id "g292"; 7 AUGUSTUS CDS 1476899 1477784 0.29 - 0 transcript_id "g292.t1"; gene_id "g292"; 7 AUGUSTUS start_codon 1477782 1477784 . - 0 transcript_id "g292.t1"; gene_id "g292"; # protein sequence = [MQPVMQVGHKEGYLTKRGKNFGGWKTRYFVLQGPVLEYFDAVRLNILLTSLQHTDSHFLDIQRGGTHLGSITVTGAQI # GRQQRNNTTTSTDEEKEYRHAFLIVEAKKGPGGNHPRHVLCAESDAERDSWVEILVRYFTGTYSEEPVAYAPSSAAPPPPPQYVNSTAQPNPSVPRTS # ISTDPPRKPSRGFSKDDIGAEKRAIPLSQLPQDATNAKLFSRPSQDDYNYSSPSKSIPASADPRTTERSQSGQPSSLPDSSPLSNPPPFWIPDSGPIP # KWVIILKSRLCVPNNSVNRLSXGDVDLLASDEYWDPHAIAGLLKSFLRDLPSSILTRELHMRFLSVIDFVDPQERIKELSQLIASLPITNYSLLRALT # AHLILIVQNSAVNKMTMRNVGIVFSPTLGIPAGVFSLMLGEFNRVFNVDAGRSPSESNEDLELEPDRRNSLQYSEAAADKLLGLSGRSLSSKRCVSYP # RTCPITYATTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g292 ### # start gene g293 7 AUGUSTUS gene 1477905 1479406 0.22 - . g293 7 AUGUSTUS transcript 1477905 1479406 0.22 - . g293.t1 7 AUGUSTUS stop_codon 1477905 1477907 . - 0 transcript_id "g293.t1"; gene_id "g293"; 7 AUGUSTUS CDS 1477905 1478674 0.99 - 2 transcript_id "g293.t1"; gene_id "g293"; 7 AUGUSTUS CDS 1478716 1479406 0.22 - 0 transcript_id "g293.t1"; gene_id "g293"; 7 AUGUSTUS start_codon 1479404 1479406 . - 0 transcript_id "g293.t1"; gene_id "g293"; # protein sequence = [MTARLAPLTVPPRSDLLPELSATQETPPHSFNNATPKYSHFAHGYNDSIISSISYSSSSNSHSTSTKPSVYPRKSSFT # ESISSVSTNGVDGVSGSAYSGIATGGKYDFSSQNTPQTAPAEYPSNNSIYTPITPHGQGTLSTPQIITSISIPNDAPDRDQHASPISQKASNNLTALS # PAIRHPLSRESRISLPDEAKQYIANMGESPAPSPRVEMFNKTSSSHSSVPVSPVHDDNDDGDEEDDESGEDLDEEYEVVDPSSAAPNSAPAPSPSASA # ESSQDRLPNQSGSSSTSFSGPLSQAPARSSSNRQYVSINDFPLSPSTMSPHHAEARAEAAYQRQLIGDTSPQRSNDDLRPQRLEAQNVPATQMNATAS # SAGFFRALPLLSTDLPHTKIYVSHSFVRPNDRGKEVLSFIVYVNPGKGKDGWKVEKMYSDVINLDQRVRGSVGKSVGRKISTLPEGKLWKDHAPAKAD # QRKVVISIHRPSVIGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g293 ### # start gene g294 7 AUGUSTUS gene 1488545 1489559 0.78 - . g294 7 AUGUSTUS transcript 1488545 1489559 0.78 - . g294.t1 7 AUGUSTUS stop_codon 1488545 1488547 . - 0 transcript_id "g294.t1"; gene_id "g294"; 7 AUGUSTUS CDS 1488545 1489107 1 - 2 transcript_id "g294.t1"; gene_id "g294"; 7 AUGUSTUS CDS 1489163 1489429 0.84 - 2 transcript_id "g294.t1"; gene_id "g294"; 7 AUGUSTUS CDS 1489508 1489559 0.78 - 0 transcript_id "g294.t1"; gene_id "g294"; 7 AUGUSTUS start_codon 1489557 1489559 . - 0 transcript_id "g294.t1"; gene_id "g294"; # protein sequence = [MLEAKLAEASVLKKLLDAIKELVTDANFECSEEGITLQAMDNSHVALVAVKLVQNGFKKYRCDRPMPLGVNVGSLTKV # LKCAKDDDVCTLRAADEADVLNLVYEAKNSDRISSYDLKLMDIDAETLGIPKTSYEARIVLSSAEFTRIVRDLSLLGDSVRIEVSKEGVRFASDGEAA # NGNVLLKGQGPIGKVERGPQGDDSDEDEDGEGVKKEKKNGGEEEDEEANGEEDEEGEKKKKTKVKKEKTDDGDVEMDEDDDDGEEEKEDEEDEEEEDG # DGKKRKKKARFRLSYTLKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g294 ### # start gene g295 7 AUGUSTUS gene 1491261 1491971 0.99 - . g295 7 AUGUSTUS transcript 1491261 1491971 0.99 - . g295.t1 7 AUGUSTUS stop_codon 1491261 1491263 . - 0 transcript_id "g295.t1"; gene_id "g295"; 7 AUGUSTUS CDS 1491261 1491971 0.99 - 0 transcript_id "g295.t1"; gene_id "g295"; 7 AUGUSTUS start_codon 1491969 1491971 . - 0 transcript_id "g295.t1"; gene_id "g295"; # protein sequence = [MTLGPSAEITPPEFSSASQSEEPIAHSMTIDLDDVLDASFMAASEPTAVSNTDEEYPAGSSVAVSNSDADPSTGQYIK # SLNRWDVISVGALRKTGVLTDSTVGRGSDSGPDYTAYSNVMKSSPLSTMLWHNRNGASKHQRSLGYILSPELGPVRDGDRTPTHGSQKHNGSPPFNTK # SRKELRRERKLKRKGYGPVNNHKHTHLHHQHSHHPNSKTRSTSSFQRSNSFNSPVPSLSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g295 ### # start gene g296 7 AUGUSTUS gene 1492127 1494093 0.52 - . g296 7 AUGUSTUS transcript 1492127 1494093 0.52 - . g296.t1 7 AUGUSTUS stop_codon 1492127 1492129 . - 0 transcript_id "g296.t1"; gene_id "g296"; 7 AUGUSTUS CDS 1492127 1493169 1 - 2 transcript_id "g296.t1"; gene_id "g296"; 7 AUGUSTUS CDS 1493253 1494093 0.52 - 0 transcript_id "g296.t1"; gene_id "g296"; 7 AUGUSTUS start_codon 1494091 1494093 . - 0 transcript_id "g296.t1"; gene_id "g296"; # protein sequence = [MSPPHPHTVTVVAEDDDDNDICPVCDGQCTCSNNTPSFYQQAPPTTRIPSPAHDPPRPILKIKLPPNLLKRKLPPTSK # TASGSSSLPSYSAHDSSIQAQRIPKRRGRPPKNLVSHSGPGVAGPSTSAYQRPKAKSVASQNRSLQKKTSKSAARDSDLRKRAIKKRKRVDSSHESSS # SELTDLDLYTSNNNYHRSVEDHDDARSVQFPTFVSALSSDSSASSSDSDSLSGFETDSSIEAEEENFILTEERARVRRELLNGSGEESLQKRRDPNWV # IRPRQMRGRYDDEPDGEDTEDMNTRRHGYVGLVSAWSEEEESSFDADLFFANLSDKESGSSGSCTQSDDGEDGDYSDPELDLSQTASSLIPHLRQGVG # IGIPNLAFELTEGWDGQVVFTNGHIESSSRDGLQSLLEASFLPPGPDTSPSPGPDGDVDMFSTDADGEADEEGYEQDVDQDTAEAEYEGDTTDEELVG # EDDLPNELAMSLFNTPFAFSNAPSIDPMSMISPSSSYRRQSDFGVESPHPSDILSQSMTWGTNDLEERFEGDEPDEEEENAFICEQRNKDRAARGGLP # RTGFFEAVEEARQIVIDGERKEIPSSYPRFTGRNGKGVKSKSLSISRGGRSGGVSVLIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g296 ### # start gene g297 7 AUGUSTUS gene 1497740 1501416 0.33 - . g297 7 AUGUSTUS transcript 1497740 1501416 0.33 - . g297.t1 7 AUGUSTUS stop_codon 1497740 1497742 . - 0 transcript_id "g297.t1"; gene_id "g297"; 7 AUGUSTUS CDS 1497740 1500666 0.72 - 2 transcript_id "g297.t1"; gene_id "g297"; 7 AUGUSTUS CDS 1500807 1501416 0.48 - 0 transcript_id "g297.t1"; gene_id "g297"; 7 AUGUSTUS start_codon 1501414 1501416 . - 0 transcript_id "g297.t1"; gene_id "g297"; # protein sequence = [MAFFNDWKSDSSSHSNPPRVDQFDYDDNVGSGPGSASPLPHLLNSPPPSMISRPRSRSRFTSQTTVNSGHVDDSDNDS # SSDSGDAKENRQLKTLGRLYPRFMLPAFGVNTRARLSSQPREQGNQRQASLRTSSDDEEDSDNLRPGLARVRVRRGNIKPIKGDTESEDDGTEMAPAT # FKSSFFPSSPRSPSPFNSRGQRNILRRHDSSSDETDVDDEEIAEFLQRSANPGRSAVKPSRKTVRNELLIDYMLARNVYIGGSSSSRRKPGKSKQLTK # GSGSRSGIRYNTSRTKSSSISAKTQTSLLKSFDSNKSSAGTGGYRLDVVRPGHGGGRQSLLSFNNHRQAREASRSRAADVDGYSQSDRRDDEDDDDDD # ESQEDESLRMESDEERSRKKGNKNLTWKQKLKQRKEAERMHGVYIHVADAGTRLLANAGQFGASESGGSYAGGTRRKRRTTRGKGKRPRKAKGKGLWK # DLSLNAEDEELHRALAPSSSQHRTTHPDLASKQHLPHRRLVKKDDAETGVLAENEQDEGSNSIKVDTDFGLLTSGQTFGFNTYIKRGLLYELLQLIHP # TPPSQADSAPASAPASLIQNSKHPSYRAPHLSLVISLSNPLSDFLRDLPILCQSLGDFIMGLPDVDEEVVAREWRSVMRGAEEVLTGFMKSEGNEAKK # KLQDIVGKTIGLLITQMHTSDFIKSTIDLMTFDVCWFVIEMLLRAGFGLSSSKLLSDACKILVQYLLEVDPGLRDVMTLIRDQNSEKREFNDSTSIVQ # REAELWVCLIHVLRPGAPDGPSYEHPLWDIIRKELGRRSSAAAKWTLQSNEVIWQTIAGVCALSQFSEHGLCKDKPSISEGWKIVFFALKSVQLKADS # AIDQQLNSAPLRMKDRYFALIVRRCFFLVNRWKWAIESSFPVLNIFSGAFGTRKFRNLLHEKADFPEFLRTQRWESCFEYSRRDSAFVLFVKLVVQRG # IALKQSERPSPHSLEKNLTLITPLSSVEMFSKVHPPQRNELSMLYNRMAAIAVRIHLSPSDYCSRVQQARQYFNFRTSDDTSRMACIRSLMYVTQMMI # LEKLPLEQTEVNAWYTEIVEVLIKEYKELSGKEEKSLNRVRFLLNAVLGSLRHILNAYNDAEMEAQYPDLSLFGKWVLYASNIDSRFDKMWYKKSGEK # RSLQTIPRLQENSQRLFVPSFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g297 ### # start gene g298 7 AUGUSTUS gene 1501563 1503222 0.51 - . g298 7 AUGUSTUS transcript 1501563 1503222 0.51 - . g298.t1 7 AUGUSTUS stop_codon 1501563 1501565 . - 0 transcript_id "g298.t1"; gene_id "g298"; 7 AUGUSTUS CDS 1501563 1502771 1 - 0 transcript_id "g298.t1"; gene_id "g298"; 7 AUGUSTUS CDS 1503130 1503222 0.51 - 0 transcript_id "g298.t1"; gene_id "g298"; 7 AUGUSTUS start_codon 1503220 1503222 . - 0 transcript_id "g298.t1"; gene_id "g298"; # protein sequence = [MGGFPDGLLELGNSIESECEGLRQMESKRGEISHVYENASKGSAQSPRPSQSNDSPGPVRVRDSAPDPLFSDFESQSP # VTDFTEPLSVLFEPMADSGLETPLSFPPSEDEKENDDRRENEDIVAGVAGDDLEMSQDPLNLLDHDRELNLSPLPPSSAPRILPSPQHSTVEDAGDLL # HFHDGPEISRVPAHSPSPPPFDRAPSPLSPPTFPPSTHSPLFSPPPRPQSTDGDAELARVLHDDDAVGTNKRNLRKRGEHQRRPYTFDKILYMQQMKN # VPEAVVTARYLEKEKRTDREQRRRDGYLSEEESQEQEYQPPSDPEEESQMPQPRIRQKGDSVTTGVGNELLPSMSESSDEDMRGLRKEARQIEKQKRR # KEKEAKRAEKEREREEKRIAAEKDKGSRTKSFPVRDKEREARKERTKPAGVGLVYNLSVIH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g298 ### # start gene g299 7 AUGUSTUS gene 1504824 1505442 0.48 - . g299 7 AUGUSTUS transcript 1504824 1505442 0.48 - . g299.t1 7 AUGUSTUS stop_codon 1504824 1504826 . - 0 transcript_id "g299.t1"; gene_id "g299"; 7 AUGUSTUS CDS 1504824 1505156 0.67 - 0 transcript_id "g299.t1"; gene_id "g299"; 7 AUGUSTUS CDS 1505344 1505442 0.49 - 0 transcript_id "g299.t1"; gene_id "g299"; 7 AUGUSTUS start_codon 1505440 1505442 . - 0 transcript_id "g299.t1"; gene_id "g299"; # protein sequence = [MKRVCVDVLVNGPRYYGALFLVIESGGIYCIAVGIYPTVIIVLVCLKLTQHDEMTRKEATLASMQFRGHPLATTTIQN # ETMNPSRTYPLRPMKFNGLGSHIEDSPAGGSSDDIDDSEGNLGLSRKESDIKFKQHDVVIDFDEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g299 ### # start gene g300 7 AUGUSTUS gene 1512960 1513349 0.88 + . g300 7 AUGUSTUS transcript 1512960 1513349 0.88 + . g300.t1 7 AUGUSTUS start_codon 1512960 1512962 . + 0 transcript_id "g300.t1"; gene_id "g300"; 7 AUGUSTUS CDS 1512960 1513349 0.88 + 0 transcript_id "g300.t1"; gene_id "g300"; 7 AUGUSTUS stop_codon 1513347 1513349 . + 0 transcript_id "g300.t1"; gene_id "g300"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPHRGQPPVVAPARGRSTTRIDSPILQAIARHTGKQPQRRAASESPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g300 ### # start gene g301 7 AUGUSTUS gene 1517772 1518287 0.82 + . g301 7 AUGUSTUS transcript 1517772 1518287 0.82 + . g301.t1 7 AUGUSTUS start_codon 1517772 1517774 . + 0 transcript_id "g301.t1"; gene_id "g301"; 7 AUGUSTUS CDS 1517772 1518287 0.82 + 0 transcript_id "g301.t1"; gene_id "g301"; 7 AUGUSTUS stop_codon 1518285 1518287 . + 0 transcript_id "g301.t1"; gene_id "g301"; # protein sequence = [MQTSIRLARPNEYPAAIRVLTRAFTQDPAFNWYGGVKQAVPHYESNSADAVKTMRNLRYFQEAVLKMTVISGGYVVVV # VVPNGTKGIQQPGLEEKEMIIGVTLWLKPGQSVDLGILDIIRSGGLKALWGWGFMGLKVTSTPNGIFILSSLIDSTFFIREFFSISHQLLNDH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g301 ### # start gene g302 7 AUGUSTUS gene 1519244 1520494 0.78 - . g302 7 AUGUSTUS transcript 1519244 1520494 0.78 - . g302.t1 7 AUGUSTUS stop_codon 1519244 1519246 . - 0 transcript_id "g302.t1"; gene_id "g302"; 7 AUGUSTUS CDS 1519244 1520494 0.78 - 0 transcript_id "g302.t1"; gene_id "g302"; 7 AUGUSTUS start_codon 1520492 1520494 . - 0 transcript_id "g302.t1"; gene_id "g302"; # protein sequence = [MDASSTEMLLGYLHRETILRRLTFFVPVKRPYATNLYVYSCHDQGKRIKPPRFLRTGLTARKNPNSPGSEPLIEQVEC # YGVASVFTPPFNRGKGYARLMMSLLHWILAGNNMSPNIRFPSDIWGSQPVPPPGMGNAIFSALSSDVGLFYESCNPDTADRTKKNGWIIRGTRTARWN # PKVDVPTTPAITSTAGNWRWLTHEEINQLCTQDAERMRADLRARWFDVSSVSSSKTKILFTFLPSGGVEAFQRERLQYFWEKENIVHCGVALSVPRSD # LTNDSTNDLGTVQAFVAWTLELRPPAPRTLLVTRLHAPSPDYISEIVRRIWEYSIQHDIQVVEIWNFPSELREVGYRSAERWFVPFGGEEGEFEFERA # LHLPAFKWYGYGPQRMTDTADAVANDSTSEKVDESEIEWMFNEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g302 ### # start gene g303 7 AUGUSTUS gene 1522881 1523858 0.33 - . g303 7 AUGUSTUS transcript 1522881 1523858 0.33 - . g303.t1 7 AUGUSTUS stop_codon 1522881 1522883 . - 0 transcript_id "g303.t1"; gene_id "g303"; 7 AUGUSTUS CDS 1522881 1523710 0.51 - 2 transcript_id "g303.t1"; gene_id "g303"; 7 AUGUSTUS CDS 1523771 1523858 0.44 - 0 transcript_id "g303.t1"; gene_id "g303"; 7 AUGUSTUS start_codon 1523856 1523858 . - 0 transcript_id "g303.t1"; gene_id "g303"; # protein sequence = [MAMPPQYHAPTQTERESLELAGGTVIIGRATLKEYFSGIVRGWTEPPTVDGRPNWGDDSREEKVRSMLDDSVFDEQDL # YTQNVSSSLNTPAPLPVSSNAALPDIPPLPPLLLVPFVNHIGFTQIPYMVLDFFYRRKHVRDGGEAALRAVSGATRELQGPNSNLKSGLTLLAPPPPQ # GGDLDFALRTESFYRSSLRSPLPSLLDTSPSSTSSESSSSSSTTIPVSESASVNDINPKSPLGVIQQAREKYYNELPRKLWVAREFARRGGFDEIERP # NIGENEKEGIISEELTKEWKKAKEAYNSVGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g303 ### # start gene g304 7 AUGUSTUS gene 1531066 1531512 0.62 + . g304 7 AUGUSTUS transcript 1531066 1531512 0.62 + . g304.t1 7 AUGUSTUS start_codon 1531066 1531068 . + 0 transcript_id "g304.t1"; gene_id "g304"; 7 AUGUSTUS CDS 1531066 1531512 0.62 + 0 transcript_id "g304.t1"; gene_id "g304"; 7 AUGUSTUS stop_codon 1531510 1531512 . + 0 transcript_id "g304.t1"; gene_id "g304"; # protein sequence = [MTRLVPRKPSSAPSTPSYAGSSPKSDPASPSPIQSTIPEQSPYHSPDQTTAWQYPLPSHEYTEHSQYPHYSPEADTSM # RYNEPQLQHGISPMNGMTDPYFGGYSSSQYYRPDFDNAFQNGLRNAGDFNLPVETGDSWHNLVASQYKPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g304 ### # start gene g305 7 AUGUSTUS gene 1536985 1537605 0.41 - . g305 7 AUGUSTUS transcript 1536985 1537605 0.41 - . g305.t1 7 AUGUSTUS stop_codon 1536985 1536987 . - 0 transcript_id "g305.t1"; gene_id "g305"; 7 AUGUSTUS CDS 1536985 1537605 0.41 - 0 transcript_id "g305.t1"; gene_id "g305"; 7 AUGUSTUS start_codon 1537603 1537605 . - 0 transcript_id "g305.t1"; gene_id "g305"; # protein sequence = [MSEPSQLSSAVPTTTIETQSNQKSKPKSKAKPKKKKGRKRSSSNAQWADKIMYAELLEMSDSDVAASTMYLDNNGFDG # LPPNLHTSWVALSPVPIGKRCLAITRDGPGRNPVPRNKNARNSRNQENNTSLRSRLHGKHISLFPDTSASIDPNSDKSDSWFFPSPLPPSTILDCILD # VNWTQNGVLHVLDVLRWKGQEVGECEAGMR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g305 ### # start gene g306 7 AUGUSTUS gene 1541123 1542196 0.73 - . g306 7 AUGUSTUS transcript 1541123 1542196 0.73 - . g306.t1 7 AUGUSTUS stop_codon 1541123 1541125 . - 0 transcript_id "g306.t1"; gene_id "g306"; 7 AUGUSTUS CDS 1541123 1542196 0.73 - 0 transcript_id "g306.t1"; gene_id "g306"; 7 AUGUSTUS start_codon 1542194 1542196 . - 0 transcript_id "g306.t1"; gene_id "g306"; # protein sequence = [MRLQTENRRQSVQITPLDLSRANLNSLSLSPPSKRTSFTPLTGSFNGRPANAHRRISSVSDSGLQALTNLNFGLALSP # EHNTQVLTFPGENSNPTPSPMSNRRMSGFFAGHSSGISPSMDVFSSHNSAEIQALRKEISTLKSDLEETRHELTEAVEAREASETCVSALRTFIEENN # VGSGPRLNGSDNASIKLPHPPASSADNEADASSIKSGWGFKLWNTKATPTLNNLHSPASASVDSPTLPSAAMQTPTQITKKIGGFFSRQASISSVTAV # APSASVTAPSLQARESMYSYESKSSSRSDTSSIAEPLSPADDEDDSMNIMVREGSSRSMPQDPLDLVAVDLRESGKKGLEVNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g306 ### # start gene g307 7 AUGUSTUS gene 1542255 1542749 1 - . g307 7 AUGUSTUS transcript 1542255 1542749 1 - . g307.t1 7 AUGUSTUS stop_codon 1542255 1542257 . - 0 transcript_id "g307.t1"; gene_id "g307"; 7 AUGUSTUS CDS 1542255 1542749 1 - 0 transcript_id "g307.t1"; gene_id "g307"; 7 AUGUSTUS start_codon 1542747 1542749 . - 0 transcript_id "g307.t1"; gene_id "g307"; # protein sequence = [MDTLTSPQPSLQFEVPPSADSSTSFAPIRPVSASHKRPFSIDLSLELERQLDMESLPPTPAHNATVHANSAPVIAHLR # DSLDPDVLAHIISQLRRSLSDLSKEKDDLVSLLSSAHSREAELEDALQHMTDKATHMEEELMEVRQKNKDDEEAISMLRTKVEESR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g307 ### # start gene g308 7 AUGUSTUS gene 1545763 1546814 0.32 + . g308 7 AUGUSTUS transcript 1545763 1546814 0.32 + . g308.t1 7 AUGUSTUS start_codon 1545763 1545765 . + 0 transcript_id "g308.t1"; gene_id "g308"; 7 AUGUSTUS CDS 1545763 1546049 0.68 + 0 transcript_id "g308.t1"; gene_id "g308"; 7 AUGUSTUS CDS 1546195 1546329 0.33 + 1 transcript_id "g308.t1"; gene_id "g308"; 7 AUGUSTUS CDS 1546514 1546814 0.61 + 1 transcript_id "g308.t1"; gene_id "g308"; 7 AUGUSTUS stop_codon 1546812 1546814 . + 0 transcript_id "g308.t1"; gene_id "g308"; # protein sequence = [MRKQSISTVNCRRFVLASTQELHEKIHELSNRVRELEDGLRSDHIQLTNEPHPLLSEELLKIKAPLQREPPAARSLNG # AIKDEESNPDVVDAFGSFDILMLGLNNASLLKQNETSEDDTPDPSQTILQLQAYLPPQILARAYNPVSEDMFNYEVWSQFYEPNAGLSADYPLVSHRL # SVMFMILAIGSLVDTSLSPYNVDAEKYHQLAKAALFQDSFLDAPTINAVQALVGHFFALIYPSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g308 ### # start gene g309 7 AUGUSTUS gene 1548140 1548829 1 + . g309 7 AUGUSTUS transcript 1548140 1548829 1 + . g309.t1 7 AUGUSTUS start_codon 1548140 1548142 . + 0 transcript_id "g309.t1"; gene_id "g309"; 7 AUGUSTUS CDS 1548140 1548829 1 + 0 transcript_id "g309.t1"; gene_id "g309"; 7 AUGUSTUS stop_codon 1548827 1548829 . + 0 transcript_id "g309.t1"; gene_id "g309"; # protein sequence = [MLDLQTRAHECLNEFRRGTGRLGSALDPPNDNDELAILGGKTRLVKKEPGSPQLFERSPNSHNPIVPLPLSPSAGAQV # DSNLVEYLSSFQPQQRSLSASSTYSDPEISPVTMYGLTSLPTNGYHSESSNYQPMTSSSHSMMPTPDSSFHHHRQHSSQGSVANDSAGLPSFPPYFPV # YDYGSSNSNSYAPMLDSPIPAHAQRRSSSGSPEQNLMHTVWQDFVTSNGYVPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g309 ### # start gene g310 7 AUGUSTUS gene 1549227 1550402 0.63 - . g310 7 AUGUSTUS transcript 1549227 1550402 0.63 - . g310.t1 7 AUGUSTUS stop_codon 1549227 1549229 . - 0 transcript_id "g310.t1"; gene_id "g310"; 7 AUGUSTUS CDS 1549227 1550402 0.63 - 0 transcript_id "g310.t1"; gene_id "g310"; 7 AUGUSTUS start_codon 1550400 1550402 . - 0 transcript_id "g310.t1"; gene_id "g310"; # protein sequence = [MQPALPSLEDFYNTIKLSPALHSLKIRHYIRIPSDVQHLPVISLPVLRLLDLNMDIQIISSILRFLVFPPTTQTSFIA # RPTQHDDYIQGVKSLMIHVRRHLRHKDAPVLRSANIVCGNYLAFSFSQNDTCPNPLFVSDSEKPLHHILLYPASQRQNRQMIVKIINALPLQKLVVLN # AIQVTCDNIEPDTESSQQQFSQETWRTLVRLLPVGITIRIGVNNAMLALLSGAIDAMKRAPDTFPSGRRLKRLHRQQGVGSLPLSNLVLLASHNIPFR # LHGTVDTPDQERLYNGLLDHLVKYRDLNTQLKPKGQPLEALSFEDLRLPFARQFAERLYEVTGKLSYDDIVWDPVKIRQEVRHSRKKMRRLRRTYPEL # GFSESDPDLSSLSSDSEIE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g310 ### # start gene g311 7 AUGUSTUS gene 1552359 1553072 0.44 - . g311 7 AUGUSTUS transcript 1552359 1553072 0.44 - . g311.t1 7 AUGUSTUS stop_codon 1552359 1552361 . - 0 transcript_id "g311.t1"; gene_id "g311"; 7 AUGUSTUS CDS 1552359 1553072 0.44 - 0 transcript_id "g311.t1"; gene_id "g311"; 7 AUGUSTUS start_codon 1553070 1553072 . - 0 transcript_id "g311.t1"; gene_id "g311"; # protein sequence = [MIVKIINALPLEKLAVFDATQVTCNNIEPDIEPYKQQFSWETWRTLVRLLPVGITIRIGVNNAMLALLGGAIDAMKRA # PDTFPSGRRLKRLHRQQGVGSLPLSNLVLLASHNIPFRLHGTVDTPDQERLYNGLLDHLVKYRDLNTQLKPKGQPLEALSFEDLRLPFARQFAERLCE # VTGKLSYDDILWDPVEMRQQVRRLRKQLRRLRRIHPELDFPEDNLNLSPLSSDSESELESN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g311 ### # start gene g312 7 AUGUSTUS gene 1555127 1557607 0.5 + . g312 7 AUGUSTUS transcript 1555127 1557607 0.5 + . g312.t1 7 AUGUSTUS start_codon 1555127 1555129 . + 0 transcript_id "g312.t1"; gene_id "g312"; 7 AUGUSTUS CDS 1555127 1557607 0.5 + 0 transcript_id "g312.t1"; gene_id "g312"; 7 AUGUSTUS stop_codon 1557605 1557607 . + 0 transcript_id "g312.t1"; gene_id "g312"; # protein sequence = [MLGEKFILDYVLKDTGRNEVVIAEDDAEALWRTYKDASSRLSHLISTRTLQPFGSQYSGQKSDVHTVIFIIGNHCISD # ISLAGIQIIYPKITVPLPSSSILEVVPSRAARVFILEQFRNWPTKWTPFHLEVVRALQQRNPTPIIRGGILGHYKTNITDSDVETLLNSTEDRVQFGS # FVDSNPPASPLIPKYELSYLKVLENLFDVRFQHSNSPNLTTLHGHLATNPEFALGRVRGQLEERARLVKITEDAMTNSSTNNELHSLLSEWLIHKDDV # FQSRTFGEEIIQRLEHEIRSPILHQMIALKHHFTLPSHWIVVSSSWSYDIGSSGLHHVLSSGLRVNILIIHTTSYMLRQSNNHRQHDIGLYAMNYGSA # YVASVAIYSSYAHTIQVLVEADLFDGPSVVLAYLPNQSDQTSAVDVLKETKLAVDSGYWPLYRWNPSKDIEGEEPFSLDSDSIKNDLAQFLDRQNHLS # QLVRSKPALNTEITGNLGYSLKEARRLKAQKTYSKLLHTVEAPSIRILYASDGGTAEKMAKRLVIRGKIRGLDVSIAALDLISLDALKDEDEHVNVFI # TSTAGQGEPPQNGRKFFKSLNTAASIVENKATLFSKLRYLVFGLGDSHYWPRDEDARYYNRPGKELDHKLALLGAQRVLDLHLGDAQDADGPETQYKV # WEAQIWKVFGVDTVEVSEKEPDPITLEHVKVASNFLRGTIAEGISDVCTGGLAPSDPPLTKYHGIWQQDDRDVREEHQAQGLDLAYNFMVRTRMPGGS # CTPVQWLKLDRLSDEYGNGTMKITTRQTLQFHGILKRFLKKSIQDINRALLDTLEVGGDVNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g312 ### # start gene g313 7 AUGUSTUS gene 1563360 1563761 0.25 + . g313 7 AUGUSTUS transcript 1563360 1563761 0.25 + . g313.t1 7 AUGUSTUS start_codon 1563360 1563362 . + 0 transcript_id "g313.t1"; gene_id "g313"; 7 AUGUSTUS CDS 1563360 1563761 0.25 + 0 transcript_id "g313.t1"; gene_id "g313"; 7 AUGUSTUS stop_codon 1563759 1563761 . + 0 transcript_id "g313.t1"; gene_id "g313"; # protein sequence = [MGVVSSSAHRRVVASLEKANQAVYFPPDRVFSAATSLPKPTSKPDPAIYLFACEKLGAPPATCVAVEDSKSGATSAVR # AGIPVIAYVGSYETPEKRNEMAKSLKDIGAAAVMYDWAEFENCLEQAGCNVSDAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g313 ### # start gene g314 7 AUGUSTUS gene 1564385 1566589 0.47 - . g314 7 AUGUSTUS transcript 1564385 1566589 0.47 - . g314.t1 7 AUGUSTUS stop_codon 1564385 1564387 . - 0 transcript_id "g314.t1"; gene_id "g314"; 7 AUGUSTUS CDS 1564385 1566589 0.47 - 0 transcript_id "g314.t1"; gene_id "g314"; 7 AUGUSTUS start_codon 1566587 1566589 . - 0 transcript_id "g314.t1"; gene_id "g314"; # protein sequence = [MHKHRDDVAGVPFLFLTPTRRPISRPSSRASTPSARLPSGRSETPNSAPSSPLAQIFRRPLLTSPLASGVQATSYMSA # RSDYSASPSSSPILPYAHATHFHAQFTASLPASPLSSPRLLNAKASEFKPIPRPLSAASSNPGPVRSESPDLWAHSPFRATSNLAIAAPLLPDQPGLS # RSTTPVRSPLRQDTGDEDEDDPFDPFGPNGDHPPSFQVSDFDINQWEPDYNVHPPLNPYAFEFTPPFLPPEGSEDTLGMSGMLNDMTIEPDTDPDAAA # ALLTNGMTPFDVLTSVFGSTLAPSELEEALAANAYDFDRAMAWLVDRALPLQQQQQQPNGLTPQQRMQPVGGRVTVVPRGPGDRGGYPPSGPQNRPNL # NGRYVNGRPNAGGNRVCRYFVAGECLRADCRFSHDLERALCRFWLRGTCAKGESCEFLHHLPKDVDVQSLGAILARVNINSNNHHNQNHNSAHNPPLD # DFPVLGQTNGNDNKNKRSVYAPGADSGRTRFAAAVKKPPLASTSLGLTSMVPGSHSNGDNAARREALGTSAAADLHHRSAIIAPRSSPRLRLRPPSLL # PTLMTGESLNNLYMTYRSRALQLGQARNACLSRAADAWRRGDGAAAKRFSREGHDLNGKMSAEMRRAAGELVRERALEAERAVRARDLGWSDDNADRT # SRGKLAGAGLGVILGVAGSGVGDGKLTAEERTEVALDLHGLHANEATDVLEEFLLAVSRLNANYLFGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g314 ### # start gene g315 7 AUGUSTUS gene 1567574 1567894 0.53 - . g315 7 AUGUSTUS transcript 1567574 1567894 0.53 - . g315.t1 7 AUGUSTUS stop_codon 1567574 1567576 . - 0 transcript_id "g315.t1"; gene_id "g315"; 7 AUGUSTUS CDS 1567574 1567894 0.53 - 0 transcript_id "g315.t1"; gene_id "g315"; 7 AUGUSTUS start_codon 1567892 1567894 . - 0 transcript_id "g315.t1"; gene_id "g315"; # protein sequence = [MKKNKRWEESISLSKQDKLYKDAMITAATSATHEVAEELLGYFVDIGNKECFAAMLYVCFDLLSQDVVEELSWQHGLN # DFYMPYKIQNSRTLVEKASFTLSVDVQD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g315 ### # start gene g316 7 AUGUSTUS gene 1569041 1569664 0.67 - . g316 7 AUGUSTUS transcript 1569041 1569664 0.67 - . g316.t1 7 AUGUSTUS stop_codon 1569041 1569043 . - 0 transcript_id "g316.t1"; gene_id "g316"; 7 AUGUSTUS CDS 1569041 1569664 0.67 - 0 transcript_id "g316.t1"; gene_id "g316"; 7 AUGUSTUS start_codon 1569662 1569664 . - 0 transcript_id "g316.t1"; gene_id "g316"; # protein sequence = [MEIAKIATEHGLFEEALTIYKKYDQHAMAMTVLVEHIVSLDRGVEYANKVNQPEVWSRLAKAQLDGLRIKESIDSYIK # AEDPSNFIEVIEIADRAGKHDDLVRYLQMARKSLREPKIDTELAFAYARTDRLHDMEDFLSMTNVADILEVGERCFEVELYQAAKLLFQSISNWARLA # TTLIYLGENQAAVESARKAGNTQYVASVSVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g316 ### # start gene g317 7 AUGUSTUS gene 1571147 1572856 0.03 - . g317 7 AUGUSTUS transcript 1571147 1572856 0.03 - . g317.t1 7 AUGUSTUS stop_codon 1571147 1571149 . - 0 transcript_id "g317.t1"; gene_id "g317"; 7 AUGUSTUS CDS 1571147 1571883 0.71 - 2 transcript_id "g317.t1"; gene_id "g317"; 7 AUGUSTUS CDS 1571969 1572467 0.65 - 0 transcript_id "g317.t1"; gene_id "g317"; 7 AUGUSTUS CDS 1572566 1572856 0.06 - 0 transcript_id "g317.t1"; gene_id "g317"; 7 AUGUSTUS start_codon 1572854 1572856 . - 0 transcript_id "g317.t1"; gene_id "g317"; # protein sequence = [MVTESSVYHWSITDQTSPPQKIFDRHATLAGTQIINYRVSSDEKWLVLIGISGNSTNPSAFKVKGSMQLYSRDRGVSQ # PIEGHAAAFAEVKLDGNQHLHVVQIDHAAPDPPFVKKAVDVYFPAEATNDFPVSMQVSKKHGIVYLVTKYGFIHLYDLESGACVYMNRISGETIFVTA # EHEATNGIIGVNKKGQVLSVNVDDQTIVPYVLTTLNNTELAFKLASRANLPGADDLYIKQYQSLFQSGQYGEAAKIAANSPRVGIILSPTPPGGLSPI # LQYFGILLEKGELNHLESLELARPVLQQGRKQLLEKWLKENKLTCSEELGDVVRLHDMTLALSVYLRANVPNKVIACFAETGQIEKIVLYAKKVGYSP # DYVALLQHVMRVNPEKGAEFASQLVNDEMGPLVDVERVVDIFMSQNMIQPATSFLLDALKDNKPEQGPLQTRLLEMNLMHAPQVADAILGNEMFTHYD # RPRIANLCEKAGLMQRVSIMSLTTILHFYHHMTGPRAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g317 ### # start gene g318 7 AUGUSTUS gene 1574426 1575152 0.37 - . g318 7 AUGUSTUS transcript 1574426 1575152 0.37 - . g318.t1 7 AUGUSTUS stop_codon 1574426 1574428 . - 0 transcript_id "g318.t1"; gene_id "g318"; 7 AUGUSTUS CDS 1574426 1574580 0.47 - 2 transcript_id "g318.t1"; gene_id "g318"; 7 AUGUSTUS CDS 1574648 1575152 0.7 - 0 transcript_id "g318.t1"; gene_id "g318"; 7 AUGUSTUS start_codon 1575150 1575152 . - 0 transcript_id "g318.t1"; gene_id "g318"; # protein sequence = [MENDSKSTSHSQPIPAIRFENNDRRSQPNQSEVPRITFGDDENESSGIQITGQGTSTPRNIIGNDSDDSDDDNSNASP # FGPLIRVSAENEGQQSTPNPPQIMFEVPGMGVDSQFGGPVIHVSDESDQDTPRRRGKDVTTAPHQGGPRALPAVRSGASQSGRGGLTCPACALYAMNY # WNFSQGGWSSPHKSLRIDHFLSYEGIGEDGIKRPYCHLDYHEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g318 ### # start gene g319 7 AUGUSTUS gene 1575202 1576448 0.85 - . g319 7 AUGUSTUS transcript 1575202 1576448 0.85 - . g319.t1 7 AUGUSTUS stop_codon 1575202 1575204 . - 0 transcript_id "g319.t1"; gene_id "g319"; 7 AUGUSTUS CDS 1575202 1575367 0.93 - 1 transcript_id "g319.t1"; gene_id "g319"; 7 AUGUSTUS CDS 1575415 1576448 0.87 - 0 transcript_id "g319.t1"; gene_id "g319"; 7 AUGUSTUS start_codon 1576446 1576448 . - 0 transcript_id "g319.t1"; gene_id "g319"; # protein sequence = [MTNSHSYNSPHPSHTHAPQTSTSQSRVATSSLQTAPQSNSTFSSIPSAAVRQQNPIFETKFFSTRSGFNATSGSETKF # VPLWKRDKPVNNIGGSSRETERGRSTTVPPTSPGRPLPQPTPNRFPAPYTVEEPDDDAANTSLESETTSSEVSGVSAASGISGNSQRSGGSNGPGILD # LRGSIPQPPSMDRAVVTTGAIPTHSMGFRSGARNIPQPPGMDRAGATTGAIHEGSTGSMTLRFAKMELDLMGSGSPWPQDLPPLPRGPGSGFSNSQSF # SRPTSAHPPSSSPRHSHTQSQPQTHSSFANVKISNHSGPRGKAERTIPDYDLDEPPPRPASVSFRWVSRFFPAGSTASSTSGALERFKRNTQQPAQPQ # PQHASYPRLNDRPESIGHSIAYAGVKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g319 ### # start gene g320 7 AUGUSTUS gene 1576485 1577318 0.97 - . g320 7 AUGUSTUS transcript 1576485 1577318 0.97 - . g320.t1 7 AUGUSTUS stop_codon 1576485 1576487 . - 0 transcript_id "g320.t1"; gene_id "g320"; 7 AUGUSTUS CDS 1576485 1577318 0.97 - 0 transcript_id "g320.t1"; gene_id "g320"; 7 AUGUSTUS start_codon 1577316 1577318 . - 0 transcript_id "g320.t1"; gene_id "g320"; # protein sequence = [MHQQHPNYWQSQAHPNARYPSDHYPNQYPAQNVPKPSPVFRSQAELGFELPPVRPAQGQPQQRPMPRGAPPPPSQLQG # RPRPQSMGYPQASANYAHVPSMHTNRVGGMPPQHARSSSASPTRKPLPSPSPASPIESTRPLTITQSSGFAPLSPNHPHSRDLSAFSRFNQERMASGA # ISPGTVRNVGPVKPFPNSYAPQQSQYQYKDPVTTMSSVSSFSAPPSQQMPSLQASNPVTINTPTRRRVSPPRFFGNSSVSSSRNHSPEKANIVRFRYH # LIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g320 ### # start gene g321 7 AUGUSTUS gene 1579384 1580254 0.58 + . g321 7 AUGUSTUS transcript 1579384 1580254 0.58 + . g321.t1 7 AUGUSTUS start_codon 1579384 1579386 . + 0 transcript_id "g321.t1"; gene_id "g321"; 7 AUGUSTUS CDS 1579384 1579929 0.62 + 0 transcript_id "g321.t1"; gene_id "g321"; 7 AUGUSTUS CDS 1579985 1580254 0.92 + 0 transcript_id "g321.t1"; gene_id "g321"; 7 AUGUSTUS stop_codon 1580252 1580254 . + 0 transcript_id "g321.t1"; gene_id "g321"; # protein sequence = [MINTVPNGVTLTQPISEPFDYVVSEPLFSYRNGTLSMATTLRVRVSLSKSGKYSQQIMEQVMTENPSRTVTMLWVDRQ # GSSCPPIGCTSPSISTQQVVFSLIGNLQGLTGTRYSFNATINASTSISKFWFEINENDGSDPIVVDNGGSGFVIEQDSMFIDNSRSENVLLSSSFNEY # RKVVVAVRGDTSSSVSITTFDPNSDASAPPYLLTVITTNLQLDDSNPSEGGFTFFTVNISETVNFVSISGNIGGVSYVQENFDMTVVNFAFVTIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g321 ### # start gene g322 7 AUGUSTUS gene 1583908 1584584 0.4 - . g322 7 AUGUSTUS transcript 1583908 1584584 0.4 - . g322.t1 7 AUGUSTUS stop_codon 1583908 1583910 . - 0 transcript_id "g322.t1"; gene_id "g322"; 7 AUGUSTUS CDS 1583908 1584186 1 - 0 transcript_id "g322.t1"; gene_id "g322"; 7 AUGUSTUS CDS 1584300 1584584 0.4 - 0 transcript_id "g322.t1"; gene_id "g322"; 7 AUGUSTUS start_codon 1584582 1584584 . - 0 transcript_id "g322.t1"; gene_id "g322"; # protein sequence = [MLWADRQGSFCPSTGCTTPAIDNIQVFFTFIGNMQGLTADRYVFNATINPATSISKFWFEINENDGSDPIIVDNGGSG # FVIEQDSVFVDDRRSENIRGDASSSVSITTFDPNSDATTPPYLPTITTTNLQLDDSNPAEGGFTFFTANISGSVNFLNISGNVGGVSYTQENYDMTVV # GFPVVTVVQSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g322 ### # start gene g323 7 AUGUSTUS gene 1587995 1592140 0.05 + . g323 7 AUGUSTUS transcript 1587995 1592140 0.05 + . g323.t1 7 AUGUSTUS start_codon 1587995 1587997 . + 0 transcript_id "g323.t1"; gene_id "g323"; 7 AUGUSTUS CDS 1587995 1590382 0.45 + 0 transcript_id "g323.t1"; gene_id "g323"; 7 AUGUSTUS CDS 1591086 1591516 0.46 + 0 transcript_id "g323.t1"; gene_id "g323"; 7 AUGUSTUS CDS 1591675 1592140 0.17 + 1 transcript_id "g323.t1"; gene_id "g323"; 7 AUGUSTUS stop_codon 1592138 1592140 . + 0 transcript_id "g323.t1"; gene_id "g323"; # protein sequence = [MSSLSTVARIAYLASETLVDSQPPLPLYSEFASSFNSVSLSSRRRPNVIAVPHGGDPAAALLRATGSALTSFTALSNS # QTIARLVLRLPELASSPLVLHIALFNDLSDVLLLRSVVPYFLVSTNAQQAHDNALLATKLARSQKKAVVHAFFSTKDDSDTTTELSEENLLTLLFDEK # GLVNGSNGHTNGVNGHSNGTNGHSNGVNGHAHGTNGYDSPEVVEDDRVALQLFKDYEVAALSVLKAVRRPILPLTSTGSSEPTTIIFTLGKATFDASV # EGVSFVNVSLLSPLLPSRILGVILPTVTSVIVLEQVQNWSLKWTPFYLEVVSALQQRNPVVRPAVHSGVLGDSTPVTEGDILKLLSKASNSTSHSRLQ # LGSSSAEKVASQGPHIPKHELSYTKILTHLFRERLEISNSPDLIPVQGDLATSPEFALGRVRGQIDERAKLLVAVRDLLQSGNVDGELHSLLSKWVLA # KDDGIKSRSLGQEITEKLELVNTSVEVQRVLALKSHFPSVSRWIIGSDAWSYDLGSSGLHHAVASGLNINILILDTLPYSQRNSADPTRRKQDVGLYA # MNHGDVYVASVAIYSSYAQVLQALIEADKFDGPSVIVAYLPYESEDAPALNILKETKLAVDAGYWPLYRWDPSKELNGGEPFTLDSDAVKNDLQAFLD # RQNHLSQLVRSKPQLATELVGSLGETVKEIRKKKAFQSYNDLLTNLDAPPLTILYASDGGNAEKVAKRLSNRAQARGLSTTLATMDTMSLDSLQQEEF # VAFISSTAGQGEPPQNGRQLLKAINAAAVHEQTKFSDQVLPRNVVCSSIPTMSKLHAQVHQFAVTVSQHLVPRTTAYHEIWLDKKMVAGEALKDFEPL # YGEFYLPRKFKVAIAVPPTNDVDVFANDLGFIAIVDDNGELAGFNVTIGGGMGVTHGNKKTYPRTGDLIGFCTPEQGNVSKNARVKYTIDRMGLDVFK # AEVEKRLGYQLQPARPFTFDRNVDDYGWSTGEDGRHHFTMFIENGRIQDETGKEFKSGLREIAKIHKGAFRLTTNQHLLISDIPTENLPQIKAILSKY # KMDNLSHSGLRLSSSACVAFPTCGECRAWKLLDSRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g323 ### # start gene g324 7 AUGUSTUS gene 1596168 1596734 0.89 + . g324 7 AUGUSTUS transcript 1596168 1596734 0.89 + . g324.t1 7 AUGUSTUS start_codon 1596168 1596170 . + 0 transcript_id "g324.t1"; gene_id "g324"; 7 AUGUSTUS CDS 1596168 1596734 0.89 + 0 transcript_id "g324.t1"; gene_id "g324"; 7 AUGUSTUS stop_codon 1596732 1596734 . + 0 transcript_id "g324.t1"; gene_id "g324"; # protein sequence = [MSGKVLNFSQYVNRFEFLVYRKSTLRKLHDNIADPKYDGVKVSRTQLLEEDDHSFKSSGEEEEEEEEQNDESGEEIWQ # EETIHRPSDEGATASEDSKEDEAEMIVTEDRSAAVDITLALRKTQDEDRKKGLAVSRQIARINYLPAMSCSDGSSGYLGLLIGCTDSDSKIYIFFKYI # TLGNSHHSLLAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g324 ### # start gene g325 7 AUGUSTUS gene 1599310 1599711 0.46 + . g325 7 AUGUSTUS transcript 1599310 1599711 0.46 + . g325.t1 7 AUGUSTUS start_codon 1599310 1599312 . + 0 transcript_id "g325.t1"; gene_id "g325"; 7 AUGUSTUS CDS 1599310 1599711 0.46 + 0 transcript_id "g325.t1"; gene_id "g325"; 7 AUGUSTUS stop_codon 1599709 1599711 . + 0 transcript_id "g325.t1"; gene_id "g325"; # protein sequence = [MTQDALEAKREQLEELEKSEHEARRLEAALGGRSAVSLPSSPDQEPTEEESNIQTHSASYVPPHPGPNPARRNARAPG # MGFLNALSYTLHGMMDVDPETARRNGISKTKETISQVIFRFLFETNKISIHSIDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g325 ### # start gene g326 7 AUGUSTUS gene 1601287 1601709 1 + . g326 7 AUGUSTUS transcript 1601287 1601709 1 + . g326.t1 7 AUGUSTUS start_codon 1601287 1601289 . + 0 transcript_id "g326.t1"; gene_id "g326"; 7 AUGUSTUS CDS 1601287 1601709 1 + 0 transcript_id "g326.t1"; gene_id "g326"; 7 AUGUSTUS stop_codon 1601707 1601709 . + 0 transcript_id "g326.t1"; gene_id "g326"; # protein sequence = [MGLSVLSRFARDLSVPSANEGFHCMVSLKPVDTKVEYLDSDIVTILDRVRSSEAVMQSRPKPMRISWAERRRQSRGGP # TRDIKTQSSYLSRAWQQGTVFPTQNTSSSIQPATEVDGDIGVQAGHTHGEVSPLLKDLLGVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g326 ### # start gene g327 7 AUGUSTUS gene 1606792 1607148 0.51 + . g327 7 AUGUSTUS transcript 1606792 1607148 0.51 + . g327.t1 7 AUGUSTUS start_codon 1606792 1606794 . + 0 transcript_id "g327.t1"; gene_id "g327"; 7 AUGUSTUS CDS 1606792 1607148 0.51 + 0 transcript_id "g327.t1"; gene_id "g327"; 7 AUGUSTUS stop_codon 1607146 1607148 . + 0 transcript_id "g327.t1"; gene_id "g327"; # protein sequence = [MLSSQLTLDIFALICISSPQQPQQAYYGGGGGPPQGYPQQGGYQPQPPPQTVYVYVRESAVNSISPAEPSLFTDNNHN # RAQAVVVDVVRVWQECVYAAALKVRDLLLVGDQPLISTHF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g327 ### # start gene g328 7 AUGUSTUS gene 1608128 1608770 0.45 + . g328 7 AUGUSTUS transcript 1608128 1608770 0.45 + . g328.t1 7 AUGUSTUS start_codon 1608128 1608130 . + 0 transcript_id "g328.t1"; gene_id "g328"; 7 AUGUSTUS CDS 1608128 1608394 0.47 + 0 transcript_id "g328.t1"; gene_id "g328"; 7 AUGUSTUS CDS 1608468 1608770 0.91 + 0 transcript_id "g328.t1"; gene_id "g328"; 7 AUGUSTUS stop_codon 1608768 1608770 . + 0 transcript_id "g328.t1"; gene_id "g328"; # protein sequence = [MFKYGLYEVFKDTYMNAAGPDISEKYKGAIWLAGSASAEVFADIALCPLEMTKVKIQTSPTGTFPIPFATALSEMNKL # KVETRFPFGSLIPYTMAKFFFFEKIAQLFYTHVFTNPKETYSKTTQLGITFASGYIAGVVCAIVSHPADSLVSLLGKAENKGKSVGTIAGEVGFATLA # TKGLSTRVVMIGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g328 ### # start gene g329 7 AUGUSTUS gene 1615047 1616046 0.77 - . g329 7 AUGUSTUS transcript 1615047 1616046 0.77 - . g329.t1 7 AUGUSTUS stop_codon 1615047 1615049 . - 0 transcript_id "g329.t1"; gene_id "g329"; 7 AUGUSTUS CDS 1615047 1615925 0.98 - 0 transcript_id "g329.t1"; gene_id "g329"; 7 AUGUSTUS CDS 1616014 1616046 0.78 - 0 transcript_id "g329.t1"; gene_id "g329"; 7 AUGUSTUS start_codon 1616044 1616046 . - 0 transcript_id "g329.t1"; gene_id "g329"; # protein sequence = [MKEAQSPKLTNTQSELSRCLQELTRVKVSHFTEEALRAQDEAYLASLPKPKPIPAIPVPLAPEKPKSKQVKLSKEEEI # LREKWQRLVEMVSKGRLEPLIAFWEREGNNLGGINVRLPEWIGEKRVATLLQLATFSGQEDVTNWMLEMCADPTIPVPRSEDEADSVEGEESASKRRR # TAYDLAQSRSIRDVFRRNAGAHPDWWDWFGAAHIPSALSKEMEDGREEKKKVRRKGLKDRLKEREAKEKEKPTAEESTPFISIPSIGPHKLGGSAGDT # AGTAGLTLEMKAKIERERRARAAEARLKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g329 ### # start gene g330 7 AUGUSTUS gene 1616306 1616824 0.63 - . g330 7 AUGUSTUS transcript 1616306 1616824 0.63 - . g330.t1 7 AUGUSTUS stop_codon 1616306 1616308 . - 0 transcript_id "g330.t1"; gene_id "g330"; 7 AUGUSTUS CDS 1616306 1616824 0.63 - 0 transcript_id "g330.t1"; gene_id "g330"; 7 AUGUSTUS start_codon 1616822 1616824 . - 0 transcript_id "g330.t1"; gene_id "g330"; # protein sequence = [MEELNVSLALEDSLSGSESSDEEIDSDSGHDAVSTLVDKQKPRKRSISPELSTRRGPRTAISWFHSSPSTQIGVYRVL # FPYDIPEDDHLQALKDLQEAKSGGRSWAMFMVAGGHFAGAIVRVSNAGKESEVQSKKTKKPVSDMEVLRHKTFHRYTSQSIEARSFISCSLTII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g330 ### # start gene g331 7 AUGUSTUS gene 1619982 1621844 0.08 - . g331 7 AUGUSTUS transcript 1619982 1621844 0.08 - . g331.t1 7 AUGUSTUS stop_codon 1619982 1619984 . - 0 transcript_id "g331.t1"; gene_id "g331"; 7 AUGUSTUS CDS 1619982 1620300 0.96 - 1 transcript_id "g331.t1"; gene_id "g331"; 7 AUGUSTUS CDS 1620377 1620515 0.85 - 2 transcript_id "g331.t1"; gene_id "g331"; 7 AUGUSTUS CDS 1620566 1620772 0.68 - 2 transcript_id "g331.t1"; gene_id "g331"; 7 AUGUSTUS CDS 1621241 1621844 0.13 - 0 transcript_id "g331.t1"; gene_id "g331"; 7 AUGUSTUS start_codon 1621842 1621844 . - 0 transcript_id "g331.t1"; gene_id "g331"; # protein sequence = [MIDTQVVGMNWIEVPAGQYELVPPDRQKSHCQIEIKLRWNAFISHAPEGDWSKIAPLRILSFDIECAGKPGRFPTADQ # DPVIQIANMVTRQGETQPFIRNVFTLNSCSHIVGSQVLSFDDEQQMLEKWRDFVEEVDPDLIIGYNIAGFDFPYLIDRAKELGSQRFPYLGRLKGETL # FMFSSEDFSLINRQMSRLELRTLISRSEDQYEGATVIEPHKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLDKPTIERLELVKDRDYIQTPNNDFFV # TTSKRKGLLPTILEDLIAARKRAKADLKKEIDPFKRAVLDGRHANSVYGFTGATIGKLPCLAISSSVTAYGRQMIERTKQVRLKFERQHRFMPLQEVE # AEYSTANGHSHDAQVIYGDTDSVMVRFGPTDLKTVMALGESLAHYGSASA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g331 ### # start gene g332 7 AUGUSTUS gene 1623517 1624254 0.72 - . g332 7 AUGUSTUS transcript 1623517 1624254 0.72 - . g332.t1 7 AUGUSTUS stop_codon 1623517 1623519 . - 0 transcript_id "g332.t1"; gene_id "g332"; 7 AUGUSTUS CDS 1623517 1624254 0.72 - 0 transcript_id "g332.t1"; gene_id "g332"; 7 AUGUSTUS start_codon 1624252 1624254 . - 0 transcript_id "g332.t1"; gene_id "g332"; # protein sequence = [MAQLYATTSLSGVVVDIEYDKTDITPIYEGFIQRSACDTIPLGIRDCQEYLVHILRHSNPSLMKTLFPPDSEITPSEE # IIEETLLAFVKQILQEGHIRVPSDGETAIPDDEGVTDIAAIVVAGKEKAVIESGMKKKANAKASAAEQARAREIEALDLITVQFRDKSVTLGKERHRL # CEPLFDPTLLNGLGKRRSSVSLQNATGHAVRQTELDMRQYIWQGLFVTGDLTRHVKGKDLISSFLRLQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g332 ### # start gene g333 7 AUGUSTUS gene 1626057 1627123 0.35 + . g333 7 AUGUSTUS transcript 1626057 1627123 0.35 + . g333.t1 7 AUGUSTUS start_codon 1626057 1626059 . + 0 transcript_id "g333.t1"; gene_id "g333"; 7 AUGUSTUS CDS 1626057 1626473 0.91 + 0 transcript_id "g333.t1"; gene_id "g333"; 7 AUGUSTUS CDS 1626581 1627123 0.35 + 0 transcript_id "g333.t1"; gene_id "g333"; 7 AUGUSTUS stop_codon 1627121 1627123 . + 0 transcript_id "g333.t1"; gene_id "g333"; # protein sequence = [MARSADKSQPLYDDSDPDTEPETFKPQRNGTRKRLSEAYNPDNDASFASDSGVRAQKSSVDINDDAAEKRRRRKSTKI # AVPENAHAGPSSEGNDEVDKSRTIKQKQQLTTVAPLAPPEKESIDILSSKFEEWMKLTTDNMSLLRNTDDNTINFQRASCTLDGCVKIWTSRVDSVGT # ETAKLASNLASGGTMDEDEEAGSDDPDREQTKQKKKRASRRENNLSDASQLRNKKPDLEFSVDPLFRKTCADFDEGGAQGLLMNHLSLGVGQDGSLRV # VFDASDSISKEDEDDLHEPEDLIDLTQLRGSKPFTKTFKLLFDHF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g333 ### # start gene g334 7 AUGUSTUS gene 1627217 1628538 0.34 + . g334 7 AUGUSTUS transcript 1627217 1628538 0.34 + . g334.t1 7 AUGUSTUS start_codon 1627217 1627219 . + 0 transcript_id "g334.t1"; gene_id "g334"; 7 AUGUSTUS CDS 1627217 1627619 0.35 + 0 transcript_id "g334.t1"; gene_id "g334"; 7 AUGUSTUS CDS 1628192 1628538 0.97 + 2 transcript_id "g334.t1"; gene_id "g334"; 7 AUGUSTUS stop_codon 1628536 1628538 . + 0 transcript_id "g334.t1"; gene_id "g334"; # protein sequence = [MNDDTTFFQDDTIADGFDDDDDDGFEAMMVDGAPPVEDFFVGDDAVGDDYGAGMMDGEDLGDANSNGSVGPMDNGQGG # TGQFVPFDPRHAPNQRDLMLAMNTEDGGGMMDYFDNTFLQNWAGPEHWKMRKPIRRPAAGDAIPFNTQFFHDDYDDGPGFDDAYDGDGGDGGAIDPGE # QDLLAATQGQTRRVKPEAVRFTKRAKRVDVRKLKENIWKGLDIAVPPPKNADDERMVSTKPYKFSTVFHLHGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g334 ### # start gene g335 7 AUGUSTUS gene 1631217 1632321 0.85 - . g335 7 AUGUSTUS transcript 1631217 1632321 0.85 - . g335.t1 7 AUGUSTUS stop_codon 1631217 1631219 . - 0 transcript_id "g335.t1"; gene_id "g335"; 7 AUGUSTUS CDS 1631217 1631975 1 - 0 transcript_id "g335.t1"; gene_id "g335"; 7 AUGUSTUS CDS 1632026 1632179 0.93 - 1 transcript_id "g335.t1"; gene_id "g335"; 7 AUGUSTUS CDS 1632305 1632321 0.85 - 0 transcript_id "g335.t1"; gene_id "g335"; 7 AUGUSTUS start_codon 1632319 1632321 . - 0 transcript_id "g335.t1"; gene_id "g335"; # protein sequence = [MAVNKTADSQNEEEFSVSSSFDTAPYGTASEYPSHQYPQSDPQQHTFSSDMPRYNYSQLANYNDQHKGITQTNYPQYQ # ERVLPDNYLEDVPRVNYSHHQGELSPTNYPQHQEEASQIIYTRQQEPYSTISHIHTPATCSDPALTVPSSYTTDSDFSSSNHGLAPHAYPTRYSSYPP # TSYPPSANYTSYSISSHPTSWTSSPSPLSNAHVLPSSYPSSSYASSSSYASSSYASSSYLPTDHHQYHSYVARPSSAQLSTPGSSEVMLSPYSTGSIP # LSSPGGSPPVDQAPYHSSGGEEESLLLSRVPVSLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g335 ### # start gene g336 7 AUGUSTUS gene 1632825 1633487 0.71 + . g336 7 AUGUSTUS transcript 1632825 1633487 0.71 + . g336.t1 7 AUGUSTUS start_codon 1632825 1632827 . + 0 transcript_id "g336.t1"; gene_id "g336"; 7 AUGUSTUS CDS 1632825 1633487 0.71 + 0 transcript_id "g336.t1"; gene_id "g336"; 7 AUGUSTUS stop_codon 1633485 1633487 . + 0 transcript_id "g336.t1"; gene_id "g336"; # protein sequence = [MKAVSKNSHTVVAHFSRRAQLRISIRKFPNLNSSTCSHNLDPFSAVVVLNSAQLIQGPSSPLVIFTLFVMSSLAGALI # PPEMSSLSSQAPSDHLYDNVDVDMKPALEHIDPTANEEDEEMTDLFGGDGEVENATRGEYVRTLLTEVPLNFCSRHTSLGDTTDGSEGLGSAEAEQRR # ALEYEEDEVPPEIAIEEREANVAFPNLPVPSNSDQDVKRISSLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g336 ### # start gene g337 7 AUGUSTUS gene 1633807 1634631 0.75 + . g337 7 AUGUSTUS transcript 1633807 1634631 0.75 + . g337.t1 7 AUGUSTUS start_codon 1633807 1633809 . + 0 transcript_id "g337.t1"; gene_id "g337"; 7 AUGUSTUS CDS 1633807 1634631 0.75 + 0 transcript_id "g337.t1"; gene_id "g337"; 7 AUGUSTUS stop_codon 1634629 1634631 . + 0 transcript_id "g337.t1"; gene_id "g337"; # protein sequence = [MSLRLGKELFDITKDIDTSGAIPRKSFGGSQSQSQLQPPPSTPGKSHGLTYLVAQHKRSQVLQSEAVITGYMSLRPTG # MQSETHRMLVRAVGQKHNKVARLRLVEDPAIDPEKEKAELMKTVKKTTKRRSNAVDSLGGRTSRKSYGRRHETSDMEQSDEDEEGGGMSTRRRKSRDE # DDSGGHYQRDGFVVEDESEEDGDFDAGRKRRRDEEEDPLDQLEAKIQRQQNKRRHESDDSDAVEGHVEVESEEEEEQKVRRAGATRRRQALYDDDEDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g337 ### # start gene g338 7 AUGUSTUS gene 1640241 1640831 0.39 + . g338 7 AUGUSTUS transcript 1640241 1640831 0.39 + . g338.t1 7 AUGUSTUS start_codon 1640241 1640243 . + 0 transcript_id "g338.t1"; gene_id "g338"; 7 AUGUSTUS CDS 1640241 1640831 0.39 + 0 transcript_id "g338.t1"; gene_id "g338"; 7 AUGUSTUS stop_codon 1640829 1640831 . + 0 transcript_id "g338.t1"; gene_id "g338"; # protein sequence = [MHGFHVRIVLNTRVQSPFDISIPNTIFDKLPVHRPNPTNRKNATFNPYQKDYRFGPIRIDWMDSNMPASTSSTGKEKD # RGKDGTSDEQSYTTSSTDMYRLLGHAVAHFVANETVSGSTNLPEGVIHVYRENETPTGQTSTSRPVTDSVILGILAVPSWMAPSDLLTFVAPAAETIS # HLRILRFVIFIYQSTSNLHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g338 ### # start gene g339 7 AUGUSTUS gene 1641307 1642248 0.9 + . g339 7 AUGUSTUS transcript 1641307 1642248 0.9 + . g339.t1 7 AUGUSTUS start_codon 1641307 1641309 . + 0 transcript_id "g339.t1"; gene_id "g339"; 7 AUGUSTUS CDS 1641307 1642248 0.9 + 0 transcript_id "g339.t1"; gene_id "g339"; 7 AUGUSTUS stop_codon 1642246 1642248 . + 0 transcript_id "g339.t1"; gene_id "g339"; # protein sequence = [MSSHPSSTSTSTRPTKIPFANPSTANMSACAACSSTTNLWICLICGNVGCGRYGRAHAQAHYQSTTHLYALELETQRV # WDYAGDGYVHRLIRNKADGKVVELPSAATAMSSSPREGGLGPSAADALSAEKIEAIGIEYSYLLTSQLDSQRAYYEDQTAELQIQVGELRGLVERLTN # QSEKEQIVSTEAERERQRLDEERIIELLKAKAKAENRAEKMAELARRLEKDLREERAVTEGLMSNLGKMKEKAEAVDKDREEFRSKISELEDQLRDVM # FFLEAKTQIETGGGVVSEAAGGSIEMPPSGSNKKKKNKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g339 ### # start gene g340 7 AUGUSTUS gene 1642309 1643499 0.8 - . g340 7 AUGUSTUS transcript 1642309 1643499 0.8 - . g340.t1 7 AUGUSTUS stop_codon 1642309 1642311 . - 0 transcript_id "g340.t1"; gene_id "g340"; 7 AUGUSTUS CDS 1642309 1643499 0.8 - 0 transcript_id "g340.t1"; gene_id "g340"; 7 AUGUSTUS start_codon 1643497 1643499 . - 0 transcript_id "g340.t1"; gene_id "g340"; # protein sequence = [MSNARHVSINRASFDPNLDVFDFYSSPSWPIESLVLNAEWMISNSENISSVTNIMTDMLRAASPTLQSLSWKGMRLPL # YLSFGRETLNFPRLRALYLEAVPMADFSILSSFLSSSNRITSLEVSSSDRNTADFLAHRGHLEALESFSWINQHTTVDEDIIFFLEANCQLRSLSIAQ # SLPPITIDTRILPVVKLSFLRLTSLRLVWDAIAVPENSLSVIGSLHQLRRLWLSAGNQLGWCTNWKIEHDVMLHSLRPLAQLESLTFSRDSYAVNGHP # LLDSSIEKYYVNAVFPRNINFQNYLTTDERALLEKAIGLANYIDMSFEQARSLQSRLMKAAWERWHQQRMLKLAELYANAFAHLSWCYMGQYSMKLER # TDSGIYAIAETPFRENIRPPYPLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g340 ### # start gene g341 7 AUGUSTUS gene 1645091 1646422 0.28 + . g341 7 AUGUSTUS transcript 1645091 1646422 0.28 + . g341.t1 7 AUGUSTUS start_codon 1645091 1645093 . + 0 transcript_id "g341.t1"; gene_id "g341"; 7 AUGUSTUS CDS 1645091 1645219 0.71 + 0 transcript_id "g341.t1"; gene_id "g341"; 7 AUGUSTUS CDS 1645291 1645711 0.43 + 0 transcript_id "g341.t1"; gene_id "g341"; 7 AUGUSTUS CDS 1645767 1646422 0.85 + 2 transcript_id "g341.t1"; gene_id "g341"; 7 AUGUSTUS stop_codon 1646420 1646422 . + 0 transcript_id "g341.t1"; gene_id "g341"; # protein sequence = [MLHLVILSCTIAERLRVLEEENKNFNSTLQSFLDDYNNLRQSFDDSSPSLHRQPSFKWAQFKPTKSPTKPEHVESPHP # SPQQLDHDIPPYTRSTPPSQIASTSASTPAPSDKPKPQQNITDSPNLTQGAPPKPARQDSTDNLKSFKVSLEDPTWKVLPAALKKYRIHNDNWENYAM # FICYGSPGNRIERCLSYDEKPLLLFQKLKDAKKNPVFMLKHIKDIRSPIVVAQQKHAARKASSVINSGNEQPSGAGSSTANAASTTAPGHTKASSRTI # TRPPRLEVNDLSAPAPLTSSGVGGLSPQPRWPEPGIASPMVETQRRAGEGGGDDSFLGIPPTSAGTLAPHGSVSNLSAGSSKLRLATTDSPPLSSGRE # MPVASAGVSYAVAIYPYMAEQEDEFDVVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g341 ### # start gene g342 7 AUGUSTUS gene 1650499 1651152 0.44 - . g342 7 AUGUSTUS transcript 1650499 1651152 0.44 - . g342.t1 7 AUGUSTUS stop_codon 1650499 1650501 . - 0 transcript_id "g342.t1"; gene_id "g342"; 7 AUGUSTUS CDS 1650499 1651152 0.44 - 0 transcript_id "g342.t1"; gene_id "g342"; 7 AUGUSTUS start_codon 1651150 1651152 . - 0 transcript_id "g342.t1"; gene_id "g342"; # protein sequence = [MHKPVGSSNELNKAGLHAELDLLTQGNGFAQSFKLRASAAGVKVPGKSLSSSIPMLFATHHSLTDLKYNAENAFIGTI # DSPLAARPLPIDDMAVESNEECSLLFDTFLVVPLLQTKGVFTERKFSGNTQTGDNTDYIGEVVDAFAHHVLEETSRTFMLADIQGDIYMEFSCFLCSL # LDFVGVVGPDRSIVLFDPQAHRYVFSSYLAQCHLSLQQLHW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g342 ### # start gene g343 7 AUGUSTUS gene 1653871 1657587 0.91 - . g343 7 AUGUSTUS transcript 1653871 1657587 0.91 - . g343.t1 7 AUGUSTUS stop_codon 1653871 1653873 . - 0 transcript_id "g343.t1"; gene_id "g343"; 7 AUGUSTUS CDS 1653871 1657587 0.91 - 0 transcript_id "g343.t1"; gene_id "g343"; 7 AUGUSTUS start_codon 1657585 1657587 . - 0 transcript_id "g343.t1"; gene_id "g343"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYCPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g343 ### # start gene g344 7 AUGUSTUS gene 1657638 1658804 0.89 - . g344 7 AUGUSTUS transcript 1657638 1658804 0.89 - . g344.t1 7 AUGUSTUS stop_codon 1657638 1657640 . - 0 transcript_id "g344.t1"; gene_id "g344"; 7 AUGUSTUS CDS 1657638 1658804 0.89 - 0 transcript_id "g344.t1"; gene_id "g344"; 7 AUGUSTUS start_codon 1658802 1658804 . - 0 transcript_id "g344.t1"; gene_id "g344"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g344 ### # start gene g345 7 AUGUSTUS gene 1663784 1665813 0.63 + . g345 7 AUGUSTUS transcript 1663784 1665813 0.63 + . g345.t1 7 AUGUSTUS start_codon 1663784 1663786 . + 0 transcript_id "g345.t1"; gene_id "g345"; 7 AUGUSTUS CDS 1663784 1665273 0.72 + 0 transcript_id "g345.t1"; gene_id "g345"; 7 AUGUSTUS CDS 1665333 1665813 0.88 + 1 transcript_id "g345.t1"; gene_id "g345"; 7 AUGUSTUS stop_codon 1665811 1665813 . + 0 transcript_id "g345.t1"; gene_id "g345"; # protein sequence = [MAVNNTVATKIPPYPSSSARKDLSPTQIANLNRTILACIGDVLSLPSTKRNTPAAHNFVSTYARDAAVQTLEALIWGN # GAVSTKVEYAIRRRVLQLAEKLDKLDVQTLLDLVIVYAKTNLNRLRAVLELNSHSLATSELVSSFVLLLQFDNSPGLYALRKASHCISSLLHVAPSAT # LRAFAHSKAFVLALATIYHTGMNTVAQSYGGLNLTRSDEPDADDWEKLWLETKVSFMDSFHACMVCLLNGLASASGPNLAAEAEATFDIVFALFESNS # SAEQSQIPFLNRSFLADYQQSYDLMRTLSSSLQRAVERDARLELLEASLRELETQSGPAEVGMKNPGALRLLLRSSGVPPGIDNRGIGSGWSKENGKG # RENKNGVSISTSAASVASTSQSISKNDIDVKISQVLDIFPDKNPLYIRDLLSHPSYPFASNSDGAERVIGALLEGTAPSWDEVRNASKAVAAAQKLDS # TPPVTERRNIFDEEEVDISKFRVGKKSEDVQLLFRDRETVEQMKADILRRVEEFSSSEDEDEGKYVDTDDDPLAPTVANKIKIVGDGEDSDSSDSEGS # HNYDSDQPAKLSPETILELAYIENAKLFDRDSATRGSKARKDLKEKTGWEDEQIEGWRIMLDRDVRSLSSLQSIVTDHLRSRGRKNGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g345 ### # start gene g346 7 AUGUSTUS gene 1670380 1674522 0.17 + . g346 7 AUGUSTUS transcript 1670380 1674522 0.17 + . g346.t1 7 AUGUSTUS start_codon 1670380 1670382 . + 0 transcript_id "g346.t1"; gene_id "g346"; 7 AUGUSTUS CDS 1670380 1671159 0.52 + 0 transcript_id "g346.t1"; gene_id "g346"; 7 AUGUSTUS CDS 1671260 1671507 0.31 + 0 transcript_id "g346.t1"; gene_id "g346"; 7 AUGUSTUS CDS 1671564 1674522 0.37 + 1 transcript_id "g346.t1"; gene_id "g346"; 7 AUGUSTUS stop_codon 1674520 1674522 . + 0 transcript_id "g346.t1"; gene_id "g346"; # protein sequence = [MDDPWANAWDESHSKNTTSSVPTKSIFSTSTWRDPAESETDIALPSWSVGPAVTWNEPSDDAPTLWGSSTSNDSPELP # ITSSFSPKGVDWKSSYESMSAHFGGSSVDENSETEEVGDAEESNEGEGMHDQMDINVDEYEAVAAKGEAPGIVDPWTPPQSTFPTSTSLSSVLEITAS # NSPPAPRSPDAFEFGTFESGASDSLAGPSTEGKTWDSGSLSNPESEWGTAWVSKEADPNDVEDVEALDEWERAKREKEKMDRVVEISDDLWPPPVQAK # PNDVNNVPTTDTTQEPLKDTRDDDPLDRDSPNLGSVVQVEDESNSLNDESQPEETLAHWKGGIDAVEGLLDLCQTIIPPLPPLSSLPALPSQTKSSPI # MKRSSEALRLTRSTVISSSGPLGMYLKTKGSIEWEVAVKARPEKTSEQEREEIVPAGWRILPKEKEDEKKVEAPEMKRKGSSILSSFFGRKAEASPTE # SKEKKDKEASPRPSFASSRNSMDSKSGTANAESSSTDKLPTSPASAPVPSTSAVGASTSTTPTPSTYGDGGSPDLFHDAPTTAPAPSAVSRFLNRFSS # SRNRPSHSRQNSNTSLALSTDDLEFLQDIVPSASDVDHEHELVQTGSNELELNGLQKMINSAPLPAPLLPPPRAPGRDPQRSQSQLSSPQSPSDDFIT # GRKAPSDASRQNKNFDFASSSSQILTPSPALPSQIQTAITRSSTPSSFALPLSTRSSSPGLDMLSIAGSSVGGRASQLTSPSTGMNALGGSAISRPSS # SSAMPNIRTTSSSSSTTMKRPTPVAIMSQSSGSSSKTPESADPFSFLPPPPSIRGGGKATSSPTLLIDDELPRASSSVSGVSSIPAALNIPSTSVTSA # HLPQNPDDDDFSDFLSATPTDVVQPPFSASNLFSLSSAQPLFSAGSAEFNGRDSEGPSDAFSARYDNPLNTSVSSIASTNSVNNMLLSSREMDSFGDS # FDAFNDFASSSSPVQRDTLRTPSPPALPDKSPGKLAARRAFGAEPTSAGVSRRASTGKKTMGGSGVGGRIPPGRLNLPAPVSSSAYSRHWGSPAREPS # PSFLSGNAVNSASPLVASSSEPALAVTPASSPSPKNHKKKVSKEAHQRTRSLVEDAMARSGIWPSPAPSAASSTSGYGSGYGAYGFGTAPPLSPLPPI # LSPPPEYSSSSKNKGGGDLLGAHEDDDDDVPLASLAPGSTYGSIPNSNIGSSTFATQQTQAKAGLIPPMSSMSSSPPYSTNGPNLNTNGTLPPIPLPG # PTPSGQQPALLMGFGALGSGPGSGSSSGSLTVASPASGMSSQLMSVFGATLASSTSKTTTGGLSAQDLSFFEGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g346 ### # start gene g347 7 AUGUSTUS gene 1677239 1677535 1 + . g347 7 AUGUSTUS transcript 1677239 1677535 1 + . g347.t1 7 AUGUSTUS start_codon 1677239 1677241 . + 0 transcript_id "g347.t1"; gene_id "g347"; 7 AUGUSTUS CDS 1677239 1677535 1 + 0 transcript_id "g347.t1"; gene_id "g347"; 7 AUGUSTUS stop_codon 1677533 1677535 . + 0 transcript_id "g347.t1"; gene_id "g347"; # protein sequence = [MSATNDTNRTTTNGHRINSPIPPPIPKSSYKIASIPGDGIGPEVIAAAVEILQALTKKLSTFELEFTEFDWGTERFLK # TGRYTPEDYLEVLREFDAIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g347 ### # start gene g348 7 AUGUSTUS gene 1680964 1681932 0.8 - . g348 7 AUGUSTUS transcript 1680964 1681932 0.8 - . g348.t1 7 AUGUSTUS stop_codon 1680964 1680966 . - 0 transcript_id "g348.t1"; gene_id "g348"; 7 AUGUSTUS CDS 1680964 1681932 0.8 - 0 transcript_id "g348.t1"; gene_id "g348"; 7 AUGUSTUS start_codon 1681930 1681932 . - 0 transcript_id "g348.t1"; gene_id "g348"; # protein sequence = [MAAFGFAATICIAVAVDRLLYHRNRRPAASVTLSDTSIDWVLSRCSQLEQQLTEKESHYQELRLVAAASQAKYLQLER # QWLADERRYERQCTELESENARLQENIRSHDTSAKTLVVFQRKTEEERAERVHPLFLSFLDRLLLANKIWQQQKELQRMRGALAEKKAEKEQLMRANA # FATFRDRLIAANMVWRQQREMKKLKEERNMMKEEADRVKQGRVRAVARSAKQMVVDTRKEGMVDELVNDLVADLKREREKHEREVEEVNVMWQEERQK # LLSEIEMLRLGQQARLIEQEISNELEDRLAASLKECQKEVHRLGAVKC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g348 ### # start gene g349 7 AUGUSTUS gene 1682747 1683727 0.76 + . g349 7 AUGUSTUS transcript 1682747 1683727 0.76 + . g349.t1 7 AUGUSTUS start_codon 1682747 1682749 . + 0 transcript_id "g349.t1"; gene_id "g349"; 7 AUGUSTUS CDS 1682747 1683727 0.76 + 0 transcript_id "g349.t1"; gene_id "g349"; 7 AUGUSTUS stop_codon 1683725 1683727 . + 0 transcript_id "g349.t1"; gene_id "g349"; # protein sequence = [MKLLSAALPHIPNLATFVYSPDFPPNFDLIDALASTPSLHTLHIPTSFLVHDALTVFNSFHGVHDLVIEQVGKATLYD # APESKRLLSVQCVANIIQGCSETLESLEIPGEYCPLPNLLQRISLPVIRNFLLTGFPPLDSDSQNYPLWTVVQSMQKLKVLEVHCRLRVIGASPHRYE # LLPPNAAQDQSNLFSSRIESITISNPSFSDQIFKFLPHSLRSLVLDFIPDSWENMLLSGNDTMLAYHKPEMIVLLLKSLPSSRPNLEQLCIKMGWCVT # TNMLAGIYECFPGLRALELQGIRYFNRAEEPESDMVISFVLFVHCRTDKNPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g349 ### # start gene g350 7 AUGUSTUS gene 1685880 1686509 0.76 - . g350 7 AUGUSTUS transcript 1685880 1686509 0.76 - . g350.t1 7 AUGUSTUS stop_codon 1685880 1685882 . - 0 transcript_id "g350.t1"; gene_id "g350"; 7 AUGUSTUS CDS 1685880 1686509 0.76 - 0 transcript_id "g350.t1"; gene_id "g350"; 7 AUGUSTUS start_codon 1686507 1686509 . - 0 transcript_id "g350.t1"; gene_id "g350"; # protein sequence = [MTLRGNVNLVYLPVLQMTPSSRAIALSLQDHTESSSGPITLNEDEALFQQQLQHAIEISKANVQRGEVAQPSASTNTF # LSERAQLEKERRERQKRLRKAQGLPDSDDDLRAVSDEEDLGQPNAKRQRLSSSSVSYIGQTNVRTSTVPSSSELGPIQGSFFWDGEWRPTATLGVEPR # KDGRSTFRLSEVLGDVSATILDKLPQPTYLTEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g350 ### # start gene g351 7 AUGUSTUS gene 1689069 1689332 0.26 + . g351 7 AUGUSTUS transcript 1689069 1689332 0.26 + . g351.t1 7 AUGUSTUS start_codon 1689069 1689071 . + 0 transcript_id "g351.t1"; gene_id "g351"; 7 AUGUSTUS CDS 1689069 1689332 0.26 + 0 transcript_id "g351.t1"; gene_id "g351"; 7 AUGUSTUS stop_codon 1689330 1689332 . + 0 transcript_id "g351.t1"; gene_id "g351"; # protein sequence = [MGTEPNSNSTIHVDNNKTQSLPTVPEASQEWARFTKVSDGVIKYPLFRIDPDEGQILYESKKKKGIKISPYNFSSSLV # SVRSHELIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g351 ### # start gene g352 7 AUGUSTUS gene 1691319 1691999 0.42 + . g352 7 AUGUSTUS transcript 1691319 1691999 0.42 + . g352.t1 7 AUGUSTUS start_codon 1691319 1691321 . + 0 transcript_id "g352.t1"; gene_id "g352"; 7 AUGUSTUS CDS 1691319 1691335 0.66 + 0 transcript_id "g352.t1"; gene_id "g352"; 7 AUGUSTUS CDS 1691438 1691999 0.62 + 1 transcript_id "g352.t1"; gene_id "g352"; 7 AUGUSTUS stop_codon 1691997 1691999 . + 0 transcript_id "g352.t1"; gene_id "g352"; # protein sequence = [MDDLDMLKIDDCFQIISAQQLPLPKDKSGKEIQSIVDPFVEVSVHIPLWTHSPFVADEAEAEGATYSPPSNITTSLTT # SQNPQNSQKNSQPTTARSISFSTGSVKNNGFNPVWQEELCIPFDCVGGMTDLIFVKFAVKQERKKLKDEADEEPIAVYCSSLGSLERGLSSSFSISGI # HTHSICEYRLSIFAVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g352 ### # start gene g353 7 AUGUSTUS gene 1692983 1693791 0.14 + . g353 7 AUGUSTUS transcript 1692983 1693791 0.14 + . g353.t1 7 AUGUSTUS start_codon 1692983 1692985 . + 0 transcript_id "g353.t1"; gene_id "g353"; 7 AUGUSTUS CDS 1692983 1693172 0.23 + 0 transcript_id "g353.t1"; gene_id "g353"; 7 AUGUSTUS CDS 1693229 1693791 0.3 + 2 transcript_id "g353.t1"; gene_id "g353"; 7 AUGUSTUS stop_codon 1693789 1693791 . + 0 transcript_id "g353.t1"; gene_id "g353"; # protein sequence = [MSATPASVGSPPTASSAARSGFTGLSNSSHTLSMFVLQGLNYSDPNVNGYIVVDGFKCVPPITLQEVQSSGSSGKNVA # AIAGGVVGGIVGLAASIAVFFIYHRRVTRLRAGGNPWEEKGVLEENSAPVYGRSGEAPYTDFGPPTHRDASKYSAGSAVALTHQSMYSQSEAGYTTVS # AAAPGVTWAASTDSGSSSQGSGSTPSGSVAGKDSTYFSEKRLQRLTVANEEPPAPPPYAARSDDQGELENDVSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g353 ### # start gene g354 7 AUGUSTUS gene 1693980 1694936 0.96 - . g354 7 AUGUSTUS transcript 1693980 1694936 0.96 - . g354.t1 7 AUGUSTUS stop_codon 1693980 1693982 . - 0 transcript_id "g354.t1"; gene_id "g354"; 7 AUGUSTUS CDS 1693980 1694936 0.96 - 0 transcript_id "g354.t1"; gene_id "g354"; 7 AUGUSTUS start_codon 1694934 1694936 . - 0 transcript_id "g354.t1"; gene_id "g354"; # protein sequence = [MPVKSTREYATDAIAIAGRDDLSFAPARWIWTGELNDGRAPPGARAFRLTVNLPPKHTLASATILVTADDYYSFYVNG # RFVGSGIQYMAAQRFEVDDIQGPRIVFAVYAENKVAPEGWNPAGLISAIRVTSRDPTLSCLQGCSITHDWFTDAGWKAYPGDAPPYGFELPVFDDSNW # AYAAVRERLPGRFSIPAIGEMDESGSPLPGAPRGVPFQKTILRHQSESSRQASHRSDSHYRQNYQSEFSHYPADPYSQPHRSQASMNSDAHEHHSGTF # ASEFRAGSLPGEFVDQPTQVASHFMTVHASLSMEKDLNLAGVCI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g354 ### # start gene g355 7 AUGUSTUS gene 1700207 1703048 0.09 - . g355 7 AUGUSTUS transcript 1700207 1703048 0.09 - . g355.t1 7 AUGUSTUS stop_codon 1700207 1700209 . - 0 transcript_id "g355.t1"; gene_id "g355"; 7 AUGUSTUS CDS 1700207 1701154 0.5 - 0 transcript_id "g355.t1"; gene_id "g355"; 7 AUGUSTUS CDS 1701256 1701548 0.44 - 2 transcript_id "g355.t1"; gene_id "g355"; 7 AUGUSTUS CDS 1701611 1703048 0.33 - 0 transcript_id "g355.t1"; gene_id "g355"; 7 AUGUSTUS start_codon 1703046 1703048 . - 0 transcript_id "g355.t1"; gene_id "g355"; # protein sequence = [MDNLRVLQSPLKPYSIRSRTSSPHISAPHSRSLFPTQITSDSATEDKQDAAEEEEIILVEGNSPRVVEEAKDLVILED # VEVPPVVESTSPIPVIRRNPSKSPTKSRYIPAPPPLLLPPQPPMTPRRSRPTLHKAVLIRSAQRMVMAELHREEELEEQEEEAEVFGTVLGEDDQEDE # TENPQSENNNERVAVEKEDRKEGTSPTWKASLERIWPFRRSTSPTKTLTKDEESVSPLPEDLMDVDSEDTATTDKTGNVDVTCENAEADVKDEDETEA # TENPAPLYPRLDASLLAPPSRRLFNTPQPQRQTSANPRFSLSPSSSALPNRSRMSLGGGEPRRIKVEEQPWKVQDLVVPSPPSSPTRPSHGLDANREH # TPRMNQLSEVERRAIQERRRSALRTPDNFFSGGIPGMSPTKTIGPTPIRTGRLSHAANNMDDQLDTRSLLEKMKETVEGMKAERRASLSSPRSGVLVT # LRLMQRNFRSVLSTPVVAPPADPGSSTSYSDGDDVQMIDVGRDAFGGSPVVTISPLKTRTAPKKDVRENLVDTPSLADDEASPDVFGRKEDQESDNES # EQSSRKRGKDSLQKSSKPLLETIMTTSSTSSLMKTVEIHDTELPVKAPSQDVRRETDGRNEQSEDAQSLKPQATTGRGRSRSRSKPPSAQAAVTSSEE # ISEKDIAATNTPLPLRRSTRKASAEPDTRTSEDEGPAPTKRTRTAVGGRTRGEESDTDSSSKGVAKKPLARTTRARGKTPVSEAETDDTNDEEVAMAK # TKRGRRPKAAIVPEVIKEEEVDELPTTRTTARSKKIVVSSDTSHPSVTPGTRGRSKKIAAPEPAIETDVNKENAQTSASEDQPVVTRTRIGRPRKAPT # LKIKEEVTTEPETALRTGSRTRAMRTRSKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g355 ### # start gene g356 7 AUGUSTUS gene 1705984 1708481 0.49 - . g356 7 AUGUSTUS transcript 1705984 1708481 0.49 - . g356.t1 7 AUGUSTUS stop_codon 1705984 1705986 . - 0 transcript_id "g356.t1"; gene_id "g356"; 7 AUGUSTUS CDS 1705984 1706834 0.88 - 2 transcript_id "g356.t1"; gene_id "g356"; 7 AUGUSTUS CDS 1706885 1707058 0.88 - 2 transcript_id "g356.t1"; gene_id "g356"; 7 AUGUSTUS CDS 1708010 1708411 0.69 - 2 transcript_id "g356.t1"; gene_id "g356"; 7 AUGUSTUS CDS 1708475 1708481 0.93 - 0 transcript_id "g356.t1"; gene_id "g356"; 7 AUGUSTUS start_codon 1708479 1708481 . - 0 transcript_id "g356.t1"; gene_id "g356"; # protein sequence = [MYTTTIFIKSFGVTTHPKLPLKPESPEPDEEVVAEAAADVREKAAAVVLAVVAVADVEPDTGEVPEVEETEGLDFRTK # DQGEDQICVPPQNESKYEVASCCSVVVQSRFTQYSTSAMKAELVQQDPSSLQTSDRSATTARLISSSRTLGEDSPEIADLYFAYGKSLLENAISQTSV # LGKDQPEEEGAEDDKGTPSSSSNGPILSFSGDAEEGAEDSAVDLFAEAAQEVAEADAAAGEEDDNDDEDAEPEDDFNAAWEVLDLARAIYDKQHDADT # SNEDVALKLADCYIALGDVSLETGTCQMHHKRHSSTDKTMPEKFDQGITDYEVGLTLKSKLLPLSSRQIAEAHYKLSIVLDLTPGRLSDSIKHADQAL # RSIESRLGELKLAKEHPSSLAKDVKPDPKGKGKGKASAVAGINSDAVQNMSATQIEGELKELAELKEELALRVSIEYSLLLFFPLFVNDAFSVRLKSL # KWPRMKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g356 ### # start gene g357 7 AUGUSTUS gene 1709020 1709586 0.27 + . g357 7 AUGUSTUS transcript 1709020 1709586 0.27 + . g357.t1 7 AUGUSTUS start_codon 1709020 1709022 . + 0 transcript_id "g357.t1"; gene_id "g357"; 7 AUGUSTUS CDS 1709020 1709586 0.27 + 0 transcript_id "g357.t1"; gene_id "g357"; 7 AUGUSTUS stop_codon 1709584 1709586 . + 0 transcript_id "g357.t1"; gene_id "g357"; # protein sequence = [MLTSTFSQVVFKALIVLHTMIRNGATDNVLSYLSSSEVLRLQNVSAGNWEGAPRDYPKVMSFSLYLSGYAAPQNLQNY # AVYLDSRIRAYRDLKHDAIRVQAESNRDMRNSASVEEDNYARGKKKDISASGPQRSKTIMGRKLRVMTVEKGLLRETKAVHRMIDSLVECKVRLFVNH # VDDLTDGSISST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g357 ### # start gene g358 7 AUGUSTUS gene 1710424 1712025 0.55 + . g358 7 AUGUSTUS transcript 1710424 1712025 0.55 + . g358.t1 7 AUGUSTUS start_codon 1710424 1710426 . + 0 transcript_id "g358.t1"; gene_id "g358"; 7 AUGUSTUS CDS 1710424 1712025 0.55 + 0 transcript_id "g358.t1"; gene_id "g358"; 7 AUGUSTUS stop_codon 1712023 1712025 . + 0 transcript_id "g358.t1"; gene_id "g358"; # protein sequence = [MGMAPQFGQPQMQVQPTGVVAPQQVSFQQVPNPFGMMQQQSQPPSHLRLQPQATGHRPFSSFLPQQATGMPQQQNSFL # QPQATGANPFRQSMLLPQTTGMAMFGVGGMQQQPHLFPQQQLQPASSGTLNGAPNGLSAVNGLPSAQSSSSLGSSSFSSSFMSAGPFSQQSSPSPINV # PARPASTPLTAFGSTQSSSATSPPPAQPVKTHQTGTRNPFGPISTPPPPVPKQPSLMELALGMGGQNGNMSVQQQQSSQQQIVQGAPQLPQQTGFGSF # SFNLSALSPGVSDMSSVASSFSSRKPDSTATSGQASSSSGPFNALNSQNTSTTTTGSTFSDSLFSSSLSSQPTGATNYSSPPSISFSSAAPLRSQTTG # FNGLKPFKPSSSFGASLLESLPSIPGSSPATPAVTGTPSMSPQGRNTSGSANGLPSGTFGSQPTGLGQSSTLGSTGIGSTLGQGLRPQMTGGGANPFR # ASMFSTMPNGANVLSMPTGIGGVGSTGGMPNSTLMGGSMFGSSFQNGNPQQQQQHHQQGTSLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g358 ### # start gene g359 7 AUGUSTUS gene 1712802 1714085 0.5 - . g359 7 AUGUSTUS transcript 1712802 1714085 0.5 - . g359.t1 7 AUGUSTUS stop_codon 1712802 1712804 . - 0 transcript_id "g359.t1"; gene_id "g359"; 7 AUGUSTUS CDS 1712802 1713249 1 - 1 transcript_id "g359.t1"; gene_id "g359"; 7 AUGUSTUS CDS 1713351 1713766 0.73 - 0 transcript_id "g359.t1"; gene_id "g359"; 7 AUGUSTUS CDS 1713816 1713948 0.65 - 1 transcript_id "g359.t1"; gene_id "g359"; 7 AUGUSTUS CDS 1714078 1714085 0.93 - 0 transcript_id "g359.t1"; gene_id "g359"; 7 AUGUSTUS start_codon 1714083 1714085 . - 0 transcript_id "g359.t1"; gene_id "g359"; # protein sequence = [MNISGLPLSTYFSATKVRWMIDNYPEVAQAHANDDMCFGTLESWLVYNLVGGVKQGLHVSEMSNAARTLLFNTTTLNW # DPMLFKFFGLRQSIVGDVVSTSQTYGHIAAGPLAGVPIGGLVGDQQAALIGNKCLSKGEAKCTYGTGAFLLFCTGNEIVKSSHGLLSTVAFQPGPNSK # PVFALEGSSNSAQVNDLAAQEPTSGGVYFVTAFSGLLAPYWDSSATGLLIGECILSLSTNALAVYDEHTPGITQYTNPSHIARATLEATAFQTRAIIE # SMVLDSGKDVANLKVDGGMTNGDLAMSILADLNGTEVIRPEMRECVSLVVTVTGPLSHCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g359 ### # start gene g360 7 AUGUSTUS gene 1721119 1721802 0.92 - . g360 7 AUGUSTUS transcript 1721119 1721802 0.92 - . g360.t1 7 AUGUSTUS stop_codon 1721119 1721121 . - 0 transcript_id "g360.t1"; gene_id "g360"; 7 AUGUSTUS CDS 1721119 1721802 0.92 - 0 transcript_id "g360.t1"; gene_id "g360"; 7 AUGUSTUS start_codon 1721800 1721802 . - 0 transcript_id "g360.t1"; gene_id "g360"; # protein sequence = [MVEFSSGVRGMCLNLEADNVGVSIFGNDRLIKEGDTVKRTGQIVDVPVGPGLLGRVVDALGDPIDGKGPIEAAERRRA # SLKAPGILPRRSVNQPMMTGLKPIDAMVPIGRGQRELIIGDRQTGKTAVAIDTILNQKRWNDGKDEDKKLYCVYVAVGQKRSTVAQLVKTLEENDAMK # YTIIVAATASEAAPLQYLAPFSGCAMGEWFRDNGKHGAFNGESFGSRLKFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g360 ### # start gene g361 7 AUGUSTUS gene 1724204 1726033 0.42 + . g361 7 AUGUSTUS transcript 1724204 1726033 0.42 + . g361.t1 7 AUGUSTUS start_codon 1724204 1724206 . + 0 transcript_id "g361.t1"; gene_id "g361"; 7 AUGUSTUS CDS 1724204 1724359 0.88 + 0 transcript_id "g361.t1"; gene_id "g361"; 7 AUGUSTUS CDS 1724420 1724701 0.8 + 0 transcript_id "g361.t1"; gene_id "g361"; 7 AUGUSTUS CDS 1724763 1725331 0.5 + 0 transcript_id "g361.t1"; gene_id "g361"; 7 AUGUSTUS CDS 1725745 1726033 0.94 + 1 transcript_id "g361.t1"; gene_id "g361"; 7 AUGUSTUS stop_codon 1726031 1726033 . + 0 transcript_id "g361.t1"; gene_id "g361"; # protein sequence = [MLKGNPNVFHYTTFNTADKLFSQHPIWQQAKIESERKLIFEEYVAELKQREVQESRAARSRSVAKVVNLFKQLDVDVL # TRWRQAHNLILESEEWNSDSELRKLPTLDILLAFEDYSRVREREYDEQTRRAQVEKTRKERKAREAFKELLQSLVASGDIKARTKWKDVYPKFKDDDR # YINMLGNPGSNQIELFWDVVDTLDQKLDAKIAIVTNAIAKVDGPTKGDSEGKEDDDAPERSGLSITATTSEEEFLGVVKATLNEDVKSLSKEELHLIF # GTVCASCMRLFFISQSRFQLHDAAVKKQADEKRRAERKQRHLQEDLRYALRKLTEPLDLNLSHDDYDRRASKDYDRDYRSKHHEKDDRRRDRDRGRRP # DYPSRDWDESQYRREEREKSVSSSTYKDRDEPSKSEKREMEELPIDDRAEKVSRLHDRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g361 ### # start gene g362 7 AUGUSTUS gene 1728074 1728557 0.65 + . g362 7 AUGUSTUS transcript 1728074 1728557 0.65 + . g362.t1 7 AUGUSTUS start_codon 1728074 1728076 . + 0 transcript_id "g362.t1"; gene_id "g362"; 7 AUGUSTUS CDS 1728074 1728110 0.65 + 0 transcript_id "g362.t1"; gene_id "g362"; 7 AUGUSTUS CDS 1728226 1728557 0.65 + 2 transcript_id "g362.t1"; gene_id "g362"; 7 AUGUSTUS stop_codon 1728555 1728557 . + 0 transcript_id "g362.t1"; gene_id "g362"; # protein sequence = [MANNFRVRSGRSSTQASEIHPLVASDFGDPHAKNPSSSSGIRSQTLDSSFSTDSLQDGKYSDYVSAPQLQFVEGSSRS # GVGSTIVTAYPDEKKVIKSDVILGVANPETEELPPPAYSEHHEH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g362 ### # start gene g363 7 AUGUSTUS gene 1731201 1731506 0.49 + . g363 7 AUGUSTUS transcript 1731201 1731506 0.49 + . g363.t1 7 AUGUSTUS start_codon 1731201 1731203 . + 0 transcript_id "g363.t1"; gene_id "g363"; 7 AUGUSTUS CDS 1731201 1731506 0.49 + 0 transcript_id "g363.t1"; gene_id "g363"; 7 AUGUSTUS stop_codon 1731504 1731506 . + 0 transcript_id "g363.t1"; gene_id "g363"; # protein sequence = [MNNLRLEADQAIERAEAAEAKNKKLDQLLLEKDQEITSLNHKLSVVDEQLEKAELSLQEAKRENMDNIGSKTTSEGLQ # RKIQLLEEELDAAEKNAKDTVEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g363 ### # start gene g364 7 AUGUSTUS gene 1735838 1736938 0.75 - . g364 7 AUGUSTUS transcript 1735838 1736938 0.75 - . g364.t1 7 AUGUSTUS stop_codon 1735838 1735840 . - 0 transcript_id "g364.t1"; gene_id "g364"; 7 AUGUSTUS CDS 1735838 1736938 0.75 - 0 transcript_id "g364.t1"; gene_id "g364"; 7 AUGUSTUS start_codon 1736936 1736938 . - 0 transcript_id "g364.t1"; gene_id "g364"; # protein sequence = [MRSKSYGNLRASASMPSVSRPSPTTRSSTFSHSSRSNYNPLSRSFSSRTLDIHLDEVDEISEFGEMNVGHGKGSNVPP # TLRSTKKSFINGETRSIRSSSSTLSMKTSISHLTSGERTPKTSSAGNRFARPGSEASTRSSASDVAGSTSRYGVDELAILTPSSTASSLSIPLTPRDD # DDILEDTQASSLTGRSHPNIDKMLPSLPNPKTGSIRRPSAPSSIRKSSLKKPLESSSYSTHSFPSIASDTSINSTPSSSLNSTSPTAMTSPRPLKQLQ # LPRQQSMMNVNGQLPVPVPSLNGGSSRLRMPSTPSLPSHSAPVTPTTPSTPTDHGKPKSRVGTGMTYRNSASRNVSRMRPPSGKSPVVAPKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g364 ### # start gene g365 7 AUGUSTUS gene 1738166 1740100 1 - . g365 7 AUGUSTUS transcript 1738166 1740100 1 - . g365.t1 7 AUGUSTUS stop_codon 1738166 1738168 . - 0 transcript_id "g365.t1"; gene_id "g365"; 7 AUGUSTUS CDS 1738166 1740100 1 - 0 transcript_id "g365.t1"; gene_id "g365"; 7 AUGUSTUS start_codon 1740098 1740100 . - 0 transcript_id "g365.t1"; gene_id "g365"; # protein sequence = [MGHSVPLLLESFPVPPSFLPPSTPRTPSSLSFNHANIGEPINEPSSSISSTSSIPPSSSVSSISSTSSNPPPSLPPRG # PLPPVPGRSRISDHEAAHLLQSRRSSKYSINSSHSGNGGYDRPDSVASFASARSNGASYAYGHGYRDLETREGRRVSKGSGRVKPPEVQVTTEDAEDT # NQAYGGLRIDEEDDSDVQLTSLRLSISPMPPSPTDTDNELEIPSSLSTQFPTPPPLSPFALQQANAMQKRIPSSAASTPIKWSAPPSPLYQPSPVPPP # VKSASPNESLAEISMHDLPSGDDGAESEWDVPTTKPPVVQAFQTRRVSGGGVPPPSSFTTSVPSRSDSRSSLRRMARISMDNLDNVSLKASIISPSVS # ISPSKSIGSTYTQPDPSPSMPSPPATFPTPPTTYPTPPSSSATYNPDVEIDLHRSLHRELRSARSRSRSHRERLISGIASPSSPPADVAWPPMPPVPY # AAEFSNRPRRKASQASTVSVADNQSTADSDDGRASPDVQRLLEKTPRPRRSLSMRTRSSIGTSSIKGSIGRRKSGGVGSDDGYDEFGGSSLLSRGRKE # SRRRLGHNEDVEAKLQKLERELDGRGSESEGENVPRRHSYGDGFGFGTYKDGVESDGDGLDSDASDSSLDLHTPLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g365 ### # start gene g366 7 AUGUSTUS gene 1741481 1742624 0.28 + . g366 7 AUGUSTUS transcript 1741481 1742624 0.28 + . g366.t1 7 AUGUSTUS start_codon 1741481 1741483 . + 0 transcript_id "g366.t1"; gene_id "g366"; 7 AUGUSTUS CDS 1741481 1741995 0.36 + 0 transcript_id "g366.t1"; gene_id "g366"; 7 AUGUSTUS CDS 1742104 1742127 0.66 + 1 transcript_id "g366.t1"; gene_id "g366"; 7 AUGUSTUS CDS 1742276 1742624 1 + 1 transcript_id "g366.t1"; gene_id "g366"; 7 AUGUSTUS stop_codon 1742622 1742624 . + 0 transcript_id "g366.t1"; gene_id "g366"; # protein sequence = [MREFDPSFLTADPSSSSQTQDGPSSSSGEPAYDENAEDLASDPFAAYFNSEEDPNIPPKVLITTSPKASKPTYEFCDE # IVGIFPGAEFIRRKKGKGFEVGRVAGWAAGRGYKHMVVVNEDMKKPSEYHSPFLQSHFSNLQCRRNHPHTSSKRSYCIFQTDLHRTYQTDLRLSLGHT # VGRIYAFRSPEKVALQEIGPRFTLKLRSLRKGIPAVFNLAEEPKGLEFDVDESKSSAEETLDSDENKQNAFEAPEKVVPPKQDNYLWKWKVMSSFFPI # GHGLTLISQPELETTRRTFFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g366 ### # start gene g367 7 AUGUSTUS gene 1744914 1746161 0.41 + . g367 7 AUGUSTUS transcript 1744914 1746161 0.41 + . g367.t1 7 AUGUSTUS start_codon 1744914 1744916 . + 0 transcript_id "g367.t1"; gene_id "g367"; 7 AUGUSTUS CDS 1744914 1745157 0.57 + 0 transcript_id "g367.t1"; gene_id "g367"; 7 AUGUSTUS CDS 1745220 1745589 0.74 + 2 transcript_id "g367.t1"; gene_id "g367"; 7 AUGUSTUS CDS 1745729 1746161 0.93 + 1 transcript_id "g367.t1"; gene_id "g367"; 7 AUGUSTUS stop_codon 1746159 1746161 . + 0 transcript_id "g367.t1"; gene_id "g367"; # protein sequence = [MSINTAQIFQPTDSITEEFALKTTQDLVKTIYTSQTADGTDSDIEGLARDACEECIAILREPEKSQAKPAIKILCAFM # STTLSRYTVAQTAPYLVKLYAHPDNVAARPSILLLLSDLIAAARDSMAANKVDDSDSLETPLSPYKDEILSIVSSALKVSSSRDPALACLLGLVSTEK # LVSDEELGFIVHSVDEILLEESDEAEETNMLPEDAPARDAALDRARAWRILSALNTVCRPLELFETLVIRLTTRLDLLCVPSETVPLPADREPRVAYA # HSILITLHQTLLAKVDDGHADVAKYIETLVPRLFNLFIYSALVSNEVNLIATDIRLITVAGQTIGTVVQNTAAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g367 ### # start gene g368 7 AUGUSTUS gene 1748101 1749612 0.52 - . g368 7 AUGUSTUS transcript 1748101 1749612 0.52 - . g368.t1 7 AUGUSTUS stop_codon 1748101 1748103 . - 0 transcript_id "g368.t1"; gene_id "g368"; 7 AUGUSTUS CDS 1748101 1749612 0.52 - 0 transcript_id "g368.t1"; gene_id "g368"; 7 AUGUSTUS start_codon 1749610 1749612 . - 0 transcript_id "g368.t1"; gene_id "g368"; # protein sequence = [MSVRKANNANLLYASTRSTRGFLLCFEISLSVMTHDNSDVFGSSSSQFLSASSSTGPRRSPSRQSLNSRRSATSLRSS # SSLAQTMDQDASNSRFSLAHELAAALMPEPSAGSRLLAEEFGIEYDEGAEGIDEDIHHSNSDHPQLLVDSNEGPSFADELNHRDALDTSFADTPQHRA # VRDEQDYDPVFGSPSATRHKKSKRPEQDAMEVLAQDLESTDKFLSHLRHLDNEPGSIASASQQLSLEKMAYDVIRRLDETTRDREGQVRELLEYEREF # RKIAGQVGGEDVLGQLEELTGMHELHEEEKPTPASIHPQIDNVEDEPPRRSRVQEWDADPHQLDRDGEDEDDIDYEEELTPVKDTFPPPPPILGPPTP # AATISQLAHLRSFTRSLVTSLTTISEQAQVNGAATTEAGRKIRALKNKLGTWRTDWDSAERSRLKIERWEAGISDGADTPDGDASPGYISSPRPSGHK # RVDGRRIVEEHLQAFELALADAGGKTKAIMASG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g368 ### # start gene g369 7 AUGUSTUS gene 1750781 1751236 0.98 + . g369 7 AUGUSTUS transcript 1750781 1751236 0.98 + . g369.t1 7 AUGUSTUS start_codon 1750781 1750783 . + 0 transcript_id "g369.t1"; gene_id "g369"; 7 AUGUSTUS CDS 1750781 1751236 0.98 + 0 transcript_id "g369.t1"; gene_id "g369"; 7 AUGUSTUS stop_codon 1751234 1751236 . + 0 transcript_id "g369.t1"; gene_id "g369"; # protein sequence = [MSTTLALPNDVLASMEVDLSMPWEFFPPKLFKMWVVVKCEGGDVEVQNFVLPTFWHSIKVSNKVGGTTTRRVEKVYKF # ADAHIDDHSKALDLGEDWWLTYRYQLEAFVDKLKGRIPQTWVTREDSIANMQWIENIYEKVRVMPLCDFSFEC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g369 ### # start gene g370 7 AUGUSTUS gene 1757742 1760183 0.94 - . g370 7 AUGUSTUS transcript 1757742 1760183 0.94 - . g370.t1 7 AUGUSTUS stop_codon 1757742 1757744 . - 0 transcript_id "g370.t1"; gene_id "g370"; 7 AUGUSTUS CDS 1757742 1760183 0.94 - 0 transcript_id "g370.t1"; gene_id "g370"; 7 AUGUSTUS start_codon 1760181 1760183 . - 0 transcript_id "g370.t1"; gene_id "g370"; # protein sequence = [MTSPSSPTTPRRRLSSRRGSVSAQDPYAKHGEINLNPNRLSTSTLTIVKVVPSDIFSAFSNNNHGTISLKDPPGPGQR # RPHRRIGNNDSGAGPRGRPEGGAGAEGSPRMSFAFSTFGPARPGTQSDRTGARTPSPSSPSTSSRIRPSSPSGHRSSTSGYAAPKPKLTPEQLYDLAH # QATHPTHLPTMTSPLNQRWSPHFTGSPRSSPSSGISTGTTPATFTPLHPSVYLPFIDRSAEVKALIESTPTRKLFALLKQTFPRQDSLPATGHLVVSN # PDPESKSSPSDSPERSIFSPTPGVDIPIDPTTWTYDSLIAFIVNTSRDQEPDTIWVAKIRRCILSHSELIWERVKGALGVPPELDVDFDLEMEMNADV # FESSESESESDRDLQTPGSTKTPRTEDMEDGGMKGKGYWEGWDAIMDSPNNDRGSAPASAFIKSPSTDPIPINAAAASMLHTQRSGSGDTTESPTPVQ # RESRSPARDPDLPKIMQQMPTPTTSFDESQQVKAVPIPDGEDVSSKTSASTTTTTTRHVKTNSRSSIGSPGSFSPSLSSSIPSLLSFTSATSGPNPET # GVVIEPLILSPSQNSVGSPGLYPPPLSLPALLSDSAGNGGSTNALGDILEGAEEEDEEDEKEKEKEKEQKSETLDNNNSAAVPEPAIDPTQIHGLRIS # LPSSPTPSTSSTTSSPVFAYRPLSQLSQSQSQSQGLTGSLSRSGSLSRTKTDPNSNLKRLSWGSIGGAGDLGDLTRSQSFGGKGGLTRTGSSGSITSI # GSHGYLVGGAGSGYDSEGGYDPVGDRAPGNPLFPSNFARLATGPTLIAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g370 ### # start gene g371 7 AUGUSTUS gene 1764141 1764677 0.24 - . g371 7 AUGUSTUS transcript 1764141 1764677 0.24 - . g371.t1 7 AUGUSTUS stop_codon 1764141 1764143 . - 0 transcript_id "g371.t1"; gene_id "g371"; 7 AUGUSTUS CDS 1764141 1764274 1 - 2 transcript_id "g371.t1"; gene_id "g371"; 7 AUGUSTUS CDS 1764330 1764491 0.49 - 2 transcript_id "g371.t1"; gene_id "g371"; 7 AUGUSTUS CDS 1764593 1764677 0.24 - 0 transcript_id "g371.t1"; gene_id "g371"; 7 AUGUSTUS start_codon 1764675 1764677 . - 0 transcript_id "g371.t1"; gene_id "g371"; # protein sequence = [MLFANDMHLGQIKCSILFHATSMESYLTFLHTLETWDSTFVDGDDGQTPELLANSNPLANGPGVRTPAGSFYYGGVNH # GNGLDQDQVSVGDEDPGNSENEIEEADLDGAFGLFSEDEDDDMLDVPM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g371 ### # start gene g372 7 AUGUSTUS gene 1765107 1765742 0.51 - . g372 7 AUGUSTUS transcript 1765107 1765742 0.51 - . g372.t1 7 AUGUSTUS stop_codon 1765107 1765109 . - 0 transcript_id "g372.t1"; gene_id "g372"; 7 AUGUSTUS CDS 1765107 1765742 0.51 - 0 transcript_id "g372.t1"; gene_id "g372"; 7 AUGUSTUS start_codon 1765740 1765742 . - 0 transcript_id "g372.t1"; gene_id "g372"; # protein sequence = [MFSARKHGETIESIAEWMKSLRLTYPKAGVRDMTDLFWREYQIKIPRFDEIPVIERSIFDDDSRSLVNSYCKTYEPDL # VKQRRANRLSRKLFWAAGLFDVVCVDQHDKWREKWKLGLHVGVEPMSGQILWLEIWHTNRNPKIVASYYLDWVEASGCECHYEQHSNANLIPQICRWL # LKVTLGPRTMESQMLILPFVSGMIQTWLELCHTDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g372 ### # start gene g373 7 AUGUSTUS gene 1790304 1793413 0.14 - . g373 7 AUGUSTUS transcript 1790304 1793413 0.14 - . g373.t1 7 AUGUSTUS stop_codon 1790304 1790306 . - 0 transcript_id "g373.t1"; gene_id "g373"; 7 AUGUSTUS CDS 1790304 1791908 1 - 0 transcript_id "g373.t1"; gene_id "g373"; 7 AUGUSTUS CDS 1792287 1792757 0.74 - 0 transcript_id "g373.t1"; gene_id "g373"; 7 AUGUSTUS CDS 1792821 1792858 0.63 - 2 transcript_id "g373.t1"; gene_id "g373"; 7 AUGUSTUS CDS 1792957 1793005 0.54 - 0 transcript_id "g373.t1"; gene_id "g373"; 7 AUGUSTUS CDS 1793105 1793413 0.27 - 0 transcript_id "g373.t1"; gene_id "g373"; 7 AUGUSTUS start_codon 1793411 1793413 . - 0 transcript_id "g373.t1"; gene_id "g373"; # protein sequence = [MRGWLLIHLYRFVSAIHFPSDQPDILISGGGDAELKLWDWLSGKHKADISILDSVKPYIKVKMRPYKRTTFAKSAEKQ # KDQSREGTESRDSVPPDGEEQTVVAVQHYSRSPIQLGSLLHQNRDHSQDGSPIRPYDECFQLSDVSSTFSSPVLDALNGKCLVKGISPLHLLTKIGAN # AEAASSEDLETLDFYSSLKSLPKNTGEYDDDEDGSGETAPPATGIPKNIKTNTRKQSQGSGGGKKEQGKLKSQKAVAQKKLESQSVLVNRGGKESDAP # KRLKSEDPHSDGTRMIVQCFSLSASSFDIWYKDDDGETLKIWTDDQLTGAITYFADAADDAHTSSASSIFSGRGFGSRKITLPVQIEVEYEGPSLSDT # GSIASIEEYGSRNGDVGEWSSAFSARDLDDDSATVSSRDNGRLSTRSFVRNRVSSPLHGRASQLSGESSRDAFSGSTGPARSISRQNQDPFADSNGQS # PNGILERLRLENDAASTDYDPLASDQRGTHWLKEQNERAKRSLGVLPASSASDESSFSLLEQEDQVGPLSLQRAPTGRYYYEYDSEASQSQMTGPEDR # GFEIDPSIDGGINGKPRPTSRQWAWVTAQQDATALRPPPHTHRSDPSLETIVPAEILQNLDPPRGENLTCCSGCGRFLNYVKYVCYTCRDKETGSDIS # SPTSSNKGKGRDCPPFTYPPTPLQTNIYTSPLSLNFSSSSNTFVGSPSKRRPLPPQPSVSTSFATLVPPTSPRMATGYELCYECIDEVGHMHAIEAMN # EPGSSPTTSNLSSSSPKDAAVQWRRAPPKQKGQLRHAYVEKIWGHNGWDDIGQRWFTYI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g373 ### # start gene g374 7 AUGUSTUS gene 1796421 1799173 0.59 + . g374 7 AUGUSTUS transcript 1796421 1799173 0.59 + . g374.t1 7 AUGUSTUS start_codon 1796421 1796423 . + 0 transcript_id "g374.t1"; gene_id "g374"; 7 AUGUSTUS CDS 1796421 1798384 0.59 + 0 transcript_id "g374.t1"; gene_id "g374"; 7 AUGUSTUS CDS 1798468 1799173 1 + 1 transcript_id "g374.t1"; gene_id "g374"; 7 AUGUSTUS stop_codon 1799171 1799173 . + 0 transcript_id "g374.t1"; gene_id "g374"; # protein sequence = [MTEMNVVAIEKSLLNGHWDNSFPHTPLVDVAQAVVRGRFGEALTSSYAQQLFQFRLADTLKNSFNISASLMQDGPQNE # LLRLALAVACLHAFLQVNWTGPDLDFQPLDILSQTESHDLSNETLNGLAISELALGGEPAYHLAQHAIFLRLAQILLDAPYHHCQTAIWWRLRAHLVH # QQVIDEPVILPDNDMTTFEHWQSPFALDSPDLNGRLLLEHGLLHHIFQQDKIAAEYFVKAARATDLQYELTGALGKRTKFQQTELSQLVLLAESHLPD # VNPEKTEVLSTNEPDQAVVPETLALNDDTLLEKTEFTSSRPLADPSSSSLYRIDPSNQPPLHPLDQCILLSLCLNVRNTSPLHGLTSEQMSPYVARVI # SHPRNWTIHTMALLLRSRLEANRTRTVERSTLQLQALVDQMPATDVEAAPVSERLRYLHSISLPPKWELERELANRFISLGVIRSALDIYERLEMWEE # VVKCHVSLDRPDRGITIVKDLLAGNKVESEAVISREKASGAVDSMKRLQRFDSVREAKLWCILGDIEPEHAVEHYKRAWGISKNTSGRAMRSLGGFYF # ARAEYGLARECLQKSVKIEPLLSKSWFILGCACMRLEDWQGAKEAFARCVTIDEEDGESWSNLASMYLRIEQSNKDGDSAVRIRGCLALKEGLRRSYD # NWRMWSNYMIIAVDVGELAEACRALGRVVEETSNQAGGVVLDEDVLDRLVNAVTRAPSDPQEAVAISNSDQVQYSLNPNEGHGLLPRVLDLFDRIILP # RVSSTRVFRAYARLLTWMGRWEDTMKAWMDAYRESDAGKLTRGELDTVAVVGDDMGRRVWRDAVGEVEEIVDILRNVGARLASSSAKKWRLQAKSVVR # SFMARTRENFEDDSEWIRLEELLDGLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g374 ### # start gene g375 7 AUGUSTUS gene 1800828 1801868 0.52 + . g375 7 AUGUSTUS transcript 1800828 1801868 0.52 + . g375.t1 7 AUGUSTUS start_codon 1800828 1800830 . + 0 transcript_id "g375.t1"; gene_id "g375"; 7 AUGUSTUS CDS 1800828 1801868 0.52 + 0 transcript_id "g375.t1"; gene_id "g375"; 7 AUGUSTUS stop_codon 1801866 1801868 . + 0 transcript_id "g375.t1"; gene_id "g375"; # protein sequence = [MKEWTVKELLLGYLHEPIDSSLSDSFKTIPFRRHFQSFEQSPNYLKYFFALLGGSAREAFSSEFLSPDDCYQKMKEDL # QNLEDSKLRDIWSSKFNAHTMTNSIEEGISHKFFSVFPYDDDIRSKAAVRTPSDKILDMIITEYDRRFHQKKVDIFSQYLIAAGVGSRSMAAELYDTH # FHEYLLRLVNAGSVQVRAMKPPSKPRQSATQKTREWSTSDSLSTLAMPGLIALLEFDHDTVLDFRQLEYKYLKPTIRYFATFHSLLVLSETSVIAFQA # TIADKHDCRPGGLEWLTTHGIEEIHYVYVSPAAVEHATVVLPGDVPDDLIYPTASSGTLQFRSVSHMYVDFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g375 ### # start gene g376 7 AUGUSTUS gene 1802883 1806599 0.89 - . g376 7 AUGUSTUS transcript 1802883 1806599 0.89 - . g376.t1 7 AUGUSTUS stop_codon 1802883 1802885 . - 0 transcript_id "g376.t1"; gene_id "g376"; 7 AUGUSTUS CDS 1802883 1806599 0.89 - 0 transcript_id "g376.t1"; gene_id "g376"; 7 AUGUSTUS start_codon 1806597 1806599 . - 0 transcript_id "g376.t1"; gene_id "g376"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDNPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g376 ### # start gene g377 7 AUGUSTUS gene 1806650 1807816 0.9 - . g377 7 AUGUSTUS transcript 1806650 1807816 0.9 - . g377.t1 7 AUGUSTUS stop_codon 1806650 1806652 . - 0 transcript_id "g377.t1"; gene_id "g377"; 7 AUGUSTUS CDS 1806650 1807816 0.9 - 0 transcript_id "g377.t1"; gene_id "g377"; 7 AUGUSTUS start_codon 1807814 1807816 . - 0 transcript_id "g377.t1"; gene_id "g377"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPMHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g377 ### # start gene g378 7 AUGUSTUS gene 1813330 1814049 0.76 + . g378 7 AUGUSTUS transcript 1813330 1814049 0.76 + . g378.t1 7 AUGUSTUS start_codon 1813330 1813332 . + 0 transcript_id "g378.t1"; gene_id "g378"; 7 AUGUSTUS CDS 1813330 1814049 0.76 + 0 transcript_id "g378.t1"; gene_id "g378"; 7 AUGUSTUS stop_codon 1814047 1814049 . + 0 transcript_id "g378.t1"; gene_id "g378"; # protein sequence = [MHQPQPQQLVNLDRISSPSLNFHDDLHSAPAVMMEYPREPYGISPSRPNTTRMIPPWFPTHVPPPPEQSYPYYPNPPY # HYPYLYPTSSESPRLNMPRVKIEYSSIHSTFLATIKDTDSLKDRKSWVKWNEGVWQAVADGFVLGHICDEPPLGTPRMEWNTPSLRPVLSSNPTRKEL # EAKLKWDKNDGWTSSILTAQLSDEARNHLPPMIDDRGDTPKFWLDVYAVNCDIFTYRFVSRGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g378 ### # start gene g379 7 AUGUSTUS gene 1815672 1816721 0.49 + . g379 7 AUGUSTUS transcript 1815672 1816721 0.49 + . g379.t1 7 AUGUSTUS start_codon 1815672 1815674 . + 0 transcript_id "g379.t1"; gene_id "g379"; 7 AUGUSTUS CDS 1815672 1816721 0.49 + 0 transcript_id "g379.t1"; gene_id "g379"; 7 AUGUSTUS stop_codon 1816719 1816721 . + 0 transcript_id "g379.t1"; gene_id "g379"; # protein sequence = [MDIEKFNLKWSSTLTTLRNYGYDIPWDTLISKYISKLPSGPRYVYLKQVLEEEFDEPGAIPNRELFDKFTIRLENTRN # RELLDLSESGGGSYNCRFQKTGTGSNDKPLDSQKPRDTPNSTKPNTKPTAYVTNANSHATTTTSKIENVDTVSDVTTVLPTNNTTVRSTYPARRLKPF # AALLSTLPSSPSPNECSTKNQPVAYSSMVQKKHTLLDSACTNHIVNDRRFFHTYNVDGAIAVQTANSGVLSTQASGTCYFETHIEGTTDTLILEMHDC # LFAPDAPVSLISVGTMLEHGFTFIILPDIIRIHPDADRHFIADITNRLCFLRGKFILPDKDFTDPIHLAMPVFIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g379 ### # start gene g380 7 AUGUSTUS gene 1816962 1817801 0.73 + . g380 7 AUGUSTUS transcript 1816962 1817801 0.73 + . g380.t1 7 AUGUSTUS start_codon 1816962 1816964 . + 0 transcript_id "g380.t1"; gene_id "g380"; 7 AUGUSTUS CDS 1816962 1817801 0.73 + 0 transcript_id "g380.t1"; gene_id "g380"; 7 AUGUSTUS stop_codon 1817799 1817801 . + 0 transcript_id "g380.t1"; gene_id "g380"; # protein sequence = [MSNHHSSHFNIIVNDYTSALSGGCFAKKNQALRIIKTTISTWENVMAPHKVKNIRLDGAKEFHGSEATSYFEEKGISV # QKTAAYSHQQNGKAERWVRIIENDAMTMLVHAGLPLQFWEDAVRTALYIRFRLPTKTIPSNKTPYEMVHKAAPNLSHLRVWGCQCWIQVSEDIRLKFG # DKMIEGIFVGYEENRIGWRVRDIHGKDHFSDQVIFNESQFGRLHGPKPSKSTKLSSDLPTTLSTSTQHPITTKGPRPQRTIKLTERGKEWRDGIRKRD # ELIAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g380 ### # start gene g381 7 AUGUSTUS gene 1818042 1819454 0.83 + . g381 7 AUGUSTUS transcript 1818042 1819454 0.83 + . g381.t1 7 AUGUSTUS start_codon 1818042 1818044 . + 0 transcript_id "g381.t1"; gene_id "g381"; 7 AUGUSTUS CDS 1818042 1819454 0.83 + 0 transcript_id "g381.t1"; gene_id "g381"; 7 AUGUSTUS stop_codon 1819452 1819454 . + 0 transcript_id "g381.t1"; gene_id "g381"; # protein sequence = [MLLWPDATDWLAVEDKEITGLFDLGVFEVTERCPRDKFPIGLKMVYDLKLDGTKKARLVAQGFTQRPEDYGNVHAPVT # RMVSYQIVMAWTAKMNLELFSFDVKQAFLNAPLAEEIYVKQIPGRPIPDQPSAVYRLRRALYGLHQALAAWYSTLCNTLEDLGFSRCECDNAVFIGRW # TIPPDPSILMPENGDPLLMFIPVHVDDGLVSTNSKELYSWFIRNINLRFKVIDLGPTSTFLGIRIYRDRTQRLLWLSQESYVTELLEQYGLMECVSHD # LPLHYKFDGHNSITSVYDNVDSESLTKIYQALIGCLLFLALCTRPDIAYSVMFLAQFNSKPSPRHLIAAKGTLRYLAKTRSWALQYGGGHRNDLIKTL # GIDSDMLALTDADWGSNSIDRKSISGFGIFLFGGLVAWSALKQKSIALSSTEAEYMGMTHVLKELLWIRPIPILYPTDPNISTFVIILSAPTLKMILL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g381 ### # start gene g382 7 AUGUSTUS gene 1821778 1824766 0.24 + . g382 7 AUGUSTUS transcript 1821778 1824766 0.24 + . g382.t1 7 AUGUSTUS start_codon 1821778 1821780 . + 0 transcript_id "g382.t1"; gene_id "g382"; 7 AUGUSTUS CDS 1821778 1821793 0.31 + 0 transcript_id "g382.t1"; gene_id "g382"; 7 AUGUSTUS CDS 1822797 1824766 0.48 + 2 transcript_id "g382.t1"; gene_id "g382"; 7 AUGUSTUS stop_codon 1824764 1824766 . + 0 transcript_id "g382.t1"; gene_id "g382"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIQPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQVLKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ # SHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPKSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLR # DNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g382 ### # start gene g383 7 AUGUSTUS gene 1824796 1830578 0.95 + . g383 7 AUGUSTUS transcript 1824796 1830578 0.95 + . g383.t1 7 AUGUSTUS start_codon 1824796 1824798 . + 0 transcript_id "g383.t1"; gene_id "g383"; 7 AUGUSTUS CDS 1824796 1826227 0.95 + 0 transcript_id "g383.t1"; gene_id "g383"; 7 AUGUSTUS CDS 1826302 1830578 1 + 2 transcript_id "g383.t1"; gene_id "g383"; 7 AUGUSTUS stop_codon 1830576 1830578 . + 0 transcript_id "g383.t1"; gene_id "g383"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKP # KPIRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRIVRYEILKRGTESFQRSQPSFEKVRYESRQRKK # GKAQDSKDKKENVQADVVTEPPINKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHG # DPLLELPELSKHPKPFAPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIF # EDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTF # QTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSG # TKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCP # ALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSC # GPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEA # DDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLSEMSKDERIKFIRL # IKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHTPSL # FQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANG # KIERAHLDIRQALIKATGGDISKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEK # VRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTILKEKVGAFRVLPHFTRNEPI # ELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPRLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g383 ### # start gene g384 7 AUGUSTUS gene 1830839 1832293 0.38 - . g384 7 AUGUSTUS transcript 1830839 1832293 0.38 - . g384.t1 7 AUGUSTUS stop_codon 1830839 1830841 . - 0 transcript_id "g384.t1"; gene_id "g384"; 7 AUGUSTUS CDS 1830839 1831266 1 - 2 transcript_id "g384.t1"; gene_id "g384"; 7 AUGUSTUS CDS 1831348 1831483 0.91 - 0 transcript_id "g384.t1"; gene_id "g384"; 7 AUGUSTUS CDS 1832126 1832293 0.53 - 0 transcript_id "g384.t1"; gene_id "g384"; 7 AUGUSTUS start_codon 1832291 1832293 . - 0 transcript_id "g384.t1"; gene_id "g384"; # protein sequence = [MPIHPKKDLDIARVAEPHLGALQQLLASYKGKKTNSPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKEEKS # AVNDVPPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKS # RQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g384 ### # start gene g385 7 AUGUSTUS gene 1998767 2001670 0.19 - . g385 7 AUGUSTUS transcript 1998767 2001670 0.19 - . g385.t1 7 AUGUSTUS stop_codon 1998767 1998769 . - 0 transcript_id "g385.t1"; gene_id "g385"; 7 AUGUSTUS CDS 1998767 1999603 0.5 - 0 transcript_id "g385.t1"; gene_id "g385"; 7 AUGUSTUS CDS 1999769 1999887 0.95 - 2 transcript_id "g385.t1"; gene_id "g385"; 7 AUGUSTUS CDS 2000249 2000402 0.41 - 0 transcript_id "g385.t1"; gene_id "g385"; 7 AUGUSTUS CDS 2001485 2001670 0.84 - 0 transcript_id "g385.t1"; gene_id "g385"; 7 AUGUSTUS start_codon 2001668 2001670 . - 0 transcript_id "g385.t1"; gene_id "g385"; # protein sequence = [MSSPSSNAVTGAPNPVLPPVSSPPHPDSAERIVDAAINELASTLEEPPLGQLALFRSVFGIGGGAGSSPPLVNTSGSA # PLSGGRVEEVVHSSPPLGETGSTGAPPLLSQGRSSEASRRALQDVAADRLEYSRVLAQFRAIEAELPEAPLEVEVKRSFEAHEELDAANARAIRLRDR # LEDLEETVHRYRAWAYVAEELIRKYPEDEGLYEVDLPSLSSLQNKLTASEVMVHRLATFAHRLYSADPANLLHHHNIYVGGLIEEIITLLLRSLLHPP # ERMRTVVELALEYLSQGRLTHGELHLCSTSSLLHYYSNAADCVNGLYQDMLTHSHFSSDTAFLTAAQHAGYVEARPDSLEPPLHRQLFSFGHPIPLPQ # SPISDHIPAVPMMDSVMLMWEGMISAYMREVLGYPASPDRVSSPVNVPGSNDPLQQLPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g385 ### # start gene g386 7 AUGUSTUS gene 2006134 2007603 1 - . g386 7 AUGUSTUS transcript 2006134 2007603 1 - . g386.t1 7 AUGUSTUS stop_codon 2006134 2006136 . - 0 transcript_id "g386.t1"; gene_id "g386"; 7 AUGUSTUS CDS 2006134 2007603 1 - 0 transcript_id "g386.t1"; gene_id "g386"; 7 AUGUSTUS start_codon 2007601 2007603 . - 0 transcript_id "g386.t1"; gene_id "g386"; # protein sequence = [MDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNR # TLEAVRRQYTWPKVRDFVRDYVTSCTIGGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGFTAILVVVDRSSKQAIFIPTHDTITSEQLA # ELFVIHVFSKHGVPNHVTSDGGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGI # TPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSHYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVV # SRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADEL # HADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g386 ### # start gene g387 7 AUGUSTUS gene 2007702 2009212 0.71 - . g387 7 AUGUSTUS transcript 2007702 2009212 0.71 - . g387.t1 7 AUGUSTUS stop_codon 2007702 2007704 . - 0 transcript_id "g387.t1"; gene_id "g387"; 7 AUGUSTUS CDS 2007702 2008256 0.96 - 0 transcript_id "g387.t1"; gene_id "g387"; 7 AUGUSTUS CDS 2008334 2009212 0.71 - 0 transcript_id "g387.t1"; gene_id "g387"; 7 AUGUSTUS start_codon 2009210 2009212 . - 0 transcript_id "g387.t1"; gene_id "g387"; # protein sequence = [MEPILLRAIHSEVAARAADRSSTAPTVPPLPPSIPAEYAEFADVFDEIAADSLPQHRPYDLKIDLEEGASPPLGRIYP # LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDE # WKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDIVIYSDTPEEHREHVKEVLQRLRHHRLYANPEKCEFNMDTVEYLGYIL # SPDGLTMSKEKVQTVLEWPRYRCADDSAYPKRRSLDLGQQLSRGLRKPQNRFYFCADTGHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLS # RTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKILTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKE # GISATPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g387 ### # start gene g388 7 AUGUSTUS gene 2010175 2011713 0.43 - . g388 7 AUGUSTUS transcript 2010175 2011713 0.43 - . g388.t1 7 AUGUSTUS stop_codon 2010175 2010177 . - 0 transcript_id "g388.t1"; gene_id "g388"; 7 AUGUSTUS CDS 2010175 2010835 0.8 - 1 transcript_id "g388.t1"; gene_id "g388"; 7 AUGUSTUS CDS 2010904 2011386 0.58 - 1 transcript_id "g388.t1"; gene_id "g388"; 7 AUGUSTUS CDS 2011442 2011713 0.72 - 0 transcript_id "g388.t1"; gene_id "g388"; 7 AUGUSTUS start_codon 2011711 2011713 . - 0 transcript_id "g388.t1"; gene_id "g388"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSESISAIGQPRRRNRGFGPATVPTTLTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPAVDNPLCHRPPYGETTQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPGDPSGPGGPGGSGGPGGPGG # PGGPRTPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRNSRRSSSISPCGSAKEWFVPDILDPDLDSLPAW # TSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNR # YWKREETRKCEAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPLAPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSDGKE # G] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g388 ### # start gene g389 7 AUGUSTUS gene 2017483 2018868 1 + . g389 7 AUGUSTUS transcript 2017483 2018868 1 + . g389.t1 7 AUGUSTUS start_codon 2017483 2017485 . + 0 transcript_id "g389.t1"; gene_id "g389"; 7 AUGUSTUS CDS 2017483 2018868 1 + 0 transcript_id "g389.t1"; gene_id "g389"; 7 AUGUSTUS stop_codon 2018866 2018868 . + 0 transcript_id "g389.t1"; gene_id "g389"; # protein sequence = [MASGAPASSATTSSSSPTSASTTTSSSSSTTSSTTSSNTSNTSNTSSSTSASNTASSAQSSGSSLGSGSSSGTSSATK # TSSSTTSTSTLTASLTTAVATTVVGTSADGQVYTTVIQTSTVLPPGATVTSSSSSDSGSSSSSDSHTGAIVGGAVGGGAALIIVLVLVGMWWKRYKQK # QRSLEAFDGNFDPDRIVTEGKAMKGEPKGMRGRGATLPNVGDDDDGMGGRLAGSALGAGVVAPYPLYHPTNANAIPSEMSTQQQQQNSNPSSTSLGYS # RPSTHTRSPSLGLSSSGVPASVYAAAYGDNGPPPTQPQGSNAPYGFGVGERLPNPYTQNPNQPNPASDPGSTSTHTTHTGAGQGYGRFNVANPDPGAG # GGASSSSAAGPEGLFVGGFTPGARGENKSLAGPAFGGRSRDVLVHQDGGRVDVSRGEGEGEGPDEIPPTYDSLLPDRSGSGPPQRGGKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g389 ### # start gene g390 7 AUGUSTUS gene 2022291 2023576 0.54 + . g390 7 AUGUSTUS transcript 2022291 2023576 0.54 + . g390.t1 7 AUGUSTUS start_codon 2022291 2022293 . + 0 transcript_id "g390.t1"; gene_id "g390"; 7 AUGUSTUS CDS 2022291 2022965 0.54 + 0 transcript_id "g390.t1"; gene_id "g390"; 7 AUGUSTUS CDS 2023019 2023576 1 + 0 transcript_id "g390.t1"; gene_id "g390"; 7 AUGUSTUS stop_codon 2023574 2023576 . + 0 transcript_id "g390.t1"; gene_id "g390"; # protein sequence = [MHRTIVNFLTTSKGCLDFKGSDVALVNEGYGIFLDPMCSRIGLNEPATIIYGAKWFKEHPYFTLVKLAGTFAWNYRTE # IHPSHFALSLALSMAMCFSHFSKVSNACTVFGLNLPSLNAKLVKFVEVADRLETMDLQLSENMPDRLVFLAGAPGEVVSWFKHERDEPFCVLPSSSST # SVTLVFCLKLSDERIFWVFVYVPSTFTSETPDFAQDIKEIHPNVIFRDQPEVVTLLDQLPNLNIDVGLSGVLRISGSFRVKNATADSILREDYPAGVL # NIEGLDKVTKEFSQDILMRRLSRIFTQKPSSPMTLPTVAQDVVVSAMSKKRGRSTSTADASSTSRADGAKIQKSFEGNATTGFGPLARKGRKGTQSSR # TRRSKGKMGNLVTGRASVVAFRSILVDPTVASSSSVSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g390 ### # start gene g391 7 AUGUSTUS gene 2025128 2026015 0.84 - . g391 7 AUGUSTUS transcript 2025128 2026015 0.84 - . g391.t1 7 AUGUSTUS stop_codon 2025128 2025130 . - 0 transcript_id "g391.t1"; gene_id "g391"; 7 AUGUSTUS CDS 2025128 2026015 0.84 - 0 transcript_id "g391.t1"; gene_id "g391"; 7 AUGUSTUS start_codon 2026013 2026015 . - 0 transcript_id "g391.t1"; gene_id "g391"; # protein sequence = [MFTTMELFPGKYFFFIGYIMHQCRTNSLLVTPPTKTTSSPLEIEVASTSTLLEAIVENTSPPSSSSFASESENTPFTS # PSPDTLTTTFSFATENFPTPFPTPSRTFTTSTIMSFSFIFHTSSATTSFHSHSSTTISNIPNSSSNPGSSSVFPISSKSHIGAIIGGTIGGVVLITTV # IILVLIHQSKKRRHRQWSMSETLDHGIGGATPFPLKDQLTTITNSDPNSHSNLTPVVPPEMTTLGESNPVVATQLTASTFGIRRNLFVHQDGGMIEMP # LQAEPEDVVLEEIPPPYESLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g391 ### # start gene g392 7 AUGUSTUS gene 2026813 2027169 0.76 - . g392 7 AUGUSTUS transcript 2026813 2027169 0.76 - . g392.t1 7 AUGUSTUS stop_codon 2026813 2026815 . - 0 transcript_id "g392.t1"; gene_id "g392"; 7 AUGUSTUS CDS 2026813 2027169 0.76 - 0 transcript_id "g392.t1"; gene_id "g392"; 7 AUGUSTUS start_codon 2027167 2027169 . - 0 transcript_id "g392.t1"; gene_id "g392"; # protein sequence = [MSTTHFDPHFYRPLLKNLRKFGDITCFLVSRLDRTSVETWANYTELDMREEDTNLEARLREDGLIVGDWITVADPWQN # EWPFVKMHPRRTCPPDPEHLRIIRKSNEQRRQERMEKQEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g392 ### # start gene g393 7 AUGUSTUS gene 2031727 2032790 0.2 + . g393 7 AUGUSTUS transcript 2031727 2032790 0.2 + . g393.t1 7 AUGUSTUS start_codon 2031727 2031729 . + 0 transcript_id "g393.t1"; gene_id "g393"; 7 AUGUSTUS CDS 2031727 2031993 0.21 + 0 transcript_id "g393.t1"; gene_id "g393"; 7 AUGUSTUS CDS 2032038 2032790 0.57 + 0 transcript_id "g393.t1"; gene_id "g393"; 7 AUGUSTUS stop_codon 2032788 2032790 . + 0 transcript_id "g393.t1"; gene_id "g393"; # protein sequence = [MLTLNSGQVETTPTPSGTRTTTNEIDIIISNSNFSFNSSAPTLNSNTPSSSSTKVTKTATGISNVLTMVGKRPSVGEE # GVPGPHMTLWGYHYQYHQHLTSSSTSSSTSSSSLPNPGSNSHIGVIVGGAVGGGVALAITIIVLVLVGIWWKRYKLKEMFLKLETKLAMPVPAIDHAG # AGEGVPGAGGEITSGSGSHRAGFKAASPYPLEHYPTYPAMILLPPTMSAGHDAVSIVGSRNSGSGRRSSRNMFIHRDREMVSINVDMLQGRVQEEVES # QLEEQVPEEILPTYESLMSDLMTVGIQSRSSEHNGGRSRSGVGGSGELGVVENSTKWTTQRFGST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g393 ### # start gene g394 7 AUGUSTUS gene 2033695 2034861 0.9 + . g394 7 AUGUSTUS transcript 2033695 2034861 0.9 + . g394.t1 7 AUGUSTUS start_codon 2033695 2033697 . + 0 transcript_id "g394.t1"; gene_id "g394"; 7 AUGUSTUS CDS 2033695 2034861 0.9 + 0 transcript_id "g394.t1"; gene_id "g394"; 7 AUGUSTUS stop_codon 2034859 2034861 . + 0 transcript_id "g394.t1"; gene_id "g394"; # protein sequence = [MSTPIPPAPNTSADDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSASAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g394 ### # start gene g395 7 AUGUSTUS gene 2034912 2038628 0.94 + . g395 7 AUGUSTUS transcript 2034912 2038628 0.94 + . g395.t1 7 AUGUSTUS start_codon 2034912 2034914 . + 0 transcript_id "g395.t1"; gene_id "g395"; 7 AUGUSTUS CDS 2034912 2038628 0.94 + 0 transcript_id "g395.t1"; gene_id "g395"; 7 AUGUSTUS stop_codon 2038626 2038628 . + 0 transcript_id "g395.t1"; gene_id "g395"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLWKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPTENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYIPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPWAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDTGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g395 ### # start gene g396 7 AUGUSTUS gene 2041220 2042308 0.71 + . g396 7 AUGUSTUS transcript 2041220 2042308 0.71 + . g396.t1 7 AUGUSTUS start_codon 2041220 2041222 . + 0 transcript_id "g396.t1"; gene_id "g396"; 7 AUGUSTUS CDS 2041220 2042308 0.71 + 0 transcript_id "g396.t1"; gene_id "g396"; 7 AUGUSTUS stop_codon 2042306 2042308 . + 0 transcript_id "g396.t1"; gene_id "g396"; # protein sequence = [MLTWDSGPVEITPAPSDMHTTTNEINIIISNSTTPSGSSTTEAIVTAIGNILSIIGDPLRPGDESTMKPTRTSQSASE # GEVSNTIIQFSSVTVNATSTSPPSLTFSSSSSSSSSSSSSSPKSGANSHIGVIVSGAVGGGVALAIATTILVLVGIWWKRYRLKEMFLKLEAKPGTLV # QTADCAGTGEGVPGAGGEIEIESGMHEESAAVGTNGGGGSPRHRARFGVATPYLLKYHLGRLAPIFSPPRTLTAQQTALEVFVDGGERGGGEEFNNIV # VPVATHAAGNGVPAVGSRAGDLGRRYSRNVFIHRDRGGININADMPQREQVPEEVPPTYESLMSGLVSGLMPVRVQSRSSEHNRRERK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g396 ### # start gene g397 7 AUGUSTUS gene 2048959 2050134 0.98 + . g397 7 AUGUSTUS transcript 2048959 2050134 0.98 + . g397.t1 7 AUGUSTUS start_codon 2048959 2048961 . + 0 transcript_id "g397.t1"; gene_id "g397"; 7 AUGUSTUS CDS 2048959 2050134 0.98 + 0 transcript_id "g397.t1"; gene_id "g397"; 7 AUGUSTUS stop_codon 2050132 2050134 . + 0 transcript_id "g397.t1"; gene_id "g397"; # protein sequence = [MSTPIPPATPAPPASAEDLMTQLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS # QAKLIKSALGFFTESAGDWATPHLLHFNAEHPPFGGNWEEFLKEFGQRFESVDPGMEARSEIKNLKQSKGQTVAEFAQKFKDIGDRTGMSDIDLRERF # FTALLPEIRQNLIIVNIAQGLAPTLKEAIKRAISVDVYMHDPTMTGRNSGHTPTHAAHTTLADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQG # HVKQNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISAMGPTPFSLFPNESVQIASSTPTSAPATVPATPSPPNQDFSNQIGQIRE # LLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g397 ### # start gene g398 7 AUGUSTUS gene 2050185 2053901 0.97 + . g398 7 AUGUSTUS transcript 2050185 2053901 0.97 + . g398.t1 7 AUGUSTUS start_codon 2050185 2050187 . + 0 transcript_id "g398.t1"; gene_id "g398"; 7 AUGUSTUS CDS 2050185 2053901 0.97 + 0 transcript_id "g398.t1"; gene_id "g398"; 7 AUGUSTUS stop_codon 2053899 2053901 . + 0 transcript_id "g398.t1"; gene_id "g398"; # protein sequence = [MFATSSYDSHPSCTISLIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFATRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDVILGLPWLRKVNPEIDWEKGRLSVKPPRVAIEEVPDEEISYSHRAAANTESPIPELPN # PEPPTEPTQIEVPLEATLEASKSAVVEEPPIHRIRANHKTRWAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLIPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISWLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSSDLQEHRRV # VREVLIRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPAPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTRKDISFTWM # DTQQQAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRINTQADALSRMAAHQVLDNEDNRQQTVLKPNHFTKIAASILRNPLEDRIRKASQRE # AQVLEGLKTVKEHGLQCLANGIAEWEEDNGLVYYRGRVYVPADNDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCETCARK # KIQRHPRAVTQPLDVPLGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHALPCTSSITAEGVADIYYKEIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDFVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPISLDRIHPVFHVDKLYPWK # GNTINGEIPPPPELVYLEDEDEPEYEVEEILDSRVRWKRLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g398 ### # start gene g399 7 AUGUSTUS gene 2058699 2059948 0.35 + . g399 7 AUGUSTUS transcript 2058699 2059948 0.35 + . g399.t1 7 AUGUSTUS start_codon 2058699 2058701 . + 0 transcript_id "g399.t1"; gene_id "g399"; 7 AUGUSTUS CDS 2058699 2058758 0.35 + 0 transcript_id "g399.t1"; gene_id "g399"; 7 AUGUSTUS CDS 2058854 2059948 0.68 + 0 transcript_id "g399.t1"; gene_id "g399"; 7 AUGUSTUS stop_codon 2059946 2059948 . + 0 transcript_id "g399.t1"; gene_id "g399"; # protein sequence = [MANSDSRTSRRFLTLSACNLLTLPFGLPTLSLPIGLPPPSLPTGLPPIGSVSTFVPDTSSTPTVVEATSATQPHKSTT # SSIFIFSSSSSSIPSSSRSFSSRSPHSAITTSITTSASSFSFFSSSSSVSSSSSSLSYSTTVTGTSSFPTSSNYSSNSNSHKSAIVGGVVGGGAAVII # IVIAIVVYSSKRRPRKQFSRVFDGDRSGTNEPRVSEGGGIGGHITAAGTWVQVDTQFRSSDVITPYSLKYQPTTPTTPTTLTTHSSLRPNSHSASLGH # PEMAARFVKGFDSASHGSCGGTSTAGSMTSPTGVSSRRYTSDRAYSIDAETSSPSREELDVGEQEHVSDEIPPTYESLVPQTGGPGIRNEGSGNVMRG # GSRSEGGVGGNE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g399 ### # start gene g400 7 AUGUSTUS gene 2068570 2069370 0.97 - . g400 7 AUGUSTUS transcript 2068570 2069370 0.97 - . g400.t1 7 AUGUSTUS stop_codon 2068570 2068572 . - 0 transcript_id "g400.t1"; gene_id "g400"; 7 AUGUSTUS CDS 2068570 2069370 0.97 - 0 transcript_id "g400.t1"; gene_id "g400"; 7 AUGUSTUS start_codon 2069368 2069370 . - 0 transcript_id "g400.t1"; gene_id "g400"; # protein sequence = [MLAALAASGFPGSSRVSGSSGEPSRSESSPSAPPPAPEASTSQDGSSSSTITRRRSQRLSAKKLGSASGVDDASTNAL # AAATDDSVMQSTNTAADEPEMPPPPPAAAESASETLVDSEMQAEFSDEELDAEVFDEEEVDPDNSISDKTVTLSVAEDGSKIEAQTPDGTRVATPNPN # ISVNQGASSKPSTSSRPSYASALRAKPTDWHLEFAMDDHVLPLDLTIYGAIHQHEMRKKTGSVPPSLFWQGVYTIKFKKVPGPTPASESK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g400 ### # start gene g401 7 AUGUSTUS gene 2069828 2070881 0.13 - . g401 7 AUGUSTUS transcript 2069828 2070881 0.13 - . g401.t1 7 AUGUSTUS stop_codon 2069828 2069830 . - 0 transcript_id "g401.t1"; gene_id "g401"; 7 AUGUSTUS CDS 2069828 2070459 0.36 - 2 transcript_id "g401.t1"; gene_id "g401"; 7 AUGUSTUS CDS 2070581 2070881 0.25 - 0 transcript_id "g401.t1"; gene_id "g401"; 7 AUGUSTUS start_codon 2070879 2070881 . - 0 transcript_id "g401.t1"; gene_id "g401"; # protein sequence = [MMKAKAKADKAAARAAVQAPLVAALLITPPSAPSPTPEEQPASEHTATTSNVSSNTTADRTELLRSKPAVVGRFMQLT # VPILIDVYAASVNTPVRVKTLTVAGFASSILSSRDHPTLVIGALQLVDLLLSKVPSLYKPTFRREGVFHEIETLAARSLASSKLKEKERADKDKDKDK # DTSDTGTPDASASTTTSVSSSSSAPIIPGYKRLSSIAYDPEDAITLRARIMKFKYLSGDDQAESDHTLQSLKELVDRISPPNASEQELSEALWDLTTL # FAAPHTSVSSFELLQSGLVDGLLKFATDTDRKGTFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g401 ### # start gene g402 7 AUGUSTUS gene 2071679 2072512 0.88 - . g402 7 AUGUSTUS transcript 2071679 2072512 0.88 - . g402.t1 7 AUGUSTUS stop_codon 2071679 2071681 . - 0 transcript_id "g402.t1"; gene_id "g402"; 7 AUGUSTUS CDS 2071679 2072512 0.88 - 0 transcript_id "g402.t1"; gene_id "g402"; 7 AUGUSTUS start_codon 2072510 2072512 . - 0 transcript_id "g402.t1"; gene_id "g402"; # protein sequence = [MVAKAKVMAELESSQHDNEDINMIDPDIKPEESDHEEDNLAEPMEDVEEGQGQGEGSENVQEHDDDDDGDRHGHDHDE # DEDHHEDDSPPAQGGMPGGLDDAAAALAIFGDYRQFGSYMMSLSSRLKTMLNNIKSTADPTTRLVTLQELSELLSISTEDTLAGSFQVEAFVRELVKI # LGGRGADRDEDDDEGDEEEERDEDAALAAALAMSTGGTYTGDENLEAQVLACRCLANLMEALPGVAHTVVYHGAIPVLCSKLIEISYIDLAEQTLSVR # ARY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g402 ### # start gene g403 7 AUGUSTUS gene 2075927 2076493 0.59 - . g403 7 AUGUSTUS transcript 2075927 2076493 0.59 - . g403.t1 7 AUGUSTUS stop_codon 2075927 2075929 . - 0 transcript_id "g403.t1"; gene_id "g403"; 7 AUGUSTUS CDS 2075927 2076493 0.59 - 0 transcript_id "g403.t1"; gene_id "g403"; 7 AUGUSTUS start_codon 2076491 2076493 . - 0 transcript_id "g403.t1"; gene_id "g403"; # protein sequence = [MVQGQIYQSQNKFPAARASFAAGFKACPKEPILWILASRLEETDGKSIKARALLDKARQVNPSNELIWAEAVGVEERS # GGAAQAKAMLARGLQDCPTSGLLWTMSIWLEPRPQRKTRALDALKKSNDNPLIICTVARLFWAERKIEKARQWFQRAVPPRPDDSVDTGADIGDLWGW # WLKFERQHGTEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g403 ### # start gene g404 7 AUGUSTUS gene 2076619 2079022 0.31 - . g404 7 AUGUSTUS transcript 2076619 2079022 0.31 - . g404.t1 7 AUGUSTUS stop_codon 2076619 2076621 . - 0 transcript_id "g404.t1"; gene_id "g404"; 7 AUGUSTUS CDS 2076619 2077596 0.49 - 0 transcript_id "g404.t1"; gene_id "g404"; 7 AUGUSTUS CDS 2077770 2078066 0.95 - 0 transcript_id "g404.t1"; gene_id "g404"; 7 AUGUSTUS CDS 2078124 2078529 0.76 - 1 transcript_id "g404.t1"; gene_id "g404"; 7 AUGUSTUS CDS 2078603 2078776 0.93 - 1 transcript_id "g404.t1"; gene_id "g404"; 7 AUGUSTUS CDS 2078943 2079022 0.83 - 0 transcript_id "g404.t1"; gene_id "g404"; 7 AUGUSTUS start_codon 2079020 2079022 . - 0 transcript_id "g404.t1"; gene_id "g404"; # protein sequence = [MASNKPNKLAFLSMPAPASYVAGLGRGEAQARRGEEAEVDPEQFQDPDNEYGLFAGTAYEQDDEEADKIYEAVDAAMD # ARRKARREAQEQAQLAKHRAERPKIQQQFADLKRGLSAVTDEEWESIPEVGNLTKRKRPKYERTYAVSDSILAGDRSRGEYENSLDSLQQQVRIQVSW # ISHRDDSNLVAQTGGLVTPAEAGPTNFVEIGQARDKILSLKLDQVSGTSTSSGLSTSIDPKGYLTSLNSVVLKSDAEIGDIKRARMLFDSLIKSNPKH # APGWIAAACLEEHAGRMVAARKLIKQGCEQCSKNEDVWLEAARLHKGYVPSQIPVFWVELINRPALEHIPNSVRLWKETVNLESSASDARVLLSRAVE # VIPLSVELWLALAQLETLDKAKAVLNKARKAIPTSHEIWIAAGRLLEQEASMMGAEKTKAEKKKALDLVDKTIEAGVRELRRHGVLLTREQWLKEAEK # CETQGSVLTSESIVKATIAMDIEEEDRLDTWIDDAEGALSRNMVGTARAVLAYALKVFPDKKNLWIRAAGLEKAHGTSESLDAILTEAVKHCPQAEVL # WLMAAKERWLAGNVQGARDVLATAFDANKESEKIWLAAVKLEAENGHLDVARELLIRARSTADTERVYHPYLYLHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g404 ### # start gene g405 7 AUGUSTUS gene 2079547 2080860 0.69 + . g405 7 AUGUSTUS transcript 2079547 2080860 0.69 + . g405.t1 7 AUGUSTUS start_codon 2079547 2079549 . + 0 transcript_id "g405.t1"; gene_id "g405"; 7 AUGUSTUS CDS 2079547 2080860 0.69 + 0 transcript_id "g405.t1"; gene_id "g405"; 7 AUGUSTUS stop_codon 2080858 2080860 . + 0 transcript_id "g405.t1"; gene_id "g405"; # protein sequence = [MLVLQDFEALTPNLLARTVETVEGGGLIVLLLKSMNSLRQLYTMGMDVHARYRTESSGEVKPRFNERFILSLAACPDC # LFLDDELNVLPLSKGKDIEPLPEQNGKGTTRSQENAELRELKNSLEGSVPAGPLVALAKTTDQARALLTFVNSLITPSDPSSSSNPSSSLSSALNTTT # TLLAARGRGKSSALGLALAAAVHTGYANIFLTSPAPENLQTAWEFLFKGLDALGWEEHLDYDILQATHDLSSFGNGVDEAAESNPTLGKGDGGKKPIV # RVNIFRNPTHRQTIQYIDPRDAHVLGQAELLIIDEAAAIPLPVVRNLLGPAMAKGSASAGGYAVWLASTVNGYEGTGRSLSLKLIQQLRDNSSSGPPT # KGDSGKGNSSHGNRTLNEVKLSTPIRYAPGDEVEKWLNTLLCLDVSSSSGKILIVSSISEADAIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g405 ### # start gene g406 7 AUGUSTUS gene 2082511 2083074 0.38 + . g406 7 AUGUSTUS transcript 2082511 2083074 0.38 + . g406.t1 7 AUGUSTUS start_codon 2082511 2082513 . + 0 transcript_id "g406.t1"; gene_id "g406"; 7 AUGUSTUS CDS 2082511 2082770 0.38 + 0 transcript_id "g406.t1"; gene_id "g406"; 7 AUGUSTUS CDS 2082870 2083074 0.73 + 1 transcript_id "g406.t1"; gene_id "g406"; 7 AUGUSTUS stop_codon 2083072 2083074 . + 0 transcript_id "g406.t1"; gene_id "g406"; # protein sequence = [MLVKLILKITKRLKDVQKEGITQTMPDHSIAVSLPSNDRPAASEGETWKNVSATVEAELEAAGAEEKDAMKKRERQRE # MINSLDLRKYAIDNASMDWSTAETQVAKIAGTASKKSHQTVLSVKSIGSKRKASDIGDDGGGGVKKPTRRGKKAKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g406 ### # start gene g407 7 AUGUSTUS gene 2091176 2092465 0.68 - . g407 7 AUGUSTUS transcript 2091176 2092465 0.68 - . g407.t1 7 AUGUSTUS stop_codon 2091176 2091178 . - 0 transcript_id "g407.t1"; gene_id "g407"; 7 AUGUSTUS CDS 2091176 2091406 0.96 - 0 transcript_id "g407.t1"; gene_id "g407"; 7 AUGUSTUS CDS 2091461 2091574 0.72 - 0 transcript_id "g407.t1"; gene_id "g407"; 7 AUGUSTUS CDS 2091683 2091930 0.97 - 2 transcript_id "g407.t1"; gene_id "g407"; 7 AUGUSTUS CDS 2092093 2092465 0.97 - 0 transcript_id "g407.t1"; gene_id "g407"; 7 AUGUSTUS start_codon 2092463 2092465 . - 0 transcript_id "g407.t1"; gene_id "g407"; # protein sequence = [MKLQPFTVLLAITAANATKINPLHIKRQATASSSVSTATSATVAASSVSSSSGTSATSSSTTGISTGTTTAVGAPASA # TWGTSYPPLSQISSGMPSEVTQAVTTTYTAGASPTYYSGADPLPTPCSSEVQEWMEELDGWDIPDLSPTVDGTCVSDPANVANASARGWWTCGGYTRD # TDITVCPGKPMTWGTRYGQIHFHQSFGLYFINIKATFFDVGSRCIENPNVLIDEYMSGHEIAVHTWSHPHLTTLTTEQIVAELGWTRKAIKTILGVTP # TTMRPPYGDIDDRVRAISLAMGMVPIIWTRTPSGVSFDTFGMFHGSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g407 ### # start gene g408 7 AUGUSTUS gene 2094136 2094947 0.58 - . g408 7 AUGUSTUS transcript 2094136 2094947 0.58 - . g408.t1 7 AUGUSTUS stop_codon 2094136 2094138 . - 0 transcript_id "g408.t1"; gene_id "g408"; 7 AUGUSTUS CDS 2094136 2094753 0.83 - 0 transcript_id "g408.t1"; gene_id "g408"; 7 AUGUSTUS CDS 2094822 2094947 0.58 - 0 transcript_id "g408.t1"; gene_id "g408"; 7 AUGUSTUS start_codon 2094945 2094947 . - 0 transcript_id "g408.t1"; gene_id "g408"; # protein sequence = [MIYKGPLNKRDGELQVYLFDHALLFTKVVKTKQHEFYKVYRPPIPLELLLVSASDDASPNGNGHNTLRGNRRQGLVKK # NSFSRDSRSSPNFTVPPVHVKTDAKGQFWINFVHLGRKYYNLVLWANSNLNQKKWLENIYKQQQAIKERSNIFETVSLSEGFFNNPNKVNCAAPFSKW # MIRFIALEESGLIGSTYLGGGRKIAYGTDDGVYFSDLREVNKDPVKVLGLMDVTQIDVLEDYQLLIVLSGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g408 ### # start gene g409 7 AUGUSTUS gene 2096505 2097721 0.44 - . g409 7 AUGUSTUS transcript 2096505 2097721 0.44 - . g409.t1 7 AUGUSTUS stop_codon 2096505 2096507 . - 0 transcript_id "g409.t1"; gene_id "g409"; 7 AUGUSTUS CDS 2096505 2097055 0.85 - 2 transcript_id "g409.t1"; gene_id "g409"; 7 AUGUSTUS CDS 2097106 2097721 0.49 - 0 transcript_id "g409.t1"; gene_id "g409"; 7 AUGUSTUS start_codon 2097719 2097721 . - 0 transcript_id "g409.t1"; gene_id "g409"; # protein sequence = [MGPRQPPAPDKRNAAYESIFGRPSASHHHQSPVPTVQPPYPPQTNYYYQQQPQSYQQNAVDRRTSFQQYHHSPSLYTN # PTYNSSNIPPNAYPRYTPSSYNYTPSLAPPSVSIRARSIHSSTNGPGIIAPKPEEPPDPSLEALTKSGLTPAQAYQAQIYRNSTPSSLPAVESDDGRL # GIDFAAESNSSDQSTDDSSELPWARKESPRTMSSLPQRNSTTNISHNRHSHASTNHSLHVDTASAQSIRSSVASTSPSSFSLADNNSLSMETATTSTL # VGTSTGRRSSESAHIHRVTGNARREKSAQDRSMSMSAATNSMRAVLASRVPIPGLPEGASLMVIYEACSTPIDLIHRAPFSHLYQNSHTQNANSLPSV # AFTSRGSVSGPHSTRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g409 ### # start gene g410 7 AUGUSTUS gene 2098327 2100636 0.55 + . g410 7 AUGUSTUS transcript 2098327 2100636 0.55 + . g410.t1 7 AUGUSTUS start_codon 2098327 2098329 . + 0 transcript_id "g410.t1"; gene_id "g410"; 7 AUGUSTUS CDS 2098327 2098650 0.99 + 0 transcript_id "g410.t1"; gene_id "g410"; 7 AUGUSTUS CDS 2099166 2099309 0.56 + 0 transcript_id "g410.t1"; gene_id "g410"; 7 AUGUSTUS CDS 2099377 2100636 1 + 0 transcript_id "g410.t1"; gene_id "g410"; 7 AUGUSTUS stop_codon 2100634 2100636 . + 0 transcript_id "g410.t1"; gene_id "g410"; # protein sequence = [MHITRQRNTHWKTFAPSALPGSETFAAQSSLPKLPVPELSGTLSYLKESLKPIAWNEAEYRAVVSKIDEFGARIGPEL # QKRLLKRQAETDHWLERWWDDGAYLGYRESRGELTQNHVVEFINQAHPSQIKYIYQNTTQSYSGVGILTASNRDVWAKDYAELVTSEHNSDILDTIHS # SAFIICLEEGAPSSPEQNSRVLWHGHFSNGQAVGLQNRWVDKPCQFIVYDNMYAGFMGEHSIMDGTPTVRLCDEVLDALASPSFDHGVKPSGQPAIPP # TPLDWEISAATAQAIMTANAAALDLINSQVLSYYLTSYGKDEIKKFGVSPDSWAQMIIQLAYRRTIGNENRKGGTYEAATTRKFYKGRTEAIRVVTSE # SDAWVESMDNPNASNATRKELFNLATKKHVALAKLCGAGQGIDRHILGMLLLPVFEDISRNSAGLKKLLAESEETPALFSDPVFTRSSYWVLSTSAIF # SKHFNAYGWGEVVPDGFGVAYMTGHNGLFCTLAYFTVITDRLDFLNFIPQIVCSTLLHLGRKCLTPNLLMRLLQQLGTYTTYTKPLARRKRNYRYIDR # ITCSCCI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g410 ### # start gene g411 7 AUGUSTUS gene 2106924 2107220 0.72 - . g411 7 AUGUSTUS transcript 2106924 2107220 0.72 - . g411.t1 7 AUGUSTUS stop_codon 2106924 2106926 . - 0 transcript_id "g411.t1"; gene_id "g411"; 7 AUGUSTUS CDS 2106924 2107220 0.72 - 0 transcript_id "g411.t1"; gene_id "g411"; 7 AUGUSTUS start_codon 2107218 2107220 . - 0 transcript_id "g411.t1"; gene_id "g411"; # protein sequence = [MLFKSLAALASLSLLSLASAWEIFMYETTAGGDPENCNGGGTTVSGTGSVCQLAAPNTVAMQVINDPEGCECKSQPRY # HVAYFIDDGLYVTVEVFTGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g411 ### # start gene g412 7 AUGUSTUS gene 2108708 2109055 0.24 - . g412 7 AUGUSTUS transcript 2108708 2109055 0.24 - . g412.t1 7 AUGUSTUS stop_codon 2108708 2108710 . - 0 transcript_id "g412.t1"; gene_id "g412"; 7 AUGUSTUS CDS 2108708 2109055 0.24 - 0 transcript_id "g412.t1"; gene_id "g412"; 7 AUGUSTUS start_codon 2109053 2109055 . - 0 transcript_id "g412.t1"; gene_id "g412"; # protein sequence = [MQAKIFLQQFVFGTNTTGLVTGSTVTGGEDPELAEDVMPGSDPIFYGSLSTESSTIWPEATRAAWTSFIQTETASVTT # TPISTSIAVSSTSGAVRRTVPCYIFTGLTMLLYVFLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g412 ### # start gene g413 7 AUGUSTUS gene 2113148 2114362 0.33 - . g413 7 AUGUSTUS transcript 2113148 2114362 0.33 - . g413.t1 7 AUGUSTUS stop_codon 2113148 2113150 . - 0 transcript_id "g413.t1"; gene_id "g413"; 7 AUGUSTUS CDS 2113148 2114362 0.33 - 0 transcript_id "g413.t1"; gene_id "g413"; 7 AUGUSTUS start_codon 2114360 2114362 . - 0 transcript_id "g413.t1"; gene_id "g413"; # protein sequence = [MTPFESLLWNVWLPKVRTSFNNEWSAHDPQPAIRLYEAWSTFLPPFIRDNVLDQLILPKVQKAVADWNPKQLDKQVSL # QTIVFPWLPHVGLRLEDFVGDARRKVKSLLRHWVVGDDLPEDLKAWKDVSVYSSECFCDSELKYSIMQVFDANDWDSMLLKYIVPKLGTTLRSDLRIN # PRNQSMEPIHYVLQWSSILRPSILSQLFETEFFPKWIEVLHLWLIQPKVSFEEVAQWYSFWKGSFPENIQSVSGISRGFTRGLQLMNQAIELGPDAPS # QLPKPDYRAEQAQHALTNSPYSRLSNNGGRAKTNASSSLRPSARTQEITFRSIVEEYTASHDLLFVPTGRAHEKSRMPLFRITPSMDGKGGLLVYILD # DAVWAALEGAGGPAEEYRAISLDEVVLRATKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g413 ### # start gene g414 7 AUGUSTUS gene 2114971 2116359 0.73 - . g414 7 AUGUSTUS transcript 2114971 2116359 0.73 - . g414.t1 7 AUGUSTUS stop_codon 2114971 2114973 . - 0 transcript_id "g414.t1"; gene_id "g414"; 7 AUGUSTUS CDS 2114971 2116359 0.73 - 0 transcript_id "g414.t1"; gene_id "g414"; 7 AUGUSTUS start_codon 2116357 2116359 . - 0 transcript_id "g414.t1"; gene_id "g414"; # protein sequence = [MARRKRILEDDDDSDSYNGSEAEDLPMNESADVREERELFENPYQRKRRKRNGKEEALYGIFAEDIDEETSRGSRDPK # KNKRSDWTKAPAFVSGAKKIDFEEETESNVEKDEEEDENEHAEEEESSEGEGEGEGAEESSDNDSDPSRRPSPRIREEDEDDDEDNPIAATSISGIGS # DRKAGIGIGFSKAGATSSTIKASSFTSSKGGIGSRTSVTHTPSSDPPSAFTSQTRSASFVRDSTPTVRPAAPLSYAEQAHFAKLSGSFGARILGKMGW # KAGQGLGATGEGIVTPIESKMRPEKSGIAFRGFKEKTEQSKMEARRRGEVISDDEDPKIRKAKKKEREVKEKKAEAWRKPRKVKTKIQHKTYEEILAE # AGTETSTSAGIGQIIDATGAVVSENISGSVSIHSDLHSSLEKSVLWPTSQSTHGLPQWTLHESPKYGIMFVSSRNRARPISMVWHGKVNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g414 ### # start gene g415 7 AUGUSTUS gene 2127323 2127667 0.91 + . g415 7 AUGUSTUS transcript 2127323 2127667 0.91 + . g415.t1 7 AUGUSTUS start_codon 2127323 2127325 . + 0 transcript_id "g415.t1"; gene_id "g415"; 7 AUGUSTUS CDS 2127323 2127667 0.91 + 0 transcript_id "g415.t1"; gene_id "g415"; 7 AUGUSTUS stop_codon 2127665 2127667 . + 0 transcript_id "g415.t1"; gene_id "g415"; # protein sequence = [MTAKDFDSLYPSSGKKRAHSPASDDESSEDESTSQAPPPRKKSQRLSAKKDVSPPVFDIAWHDNDVEEAGAVEVDNTS # GDDYGSQDRAHQSSHLYLRMYGILTVNSSTSQQTSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g415 ### # start gene g416 7 AUGUSTUS gene 2127680 2128207 0.81 - . g416 7 AUGUSTUS transcript 2127680 2128207 0.81 - . g416.t1 7 AUGUSTUS stop_codon 2127680 2127682 . - 0 transcript_id "g416.t1"; gene_id "g416"; 7 AUGUSTUS CDS 2127680 2128207 0.81 - 0 transcript_id "g416.t1"; gene_id "g416"; 7 AUGUSTUS start_codon 2128205 2128207 . - 0 transcript_id "g416.t1"; gene_id "g416"; # protein sequence = [MDDCEGLDTDTIEHLYGTDGPEVLRPPGHTGAGYLNDEGESTPSNASSDSEGDNDSDVEGFDTRIDNVAQASSRQFLP # KPVKTPRHICPLTNEEMAIFNEALQLAVAQGIVPVGYGICPEEWKDNHYPSIEIIQTGRKGAKEISVQLPDFIWRPRAHLWTLGLNILEHIVENRTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g416 ### # start gene g417 7 AUGUSTUS gene 2129794 2130495 0.47 + . g417 7 AUGUSTUS transcript 2129794 2130495 0.47 + . g417.t1 7 AUGUSTUS start_codon 2129794 2129796 . + 0 transcript_id "g417.t1"; gene_id "g417"; 7 AUGUSTUS CDS 2129794 2129913 0.77 + 0 transcript_id "g417.t1"; gene_id "g417"; 7 AUGUSTUS CDS 2129967 2130154 0.76 + 0 transcript_id "g417.t1"; gene_id "g417"; 7 AUGUSTUS CDS 2130204 2130495 0.48 + 1 transcript_id "g417.t1"; gene_id "g417"; 7 AUGUSTUS stop_codon 2130493 2130495 . + 0 transcript_id "g417.t1"; gene_id "g417"; # protein sequence = [MDIDNGPISGDDLPEQGDKSPAVYKRHPLYYFEDANLFLKAQDSGFIYAVYKGMMAKFSETFEACFTFPQPQGKEEGT # IFDNPILLPIDAAAFDVLCSFIFHLGWKSQSNRSTDELLALGRISQFLQCPDALKFAIAGLRFHSYDFNGGKKMFYASTFGVPKWGYSATREILTSVY # GVGGCCSGVLSEFTSMSKLILPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g417 ### # start gene g418 7 AUGUSTUS gene 2133412 2133894 0.91 + . g418 7 AUGUSTUS transcript 2133412 2133894 0.91 + . g418.t1 7 AUGUSTUS start_codon 2133412 2133414 . + 0 transcript_id "g418.t1"; gene_id "g418"; 7 AUGUSTUS CDS 2133412 2133894 0.91 + 0 transcript_id "g418.t1"; gene_id "g418"; 7 AUGUSTUS stop_codon 2133892 2133894 . + 0 transcript_id "g418.t1"; gene_id "g418"; # protein sequence = [MGQSVSTSKSTGGAQCPVDHNSLKPASCPVDHNSLKTSFQTPAQCPVDHQNKSPSSSSSSTQKPAECPVDHSSLNQMP # TLSQQPSPNQTITLPTARTESSILRDGSTKWDYPSPQQFYNALVRKGWETPEEHIETMVEIHNFLNEQAWQEVLKWEKRATE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g418 ### # start gene g419 7 AUGUSTUS gene 2148147 2148554 0.6 - . g419 7 AUGUSTUS transcript 2148147 2148554 0.6 - . g419.t1 7 AUGUSTUS stop_codon 2148147 2148149 . - 0 transcript_id "g419.t1"; gene_id "g419"; 7 AUGUSTUS CDS 2148147 2148554 0.6 - 0 transcript_id "g419.t1"; gene_id "g419"; 7 AUGUSTUS start_codon 2148552 2148554 . - 0 transcript_id "g419.t1"; gene_id "g419"; # protein sequence = [MLLQPNATDWLAAEDKEITGLFELGVFEATERCPKDKFPIGLKMVYDLKLDGMKKARLVAQGFTQQPEDYGNVHAPIT # QMVSYQIVMAWTAKMNLELFLFDVKQVFLNAPLVEEIYIKQIPGCPIPDQPSAVYCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g419 ### # start gene g420 7 AUGUSTUS gene 2152632 2152940 0.39 + . g420 7 AUGUSTUS transcript 2152632 2152940 0.39 + . g420.t1 7 AUGUSTUS start_codon 2152632 2152634 . + 0 transcript_id "g420.t1"; gene_id "g420"; 7 AUGUSTUS CDS 2152632 2152940 0.39 + 0 transcript_id "g420.t1"; gene_id "g420"; 7 AUGUSTUS stop_codon 2152938 2152940 . + 0 transcript_id "g420.t1"; gene_id "g420"; # protein sequence = [MSNHHSSHFNIIVNDYMSTLSGGCFAKKNQVLWVIKTTILTWENRMAPHKVKNIRLGGAKEFHGSEATSYFEEKGISV # QKTAAYSQNGKAEQWVHVKIIYTM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g420 ### # start gene g421 7 AUGUSTUS gene 2155124 2156593 1 - . g421 7 AUGUSTUS transcript 2155124 2156593 1 - . g421.t1 7 AUGUSTUS stop_codon 2155124 2155126 . - 0 transcript_id "g421.t1"; gene_id "g421"; 7 AUGUSTUS CDS 2155124 2156593 1 - 0 transcript_id "g421.t1"; gene_id "g421"; 7 AUGUSTUS start_codon 2156591 2156593 . - 0 transcript_id "g421.t1"; gene_id "g421"; # protein sequence = [MDIEALHQAIILTLPKDPSSVVGLELAKDPSNECWGLGSDGLLCLDDRIYVSNHGDLHLQVVRYFHDHPLSGHFGQNC # TLEAVHCQYTWPKVRDFVHDYVSSCTTCGRNKPHRHQPYGLLKPLPVLVQPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTFDTITSEQLA # ELFVIHVFSKHGVPNHVTSDCGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTEHVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGI # TPFFANKGYHPNITVRPKVNMKSDLARDFVVNLDELHVFLQEEILLAQSRYKEQADGKRISHPEFPIGSEVFVLAKHIRSTHPTEKFSEKYLGPFKVI # SQPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNCTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKCCPLRYYIWWAGYEGTDDEFSWVAADEL # HADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g421 ### # start gene g422 7 AUGUSTUS gene 2157445 2158698 0.91 - . g422 7 AUGUSTUS transcript 2157445 2158698 0.91 - . g422.t1 7 AUGUSTUS stop_codon 2157445 2157447 . - 0 transcript_id "g422.t1"; gene_id "g422"; 7 AUGUSTUS CDS 2157445 2158698 0.91 - 0 transcript_id "g422.t1"; gene_id "g422"; 7 AUGUSTUS start_codon 2158696 2158698 . - 0 transcript_id "g422.t1"; gene_id "g422"; # protein sequence = [MTKISPVNLRLFDGSLSSKPITNMANIAIRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNT # SHFDSPQMSVPSATNTVDAKVVVLLLEPLPSVSLTILETPPGDSLCSRSRTLQAKPLLSKFPFEPIYSYPMVSQFAAQLETPEVDIALVSAAVFNRAC # KDAGMEPILLRAIHSEVVACAADCSSTAPTVPPLPHSIPAEYAEFADIFDKIAADALPKHRPYDLKIDLKKCASLPVGRIYPLSEKELVALKDFIDKQ # LATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYIKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKV # MPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g422 ### # start gene g423 7 AUGUSTUS gene 2158901 2159611 0.84 - . g423 7 AUGUSTUS transcript 2158901 2159611 0.84 - . g423.t1 7 AUGUSTUS stop_codon 2158901 2158903 . - 0 transcript_id "g423.t1"; gene_id "g423"; 7 AUGUSTUS CDS 2158901 2159611 0.84 - 0 transcript_id "g423.t1"; gene_id "g423"; 7 AUGUSTUS start_codon 2159609 2159611 . - 0 transcript_id "g423.t1"; gene_id "g423"; # protein sequence = [MEARGMDLTGNLKMKETENIRKYNIRFNTLAANTNWDSAALKWAYGRGLAERIKDEMACLPELATLADYRQEVLHIDN # RYWKREETKKREAGKPFIARNPKKGFSDFKAGPTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNGKPQNSSNSGQPGGQCPAFNHLGADGKVLPSERER # RMRKNLCLFCGGKHQIADCNKRKAVLPKLKKPPKQLLKLLKRNWKTSPQLLFPGTKWELR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g423 ### # start gene g424 7 AUGUSTUS gene 2160226 2161120 0.74 - . g424 7 AUGUSTUS transcript 2160226 2161120 0.74 - . g424.t1 7 AUGUSTUS stop_codon 2160226 2160228 . - 0 transcript_id "g424.t1"; gene_id "g424"; 7 AUGUSTUS CDS 2160226 2160761 0.81 - 2 transcript_id "g424.t1"; gene_id "g424"; 7 AUGUSTUS CDS 2160871 2161120 0.84 - 0 transcript_id "g424.t1"; gene_id "g424"; 7 AUGUSTUS start_codon 2161118 2161120 . - 0 transcript_id "g424.t1"; gene_id "g424"; # protein sequence = [MPPRTRAQSRANSEENTFFTTAQSFAPFSESISAIGQPRRRNHGPATVPTTSTLPANMEEEQQFEYSTLYTGDGQPVQ # VLTPRQSPHDPPRHFDLYAGDHDDQDPPVDPDDPGADNDNDNLDDDSGGLQRGEPGDPSGPGGPGGPCSPISPDIPNEQCAMLDLLSGFKGSIETLGS # VLAALSRPSDSSESKSKVKEPEVFNGSDPQKLKTFFVNLALVFNDRSKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g424 ### # start gene g425 7 AUGUSTUS gene 2161946 2162413 0.92 + . g425 7 AUGUSTUS transcript 2161946 2162413 0.92 + . g425.t1 7 AUGUSTUS start_codon 2161946 2161948 . + 0 transcript_id "g425.t1"; gene_id "g425"; 7 AUGUSTUS CDS 2161946 2162413 0.92 + 0 transcript_id "g425.t1"; gene_id "g425"; 7 AUGUSTUS stop_codon 2162411 2162413 . + 0 transcript_id "g425.t1"; gene_id "g425"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSFSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEAHSEIKNLRQSKGQTVAVRPGSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g425 ### # start gene g426 7 AUGUSTUS gene 2163408 2164187 0.56 + . g426 7 AUGUSTUS transcript 2163408 2164187 0.56 + . g426.t1 7 AUGUSTUS start_codon 2163408 2163410 . + 0 transcript_id "g426.t1"; gene_id "g426"; 7 AUGUSTUS CDS 2163408 2164187 0.56 + 0 transcript_id "g426.t1"; gene_id "g426"; 7 AUGUSTUS stop_codon 2164185 2164187 . + 0 transcript_id "g426.t1"; gene_id "g426"; # protein sequence = [MATCGGYWDWSGCSQGMTVAEFAQKFKDIGDWTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAIS # VDVYLHNPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPHRETTCRYCGRRGHLEAVCQDKFMGLG # QDQGRCQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVPATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g426 ### # start gene g427 7 AUGUSTUS gene 2164556 2165896 0.65 + . g427 7 AUGUSTUS transcript 2164556 2165896 0.65 + . g427.t1 7 AUGUSTUS start_codon 2164556 2164558 . + 0 transcript_id "g427.t1"; gene_id "g427"; 7 AUGUSTUS CDS 2164556 2165896 0.65 + 0 transcript_id "g427.t1"; gene_id "g427"; 7 AUGUSTUS stop_codon 2165894 2165896 . + 0 transcript_id "g427.t1"; gene_id "g427"; # protein sequence = [MDFLITNLGGEDIILGLPWLQKVNPEIDWEKGRLSVKPPRVAIEEVPDKEILYSHLAATNTESPILEPLNLEPPAEPP # HIEVPLEATLEESKSAVVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDNPVKTFEEMVPEQYHDFKKVFSESASEQLP # AHQPWDHAIDLIPGAPATMCTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLCFVQDYRKLNEYTVKNRYPLPLVADIISQL # QGARYFTKFDVRWGYNNIWIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADFIAAGKVAVYLDDILIFNNDLKEHQQVVWEVLTRL # EKHDLYLWPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPIPTDLREWRGFLGFANFYRHFIRNFARIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g427 ### # start gene g428 7 AUGUSTUS gene 2168710 2169742 0.54 + . g428 7 AUGUSTUS transcript 2168710 2169742 0.54 + . g428.t1 7 AUGUSTUS start_codon 2168710 2168712 . + 0 transcript_id "g428.t1"; gene_id "g428"; 7 AUGUSTUS CDS 2168710 2168717 0.54 + 0 transcript_id "g428.t1"; gene_id "g428"; 7 AUGUSTUS CDS 2169490 2169742 0.54 + 1 transcript_id "g428.t1"; gene_id "g428"; 7 AUGUSTUS stop_codon 2169740 2169742 . + 0 transcript_id "g428.t1"; gene_id "g428"; # protein sequence = [MKGLPNLFISHLVLNLQIFSKPGNTVISQRTKTSVSSLNFASSQMLGTIGAPLDGTFFAEKENEEEENGVKIEMEAIE # EHSEAKEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g428 ### # start gene g429 7 AUGUSTUS gene 2174658 2175284 0.25 + . g429 7 AUGUSTUS transcript 2174658 2175284 0.25 + . g429.t1 7 AUGUSTUS start_codon 2174658 2174660 . + 0 transcript_id "g429.t1"; gene_id "g429"; 7 AUGUSTUS CDS 2174658 2175284 0.25 + 0 transcript_id "g429.t1"; gene_id "g429"; 7 AUGUSTUS stop_codon 2175282 2175284 . + 0 transcript_id "g429.t1"; gene_id "g429"; # protein sequence = [MEWWNDIKMLCARYLVASEQVERSGPVEAAVRAVGYPEEDEDEDEDERSLSPSASDEEEEEDSEFEDTGGVTPYHTVA # VGGGSGGGGGDHHPVTSGSEDDVDHSDEELYANANEEQEDDDEALPSYSHLHGGRGESDLKGDKVMPGGVGEVGENGFPVSWVLFSFSLFFLSSSPSS # LLIPHPFPPLPSPHLLPYPYPYLHTNLTNQPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g429 ### # start gene g430 7 AUGUSTUS gene 2182582 2183118 0.93 - . g430 7 AUGUSTUS transcript 2182582 2183118 0.93 - . g430.t1 7 AUGUSTUS stop_codon 2182582 2182584 . - 0 transcript_id "g430.t1"; gene_id "g430"; 7 AUGUSTUS CDS 2182582 2183118 0.93 - 0 transcript_id "g430.t1"; gene_id "g430"; 7 AUGUSTUS start_codon 2183116 2183118 . - 0 transcript_id "g430.t1"; gene_id "g430"; # protein sequence = [MNQTATNRDSGFRTEPIVGGTAGGTSPTWKSAVRGNRTGVFVIISRNPPVSKILGRAKATLTGKRKIFRSCRDVDANQ # PNLLYLDSLLSALKKMEDEEGIADVDLDLSLDGEWLPMMKEMIITAGSAAGQKVTGQDWERYKKVLEEPRFKFEPQSPPTKAWEEAAEKRILGDGFKL # EK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g430 ### # start gene g431 7 AUGUSTUS gene 2185225 2185851 0.67 - . g431 7 AUGUSTUS transcript 2185225 2185851 0.67 - . g431.t1 7 AUGUSTUS stop_codon 2185225 2185227 . - 0 transcript_id "g431.t1"; gene_id "g431"; 7 AUGUSTUS CDS 2185225 2185851 0.67 - 0 transcript_id "g431.t1"; gene_id "g431"; 7 AUGUSTUS start_codon 2185849 2185851 . - 0 transcript_id "g431.t1"; gene_id "g431"; # protein sequence = [MTFGYGAGAMPDGYSDLVLETQEAEDCLIPMGITSENVAADYNISREAQDTFAALSFQKAAAAQKAHLFDPEILPIRV # KQVSPDGGKQFLVDADDGIRDGVTVQSLGKLKPAFKKDGSTHAGNASQVSDGAAAVLLARRSVAKKLGLPIVGKFVGAQAVGVPPRIMGVGPAYAIPH # VSKKNPYLLTSPTTKTRPTPKILAYNSYHLGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g431 ### # start gene g432 7 AUGUSTUS gene 2187547 2188954 0.57 + . g432 7 AUGUSTUS transcript 2187547 2188954 0.57 + . g432.t1 7 AUGUSTUS start_codon 2187547 2187549 . + 0 transcript_id "g432.t1"; gene_id "g432"; 7 AUGUSTUS CDS 2187547 2187785 0.57 + 0 transcript_id "g432.t1"; gene_id "g432"; 7 AUGUSTUS CDS 2187838 2188954 0.98 + 1 transcript_id "g432.t1"; gene_id "g432"; 7 AUGUSTUS stop_codon 2188952 2188954 . + 0 transcript_id "g432.t1"; gene_id "g432"; # protein sequence = [MEFYLVDDLECDLIVFHPYRTLLALCNKDFGNSNSSSDSPAEEAEAGELGTGIGADDGPRYWGTGQGQLELSEGGLQT # AWFIINDTYRSELCLIYPPHLIAVTAIYLTLVLHTPTQNSIAHLLPYSPAFNSDSSNSGEPSQTTPHPRRSSRTSDSSSKHANQQDPIDFLANLNVSL # SAIATIAQEIISMYSLWNRYREDVTAEEMRNMNANANMGKRNAAGNFKSTMKGARVSQSMQSQKNLPRNVSASAATTSDMEWQLERQRFHGAIQLQAH # LKKQGYASAPLPPQHMINGPYFMPQHPQQMQHRYPPALVPVSLGSLSPTKRSATGLRSRSGSRAGTPNSVGGGGGRMEDLFGDGTSSGSPASHTSHAA # GVGPRAGSTPLGNTPGSIGGADDTANSPINPWPFGQGRIVTAIFLSSMLNTMREARMNDMAHPSSGRPVVVNRMLERTW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g432 ### # start gene g433 7 AUGUSTUS gene 2191687 2192115 0.69 + . g433 7 AUGUSTUS transcript 2191687 2192115 0.69 + . g433.t1 7 AUGUSTUS start_codon 2191687 2191689 . + 0 transcript_id "g433.t1"; gene_id "g433"; 7 AUGUSTUS CDS 2191687 2192115 0.69 + 0 transcript_id "g433.t1"; gene_id "g433"; 7 AUGUSTUS stop_codon 2192113 2192115 . + 0 transcript_id "g433.t1"; gene_id "g433"; # protein sequence = [MYTTIAFITFITFVVGSNSFYPTSDAACVFSLIPRSTANSLIQQELQILSIAFNLIIIRISAHPSGSDDHSTSVQSAP # QTFPLRKFSSAPKSTNESTQIESDPYRTGMNKPQQESFLEVEEGNWAQSLTVKPQALDMEITDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g433 ### # start gene g434 7 AUGUSTUS gene 2197616 2199371 0.14 - . g434 7 AUGUSTUS transcript 2197616 2199371 0.14 - . g434.t1 7 AUGUSTUS stop_codon 2197616 2197618 . - 0 transcript_id "g434.t1"; gene_id "g434"; 7 AUGUSTUS CDS 2197616 2198197 0.69 - 0 transcript_id "g434.t1"; gene_id "g434"; 7 AUGUSTUS CDS 2198310 2199371 0.19 - 0 transcript_id "g434.t1"; gene_id "g434"; 7 AUGUSTUS start_codon 2199369 2199371 . - 0 transcript_id "g434.t1"; gene_id "g434"; # protein sequence = [MDEDGLETVTEISEDGAVVNVTQPVPARQQPTPLLTPEEGDIVDEKSMVLDIGEDTLESGLKSAVPIRLGPKKDIFTL # RLSTGQKDYGTSGYTSTPVSWESRIEEAEKTALTNPESAVGGLLKEHDVLYCEFDENMKSYYFGEERSFPKYEHALWEIWDEYLHPEYQDSVKSAASK # SSRGISLSDCLDEFTKEEQLGADDLWYCPQCKKHQQATKKFDLWSTPDVLVVHLKRFSNSRMLRDKIDAFVDFPILGLDMNERVNERRVISSLERMGV # DTDSVELLGRGSEGGSGPTSEPLIYDLFAVDEHLGGLGGGHYRAYAFNHMNNKWYHFDDSFVSESTADNAVVRLDWCLFVVLRSPTQIVSSTSDDETN # DAPSDVIGVSPMHTDIQLPTPPSEVDTLPSYLNDSPTSSLGAGFTMTNWQSSQSSHFRSGVPTDDEGEYEQSPFLGIFNDVDISSVLPPSSLADSSPS # SSVGVEPDFDTDLRSDDLNDLDGEGEDDDDEGPWSSEARARSMTLETEGEVRETSPAWSVSAHSASQRSSEVASPDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g434 ### # start gene g435 7 AUGUSTUS gene 2200126 2201391 0.46 - . g435 7 AUGUSTUS transcript 2200126 2201391 0.46 - . g435.t1 7 AUGUSTUS stop_codon 2200126 2200128 . - 0 transcript_id "g435.t1"; gene_id "g435"; 7 AUGUSTUS CDS 2200126 2200984 0.61 - 1 transcript_id "g435.t1"; gene_id "g435"; 7 AUGUSTUS CDS 2201075 2201391 0.46 - 0 transcript_id "g435.t1"; gene_id "g435"; 7 AUGUSTUS start_codon 2201389 2201391 . - 0 transcript_id "g435.t1"; gene_id "g435"; # protein sequence = [MSKFSAIELLDTTINGSKTLEEALFQSQDSFALEFQDITTREWLVKSEIEETTPEPLFKSNDAFFNRMSGASSSSLFS # NSQSNGDARAEVNEKLSVVSKKEKPKEKGNTCFMNSAIQCLGHQKELTEYFLTGVYSRELNPDNPLGMGGAIAEGFGALLTRMWAGSELAHTYGALDK # LREGSGGMGAKNKVSKFFKNTSNFSNNFGGSGDGATLNPSATSYSPRDFKSQLSRFAPQFSGYQQHDSQELVAFLLDGLHEDLNRVLKKPYVEKPDWF # GARPPVLHPFRERRTAEIDGEEEDKDEYMRAKEEYEAKEREIYVQEHGWNKDLEDNKEMLRFARESWEGYKKRNDSVIVDLFQGQYRSTLVCPECQKV # SQFFHIQQLHVHGFHIRSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g435 ### # start gene g436 7 AUGUSTUS gene 2202848 2203184 0.32 - . g436 7 AUGUSTUS transcript 2202848 2203184 0.32 - . g436.t1 7 AUGUSTUS stop_codon 2202848 2202850 . - 0 transcript_id "g436.t1"; gene_id "g436"; 7 AUGUSTUS CDS 2202848 2203024 0.32 - 0 transcript_id "g436.t1"; gene_id "g436"; 7 AUGUSTUS CDS 2203182 2203184 0.96 - 0 transcript_id "g436.t1"; gene_id "g436"; 7 AUGUSTUS start_codon 2203182 2203184 . - 0 transcript_id "g436.t1"; gene_id "g436"; # protein sequence = [MDDNAPLVRHDDGTYDVMSVISVSGETPADVGAFVETWESQTISGIVAQWFVGAADCVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g436 ### # start gene g437 7 AUGUSTUS gene 2204496 2205119 0.75 - . g437 7 AUGUSTUS transcript 2204496 2205119 0.75 - . g437.t1 7 AUGUSTUS stop_codon 2204496 2204498 . - 0 transcript_id "g437.t1"; gene_id "g437"; 7 AUGUSTUS CDS 2204496 2205119 0.75 - 0 transcript_id "g437.t1"; gene_id "g437"; 7 AUGUSTUS start_codon 2205117 2205119 . - 0 transcript_id "g437.t1"; gene_id "g437"; # protein sequence = [MYQHDPSKIAICWNFLQENCPNTADTCNLSHDPTPERTPLCLHFLNKGRCTRPNCLFPHVNVGARHGVCRDFAVLGYC # GKGLDCDKQHVRECPDFAEKGGCSTKGCKLPHVIRANRNRKPPSLVSSDGSSSSTVVSGLVDLADSQGESRMQHVAANDAQLGDEYISLTFNESESEE # ESDSEEEENDEEGVEEGDDPDDVSDMLPVVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g437 ### # start gene g438 7 AUGUSTUS gene 2206594 2207460 0.78 - . g438 7 AUGUSTUS transcript 2206594 2207460 0.78 - . g438.t1 7 AUGUSTUS stop_codon 2206594 2206596 . - 0 transcript_id "g438.t1"; gene_id "g438"; 7 AUGUSTUS CDS 2206594 2207460 0.78 - 0 transcript_id "g438.t1"; gene_id "g438"; 7 AUGUSTUS start_codon 2207458 2207460 . - 0 transcript_id "g438.t1"; gene_id "g438"; # protein sequence = [MSLALGTPLHPMYRRMLPLLDTLSNDIPDTIIPIVVTSTHAIPSTRFSEAHLPAILSSHLLYLVPSASQNLPPSPSTS # TIHDATMQPQRPLDSHLHPVDGEEHSPTDDAHRSTFMGMGMPNMDVGKWGWLNFGKNGKKPTKGGQDEAEPNTIDNPDTAREEILRSPDGAVDQSALD # DAISSKGVMTNDLDATELKYVVDKEYFTTAELDDIESDIIPNPSTPSDSPSPFSLLPQEFTSTIVHLAEDPHSSNTRERKIYYLTVGFSSSLPCLFSP # SVPRNIPSCSLSST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g438 ### # start gene g439 7 AUGUSTUS gene 2218273 2218632 0.96 - . g439 7 AUGUSTUS transcript 2218273 2218632 0.96 - . g439.t1 7 AUGUSTUS stop_codon 2218273 2218275 . - 0 transcript_id "g439.t1"; gene_id "g439"; 7 AUGUSTUS CDS 2218273 2218632 0.96 - 0 transcript_id "g439.t1"; gene_id "g439"; 7 AUGUSTUS start_codon 2218630 2218632 . - 0 transcript_id "g439.t1"; gene_id "g439"; # protein sequence = [MLIKNIDENLVNGSMGRVVRFCDPATYGDHEDPSRTASNSKPVSSSSKPAPTAKVPQLLPVVEFVMPNGSHKEMLVIP # ESFKVELPNGEIQAARSQVSLIYLTATDTFDDICKFHPSCR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g439 ### # start gene g440 7 AUGUSTUS gene 2225650 2226309 0.5 - . g440 7 AUGUSTUS transcript 2225650 2226309 0.5 - . g440.t1 7 AUGUSTUS stop_codon 2225650 2225652 . - 0 transcript_id "g440.t1"; gene_id "g440"; 7 AUGUSTUS CDS 2225650 2226309 0.5 - 0 transcript_id "g440.t1"; gene_id "g440"; 7 AUGUSTUS start_codon 2226307 2226309 . - 0 transcript_id "g440.t1"; gene_id "g440"; # protein sequence = [MLCYKNGALAREQVRDKYTDSDWSNYNTLVDSGNPGCDGYMGLYFPLPEIIPPGVKGEFFFRNGRSVPPVQVTEEEVP # QAFQPRMILESQFLSIRSRIAAILPPDSPPLQRLVVTGGSSANHTIRQLAADLFNMKVYVSTTKEAAGMGGALLAKYAWWKQNGNSKGTFEEMNAMME # GESTGMKCVAEPREEVAMQYDGLVASYTACEEEVVKIWATKDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g440 ### # start gene g441 7 AUGUSTUS gene 2227171 2227524 0.34 - . g441 7 AUGUSTUS transcript 2227171 2227524 0.34 - . g441.t1 7 AUGUSTUS stop_codon 2227171 2227173 . - 0 transcript_id "g441.t1"; gene_id "g441"; 7 AUGUSTUS CDS 2227171 2227524 0.34 - 0 transcript_id "g441.t1"; gene_id "g441"; 7 AUGUSTUS start_codon 2227522 2227524 . - 0 transcript_id "g441.t1"; gene_id "g441"; # protein sequence = [MQPLFLGLDLSTQQLKAVLVREDHSILHESSVRFDQDLPSYETENGALKGPAEGEVTSPVAMWLDAFELLAERMKQAG # VDFGSIAAISGAGQVYECVSVKRLPSNKSSATWLRFLVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g441 ### # start gene g442 7 AUGUSTUS gene 2228802 2230815 0.85 - . g442 7 AUGUSTUS transcript 2228802 2230815 0.85 - . g442.t1 7 AUGUSTUS stop_codon 2228802 2228804 . - 0 transcript_id "g442.t1"; gene_id "g442"; 7 AUGUSTUS CDS 2228802 2229899 0.87 - 0 transcript_id "g442.t1"; gene_id "g442"; 7 AUGUSTUS CDS 2230015 2230815 0.85 - 0 transcript_id "g442.t1"; gene_id "g442"; 7 AUGUSTUS start_codon 2230813 2230815 . - 0 transcript_id "g442.t1"; gene_id "g442"; # protein sequence = [MQRSPHDRRVKPQSHTGSVTGEDADSSDIEPSEAGSVGGRSSVTGGSSKKRMTMEEREAAYNEARSRIFNEKGRDTDM # SASSSSISVASSSAGGSSLGDGEDSVNSLATESERSSPSSNRRGNSSIKSSGSRPLRSSAQPFTSSGSGSSRNSRAPSPAFTYASLYEPASSGSFDPN # SANQQYPSAPFGYPYSAPAPAHPGPSFPIQPYPYYYPYGPPPPSRNPSDPPLTGEVYPPPLPMMYNQYMWQARNMPPLHSAPPYSHRTLLASHPDGQL # YDGRNMGASFPAVIPPTTNNGSAHDGVPGSNNKSLNHRASNGHTKPQTTPLSRPAWSYGPGISMGGTMVTMAGSNSNGSGETTGPRLHSMRRQSNTSN # GSSSGAYRSSNSDEASSIAVSLTPSHLLQPSLISFLYQSSSTSSSSRRTYTSTASSQHPLPPRPDWAVGLKPDPTLHSTNSSRHHDNSSRNSPVSPPR # VPNGTGHSNNSHRRPQQTQPLISLQSQDFPPLTAMATPEKRPTAGGVWTNPSRSVMTTPALGVTSSGNALVHHPNAPNIPFTNSEANGFRAEDGFQRP # PPRTAELYNPKISKRSNTMQVQGEKNSDGRLNDQIRGLSLVDGPFHTNHTRSNSEMSLPEARST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g442 ### # start gene g443 7 AUGUSTUS gene 2231246 2231551 0.51 + . g443 7 AUGUSTUS transcript 2231246 2231551 0.51 + . g443.t1 7 AUGUSTUS start_codon 2231246 2231248 . + 0 transcript_id "g443.t1"; gene_id "g443"; 7 AUGUSTUS CDS 2231246 2231551 0.51 + 0 transcript_id "g443.t1"; gene_id "g443"; 7 AUGUSTUS stop_codon 2231549 2231551 . + 0 transcript_id "g443.t1"; gene_id "g443"; # protein sequence = [MELGRSPGASSAEIKGDTKGIPSMDGDGESEKVSSEGTRKLVVLELAVILVETRLKSDISMIEGDEALEFAEDDVDDS # ESAGLLVWSGARAKSSDRHAAFQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g443 ### # start gene g444 7 AUGUSTUS gene 2234751 2235904 0.09 - . g444 7 AUGUSTUS transcript 2234751 2235904 0.09 - . g444.t1 7 AUGUSTUS stop_codon 2234751 2234753 . - 0 transcript_id "g444.t1"; gene_id "g444"; 7 AUGUSTUS CDS 2234751 2234957 0.44 - 0 transcript_id "g444.t1"; gene_id "g444"; 7 AUGUSTUS CDS 2235013 2235108 0.77 - 0 transcript_id "g444.t1"; gene_id "g444"; 7 AUGUSTUS CDS 2235150 2235445 0.64 - 2 transcript_id "g444.t1"; gene_id "g444"; 7 AUGUSTUS CDS 2235672 2235693 0.98 - 0 transcript_id "g444.t1"; gene_id "g444"; 7 AUGUSTUS CDS 2235791 2235904 0.53 - 0 transcript_id "g444.t1"; gene_id "g444"; 7 AUGUSTUS start_codon 2235902 2235904 . - 0 transcript_id "g444.t1"; gene_id "g444"; # protein sequence = [MMTNVDMDEENIQYDDDDGAEEAPLIEVVLVGEKDLERFIPCTYNRKPYVQTPPPPPAATTSTISGPKSSVSVSTESN # SITRKSTSTFEKPKRSDFFAKAKPKEVVKKEKSTKEESSNSKAKITAATSKISEPEEKLSNVGAKEVGREHKREFPPESKEDKIKASSTKGKAPANHR # TGHKRKSPDSETEIGSPSVTVKKNVIISDEEEDQSTPKVEHPKGRNKGKQAMRGSDEDVLKMMDVDDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g444 ### # start gene g445 7 AUGUSTUS gene 2236459 2236755 0.61 + . g445 7 AUGUSTUS transcript 2236459 2236755 0.61 + . g445.t1 7 AUGUSTUS start_codon 2236459 2236461 . + 0 transcript_id "g445.t1"; gene_id "g445"; 7 AUGUSTUS CDS 2236459 2236755 0.61 + 0 transcript_id "g445.t1"; gene_id "g445"; 7 AUGUSTUS stop_codon 2236753 2236755 . + 0 transcript_id "g445.t1"; gene_id "g445"; # protein sequence = [MSVQYEYSKLPKETSKRRNADEEVLLLTPFKNFHIASHFSRDTTDVLLWFTSPPVNITGGGGATYSTTLNKLPHYSLE # YLHWRATKTGNQGDSGSTMQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g445 ### # start gene g446 7 AUGUSTUS gene 2237067 2238305 0.88 - . g446 7 AUGUSTUS transcript 2237067 2238305 0.88 - . g446.t1 7 AUGUSTUS stop_codon 2237067 2237069 . - 0 transcript_id "g446.t1"; gene_id "g446"; 7 AUGUSTUS CDS 2237067 2238305 0.88 - 0 transcript_id "g446.t1"; gene_id "g446"; 7 AUGUSTUS start_codon 2238303 2238305 . - 0 transcript_id "g446.t1"; gene_id "g446"; # protein sequence = [MSDHDLCSTSSFLDNPAVSSMEVELSATTESSQIIDSPYITENPHNNLDRDPKTPRRASEVFGFLAEKRKSRPTEETF # DKLLSKPPSTFSSPSDKDPSESTALSRFSEDSSMFNHNPPIVTPSRDASSSEFSRHSNSNTYPNPSSNPSSQRPVSRMLFEDGRASRVPQQQLTDQPS # GPIEEDVREVKVILIAPTKVIVTAPTPLADTSDRPTTRMTRGPRSLHRHRSRNNAKERGYREGLVERSNSSNSSDPFTPIPSRPMKLRSSSGSLSLTY # MDSKTTHSHGHISNPMPLGKESRSRRHGSTKSLMSAVFDKENSHNHTLGLVATPDIPFTPVRSNSSSRSSLLRAAVTAASFKPPRDMTPSPASSTELS # PVGKMMMMDVRRQKIMMRGTQEKERSQKSGSEGRKKHRRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g446 ### # start gene g447 7 AUGUSTUS gene 2240635 2242316 0.4 + . g447 7 AUGUSTUS transcript 2240635 2242316 0.4 + . g447.t1 7 AUGUSTUS start_codon 2240635 2240637 . + 0 transcript_id "g447.t1"; gene_id "g447"; 7 AUGUSTUS CDS 2240635 2241186 0.42 + 0 transcript_id "g447.t1"; gene_id "g447"; 7 AUGUSTUS CDS 2242119 2242316 0.64 + 0 transcript_id "g447.t1"; gene_id "g447"; 7 AUGUSTUS stop_codon 2242314 2242316 . + 0 transcript_id "g447.t1"; gene_id "g447"; # protein sequence = [MGKEEWEAVEGGFVHGIDLVRHIRREYGDYFDIAVAGFPQHQTLPPEERDLEMRYLKEKVDAGVNFIFTQMFYDVDVF # IDWVNTVRAAGITIPIVPGIAPIQTWNGFQRATSLAQTIIPQTFQDALEPHKANDEKVREIGTKLVADMCRRILNANLGIHGLHFYTMNLEKGTRMLL # EELNLVPRDEAFELGQQWARVYDPDSPSAKIISELMDSCYLVNVVHNDFHDAGAIFKPFFQAGEEYATQANGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g447 ### # start gene g448 7 AUGUSTUS gene 2242775 2245626 0.42 - . g448 7 AUGUSTUS transcript 2242775 2245626 0.42 - . g448.t1 7 AUGUSTUS stop_codon 2242775 2242777 . - 0 transcript_id "g448.t1"; gene_id "g448"; 7 AUGUSTUS CDS 2242775 2243173 1 - 0 transcript_id "g448.t1"; gene_id "g448"; 7 AUGUSTUS CDS 2244152 2244290 0.88 - 1 transcript_id "g448.t1"; gene_id "g448"; 7 AUGUSTUS CDS 2244629 2244895 0.42 - 1 transcript_id "g448.t1"; gene_id "g448"; 7 AUGUSTUS CDS 2245331 2245626 0.46 - 0 transcript_id "g448.t1"; gene_id "g448"; 7 AUGUSTUS start_codon 2245624 2245626 . - 0 transcript_id "g448.t1"; gene_id "g448"; # protein sequence = [MSNHNSLPPRSPLSSTPPTANGSQAKSGLVPTNNVTTTEGITVRARIDPTLTVADVVRQLCVNLKIKGMPSDYALRDE # NHELVTNDNLRKKIKARLDLKVVQVLSSPHSLINVCRPATAILKKLVEADPSNTPGPQAGSSKNGPVIVPGSIYRYGFTMVFEQMRKEKSLLETIVNR # LGSADTAMAQYSYIWDHSKLIEESDEKGQQLKWRKLGFDTEDIELEFNDVGVLGLECLDNSTKYLHYVDSAVKFPVRSGLEDLPDRIEIATVSEIATG # TCAPPPNVLRDHDDLPPTTPLAPSPLSFSLLSIHEEQGSLADLIAPDQSRWADWTDGLNMLRKDGGHVASKETAGFVQALTEIGLKIKLLGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g448 ### # start gene g449 7 AUGUSTUS gene 2247690 2249681 0.97 + . g449 7 AUGUSTUS transcript 2247690 2249681 0.97 + . g449.t1 7 AUGUSTUS start_codon 2247690 2247692 . + 0 transcript_id "g449.t1"; gene_id "g449"; 7 AUGUSTUS CDS 2247690 2249681 0.97 + 0 transcript_id "g449.t1"; gene_id "g449"; 7 AUGUSTUS stop_codon 2249679 2249681 . + 0 transcript_id "g449.t1"; gene_id "g449"; # protein sequence = [MSSLTSTPSTPSLDALSDFDHSLLSESLSLDTISILSLDSIPPFPSGCRTPLPTFLTINDITCASANLQPNTLSTSTT # TIPTPPRLKTLLKEDLCISRWTVCEWNFISPRCAHYSLQESLAFAEAPGHTPWGDVEDHDITPWKPEGSLYAGDTFQMALLKSRQRPSMLRLARQRLP # VPNSHHRNALVFEREITLKSEGRTKRWSVQVPAGSMDPDLAGMMMELRNLNSYFKEEEVQADDSVQRLEEGLCSPVDGVYTHTPSLIVSNSQCIIPLS # LESAGSLHTVPKILAVRRGNKALPPLSIKSELMNPSPYPSIPTAFLGSPSSYHPTFEFAGTTRSSTAFQDMIESLRSQCASLQVETAHFPALQEEENN # FQMIQSCPHVPPASPSARDGDNDWAFADSLLQEFPEFCSKQNLEPPNVELQSDKIFPEASITDPAQLTHTISSNDPSNSHLPSPSIAGSVSPTPSSNS # PRGILKRCKSVRFAEAPLIDPDSVHTTPVQEVVCPSTRHSTGPPIARSLKRPSPLRHTYAPQLKLTSSADSSLPLRNAGSLKPTIASETTNSKPSVHL # QRTAMKKLGRECIVSSPIKPHKPKTQGPPSLGRSFRNTLISGKENKLIKLRTSSFANRHTMDENALRRVGNSSSPSETLKSRMPVPLRNILTRFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g449 ### # start gene g450 7 AUGUSTUS gene 2250151 2250582 0.91 - . g450 7 AUGUSTUS transcript 2250151 2250582 0.91 - . g450.t1 7 AUGUSTUS stop_codon 2250151 2250153 . - 0 transcript_id "g450.t1"; gene_id "g450"; 7 AUGUSTUS CDS 2250151 2250582 0.91 - 0 transcript_id "g450.t1"; gene_id "g450"; 7 AUGUSTUS start_codon 2250580 2250582 . - 0 transcript_id "g450.t1"; gene_id "g450"; # protein sequence = [MGDTETNPDTLPKIIPGLQDKSIISVVLGDYHFAAVTATGKLLTWGQYSDGALGLGDPGSLQAGTPGGFANETLRVRA # LETRHGTPPDVEIPTEVRFDSHRKKPKDRFCVSAAASGWHTGALVIDLEASLTRDPFTTFRFNND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g450 ### # start gene g451 7 AUGUSTUS gene 2250831 2251121 0.88 - . g451 7 AUGUSTUS transcript 2250831 2251121 0.88 - . g451.t1 7 AUGUSTUS stop_codon 2250831 2250833 . - 0 transcript_id "g451.t1"; gene_id "g451"; 7 AUGUSTUS CDS 2250831 2251121 0.88 - 0 transcript_id "g451.t1"; gene_id "g451"; 7 AUGUSTUS start_codon 2251119 2251121 . - 0 transcript_id "g451.t1"; gene_id "g451"; # protein sequence = [MGEMDNEEENSAHSTNDRLIMCAPWDLQTDPVVLPSLPSLPKLFGAEPDSDTPRVVKIAGFDNAMIALTNQGHVLLFD # TLQSASESSLGSWKYVSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g451 ### # start gene g452 7 AUGUSTUS gene 2255226 2256653 0.68 - . g452 7 AUGUSTUS transcript 2255226 2256653 0.68 - . g452.t1 7 AUGUSTUS stop_codon 2255226 2255228 . - 0 transcript_id "g452.t1"; gene_id "g452"; 7 AUGUSTUS CDS 2255226 2256653 0.68 - 0 transcript_id "g452.t1"; gene_id "g452"; 7 AUGUSTUS start_codon 2256651 2256653 . - 0 transcript_id "g452.t1"; gene_id "g452"; # protein sequence = [MFPSSEQVTSNLYPLQCEEAACKPFVHRSGSESFYEDIAQLVSSSISPANSPDTVDDDLSSSPGLSPTHTSPNYYYVD # RVEPSFGSPSSPTEMYDTDPPSAYPASSSNIYQQPLPTPQNTYSFTAVNDIRESDAPASYPSDSPSPGDVQSSADFSHSYPESHPQHPHISSYQTDSD # PRYNPATLSRDSYLETSSASNISSSGLLDQRRMSEPAILAIPNNYSTNSSTADTSSRYSYPMSYNNSSRSSYAPSLQRGSSIGSLRDLRLHHQHLHYS # SPRSHNGWKTEDDSHHMAHSTHVNEGLDSPLSPFQPSFTGGQVGGSPTMAQGLQYSSIAEDHCSASPTGTSTPASLGTSRLPSQASISAGDAPGEDVD # ADGNRSPMDPNSKTYSFVALPGNTVKKRPRRRYDEIERLYQCSWPDCNKAYGTLNHLNAHVTMQKHGSKRSPNGKFTRFFLSTSPYFILLRSELVLHL # FPRFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g452 ### # start gene g453 7 AUGUSTUS gene 2261836 2262899 0.61 + . g453 7 AUGUSTUS transcript 2261836 2262899 0.61 + . g453.t1 7 AUGUSTUS start_codon 2261836 2261838 . + 0 transcript_id "g453.t1"; gene_id "g453"; 7 AUGUSTUS CDS 2261836 2261988 0.63 + 0 transcript_id "g453.t1"; gene_id "g453"; 7 AUGUSTUS CDS 2262042 2262171 0.82 + 0 transcript_id "g453.t1"; gene_id "g453"; 7 AUGUSTUS CDS 2262499 2262899 0.98 + 2 transcript_id "g453.t1"; gene_id "g453"; 7 AUGUSTUS stop_codon 2262897 2262899 . + 0 transcript_id "g453.t1"; gene_id "g453"; # protein sequence = [MSLNIGGDDITEFLYVLLERISFPYKDINLANSYDWNVMEDLKARLCTLMEVDVALNLYDFVVRKPGSPAEKYGLRAY # DEIILAPMVSVQVFRHQGSLQNLIADKTSSDAGPTLGTSSNIIVEGSIDVPMEVIDIELEDNKSSGPQQSSPSKSARRPSSEPVQPFPGSFGVDVCFE # ASKLPLDVAIFNSARASGGDEKIRKYLQAVLVIGGTARISGMGHALESRYV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g453 ### # start gene g454 7 AUGUSTUS gene 2267243 2268282 0.39 - . g454 7 AUGUSTUS transcript 2267243 2268282 0.39 - . g454.t1 7 AUGUSTUS stop_codon 2267243 2267245 . - 0 transcript_id "g454.t1"; gene_id "g454"; 7 AUGUSTUS CDS 2267243 2267964 0.8 - 2 transcript_id "g454.t1"; gene_id "g454"; 7 AUGUSTUS CDS 2268048 2268282 0.39 - 0 transcript_id "g454.t1"; gene_id "g454"; 7 AUGUSTUS start_codon 2268280 2268282 . - 0 transcript_id "g454.t1"; gene_id "g454"; # protein sequence = [MIVNQQHLKQAWDTSDVSTKEDWTAWMHKLSVEFMKESPSPALRACMSLVDVHTPLAKELFNAAFLSCWTELYDQYQV # SISAPSAPSELIHRWLNLAEFMEHEEKPLPIEHRTLGEYALKYLAYAKALHYKELEYWSEPSPSTIEALITINTRLQQHDAAWGTLLMAREQYDVTRH # EEWYERLGRWQEALQVYNKKAESDPNAPGVQIGRMKCLNALGEWDQLAVQVDEIWDHANHDDRREIGPIAAAAAWSLNEWDSMDDYIATMRPDSPDRA # FYRAILSIHQNQFSKAKTQIAKARDLLYPELTSFVGEGYVSSYK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g454 ### # start gene g455 7 AUGUSTUS gene 2271374 2272184 0.75 - . g455 7 AUGUSTUS transcript 2271374 2272184 0.75 - . g455.t1 7 AUGUSTUS stop_codon 2271374 2271376 . - 0 transcript_id "g455.t1"; gene_id "g455"; 7 AUGUSTUS CDS 2271374 2271924 0.77 - 2 transcript_id "g455.t1"; gene_id "g455"; 7 AUGUSTUS CDS 2272073 2272184 0.98 - 0 transcript_id "g455.t1"; gene_id "g455"; 7 AUGUSTUS start_codon 2272182 2272184 . - 0 transcript_id "g455.t1"; gene_id "g455"; # protein sequence = [MPSDTAAKLWDDDINRRIFDLMHSQNTAENFGGLLAIDVNLMLAASKTLGQIAEIGGSAFGERFMDFEVPAAIDLVKQ # ESPRYAGVLILKELARNSPTYFHSHISMVFENILVSLRDQRVMVREGAAELLAACLEIITQRERQTRSPFLTKILQDAQGGLKSSQPETIHGSLLTYR # ELLLYGGMVCPIVISCNRQLIHPSQVHERKLYGQRRADSSIQDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g455 ### # start gene g456 7 AUGUSTUS gene 2276609 2277217 0.48 - . g456 7 AUGUSTUS transcript 2276609 2277217 0.48 - . g456.t1 7 AUGUSTUS stop_codon 2276609 2276611 . - 0 transcript_id "g456.t1"; gene_id "g456"; 7 AUGUSTUS CDS 2276609 2277217 0.48 - 0 transcript_id "g456.t1"; gene_id "g456"; 7 AUGUSTUS start_codon 2277215 2277217 . - 0 transcript_id "g456.t1"; gene_id "g456"; # protein sequence = [MKDMTEAASTMMTDEEKAEIDKQLNPDKPSTPPVAGEQTPAIHHEEPPPNPTSVANTSSELPTSSPSSLSEATTQPNG # NSSLVIHGEHAQSPSPSPSHSVAEKEKLEKEREAARKRKAEQKEKLREQEKERRKVMEARVNMLTTKMIERLRPFVDAKHPGDKDDPETLAFEAKMKR # EVEDLKLESFGVEVRSSKVCSTTEND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g456 ### # start gene g457 7 AUGUSTUS gene 2284120 2285348 0.23 + . g457 7 AUGUSTUS transcript 2284120 2285348 0.23 + . g457.t1 7 AUGUSTUS start_codon 2284120 2284122 . + 0 transcript_id "g457.t1"; gene_id "g457"; 7 AUGUSTUS CDS 2284120 2284314 0.56 + 0 transcript_id "g457.t1"; gene_id "g457"; 7 AUGUSTUS CDS 2284358 2284610 0.52 + 0 transcript_id "g457.t1"; gene_id "g457"; 7 AUGUSTUS CDS 2284690 2285348 0.64 + 2 transcript_id "g457.t1"; gene_id "g457"; 7 AUGUSTUS stop_codon 2285346 2285348 . + 0 transcript_id "g457.t1"; gene_id "g457"; # protein sequence = [MDQERRLITAQSLQTLFDSTNTSLTIVRNVAEFSAHKLDEGDVSDVEDIDTRDPAIVAIDVASQVLFEPPQSYLRKLK # HQYLEQNAKDKYVKLIVTDIDDPPTVTDGDNKQLEKQNMEQKEKLKVAKEKLSTIEEEFRVVSSKVEEGRAKLAQKIIDARLALSRLRQTHPHPRVTV # QTADKKLEDQVMEMQALTDEMQVVEQKVHSVKGKLKSESLEMESLKSQRNEVEKSVKKSESGFNDDRRFVPLYDWSVISVFQLVSVNLTYLHRLTGSL # MIHRSMQGLEVMEAISENELRLQYGVEDKHGRSRSISITLIFVPNSRKLAAANANVQGMEEFAIDFSDIIEAHLQMNNIRGMLAAILARTREGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g457 ### # start gene g458 7 AUGUSTUS gene 2286636 2287100 0.38 + . g458 7 AUGUSTUS transcript 2286636 2287100 0.38 + . g458.t1 7 AUGUSTUS start_codon 2286636 2286638 . + 0 transcript_id "g458.t1"; gene_id "g458"; 7 AUGUSTUS CDS 2286636 2287100 0.38 + 0 transcript_id "g458.t1"; gene_id "g458"; 7 AUGUSTUS stop_codon 2287098 2287100 . + 0 transcript_id "g458.t1"; gene_id "g458"; # protein sequence = [MTSSLATAITQGGGNLPSLAADNSISFTLHQVNADGGGPFSAMVNTDATGQTWTSALITQQPPGANGLLSGGPVDSQV # TAALPAGTTCTGTSADGSISNICLIRISNGGTGNEAASLASFANGAGPFGGCFAVTTCKKFFFAPISFHVNTGFHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g458 ### # start gene g459 7 AUGUSTUS gene 2287467 2288303 0.48 + . g459 7 AUGUSTUS transcript 2287467 2288303 0.48 + . g459.t1 7 AUGUSTUS start_codon 2287467 2287469 . + 0 transcript_id "g459.t1"; gene_id "g459"; 7 AUGUSTUS CDS 2287467 2287748 0.63 + 0 transcript_id "g459.t1"; gene_id "g459"; 7 AUGUSTUS CDS 2287816 2287936 0.69 + 0 transcript_id "g459.t1"; gene_id "g459"; 7 AUGUSTUS CDS 2288011 2288303 0.94 + 2 transcript_id "g459.t1"; gene_id "g459"; 7 AUGUSTUS stop_codon 2288301 2288303 . + 0 transcript_id "g459.t1"; gene_id "g459"; # protein sequence = [MIVSGIFSPLYPQSSDRCILSVPVDAFAGQIDEAANGGNSSTSSTAKLSLQDAVNLKAALRTQVEGVLAAFAANQNAS # LLTAGSNFNFTGNLTTETVAQANSDADAAQAAGTTSINAGNAGVGEVQTAIKNSLLVSTVQSVTNGATLLGASPTTAAAVATTTAAAAATTTAAASVS # SAAAAAVTSTTTNKKSKNNKASTNNAASNKDDKSARALNKRLLRSRVRAVFDDVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g459 ### # start gene g460 7 AUGUSTUS gene 2299879 2300946 0.92 - . g460 7 AUGUSTUS transcript 2299879 2300946 0.92 - . g460.t1 7 AUGUSTUS stop_codon 2299879 2299881 . - 0 transcript_id "g460.t1"; gene_id "g460"; 7 AUGUSTUS CDS 2299879 2300946 0.92 - 0 transcript_id "g460.t1"; gene_id "g460"; 7 AUGUSTUS start_codon 2300944 2300946 . - 0 transcript_id "g460.t1"; gene_id "g460"; # protein sequence = [MDFIEQLPMLNGYTAILVVVDRSSKQAIFIPTLDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVLAFFRALGKA # LSMELHYTSGYHPEADGQTECVNQTLEQYIRIYCSYQQDDWSPLLPIAEFTYNNAPNASTGITPFFTNKGYHPNITVRPEVDMKSDLARDFVVNLDEL # HVFLQEEILLAQSCYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLLDYLRRIHPVFHVSQLEPVTLNPF # LNRTQSPSPPIEVDGEEEYNIAEILDSKLDRRYKRCPLRYYIRWAGYEGTDNEFSWVAADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g460 ### # start gene g461 7 AUGUSTUS gene 2301233 2303263 0.89 - . g461 7 AUGUSTUS transcript 2301233 2303263 0.89 - . g461.t1 7 AUGUSTUS stop_codon 2301233 2301235 . - 0 transcript_id "g461.t1"; gene_id "g461"; 7 AUGUSTUS CDS 2301233 2302558 0.92 - 0 transcript_id "g461.t1"; gene_id "g461"; 7 AUGUSTUS CDS 2302676 2303263 0.94 - 0 transcript_id "g461.t1"; gene_id "g461"; 7 AUGUSTUS start_codon 2303261 2303263 . - 0 transcript_id "g461.t1"; gene_id "g461"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFHNTSHFDSPQTSVPSAINTVDAKVAV # PLPELSPTILETPPGDSPRSCSRTLRAKPLSSKFPFEPIYSYPMVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAARAADRSST # APTVPPLHHSIPEEYTEFADELVALKDFIDKQLATGAITPSSSPHGALVLFVPKKDGKLRLCVDFRGLNHITKKDHYPLPLISDLLDAPKRAKIYTKL # DLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMLFGLTNAPAAFQQFVNDIFSDMLDACVIVYLDDILIYSDMPEEHREHVKEVLRRLRKHWLYANPK # KCEFNMDTVEYLGYILSPDRLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTWLTRKGASWIWDSSCQEAFENLKTAFTSAP # ILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWHHYLEGSGDLVDVVTDHKNLEYFSTTKVL # TRRQVRWSEFLHQFNMVICFRPGKLGEKPDLITRRWDVYPKEGDIGYAQVNPHNFHPIFTNEQLTASLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g461 ### # start gene g462 7 AUGUSTUS gene 2303677 2305278 1 - . g462 7 AUGUSTUS transcript 2303677 2305278 1 - . g462.t1 7 AUGUSTUS stop_codon 2303677 2303679 . - 0 transcript_id "g462.t1"; gene_id "g462"; 7 AUGUSTUS CDS 2303677 2305278 1 - 0 transcript_id "g462.t1"; gene_id "g462"; 7 AUGUSTUS start_codon 2305276 2305278 . - 0 transcript_id "g462.t1"; gene_id "g462"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSESISAIGQPRHRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPHRGQPPVVAPAWGRSTTRIESPILHAIACRTGKQPQRRAASESPRDPPPHFNLDTGDHNDQDPPVDPDDLGADNNHDDLDDDSGGLPRGEPG # DPSGPGGPGGPGSPGGPGGPRFPISPDIPNEQRAMLELLSGFKGSIETLGTVFAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRP # KYFTNQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPDWTSSFTALVKELQDNFGVYNAQGKAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAA # LKWAYGRGLAECIKDEMARLLEPATLADYRQEVLRIDNRYWKCEETRKHEAGKPFIARNPKKGSLDFKTGSTNQQNNSQPSGSLAPFTPKPKPFSGGK # PNNNGKPQNSSNSGQSGSQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g462 ### # start gene g463 7 AUGUSTUS gene 2310312 2310689 0.58 + . g463 7 AUGUSTUS transcript 2310312 2310689 0.58 + . g463.t1 7 AUGUSTUS start_codon 2310312 2310314 . + 0 transcript_id "g463.t1"; gene_id "g463"; 7 AUGUSTUS CDS 2310312 2310689 0.58 + 0 transcript_id "g463.t1"; gene_id "g463"; 7 AUGUSTUS stop_codon 2310687 2310689 . + 0 transcript_id "g463.t1"; gene_id "g463"; # protein sequence = [MSGFLLVDAAPRASLSTKVPLGRKEPKSKTTFKVVEDSKASNSSSRKIAPITAKGKSQQVVVSDDDSASNEVESEDEE # EDEDEDEEEDEEEEEEDSAPPPKHLKTTSSISGKTLFFLLFPLINSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g463 ### # start gene g464 7 AUGUSTUS gene 2311290 2311948 0.79 + . g464 7 AUGUSTUS transcript 2311290 2311948 0.79 + . g464.t1 7 AUGUSTUS start_codon 2311290 2311292 . + 0 transcript_id "g464.t1"; gene_id "g464"; 7 AUGUSTUS CDS 2311290 2311338 0.79 + 0 transcript_id "g464.t1"; gene_id "g464"; 7 AUGUSTUS CDS 2311401 2311948 0.99 + 2 transcript_id "g464.t1"; gene_id "g464"; 7 AUGUSTUS stop_codon 2311946 2311948 . + 0 transcript_id "g464.t1"; gene_id "g464"; # protein sequence = [MDALNALHTASSSSTHNLANSLRRAADLNDQLKQLGSLFDTTKELFLRSILDLQNAGTDPIVVLKALKAAEPNRRAIN # LNEWTLLATLFRWPSPFNLSGLDFDNRTPGEWIKLLRSIHSGESTASIDEHSHLVESSPPPDSAAEALEGLNDVEKGSADEDTSSQVGGSVPMELDLP # TIKSLAERTLSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g464 ### # start gene g465 7 AUGUSTUS gene 2312939 2314392 0.19 + . g465 7 AUGUSTUS transcript 2312939 2314392 0.19 + . g465.t1 7 AUGUSTUS start_codon 2312939 2312941 . + 0 transcript_id "g465.t1"; gene_id "g465"; 7 AUGUSTUS CDS 2312939 2313106 0.83 + 0 transcript_id "g465.t1"; gene_id "g465"; 7 AUGUSTUS CDS 2313748 2313883 0.97 + 0 transcript_id "g465.t1"; gene_id "g465"; 7 AUGUSTUS CDS 2313965 2314392 0.99 + 2 transcript_id "g465.t1"; gene_id "g465"; 7 AUGUSTUS stop_codon 2314390 2314392 . + 0 transcript_id "g465.t1"; gene_id "g465"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNHPDKATISVLHRSTEYLHDLLNRRSTPYPTTGSNKGSNKDEKS # AVNDVSPLLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFELNTNLVKTYATRARIAKVIADEACSILKS # RQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEIAAPVLKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g465 ### # start gene g466 7 AUGUSTUS gene 2317354 2318631 0.55 - . g466 7 AUGUSTUS transcript 2317354 2318631 0.55 - . g466.t1 7 AUGUSTUS stop_codon 2317354 2317356 . - 0 transcript_id "g466.t1"; gene_id "g466"; 7 AUGUSTUS CDS 2317354 2318631 0.55 - 0 transcript_id "g466.t1"; gene_id "g466"; 7 AUGUSTUS start_codon 2318629 2318631 . - 0 transcript_id "g466.t1"; gene_id "g466"; # protein sequence = [MDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEISYSHLAATHTESPILELPEPESPAENP # HIEVPPEATLEQSESVAVEEPPIHRIQANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLP # AHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIIPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRL # QGARYFTKFDVRWGYNNIWIKKGHEWKGAFATTRGLFEPKVMFFGLTNFPAMFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRL # EKHDLYLRPKKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLREL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g466 ### # start gene g467 7 AUGUSTUS gene 2319222 2320166 0.28 - . g467 7 AUGUSTUS transcript 2319222 2320166 0.28 - . g467.t1 7 AUGUSTUS stop_codon 2319222 2319224 . - 0 transcript_id "g467.t1"; gene_id "g467"; 7 AUGUSTUS CDS 2319222 2320166 0.28 - 0 transcript_id "g467.t1"; gene_id "g467"; 7 AUGUSTUS start_codon 2320164 2320166 . - 0 transcript_id "g467.t1"; gene_id "g467"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQQFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGCRGHLEAVCQDKFMGLGRDRGRRQQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g467 ### # start gene g468 7 AUGUSTUS gene 2322176 2323342 0.9 + . g468 7 AUGUSTUS transcript 2322176 2323342 0.9 + . g468.t1 7 AUGUSTUS start_codon 2322176 2322178 . + 0 transcript_id "g468.t1"; gene_id "g468"; 7 AUGUSTUS CDS 2322176 2323342 0.9 + 0 transcript_id "g468.t1"; gene_id "g468"; 7 AUGUSTUS stop_codon 2323340 2323342 . + 0 transcript_id "g468.t1"; gene_id "g468"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQQFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSASAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g468 ### # start gene g469 7 AUGUSTUS gene 2323393 2327109 0.92 + . g469 7 AUGUSTUS transcript 2323393 2327109 0.92 + . g469.t1 7 AUGUSTUS start_codon 2323393 2323395 . + 0 transcript_id "g469.t1"; gene_id "g469"; 7 AUGUSTUS CDS 2323393 2327109 0.92 + 0 transcript_id "g469.t1"; gene_id "g469"; 7 AUGUSTUS stop_codon 2327107 2327109 . + 0 transcript_id "g469.t1"; gene_id "g469"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADVIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVKMDPVKVAAVRDWPVPTNLRELRGFLGFANFYQRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g469 ### # start gene g470 7 AUGUSTUS gene 2327496 2327969 0.24 - . g470 7 AUGUSTUS transcript 2327496 2327969 0.24 - . g470.t1 7 AUGUSTUS stop_codon 2327496 2327498 . - 0 transcript_id "g470.t1"; gene_id "g470"; 7 AUGUSTUS CDS 2327496 2327969 0.24 - 0 transcript_id "g470.t1"; gene_id "g470"; 7 AUGUSTUS start_codon 2327967 2327969 . - 0 transcript_id "g470.t1"; gene_id "g470"; # protein sequence = [MSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICCWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIR # ISAYNSQANGKIERAHLDIHQVLIEATGGDVSKWFYFLKMILWADRVTPRHGLGCSPYFLVMSRSGRGGVTNGAGKRSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g470 ### # start gene g471 7 AUGUSTUS gene 2328949 2332028 0.9 - . g471 7 AUGUSTUS transcript 2328949 2332028 0.9 - . g471.t1 7 AUGUSTUS stop_codon 2328949 2328951 . - 0 transcript_id "g471.t1"; gene_id "g471"; 7 AUGUSTUS CDS 2328949 2330501 1 - 2 transcript_id "g471.t1"; gene_id "g471"; 7 AUGUSTUS CDS 2330576 2332028 0.9 - 0 transcript_id "g471.t1"; gene_id "g471"; 7 AUGUSTUS start_codon 2332026 2332028 . - 0 transcript_id "g471.t1"; gene_id "g471"; # protein sequence = [MKEQDWSMRTLRSNAVAPEESEKAKQNQFNDNTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRSLK # KPSVTIEDVDESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYHPIQMNTPTKVSRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD # LSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSKDGETEILDNPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESF # LRDLSIDDERRNIAIVANQSVAYEDHSDHPVVIANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDQLIAIGLGITWDPEFTIRMQDASGKLNQTL # GLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVKSEIKTFGNGDSEITISDPNSHKRITVGTYPHGQKGRNNQINTSRYNEPKNVPPDNENS # TGENDSKGNFHSSMNGYKRCEQETFSKKELSEAYVFASREHLKSQDDQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFL # QNGRIKPKPVRRKVQKRRFVEPILQNFSLGENCDKSDSTETTQNQCNNENTSETVRDDNWNKPKNSQRTRKRMVRYEVLKRGTESFQRSQPSFEKVRY # ELRQRKKGKAQDSKDKKENVQPDLLNEPPTIKLEERIKLNQQDKSPINLIDETNKQVVNEAIGVEKPINLDIEEVFTKYKPVDKKVNPIKATLPDEFR # IERHIHGDPLLELPELSKHPKPFVPTGRYKEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEADFAWQPSEAGTFKNEFFPPVKVPVIPHEPWVERNI # PIPPGIFEDVCKIIKSKIDSGIYEPSNASYHSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATSDLARSFSGRSCGGTLDLYVGYDERELDQL # SRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHNDVTYILQVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g471 ### # start gene g472 7 AUGUSTUS gene 2332441 2333929 0.49 - . g472 7 AUGUSTUS transcript 2332441 2333929 0.49 - . g472.t1 7 AUGUSTUS stop_codon 2332441 2332443 . - 0 transcript_id "g472.t1"; gene_id "g472"; 7 AUGUSTUS CDS 2332441 2333864 0.58 - 2 transcript_id "g472.t1"; gene_id "g472"; 7 AUGUSTUS CDS 2333917 2333929 0.49 - 0 transcript_id "g472.t1"; gene_id "g472"; 7 AUGUSTUS start_codon 2333927 2333929 . - 0 transcript_id "g472.t1"; gene_id "g472"; # protein sequence = [MITRSRTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSISRGRLTSLPSNLKKSNLDPKWKRKEINPIDIEEDII # ELIAPESISTSSTSIESTTLIDTLNQTISQASNMIEPVKMTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFKATESIFEHGG # ITSDKAEVISALEWMSYKTRQTLRVFDSVKTPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMI # TNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSKRHINLPFAADVPK # TDRNYLQALKPKVEDKFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSG # PSNQSNRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g472 ### # start gene g473 7 AUGUSTUS gene 2334726 2334998 0.68 + . g473 7 AUGUSTUS transcript 2334726 2334998 0.68 + . g473.t1 7 AUGUSTUS start_codon 2334726 2334728 . + 0 transcript_id "g473.t1"; gene_id "g473"; 7 AUGUSTUS CDS 2334726 2334998 0.68 + 0 transcript_id "g473.t1"; gene_id "g473"; 7 AUGUSTUS stop_codon 2334996 2334998 . + 0 transcript_id "g473.t1"; gene_id "g473"; # protein sequence = [MLSATYNDLGYYTSHADPCVCTKWLKDGSFTMMDTYTDNIWGASSSKEEAERRMKELGDEWEIKDVGENKYFLGMHID # QGLDMGTIQLSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g473 ### # start gene g474 7 AUGUSTUS gene 2335718 2336257 0.83 + . g474 7 AUGUSTUS transcript 2335718 2336257 0.83 + . g474.t1 7 AUGUSTUS start_codon 2335718 2335720 . + 0 transcript_id "g474.t1"; gene_id "g474"; 7 AUGUSTUS CDS 2335718 2336257 0.83 + 0 transcript_id "g474.t1"; gene_id "g474"; 7 AUGUSTUS stop_codon 2336255 2336257 . + 0 transcript_id "g474.t1"; gene_id "g474"; # protein sequence = [MHTIGYIRSTLNYSITYSKDQPLKPVRFIDVNYGGCHDTKQSMSGYIFTMAGGLVCWSSKCQATVALLTIEAEYVSLT # CAAQQLKWTHSWMEKVGLPQEKPGILKGDNQGAVSLTMNTCNHGKVKHIDIWEHYIRELIQSGEIDVEFIRGNANAADIFTKPLPHDAYYHYLSELKI # LPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g474 ### # start gene g475 7 AUGUSTUS gene 2340579 2341208 1 + . g475 7 AUGUSTUS transcript 2340579 2341208 1 + . g475.t1 7 AUGUSTUS start_codon 2340579 2340581 . + 0 transcript_id "g475.t1"; gene_id "g475"; 7 AUGUSTUS CDS 2340579 2341208 1 + 0 transcript_id "g475.t1"; gene_id "g475"; 7 AUGUSTUS stop_codon 2341206 2341208 . + 0 transcript_id "g475.t1"; gene_id "g475"; # protein sequence = [MIQAIEHRVERVIEDAVVDTIDDPVGGGSISANPSGASTPLYDDGTTAYSPSGSPEPSPRPESVLTSTAAALASTPPN # ATSMINPKPSHSPSELPKSSKNAPLLTPLQHTIAARLNTLPGLSKEIAFIDSFVDEVPENEDEDNNPKSRDEAIINNSSKSTKSTKSKPKHSIPIPIR # NAHAPIVSRDVRNFEHHKIGEGVLRCWAEGLVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g475 ### # start gene g476 7 AUGUSTUS gene 2349731 2350313 0.81 + . g476 7 AUGUSTUS transcript 2349731 2350313 0.81 + . g476.t1 7 AUGUSTUS start_codon 2349731 2349733 . + 0 transcript_id "g476.t1"; gene_id "g476"; 7 AUGUSTUS CDS 2349731 2349822 0.81 + 0 transcript_id "g476.t1"; gene_id "g476"; 7 AUGUSTUS CDS 2349986 2350313 0.95 + 1 transcript_id "g476.t1"; gene_id "g476"; 7 AUGUSTUS stop_codon 2350311 2350313 . + 0 transcript_id "g476.t1"; gene_id "g476"; # protein sequence = [MSAPPPYPYPPNENPDRRPLPRGWLTRYDNKFYVNTDVDPPVTTWTHPLGAPPTSPAPNSYGAPPGPPPPGPGGPGYG # YNSQPQGQYPGYGGYQQSPPPQPYYGGGQPPQQGYGSSPGYGGPGYGGYREEESRGKLNEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g476 ### # start gene g477 7 AUGUSTUS gene 2360483 2361244 0.81 - . g477 7 AUGUSTUS transcript 2360483 2361244 0.81 - . g477.t1 7 AUGUSTUS stop_codon 2360483 2360485 . - 0 transcript_id "g477.t1"; gene_id "g477"; 7 AUGUSTUS CDS 2360483 2361244 0.81 - 0 transcript_id "g477.t1"; gene_id "g477"; 7 AUGUSTUS start_codon 2361242 2361244 . - 0 transcript_id "g477.t1"; gene_id "g477"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNRGALVMFEGARGLTRKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g477 ### # start gene g478 7 AUGUSTUS gene 2377725 2384482 0.12 + . g478 7 AUGUSTUS transcript 2377725 2384482 0.12 + . g478.t1 7 AUGUSTUS start_codon 2377725 2377727 . + 0 transcript_id "g478.t1"; gene_id "g478"; 7 AUGUSTUS CDS 2377725 2378257 0.7 + 0 transcript_id "g478.t1"; gene_id "g478"; 7 AUGUSTUS CDS 2378347 2378744 0.53 + 1 transcript_id "g478.t1"; gene_id "g478"; 7 AUGUSTUS CDS 2378876 2379047 0.52 + 2 transcript_id "g478.t1"; gene_id "g478"; 7 AUGUSTUS CDS 2379164 2379629 0.27 + 1 transcript_id "g478.t1"; gene_id "g478"; 7 AUGUSTUS CDS 2379705 2380131 0.56 + 0 transcript_id "g478.t1"; gene_id "g478"; 7 AUGUSTUS CDS 2380206 2384482 0.99 + 2 transcript_id "g478.t1"; gene_id "g478"; 7 AUGUSTUS stop_codon 2384480 2384482 . + 0 transcript_id "g478.t1"; gene_id "g478"; # protein sequence = [MSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQVLKPKV # EDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIHRVVPRINLIDLKEIRH # RKGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHEKMM # SVCSTKIVQMEKNKYSMKEQDRSMRTLRSNAVAPEEMRFEAPKSIDRPLKKPSVTIEDVNESDDEDAIKLIPSSRPTNQINNEHRPYDHVQPRTVEED # IAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVG # SIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRATIDSYRSRNYLGSRIHDQNARCKWKLNQTLGLARNIPFKFGEVTV # YLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLKGNFHSSMN # GYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPIRKKVQ # KRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRIVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKD # KKENVQADVVTEPPINKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPE # LSKHPKPFAPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIK # SKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHR # LVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCE # ETIVVGHRCTYEGSMPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFD # WDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINR # WIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQ # EALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLSEMSKDERIKFIRLIKKFQVDD # QGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQKVHVDT # MIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLD # IRQALIKATGGDISKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDAN # KVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTILKEKVGAFRVLPHFTRNEPIELPNNIHE # LIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPRLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g478 ### # start gene g479 7 AUGUSTUS gene 2384743 2386197 0.36 - . g479 7 AUGUSTUS transcript 2384743 2386197 0.36 - . g479.t1 7 AUGUSTUS stop_codon 2384743 2384745 . - 0 transcript_id "g479.t1"; gene_id "g479"; 7 AUGUSTUS CDS 2384743 2385170 1 - 2 transcript_id "g479.t1"; gene_id "g479"; 7 AUGUSTUS CDS 2385252 2385387 0.86 - 0 transcript_id "g479.t1"; gene_id "g479"; 7 AUGUSTUS CDS 2386030 2386197 0.5 - 0 transcript_id "g479.t1"; gene_id "g479"; 7 AUGUSTUS start_codon 2386195 2386197 . - 0 transcript_id "g479.t1"; gene_id "g479"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNSPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKEEKS # AVNDVPPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKS # RQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g479 ### # start gene g480 7 AUGUSTUS gene 2387274 2387618 0.22 - . g480 7 AUGUSTUS transcript 2387274 2387618 0.22 - . g480.t1 7 AUGUSTUS stop_codon 2387274 2387276 . - 0 transcript_id "g480.t1"; gene_id "g480"; 7 AUGUSTUS CDS 2387274 2387618 0.22 - 0 transcript_id "g480.t1"; gene_id "g480"; 7 AUGUSTUS start_codon 2387616 2387618 . - 0 transcript_id "g480.t1"; gene_id "g480"; # protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGAS # SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g480 ### # start gene g481 7 AUGUSTUS gene 2388541 2389231 0.17 - . g481 7 AUGUSTUS transcript 2388541 2389231 0.17 - . g481.t1 7 AUGUSTUS stop_codon 2388541 2388543 . - 0 transcript_id "g481.t1"; gene_id "g481"; 7 AUGUSTUS CDS 2388541 2388965 0.27 - 2 transcript_id "g481.t1"; gene_id "g481"; 7 AUGUSTUS CDS 2389024 2389231 0.56 - 0 transcript_id "g481.t1"; gene_id "g481"; 7 AUGUSTUS start_codon 2389229 2389231 . - 0 transcript_id "g481.t1"; gene_id "g481"; # protein sequence = [MRLAPSKDLDVFASLRGKVSPAVTSKITTPSPPLEIKPSTPAPKAPVAPPRLIRRNRELENLKTDASSFLASPRSARS # KDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRSRKVAPAASKGKARQIVVTDEDSASNEVESEDE # DEEEDSAPPPKRLKTNLPFLVKYILHLFRFILLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g481 ### # start gene g482 7 AUGUSTUS gene 2393483 2395008 0.54 - . g482 7 AUGUSTUS transcript 2393483 2395008 0.54 - . g482.t1 7 AUGUSTUS stop_codon 2393483 2393485 . - 0 transcript_id "g482.t1"; gene_id "g482"; 7 AUGUSTUS CDS 2393483 2394647 0.97 - 1 transcript_id "g482.t1"; gene_id "g482"; 7 AUGUSTUS CDS 2394722 2394848 0.95 - 2 transcript_id "g482.t1"; gene_id "g482"; 7 AUGUSTUS CDS 2394909 2395008 0.56 - 0 transcript_id "g482.t1"; gene_id "g482"; 7 AUGUSTUS start_codon 2395006 2395008 . - 0 transcript_id "g482.t1"; gene_id "g482"; # protein sequence = [MANKRPEVNPEDYVDEDGGEPINFIMGKGKRKSPQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLLD # ELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYK # DVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTD # NAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVEST # WLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRLNENIDIQLKIGISNQVNWSRLGILELKRVWIERCIQDIEDLWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g482 ### # start gene g483 7 AUGUSTUS gene 2395323 2395646 0.94 - . g483 7 AUGUSTUS transcript 2395323 2395646 0.94 - . g483.t1 7 AUGUSTUS stop_codon 2395323 2395325 . - 0 transcript_id "g483.t1"; gene_id "g483"; 7 AUGUSTUS CDS 2395323 2395646 0.94 - 0 transcript_id "g483.t1"; gene_id "g483"; 7 AUGUSTUS start_codon 2395644 2395646 . - 0 transcript_id "g483.t1"; gene_id "g483"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAWIPLTKLWDGISIKLID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g483 ### # start gene g484 7 AUGUSTUS gene 2396497 2396829 0.59 - . g484 7 AUGUSTUS transcript 2396497 2396829 0.59 - . g484.t1 7 AUGUSTUS stop_codon 2396497 2396499 . - 0 transcript_id "g484.t1"; gene_id "g484"; 7 AUGUSTUS CDS 2396497 2396829 0.59 - 0 transcript_id "g484.t1"; gene_id "g484"; 7 AUGUSTUS start_codon 2396827 2396829 . - 0 transcript_id "g484.t1"; gene_id "g484"; # protein sequence = [MTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKASYQMNFELKDT # FMVIRYWNYLNCRNILNRLFLREDIRKKGKRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g484 ### # start gene g485 7 AUGUSTUS gene 2396962 2400495 0.05 - . g485 7 AUGUSTUS transcript 2396962 2400495 0.05 - . g485.t1 7 AUGUSTUS stop_codon 2396962 2396964 . - 0 transcript_id "g485.t1"; gene_id "g485"; 7 AUGUSTUS CDS 2396962 2397440 0.88 - 2 transcript_id "g485.t1"; gene_id "g485"; 7 AUGUSTUS CDS 2397727 2398061 0.38 - 1 transcript_id "g485.t1"; gene_id "g485"; 7 AUGUSTUS CDS 2398168 2398768 0.39 - 2 transcript_id "g485.t1"; gene_id "g485"; 7 AUGUSTUS CDS 2399007 2400495 0.15 - 0 transcript_id "g485.t1"; gene_id "g485"; 7 AUGUSTUS start_codon 2400493 2400495 . - 0 transcript_id "g485.t1"; gene_id "g485"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYNTAPLFDITDPSQMIPWFEATESIFEHGGITSDKAKVRLALEWTSYKM # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASLSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEYKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMMQLTAVMAQMAKENAKGMINSIPPSVTSNQSNRFERNTTPRSSNG # TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPHYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSDRLGNLEAHREDDVLRFEAPKSIDRPLKKPSVTIEDVDESDDEDTIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPR # DQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDEPSRVQMID # TCIRIEDLWQDQMDMFEVLTESRNDILWDLYDHPVVVANQSNGLRAVTPEINKKDEEIESVLDQGSQIVVIDQLIAIGLGITWDPEFTIRMQDASGKL # NQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVENGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVF # CVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSRE # LEENGSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g485 ### # start gene g486 7 AUGUSTUS gene 2406616 2407743 0.95 + . g486 7 AUGUSTUS transcript 2406616 2407743 0.95 + . g486.t1 7 AUGUSTUS start_codon 2406616 2406618 . + 0 transcript_id "g486.t1"; gene_id "g486"; 7 AUGUSTUS CDS 2406616 2407743 0.95 + 0 transcript_id "g486.t1"; gene_id "g486"; 7 AUGUSTUS stop_codon 2407741 2407743 . + 0 transcript_id "g486.t1"; gene_id "g486"; # protein sequence = [MGNSFSKALAVPIRFLANLFGFGFGEDPTMAAIAERLQQVEKEKEEESRRGKEQIEAAQQEIRKMEEERTRMHNSMDE # QKLRAAEAQAIAQQADKKIEDLKVEMTRVQNGVEEEKRKAIVEAMDRLKLGIDPVELPTNFKAMKQHYKYDPAKFHLAVAGVSGTGKSSLINAFRGIK # NKAKDAEPTDFVECTSEVKRLPDKARPQIVWFDVPGANTLKVPDWRYFNDQGLYIFQAIIVLYSSRFTATDIAILRNCERYNIPTYLVRSQSDTPLRE # IIKEKINEDEFLLADIDPAILEEARQEFIDRTQANVDSNLKQAGLGQKRMYAVSRDALYNLVIGKDSRSSICLHEVELVEDIIREALERRGVDVPEMR # QVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g486 ### # start gene g487 7 AUGUSTUS gene 2408312 2409085 1 + . g487 7 AUGUSTUS transcript 2408312 2409085 1 + . g487.t1 7 AUGUSTUS start_codon 2408312 2408314 . + 0 transcript_id "g487.t1"; gene_id "g487"; 7 AUGUSTUS CDS 2408312 2409085 1 + 0 transcript_id "g487.t1"; gene_id "g487"; 7 AUGUSTUS stop_codon 2409083 2409085 . + 0 transcript_id "g487.t1"; gene_id "g487"; # protein sequence = [MVDNSQSSHNKLFPVTSIGRSAGSNLLNPSSEQHRSLSRQSSRESLNVIAHPLLSPSSTGSALSGSSGSGSAATSSNS # PSTTWDNGYSSSALGYVPYTRTPKHKASPASPTHPTPHVSHSSSNPSPSVIVTPATTSSSSSSANHLDATTKLQLMNLKAAAQALGLDAGSVGWAMLE # ALLGEHGTEWDTIWDALSTGKATLLLPSEPLTSLKGKSTNAPLISPEFVKNHVFYTEFEGKVPGRAVSLSGLRGVIIQKQE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g487 ### # start gene g488 7 AUGUSTUS gene 2409234 2411401 0.23 + . g488 7 AUGUSTUS transcript 2409234 2411401 0.23 + . g488.t1 7 AUGUSTUS start_codon 2409234 2409236 . + 0 transcript_id "g488.t1"; gene_id "g488"; 7 AUGUSTUS CDS 2409234 2410456 0.83 + 0 transcript_id "g488.t1"; gene_id "g488"; 7 AUGUSTUS CDS 2410577 2410803 0.31 + 1 transcript_id "g488.t1"; gene_id "g488"; 7 AUGUSTUS CDS 2410944 2411401 1 + 2 transcript_id "g488.t1"; gene_id "g488"; 7 AUGUSTUS stop_codon 2411399 2411401 . + 0 transcript_id "g488.t1"; gene_id "g488"; # protein sequence = [MSSTAQIISQSDYPTYILPTDTPALSLPPRKSLSLPPPLPPRRHLQSHQTGSVPSRPSTPTHDGKSSTGSHASSRFAG # LTSLFSRSSIPPSNPILNAQPSSPAGSRPPSIILSDTASVNEDILGSGVVKDESSSTLHASTSVPAYIISTSVIEQEVLGGIWKGIVGDVERILRSAS # SVGPSPLANTFPSNLQSILISFLESANALSVLRVSAPHPRPTNKSKTITKRLISGSGALKEGNREGKEGKEAVESDSLQPGLDSTTPSSPSHSPSYFA # HAHADSEYYVYEINPYGVKEGWGSAAVVLSATSVSAPDGSTGAGGGIIDIKEAEIGAMEAIEDLSARWQSFYREVEDVVVEWAEAEIPEVEDESSGTD # ERSEKAGVSVQKEQRTKEILDQAERVLCCVGGVYERIEAAASDTNDTNPSNNSEPTEIITDSAHDDALASRIAALVMVDFGLRDLDLDIGADIGDETK # SRKEEQVITVLRAYGLTRLPFMISLKDSESSKPETQTQPQSDHVEVPSEEVLELGEEDLATAVPWKKDNAFPKPEDDDNIGIEALKEKEGLAAELKSS # SSKVVLDTMLDVGNDSIVEGQNTSQSSAVGTKTPKAEKPPSSKASTFSLDTLFPFSFYPSLLQTLPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g488 ### # start gene g489 7 AUGUSTUS gene 2411512 2412687 0.56 + . g489 7 AUGUSTUS transcript 2411512 2412687 0.56 + . g489.t1 7 AUGUSTUS start_codon 2411512 2411514 . + 0 transcript_id "g489.t1"; gene_id "g489"; 7 AUGUSTUS CDS 2411512 2412687 0.56 + 0 transcript_id "g489.t1"; gene_id "g489"; 7 AUGUSTUS stop_codon 2412685 2412687 . + 0 transcript_id "g489.t1"; gene_id "g489"; # protein sequence = [MAVAEFIGNLDLEGVMSARDNPVLSSEDGPMPIPVPMTLPINIGGRPSSRRASMSSQYSTTSKDGSTATTPVLSSSFT # LRNRVEQQASVLSSSANKVLTGMSGVMDSSIGGFGGLFKSMNVNLSLPGSLPTGFGFGGEESSAGPVTPALGSAQAAAPWNHHHIQNQSNNPRETMER # KESGFSIKSLKLPSIPNMPAIPNIPNLTRSITPGPGDSREKEMVNVSRPGSVRSMRSTRSRKSNIGSLFGDESTEEDDESEDVGEDEYEDEYEDEDED # ENDVDEEEDMDGDLLHPRPEVDDNDESDVGEARASADTRSIKSFESMMKDGKRRAKVKSADRDAAVVLKKEKQADKKSTTLNTVAGAARKSLSDRLAR # VSSGISGSSTKKVCFYESG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g489 ### # start gene g490 7 AUGUSTUS gene 2414532 2415437 0.97 - . g490 7 AUGUSTUS transcript 2414532 2415437 0.97 - . g490.t1 7 AUGUSTUS stop_codon 2414532 2414534 . - 0 transcript_id "g490.t1"; gene_id "g490"; 7 AUGUSTUS CDS 2414532 2415437 0.97 - 0 transcript_id "g490.t1"; gene_id "g490"; 7 AUGUSTUS start_codon 2415435 2415437 . - 0 transcript_id "g490.t1"; gene_id "g490"; # protein sequence = [MSSTDLANEELKQSIKSAEQESLKQSILTKSNAPRTKITHKGLEDIEDISGRDSNRERERQLEEEERMEKERLARLRA # VEPRQRTVSLSVPPESPVVPASEGWGAPPPVPPHALDMARETNATRPPLYLHTSSDLGTSEPEMNLADLINIDDEPGSNQTVASPKDVQESIEADAPA # VLRSPTGISPFAIQPAPSPSTPSPSAQLPSAQPPTPRPSIFDLNSLWSRSNSSNLSSGPSTSAAEPTANVEPDDQNDVVMDSEPVAANDQDFDMLLEE # KEPETPEIVQATFDTIPQVWTGKVTGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g490 ### # start gene g491 7 AUGUSTUS gene 2415591 2417166 0.17 - . g491 7 AUGUSTUS transcript 2415591 2417166 0.17 - . g491.t1 7 AUGUSTUS stop_codon 2415591 2415593 . - 0 transcript_id "g491.t1"; gene_id "g491"; 7 AUGUSTUS CDS 2415591 2416005 0.42 - 1 transcript_id "g491.t1"; gene_id "g491"; 7 AUGUSTUS CDS 2416889 2417166 0.24 - 0 transcript_id "g491.t1"; gene_id "g491"; 7 AUGUSTUS start_codon 2417164 2417166 . - 0 transcript_id "g491.t1"; gene_id "g491"; # protein sequence = [MSTRTTRSTRTSTKQNSARSSAPLSKNSKAIKSHDVEPQSGKENQNTKDISPPTTAQGKDSTMINAASDKIYCSCKKG # DDGTPMIYCSECKEXVSYHSDSDLSDVADKPARIRKASSPSLKRIAKRTVDGPPTKKAKTSNVVDDPTRKYCLGKLEDVFRDIFLRYPHIRRENEDDI # AEVTEKQTEDLTEEDRNNVLESSKQFADDLEKCVFEIYSEPDKHGNQTAAARYK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g491 ### # start gene g492 7 AUGUSTUS gene 2421172 2424896 0.39 + . g492 7 AUGUSTUS transcript 2421172 2424896 0.39 + . g492.t1 7 AUGUSTUS start_codon 2421172 2421174 . + 0 transcript_id "g492.t1"; gene_id "g492"; 7 AUGUSTUS CDS 2421172 2422622 0.46 + 0 transcript_id "g492.t1"; gene_id "g492"; 7 AUGUSTUS CDS 2422706 2424896 0.87 + 1 transcript_id "g492.t1"; gene_id "g492"; 7 AUGUSTUS stop_codon 2424894 2424896 . + 0 transcript_id "g492.t1"; gene_id "g492"; # protein sequence = [MAAAAVSISSPFAMSSHQRLAVAPPPAASSSRSKQPTPSSHSPTQEPTIKPFNRIRSSLEQSLRTATRSKKAPAPAAD # EFATVSAKSKGKEKEKHKVPEEKQGMLRRLESRVNFRRVTPSPQPPVSISPSPMEDKVRSAGSTSYTTPSLRMASMSSPALHLSSQALPSPRSRPAIP # ASSSSTSDSLVTPSRARSRQADSPTTPTTRHRPTKSSPIDIPPSSSVLSLHSPPETPRRPRREQSSPPDTPTPIHGSRGSKQASSSTSHLPLNAPSSP # SHVRPRETNLNRARSPSISRTRVVSPSHRGLTSSSSTHLPSNSSPSPPPTPTPSRPLDARRPSLDSPRRTSFGREGSESPSPAVRSRPISPNQRAYAN # HRHFNISTTSLSGPSNPEHRELIRTATGLLCKETTRPPLTQTESGKKDWEGVEVRMRSLARLERIWGKSGVQASSSNVNVNGLSSSGLSASGEERERR # LFTEALRDGFVLCHLLNKLRSSSIVRPDPKEDGFARTSNITKFLAACSSYGLANEDLFQRDDLIEASSESLARVARTIIALIKFVDAPITISDRSKVL # SGQSKKSSSNETNSGSSSGGGGVSPSSPYKLGTVTSRSGASASTPNLVSNNGSRTTSPTQNTTGVSPTRKRWSPPNLLPTVRSDSSEEGTVSKGNFQG # TGPVSVSMTQDVKSQRKDTDRMPPPSSVDNDRERDLPMTPPPRSPLRIRTSRKSSSSSPYQPSTDDGKSLFTWSVTNSTASPSSPSRISAAESTRASV # GDASMRDFDRHSNVRQSVASSAVTDMSTSTTTTVLSSLLDVGRASSAGFSKFGTIRTMTTEATSETPSITRTEGSSIAEDLARKYRGVPDIFDRKLSD # AVVDLTRVEEGDESGSSSAKGGGRDKRRHRGIESEVEIERERAVEKGPGPAIRLGKGKWPDDFMDAMQSHTSSNLSISTSPTSDPVERLRTPPISGSP # PRKLAVVGIGGSRRNESVESLPQFPRRPSHRARHSIDTAGVPPKEALLRREASPDGVPTRVLPRRHSTKPRPAHLLPRGVNDDSDSLVPFPRSVSGEN # TNSPSPYSSEDASGSQQRLEKPHQPRGRFQSDIEGSSRRRPRPNSYDELGAKPARSRFESMVNLGGASGNTSASDLMSRDSIDGSAVRKPLIIKEEGK # VPTHFVSHYIVPIRALVPENTKWETFSQSSNLEIALEGVNLVLCTAPLISILVKWLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g492 ### # start gene g493 7 AUGUSTUS gene 2425956 2426762 0.3 + . g493 7 AUGUSTUS transcript 2425956 2426762 0.3 + . g493.t1 7 AUGUSTUS start_codon 2425956 2425958 . + 0 transcript_id "g493.t1"; gene_id "g493"; 7 AUGUSTUS CDS 2425956 2426762 0.3 + 0 transcript_id "g493.t1"; gene_id "g493"; 7 AUGUSTUS stop_codon 2426760 2426762 . + 0 transcript_id "g493.t1"; gene_id "g493"; # protein sequence = [MRYHHEITPSSRPHSANVSLVIYFIVSVDFHIVSLAMVCRVCLLHVKKSAVLCAQCSLICHSKCTDNAPPTCDLRAQL # LLYAQYAEKGNPSSAYSNPADILGNAHPKSPMSDVAFVSHTPRTSLDTAPPQVPPSPSPANAVHPPVAFKFMNFKRPKVGHPSTDPAHLSSSPSLENM # ARKPTVLRKAHDDRAPSVKSSSTQANSSMRSAGTVASTSGNSEGVVESDARASRVTSQSGPSDNGDIRMPGELSDTNRQHRKNKSSNNCIVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g493 ### # start gene g494 7 AUGUSTUS gene 2432168 2432512 0.71 + . g494 7 AUGUSTUS transcript 2432168 2432512 0.71 + . g494.t1 7 AUGUSTUS start_codon 2432168 2432170 . + 0 transcript_id "g494.t1"; gene_id "g494"; 7 AUGUSTUS CDS 2432168 2432512 0.71 + 0 transcript_id "g494.t1"; gene_id "g494"; 7 AUGUSTUS stop_codon 2432510 2432512 . + 0 transcript_id "g494.t1"; gene_id "g494"; # protein sequence = [MTLNQSSDPLTALVDIISTQTAVLQSAYKNDSTKVPSIDDPYQPTPLEFDPSITAARNLIVAAATQLIATVGSPHELI # YANLSGEYDTVTMGFIVDVNIPEILKEAGTQVKKSW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g494 ### # start gene g495 7 AUGUSTUS gene 2434802 2437147 0.95 - . g495 7 AUGUSTUS transcript 2434802 2437147 0.95 - . g495.t1 7 AUGUSTUS stop_codon 2434802 2434804 . - 0 transcript_id "g495.t1"; gene_id "g495"; 7 AUGUSTUS CDS 2434802 2437147 0.95 - 0 transcript_id "g495.t1"; gene_id "g495"; 7 AUGUSTUS start_codon 2437145 2437147 . - 0 transcript_id "g495.t1"; gene_id "g495"; # protein sequence = [MPDTAAKSRTLDGPLTSKTPADKGPSSADIQQQSLGGFTNLSQLRVLGLMDVTITTTGQSVIPDEHEDRRVRTSESTV # CGMAYGIADTLGRNDHLNMLDLVHEFPSSSTALRKNEAIFAIFGRSQPPKAMPAGISGNRIAKFLRDNFVNVFNTQLAGLKREKAEGVPDALRRSFLK # INQNLHDLLFSNRNKTLQTMQASSGGSAPSPDLLVSRGGASGVVLYFCGETMYVANAGNALAVVSRGGYPEPVSRKHDPYDRLEMSRIRAAEGWISPA # GLVNDEIDISRSFGFFHLLPVVNARPDIFVWELSELDEFVIVANRGLWDFVSYKTAVDIARRERGDPMLAAQKLRDFAISYGADGSTMIMVISVSDLF # RRDEARSREGSIVDPQPFKTPKAVITDRGLSRLQDEVSAPTGHLALVFTDIRNSTHLWDVNRGMNTAWRLHNTLLRRKLRFCGGYEVKTEGDAFMCAF # PTTMAAVWWSLAVQMELLEQDWPLEILECEDGKPIYDFDNRLIAQGLSVRMGIHCGSPLCEVDPVNHRMDYFGPMVNRSARINSSAAGGQIMCSEEVI # REIRAKLYNGPSTPQSDSQPLEAIDNVRRLGLSIIEVGAVKLKGLELPEQLSLIYPGHLVARHNMREVVADPDASGSRVQFSVSQIRQLGLVCLRLES # LATSRVFKEIGERKSSIQTVNLSVENDHDEEEDPLYIYGDPNLLLPPLDEKASSDRDMTLVLDALSGRIENAVAKIKEKALVNSVKYSLISAMGNTRG # CLDERTLQSLLDIIQGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g495 ### # start gene g496 7 AUGUSTUS gene 2437307 2439088 0.74 - . g496 7 AUGUSTUS transcript 2437307 2439088 0.74 - . g496.t1 7 AUGUSTUS stop_codon 2437307 2437309 . - 0 transcript_id "g496.t1"; gene_id "g496"; 7 AUGUSTUS CDS 2437307 2439088 0.74 - 0 transcript_id "g496.t1"; gene_id "g496"; 7 AUGUSTUS start_codon 2439086 2439088 . - 0 transcript_id "g496.t1"; gene_id "g496"; # protein sequence = [MSIASFTPLKLNRSFIQEQNLAIEDFERVDLSGRSLRTIPVALHQHADQITSLSLSRNPMLDLPLDFIQATSHSLTEL # RLSHMALKKVPTNIQFAVSLTRLDLSSNRIGDLDDAYLEKIPGLKSLKVQNNRMEKLPWHFPRLRSLTTLNISNNKFRVLPAVICQLESLRDLDISFN # TISELPEELGLLRNLEHLIMVGNQITSIPPTASSLGSLRRLDCRRNLIGDLAVIGMLPKLEKLSADHNRLNGVELSLGPNLSTIDAGYNEITEIRVVA # SPVGHPKPYTALFSLDVSHAKLSSISASALSSLPSLRTLKLSHNNIKVLPSSLGDLDYLEVLECADNLLERLPQGIGRLRRLEVLDVHENNLTELPGE # LWACMSLGKLNATSNLIEKWDAPSAPPPPTSQNGDTSSSDTATRISTIDLHMHPFPDRKSSASSLSDPFSSPSRLPNLAYALEKLYLGENQLSAESLG # FLSLFQKLKVLNLSFNLIQELPPGFFKNFLSEIPFTASPSPQQQPQTFQKSSLEELYLSGNKLTTLPTEDLARMTRLGTLFLNGNRLQTLPQELGKVQ # SLTILDVGSNLLKYNIYNWEFDWNW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g496 ### # start gene g497 7 AUGUSTUS gene 2439644 2441365 0.77 - . g497 7 AUGUSTUS transcript 2439644 2441365 0.77 - . g497.t1 7 AUGUSTUS stop_codon 2439644 2439646 . - 0 transcript_id "g497.t1"; gene_id "g497"; 7 AUGUSTUS CDS 2439644 2441365 0.77 - 0 transcript_id "g497.t1"; gene_id "g497"; 7 AUGUSTUS start_codon 2441363 2441365 . - 0 transcript_id "g497.t1"; gene_id "g497"; # protein sequence = [MHSHHGSESTLAFPYLRSTTSLSQSLTSEQEQSLRKAKSSLFLHNAKASTSNVPGPSAPPSSAGVAKSMLLPFMRKRS # KSRLRAKTLENDGRDREHPSLRPKTPPLPEFPAYASSVTLNMVAENGQVIGNGKKKAVGGVSHPRRWKDKEKDRDRSYGDFGDHAPVPPPKDGEVVMR # LDTNLDRMEGIVDTSILSTGTSTMGILPSKGSSIHTLSQSISDDRHSQHSQQSSTNTQYNNLGPISHSEFHNPFSSFSSQSTAATSSSSFISHPSLSP # YSPPTSVSPPPPRGSSLAHINNVVDRKISPRTIVPNQQQHNKFREGLQPGLNVMIPPTSTNGLHGGVDSVNGLHRNDGSNAIVAPNAQPPVSTHPSDN # DAPPPDSPSWVPPQSWDVQFLDEGEHEAEDEYYSSSEDSLLHNLSGSIGSRNVGSGGRGTVGGGRPLEFARPSRGELDDDDEDDDLSAVRTGVGGLSG # VDEHGRRIERQPPGSVASIRSFSTNTSRYGSGTTSAYNPPSMAGSITSINSYSNLNGGGKSLVIVIRRVENSFLIRGRIVKATRLTISTAIIRWDQNV # KSTSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g497 ### # start gene g498 7 AUGUSTUS gene 2444375 2445133 1 - . g498 7 AUGUSTUS transcript 2444375 2445133 1 - . g498.t1 7 AUGUSTUS stop_codon 2444375 2444377 . - 0 transcript_id "g498.t1"; gene_id "g498"; 7 AUGUSTUS CDS 2444375 2445133 1 - 0 transcript_id "g498.t1"; gene_id "g498"; 7 AUGUSTUS start_codon 2445131 2445133 . - 0 transcript_id "g498.t1"; gene_id "g498"; # protein sequence = [MVDPAPINFNVTVPTLPFVVSLLSESSLTPIASVQTDPFALTHPNITLSITGHVLSLPPDAFPVLSAFLTHYLAGRSN # LISISTPLVSDMTIEANFPAPNPKPQILRNVTIHDMKIKPGNTFLASGTVLAHVVLPKGMDVDIDVKRVLPDVLVFDGEVPDDVHIGTPPVQPLPNPL # PEGAFGHIRPDDWLKSRCVSIDHEEGQGSSYAVSAKIVDVPLEVLPGRQKEFSDFVSKVPRVSPLLVHLELTMNSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g498 ### # start gene g499 7 AUGUSTUS gene 2448372 2448991 0.56 - . g499 7 AUGUSTUS transcript 2448372 2448991 0.56 - . g499.t1 7 AUGUSTUS stop_codon 2448372 2448374 . - 0 transcript_id "g499.t1"; gene_id "g499"; 7 AUGUSTUS CDS 2448372 2448600 0.7 - 1 transcript_id "g499.t1"; gene_id "g499"; 7 AUGUSTUS CDS 2448678 2448991 0.69 - 0 transcript_id "g499.t1"; gene_id "g499"; 7 AUGUSTUS start_codon 2448989 2448991 . - 0 transcript_id "g499.t1"; gene_id "g499"; # protein sequence = [MKGKYKGKSGDDIVLKVLKSVDDEAYAEVKALKGIGEYVDSGMFTVKGKEVPVIIMIKVPGSVLSDTPEYKKAKTDEK # EKMKEEAIDLMCKEVAEVGKSKGILHKIENIHVTMSGNKVVSAKLTDWGAYELYTMDKSASEAEIVGSVYNCHFIQLKIAMQIAFCKKHWTHVDWFVQ # ADFE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g499 ### # start gene g500 7 AUGUSTUS gene 2452042 2452425 0.41 + . g500 7 AUGUSTUS transcript 2452042 2452425 0.41 + . g500.t1 7 AUGUSTUS start_codon 2452042 2452044 . + 0 transcript_id "g500.t1"; gene_id "g500"; 7 AUGUSTUS CDS 2452042 2452425 0.41 + 0 transcript_id "g500.t1"; gene_id "g500"; 7 AUGUSTUS stop_codon 2452423 2452425 . + 0 transcript_id "g500.t1"; gene_id "g500"; # protein sequence = [MKNVQQTTQELLSRVTKINFLVLSPGLLSLNGRDETEEGIDRKMALHYYARWKFIHGLIPALLKAKEADEDAKVFSVL # AAGKGGKVDLDDLGLKKTFSLSAAASQVPTYNDLMMEVSSMYDCVFEWN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g500 ### # start gene g501 7 AUGUSTUS gene 2459614 2460477 0.89 + . g501 7 AUGUSTUS transcript 2459614 2460477 0.89 + . g501.t1 7 AUGUSTUS start_codon 2459614 2459616 . + 0 transcript_id "g501.t1"; gene_id "g501"; 7 AUGUSTUS CDS 2459614 2460477 0.89 + 0 transcript_id "g501.t1"; gene_id "g501"; 7 AUGUSTUS stop_codon 2460475 2460477 . + 0 transcript_id "g501.t1"; gene_id "g501"; # protein sequence = [MDGFDDLLAPSRSMLEDNPFNEDSNPFGSRRSGSPDPWASPFDHSHDAWTEDHHTQQSTEVEDYEPETPVSSSNISTE # IPTEPVDSAGPGDPLDSATANVPSSDEEDNKPLGFKRARNVSLKASGFKESVDIASEDTKEQEGRKDEGSAWKEEQAQDKGKGKEIEEVLEKAESLKG # FSETATIRPSMIEEPELQRHSTPPTVTSSTSSLSGPSSPTAVWGPLSGQTSGWGEHEPYSQPEFDDGMSASAPVVSRNRDEDDSDDDKPLAQSLSMSP # VSSTKPVSSTISH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g501 ### # start gene g502 7 AUGUSTUS gene 2463522 2464577 0.32 + . g502 7 AUGUSTUS transcript 2463522 2464577 0.32 + . g502.t1 7 AUGUSTUS start_codon 2463522 2463524 . + 0 transcript_id "g502.t1"; gene_id "g502"; 7 AUGUSTUS CDS 2463522 2463674 0.77 + 0 transcript_id "g502.t1"; gene_id "g502"; 7 AUGUSTUS CDS 2463844 2463949 0.4 + 0 transcript_id "g502.t1"; gene_id "g502"; 7 AUGUSTUS CDS 2464060 2464577 0.74 + 2 transcript_id "g502.t1"; gene_id "g502"; 7 AUGUSTUS stop_codon 2464575 2464577 . + 0 transcript_id "g502.t1"; gene_id "g502"; # protein sequence = [MLKAVENINNGELGQGVMVTPEGGYVVAQPDLYVLVAGFGQKLIISTVQGVTHLLERDFICPNPNCGKKIASLDKLSP # NHEKRRRVSRDFSSFAQETINLEQDFYSDQQPGMDVQQLIPMLQAQISQISVALQNPSLPPRVRQQTEVQQEQLKIQLQQAQTISVALAAATEFQQQQ # QAQQMQMQNIQQQQGSMGGSMGYNNNMYPSQGGPSQVVQDSAYQRLPVNNRRRNLKRDRPSDFLEIGNGANENDAKAARYWE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g502 ### # start gene g503 7 AUGUSTUS gene 2473508 2474641 0.81 + . g503 7 AUGUSTUS transcript 2473508 2474641 0.81 + . g503.t1 7 AUGUSTUS start_codon 2473508 2473510 . + 0 transcript_id "g503.t1"; gene_id "g503"; 7 AUGUSTUS CDS 2473508 2474641 0.81 + 0 transcript_id "g503.t1"; gene_id "g503"; 7 AUGUSTUS stop_codon 2474639 2474641 . + 0 transcript_id "g503.t1"; gene_id "g503"; # protein sequence = [MTNSDSSKKSLSVGLDVLFGLIGFFGLCFVLFGIRFCFMRRRYRGSGASTDEHGLPSRAFGDASATNSTKSGGLFAWF # HPKKISSPYVGDQKGLGAYELAGRTSPTTDTFPSEDALRQMRYQAYMNKERLTSEYTVSSEHTRIGDAEDGNDAEMGWRKKIGEKFPRDTSDGLTTSR # TLTQDADWNPAKEFDWNRDTLVGLDSPTHNKDEQIANARALSPEGRPIIPRRESSDTAGSRSSRFEPSTDLLGHGRGQSIALPLLQLPETALMLDNAP # LTSQSTQDTADRSPAQTTSSPENDWDLGEFGSGMAGVGSARRNERLRSESLDISGDINLPSSVERPASSYSSYSSRFERGRPARTPTGPRHSTLSTSS # SIIHD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g503 ### # start gene g504 7 AUGUSTUS gene 2475169 2475585 0.48 - . g504 7 AUGUSTUS transcript 2475169 2475585 0.48 - . g504.t1 7 AUGUSTUS stop_codon 2475169 2475171 . - 0 transcript_id "g504.t1"; gene_id "g504"; 7 AUGUSTUS CDS 2475169 2475585 0.48 - 0 transcript_id "g504.t1"; gene_id "g504"; 7 AUGUSTUS start_codon 2475583 2475585 . - 0 transcript_id "g504.t1"; gene_id "g504"; # protein sequence = [MLRMSSMMQGGMGGGMGGGGMGGGMGGGMFGSAPSFPAPGTPGGASATGTTLGSTPVTGTTPGSPGVGTGAANPLGMF # GNPAMMQQMQQMFGGGGGGLGGGLGSFGGMGGFGAPAAPTDSRPPEERFQVQLQVDNLFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g504 ### # start gene g505 7 AUGUSTUS gene 2478401 2480402 0.16 + . g505 7 AUGUSTUS transcript 2478401 2480402 0.16 + . g505.t1 7 AUGUSTUS start_codon 2478401 2478403 . + 0 transcript_id "g505.t1"; gene_id "g505"; 7 AUGUSTUS CDS 2478401 2479918 0.31 + 0 transcript_id "g505.t1"; gene_id "g505"; 7 AUGUSTUS CDS 2480061 2480402 0.49 + 0 transcript_id "g505.t1"; gene_id "g505"; 7 AUGUSTUS stop_codon 2480400 2480402 . + 0 transcript_id "g505.t1"; gene_id "g505"; # protein sequence = [MSVVKEGFKLSFFPSPPNDENLESRIDNLSRTLHFLHAHLFTYLPAAKCSSFLQSLCKPVISSVLNNLLISSLPYSFN # RLPSFLELVKDAVSFEQTCIIELLGNDSADRPIKAWADGVCGHYERQRRVHILENTRAKILEPEDFSDTFHVEVEVVQAAAEPEVVPIQEEGVAEDAW # GLEEDDASASAKVDDSGWGFEDDTGSAKTGEDGWGFEDEVNTDDMDKIDDGWGFDTAEEATVPTGDDPLPDIKPATNGHEPEPEAEDAWGLDDDATAD # DAPPASEDETNWDDPWGEKTSAPPSTSVESPRPPPAPSIKSPPKVATRLEKLANKGKKGLNGHSPMNSPSMAMAFSPNVSSPSFSPAIASPSFNAKVT # QSPSPSQPSLPSLPSAASKLAEKRPPDLSISAPKESYLVSTSMKDIIALVQETLREGGEVGDSKSLSPAHESSSAPGSTLYQTAVSILDLYRALYPVV # FSGILQSLEGPMRFSNNTLYLSTEIDIIVKELHGSNEKQRQLVDKILAESTQGFTFTGDQDRYDECESAMNRSLQEIRRVSQKWKGLLTKSKYYTALG # SVTDAALSRVVQDVLALGDIPELESHQLSELCRILLALEGLFSEDPEKVRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g505 ### # start gene g506 7 AUGUSTUS gene 2481461 2482816 0.53 + . g506 7 AUGUSTUS transcript 2481461 2482816 0.53 + . g506.t1 7 AUGUSTUS start_codon 2481461 2481463 . + 0 transcript_id "g506.t1"; gene_id "g506"; 7 AUGUSTUS CDS 2481461 2482816 0.53 + 0 transcript_id "g506.t1"; gene_id "g506"; 7 AUGUSTUS stop_codon 2482814 2482816 . + 0 transcript_id "g506.t1"; gene_id "g506"; # protein sequence = [MRGCYILCSRFGRVPSLQNHWRFLSLASTTNAHSTTPSPPDPFALVAPELSRIRTDLVRLLGSAHPGLNEITSYYFLR # PSKQLRPLIVLLFAQATNGLGKNWPLKKWASEQPRPGGRAENLDEPLSRANVLNDWNPNIQEKTSFYDPLHSLSIPPTPPTLPQPPLSISSSTERILT # SPASVLPTQMRLAQIVEMVHAASLLHDDVIDESPLRRGSLSAPEAFGNKFAVLGGNFVLGRASAALARLGDPEVIQLIASVIANLVEGEILQMQDVES # PDGEAVPSSQVAKNAWTLYLQKTYMKTASLMAKGARSAVVLGGCADGEVYKEVAYAYGRNIGIAFQLVDDVLDYEAAEDTLGKPGGADLQLGLATGPA # LYAWEEHPEMGPLIERKFGEAGDVELARRLVRKSAGVERTRALAVGYATQAREVLQVLPESEARAALEALTERVIKRRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g506 ### # start gene g507 7 AUGUSTUS gene 2482973 2483497 0.58 - . g507 7 AUGUSTUS transcript 2482973 2483497 0.58 - . g507.t1 7 AUGUSTUS stop_codon 2482973 2482975 . - 0 transcript_id "g507.t1"; gene_id "g507"; 7 AUGUSTUS CDS 2482973 2483497 0.58 - 0 transcript_id "g507.t1"; gene_id "g507"; 7 AUGUSTUS start_codon 2483495 2483497 . - 0 transcript_id "g507.t1"; gene_id "g507"; # protein sequence = [MKTFTSFDALIDSFTSSLPSFSQTYISSPDFVTVWATHLICRAATIKLHNVFTASNAFSRKKVLECAERCVMLGRGMD # LTSVEVNPIFGLLWMITGEAIINEISRLDDLNRQTMSLPNWVLEEATILGRVEMVALLEELFLTMELFGNRSGSKIIGMNSFHSPSATCSSYSFYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g507 ### # start gene g508 7 AUGUSTUS gene 2487094 2488101 0.68 + . g508 7 AUGUSTUS transcript 2487094 2488101 0.68 + . g508.t1 7 AUGUSTUS start_codon 2487094 2487096 . + 0 transcript_id "g508.t1"; gene_id "g508"; 7 AUGUSTUS CDS 2487094 2488101 0.68 + 0 transcript_id "g508.t1"; gene_id "g508"; 7 AUGUSTUS stop_codon 2488099 2488101 . + 0 transcript_id "g508.t1"; gene_id "g508"; # protein sequence = [MKRSSSPSLDITYHQSTAMIKSQSIPESPHRAKKRRLFETYTSESPFLNFPHPTPSEAVAVFNILSKAHPQYASTRMI # PKLTSNSAATCGNVPNVIDSLIGTILSQNTSGKNSSRAKSSLDVAFGRNNFAAIASSPREAVVEAIRHGGLANKKAATIQNLLKSVEERHGEFSLQHL # TETGKDGKQLSDEDIMKELTSYDGVGPKTASCVLMFCLGRDSFAVDTHIFRLSKVLDWVPSSADRILTQAHLDKMLPAELKYGLHVLMIQHGRTCKGC # KKVGSSTPCILKDLVKKNRPSSKLSEEPVVLVSNLPDPITKLMRDPPHSDTGRQDRKSRRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g508 ### # start gene g509 7 AUGUSTUS gene 2488146 2489685 0.62 - . g509 7 AUGUSTUS transcript 2488146 2489685 0.62 - . g509.t1 7 AUGUSTUS stop_codon 2488146 2488148 . - 0 transcript_id "g509.t1"; gene_id "g509"; 7 AUGUSTUS CDS 2488146 2489297 0.7 - 0 transcript_id "g509.t1"; gene_id "g509"; 7 AUGUSTUS CDS 2489677 2489685 0.62 - 0 transcript_id "g509.t1"; gene_id "g509"; 7 AUGUSTUS start_codon 2489683 2489685 . - 0 transcript_id "g509.t1"; gene_id "g509"; # protein sequence = [MDQVEAVLEEFEKRTADQDEHVVSTNSSMCLALRLNSRCIQIDEQRRYLGGDGEHSILVKGLDMALLQQNKAKAATAT # DEDESLEQAYTQSASEPIVSSTKKRTREEIIRELKEQRAQRGESNLVEDPTLNKNKFKPIGFKPIGGSVEQKKNKKKVKGDGERKKKRRKVELSAEDK # SAKSMATVQPTSTTSTVPKSPRLLELEELQPPEEFDIFAGVGDYEGVNDDDDDESEGEGEEKEKTEEVISRSLRPGQWFVTDEQTEKSPGIADESPLG # PTPGPSVSHPPPIEEAQASDEEQLTRLVPLSSSAVPSIKELLAIDEAAEAADKKHKRKNKKRGGDGAGSKKLDAEAKANRDYQRSVVVPSKLEIFSNK # QYRLKSYTDKRGDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g509 ### # start gene g510 7 AUGUSTUS gene 2489941 2491593 0.96 + . g510 7 AUGUSTUS transcript 2489941 2491593 0.96 + . g510.t1 7 AUGUSTUS start_codon 2489941 2489943 . + 0 transcript_id "g510.t1"; gene_id "g510"; 7 AUGUSTUS CDS 2489941 2491593 0.96 + 0 transcript_id "g510.t1"; gene_id "g510"; 7 AUGUSTUS stop_codon 2491591 2491593 . + 0 transcript_id "g510.t1"; gene_id "g510"; # protein sequence = [MPIFQQDNTVGSTLELVNPLDSLPNELMAKIFGVGIELDRRNELPRALITYCSVSSRWREICQHSSELWTDVRIPLRH # TRPKGIVARTTTQLERSNPRPFDLTLTIPPIMPTVDLFDEPQDEFELIRDILSVLSPHLPRIRRLSFITELPYYAREVTFTCSRLAAFEAPQLSHIHL # QFGVLGISEFLVPMDRIIPMLFKSVPRLKHQRVYGVDIQYPLHGLTSLHLSHLLPDETNFRYLSINSPALEELCLISLYPMAHAAEPVQSKISFPALR # SLRVSFARRAFASGTCILALMSPPNLTSLEIRGFAFPDSLNSFPDSSLLTQLHTLRLEQVIFTSPNSFDVPLHDASFYLGLTAVRHLQLINTPPQSLF # PEPEAKVKPLLRARSGDFRERLDVSRRESTLHPPVLANEMDSSVLSKHKGELFQLLFSPEDTPKSKSSIVYTHWPNLTTITLDTIRAKDVLWLCELVA # VRPEVETVHLSRSAKRHLASSLTMWKGEKKDRFSSWDIDMERKNLVRRRPDVEKGDMDPVGWLEQRVKVYELESDTNGPW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g510 ### # start gene g511 7 AUGUSTUS gene 2492067 2493376 0.81 - . g511 7 AUGUSTUS transcript 2492067 2493376 0.81 - . g511.t1 7 AUGUSTUS stop_codon 2492067 2492069 . - 0 transcript_id "g511.t1"; gene_id "g511"; 7 AUGUSTUS CDS 2492067 2492812 0.99 - 2 transcript_id "g511.t1"; gene_id "g511"; 7 AUGUSTUS CDS 2492869 2493376 0.81 - 0 transcript_id "g511.t1"; gene_id "g511"; 7 AUGUSTUS start_codon 2493374 2493376 . - 0 transcript_id "g511.t1"; gene_id "g511"; # protein sequence = [MLKRRFVPCVFDEVENVEDYQPGGFHPMRIGDKFDNGRYRILHKLGNGGSSTIWLARDEHSSESGVGKLVTIKALRAD # ASKINSPELVVPTLMPSSESFDFYRKVEDNFVVNGPNGTHMFIVYAFAGPSVRAISKSPENRRLRADLARKIAAQASSALQRIHHAGFIHGDFTTSNF # LFRLTDEVHKWSDDEVYFQLESPETDAVQMLNGQPIGPQVPSEVTEAIDPFIFFENDLLQESIVVVDFGQSYAASEPPKDYKPRTMINYMSPEARFEG # RVGPESDVWTLGCAIFEIRAGFPLFDPFFPSDAVILTKIVGTLGRLPDPWWNVFKNRHLFEEDGRPKTNGIAVTPSIRELLQSIGTRDEILDSDGGSM # FEQTETRIDGTEVDLLVDLLEKMLRYRPEDRIGVDEVVNHSWFKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g511 ### # start gene g512 7 AUGUSTUS gene 2496531 2499917 0.64 + . g512 7 AUGUSTUS transcript 2496531 2499917 0.64 + . g512.t1 7 AUGUSTUS start_codon 2496531 2496533 . + 0 transcript_id "g512.t1"; gene_id "g512"; 7 AUGUSTUS CDS 2496531 2499434 0.64 + 0 transcript_id "g512.t1"; gene_id "g512"; 7 AUGUSTUS CDS 2499594 2499917 1 + 0 transcript_id "g512.t1"; gene_id "g512"; 7 AUGUSTUS stop_codon 2499915 2499917 . + 0 transcript_id "g512.t1"; gene_id "g512"; # protein sequence = [MTQSSSSTVTTNVNLLNLIPSRSTPFSRSSKGFDVQFIAFFFCFISRILSDLIQLWITVAPKSVIALVVVDSVPQLTS # ELYSDMPSRIVGRRKLKQLLVWGNDLGLHPLHRNQRCNTILCLILVGSNIMRLKGSQSYPSSPTHQPRSYPSPPARGPRRYLPNNDFQNSRRSSIPSG # LDESVLPSPPAASPEPEDELDEDDLNEQQVEDAHARYTTAFLENLHLHERGVGDGQGVIDGDEESDEEEEREGSNENVGAKSSIEDIRIADEFIQLLR # EATLENSGLDERTIERLRNPIEGPPDELDPDTRLSIDLYLSITHASEATYSSVRNAILLRFPETNILSYHCVKSFIADTTGVISMYSDMCVNSCHAFT # GPWTDLEHCFYCNEPRYDLDQLRRTGDKVPRLQCSTILLGPQLAANRRSSEGADGRKYRTQKLDQIRRMVEDYDDEVEGAEMIYDDIWCGEDVRQLVE # NIGMTEDDVAISASIDGAQLYQNKKSDCWIGIWINQDYAPDSRFKKKKVLPNIIIPGPNKPKHTDSFLFPGLHHLSALQKENNGRGMKVWDALVKKIV # YQRVIFLLGLADALGMVEWDGRVGHHGAQGCRVGCEMKGRHKPNSGHYYAVHARPNNASILDNQHPDTDIQGLKPQTAVQYDEKIAKLRASKDKTEYK # YNRKATGLSKPSILSGLHPGYSLPVPRCFGLDLMHLLLLNLEDLLLCLWRGTLKREVSDTDAWEWVKLVGSTWEDHGKTVANTTQYFPSSFQRPPRNP # AEKLSSGYKATEYYLYVFGLGPGLFRTILDAEYWQNFCQLTSGVRILLQWSITGGQIQNAQRLLVNFAEGYENLYYQRREDRLHFCRPCVHTVGAHAV # SEIIRLGPGAYSTQFAMERTIGDLGQEVKQPSNPFANLAQRALRRAQVNALKIILPEVDSDTGYTLPKGAIDLGEGQVLLRPRERKLYQAEFKEGDLL # MNQFGSSYIKSNGITEFGEVWYYFITTDKEVFAMVSVYGRPDPDLLCQSSNALWACKYLSSQNLHVVPVARLQSVVSMQPLPIFPHEQEGQWFVVQKP # GIDNALITGHEDNMDVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g512 ### # start gene g513 7 AUGUSTUS gene 2500353 2501712 0.77 + . g513 7 AUGUSTUS transcript 2500353 2501712 0.77 + . g513.t1 7 AUGUSTUS start_codon 2500353 2500355 . + 0 transcript_id "g513.t1"; gene_id "g513"; 7 AUGUSTUS CDS 2500353 2501040 0.78 + 0 transcript_id "g513.t1"; gene_id "g513"; 7 AUGUSTUS CDS 2501210 2501712 0.97 + 2 transcript_id "g513.t1"; gene_id "g513"; 7 AUGUSTUS stop_codon 2501710 2501712 . + 0 transcript_id "g513.t1"; gene_id "g513"; # protein sequence = [MSGNIVYIELRTRNLELSAELRASQYVAFHVFIIALIFSLRKLNSTYENILQSRTVFPPAPATSTLISSTATHSSTTP # ASGRLPKIETTFEPLTKEECCNIRFYHEKEWNDYKEQKKDTNEKAPKALGFLQAHDGTYTTGDASRLAQFYQHAKSLFNLFYTLYLDADSWGRMSSEV # AGYFYRAMAAEFPELRSCNDGKWKARVYATNKYPDWKRDYRDQDKLMRDTAMEVLAISVDSVSKVSKIPDPPLSLPVNEPGSTLPIAVLDTDEDMVTA # KSSNVFDTVSPASADLVSATSAPGNIPAESMTYGSEFSSISVLQHQTSQVSPQSDPPVTSASESSSAAMESNQSSSVTALASPEVVMTPSASSSDSAT # TNDLVDFAPKGFGNMRTRVSMLRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g513 ### # start gene g514 7 AUGUSTUS gene 2503103 2504738 0.77 - . g514 7 AUGUSTUS transcript 2503103 2504738 0.77 - . g514.t1 7 AUGUSTUS stop_codon 2503103 2503105 . - 0 transcript_id "g514.t1"; gene_id "g514"; 7 AUGUSTUS CDS 2503103 2503711 0.77 - 0 transcript_id "g514.t1"; gene_id "g514"; 7 AUGUSTUS CDS 2504280 2504738 0.77 - 0 transcript_id "g514.t1"; gene_id "g514"; 7 AUGUSTUS start_codon 2504736 2504738 . - 0 transcript_id "g514.t1"; gene_id "g514"; # protein sequence = [MNKDEAIRCLSIAQKHRDAANYSSARKFALKSISLFETPEAHKLLQSIDNAEAASASSSSSGYSGSTSNAASSSASGA # ETHPSAAGATHRHTQSSSTQPNGTAGGQGGKKREYTAEQHSMVRKIRACKITEYYEIMSLKRDCEEVEVKKAYRKEQQANQVPRSTFIQLLPLIILFG # FSMLSALPNLFATPPVPDPNFSFASTSRYHLERHTPTRDVIYHINPAEFMHHPVLGPELVRDGVDLKAEYQKVKKEKESKKKEQTEERKEKPKDDEEK # EKTKVKRGPHMTKFEDGVERAYISEVWTQCRRGQDRKERLLDAERGIFGIGTDWDKVRKIQKEPIEACVELERLGVGRGQM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g514 ### # start gene g515 7 AUGUSTUS gene 2507060 2508511 0.4 - . g515 7 AUGUSTUS transcript 2507060 2508511 0.4 - . g515.t1 7 AUGUSTUS stop_codon 2507060 2507062 . - 0 transcript_id "g515.t1"; gene_id "g515"; 7 AUGUSTUS CDS 2507060 2507870 0.71 - 1 transcript_id "g515.t1"; gene_id "g515"; 7 AUGUSTUS CDS 2507967 2508511 0.43 - 0 transcript_id "g515.t1"; gene_id "g515"; 7 AUGUSTUS start_codon 2508509 2508511 . - 0 transcript_id "g515.t1"; gene_id "g515"; # protein sequence = [MSGDRDVRTRNHRPDDSRVKVEFRERENQQPVNTDADADGDLDADADGDPESDLDGSNHIRVVDLSRPPPGQIHISET # HNNNEEHSTSIVLSHQAGSVAPPLDTSAPSTEGGSQSEPIMYSPAAGIFPPGPAHESRRRNAEQRAATLRADTLIKHVEPNRVFCSLCEKWVQLRQDS # SFCAYPQRRAQKAAEIEDIKKRRTTSGTSAQSIHAHDPQRYAPPPPYPPRSHHLYHPSTSHHPHYTYPAHPPHLMYPQGGRLVRGPHPHNGGEEDELA # YFSGSDQGRSDEDDIPFNYRGLSASASPDSEGRSVSVGSRASHNERSGLEYATENADHVHSRTQLREEAENTEPDADSNVVDSNARPNGETRAESSGD # KIEKEVGAEGEMNGSGEVRIHLSAAYILLSLLISSEGKQARPIYESNSKSAFDTRSSSLDFNETSSYRASRHVHSRTTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g515 ### # start gene g516 7 AUGUSTUS gene 2509384 2509740 0.43 - . g516 7 AUGUSTUS transcript 2509384 2509740 0.43 - . g516.t1 7 AUGUSTUS stop_codon 2509384 2509386 . - 0 transcript_id "g516.t1"; gene_id "g516"; 7 AUGUSTUS CDS 2509384 2509740 0.43 - 0 transcript_id "g516.t1"; gene_id "g516"; 7 AUGUSTUS start_codon 2509738 2509740 . - 0 transcript_id "g516.t1"; gene_id "g516"; # protein sequence = [MQAIFTLPLDWSLMSFHYRNPLKRKTPPVDDSSAEHNGATAVVLDDGDSGSADGDANERDDIRNEPRGTSSPPPFQER # PGEYETGRIDCPSCHKQVAFRDEETGEFSLKRWQQHWESW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g516 ### # start gene g517 7 AUGUSTUS gene 2514497 2515315 1 + . g517 7 AUGUSTUS transcript 2514497 2515315 1 + . g517.t1 7 AUGUSTUS start_codon 2514497 2514499 . + 0 transcript_id "g517.t1"; gene_id "g517"; 7 AUGUSTUS CDS 2514497 2515315 1 + 0 transcript_id "g517.t1"; gene_id "g517"; 7 AUGUSTUS stop_codon 2515313 2515315 . + 0 transcript_id "g517.t1"; gene_id "g517"; # protein sequence = [MNNPPLQNESEELRKFREEWRAEVRRRNGVGSVTRSESTEASDWPDTASLNVFSTSSGPASSGYATSVATVPPTPSTS # FHVSTAPPLSQVSSLAVSIYREAVIHEQRGELEEALYLYRSAFRRDANVDILFEREEMLGAIMAQQIAPVSSASAETFDSSTLTPKVILAGNGFTMDD # LSKKLENTLAMQSTKAAVSPAEHGVTASRSLNSILNNFPRDLVFEPEDEEDSVPFNLLPDEMIVYILKILDASSLERFASVNRKARVVSLDVSIWR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g517 ### # start gene g518 7 AUGUSTUS gene 2517753 2518331 0.59 + . g518 7 AUGUSTUS transcript 2517753 2518331 0.59 + . g518.t1 7 AUGUSTUS start_codon 2517753 2517755 . + 0 transcript_id "g518.t1"; gene_id "g518"; 7 AUGUSTUS CDS 2517753 2518331 0.59 + 0 transcript_id "g518.t1"; gene_id "g518"; 7 AUGUSTUS stop_codon 2518329 2518331 . + 0 transcript_id "g518.t1"; gene_id "g518"; # protein sequence = [MTVNGYLQWVSEQSQAILDQLREATNSEGGWDHAVRVAKEHRAELDAASAIGSSHSSGTSPMGTPPIPDGVQASYVDP # DTAKALRKRLASMSDANGVVDADTKNVVDSLNDPNTYKKTDEHIPSATAPHPLIDHPDENISNLAKDYSELQGELVSTGPLYIVWPNNITFKNFAVYM # LIPTLVYELEYPRTNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g518 ### # start gene g519 7 AUGUSTUS gene 2519460 2520896 0.42 - . g519 7 AUGUSTUS transcript 2519460 2520896 0.42 - . g519.t1 7 AUGUSTUS stop_codon 2519460 2519462 . - 0 transcript_id "g519.t1"; gene_id "g519"; 7 AUGUSTUS CDS 2519460 2520896 0.42 - 0 transcript_id "g519.t1"; gene_id "g519"; 7 AUGUSTUS start_codon 2520894 2520896 . - 0 transcript_id "g519.t1"; gene_id "g519"; # protein sequence = [MPRSQLFQTHGQKPHDNSNKPETIEFPSGSPVSSSSTSESSTYFPPPSTSFERKQELPTIYLDSDHDSAPAILIHGTN # SQSPVPKESSHLSLIKSIAKKASMKRLRSVSRPSTSFHHQNHHDNHNRDTSDSSLSSSTSHASTLSTSSNTSAFSKDSPPSNPPSYHRTRLLSLPSFH # RRSRTSHSTSEQTLDPDTSNFASGAYDSYDGNSVPSSQRSFEVLSRPRRAQSQNMEVIEQITLKRDPDAEIKPTTNPTHSIVCCRCGSEVHNAAAVEV # SKEFLGPIDSDAKLDLATKDVQSGKPLASEDENLRDIPSSSSPSFPNLPGPLDLVQATNEDVEADGALERTAESFTDVDIPTPETQEITDKTTTEASQ # TNVTVVSPRNSKTIHPGPNSSDEVIPPPFLVGPFILDELAMPILSGTRPLSFFFRRIFWGSLWRDLWHALTRKLQVDVRRRISVYLTWWLSRVTLLFP # RGFSASRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g519 ### # start gene g520 7 AUGUSTUS gene 2523593 2523871 0.49 - . g520 7 AUGUSTUS transcript 2523593 2523871 0.49 - . g520.t1 7 AUGUSTUS stop_codon 2523593 2523595 . - 0 transcript_id "g520.t1"; gene_id "g520"; 7 AUGUSTUS CDS 2523593 2523871 0.49 - 0 transcript_id "g520.t1"; gene_id "g520"; 7 AUGUSTUS start_codon 2523869 2523871 . - 0 transcript_id "g520.t1"; gene_id "g520"; # protein sequence = [MNRSYPNTTNGMPISTAMNQVLQVRRQDKRVELNVLLEDAMNSMTVSGSTCELTLKEVHPWDLFYTSRIFEKAIRLLK # CLAQVLLSIMKEGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g520 ### # start gene g521 7 AUGUSTUS gene 2524967 2526376 1 - . g521 7 AUGUSTUS transcript 2524967 2526376 1 - . g521.t1 7 AUGUSTUS stop_codon 2524967 2524969 . - 0 transcript_id "g521.t1"; gene_id "g521"; 7 AUGUSTUS CDS 2524967 2526376 1 - 0 transcript_id "g521.t1"; gene_id "g521"; 7 AUGUSTUS start_codon 2526374 2526376 . - 0 transcript_id "g521.t1"; gene_id "g521"; # protein sequence = [MTKLIKPHPPHTPSRTNAHTNESKESEEVQEPKDSKAVVFPTTSDASPFSTPSKFSKFHRSSRHSTSSTSSSDNQDDH # DGLRLRKPSLLKTVKRVSTKQLRSISSTLTNSAHRITLHGHGHGHHIDHSSESSESSQLSEPPHLTQSFDSSHLAPSPRSSQSAEHPELAEANSDSSS # KDARRRRVSLPSFRLLRPSSYSRSRTGSNVGSVPSSTVTSPPVPPVPANLDIGVGRSHSSPSISTERNIESTVLSPVLASPAVTPTTTAATPTSPTPM # AVSVSTALSADGEGRDTKDFRATSLVTGDDSFHHADAQEARPHPPGLLVSVELVPTSPITSNERAKAQTPSVTSRGVSEDDTVASLPPLPSSSRSVVS # LSSFFSYTLPPSASPNHYSWTDDIDEQKGSEDESEDEDEDSDDDSEEHIKTEKDLNRVGSHRVLEGPFISSVFILVPVFSVRRPIGFYLTWWLGRNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g521 ### # start gene g522 7 AUGUSTUS gene 2531393 2532961 0.66 - . g522 7 AUGUSTUS transcript 2531393 2532961 0.66 - . g522.t1 7 AUGUSTUS stop_codon 2531393 2531395 . - 0 transcript_id "g522.t1"; gene_id "g522"; 7 AUGUSTUS CDS 2531393 2532961 0.66 - 0 transcript_id "g522.t1"; gene_id "g522"; 7 AUGUSTUS start_codon 2532959 2532961 . - 0 transcript_id "g522.t1"; gene_id "g522"; # protein sequence = [MDSVRQILTHGDAGSEHGSSGTASTQNGYLATPQSGRAPSSSSTISRSISPFKKFARRLTGSARSPVSPVTPLSINKN # NGARAPSSEPVPLRRQKTSLFTSLRGPTTPITPDRPSHKYSQSLTPDSSPRNARVDSKNNGGKTLNKSPWNSSTKVEPEATIKGTPPKRAPSAAGLYS # DVSYSSSSVNFGDGTYRRSLSRVSMASSRPWSPVTSSVSTNQSSNAFYRPHPPPPPIPLSFRPPSRAQTPSRARTPGLTSTTPRPRPKTPSHIPGPSD # KLRYIAGKSDAGWDEDESVSGRAFSPTQSVTSTPGDGGAHPPRPPSRSMIPVPALHLSSPSRPGSSMSIRARSESPSFTFKAHAMRSQTPESTLKARS # QQVPVYQGTFGRSSARPSLPPSSFRDGSSSRAPSRSTSRAGASTPSGTSGLPTYEYVPGNNKDPLDVEVAFIVNSIAHGLLIERVDPPIKRVPGENEE # VKAQYAFSNALSRKVVTCKLTTLTRSGKSGTMTTKKVMCRVGGGEYSIPQYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g522 ### # start gene g523 7 AUGUSTUS gene 2533139 2534189 0.32 - . g523 7 AUGUSTUS transcript 2533139 2534189 0.32 - . g523.t1 7 AUGUSTUS stop_codon 2533139 2533141 . - 0 transcript_id "g523.t1"; gene_id "g523"; 7 AUGUSTUS CDS 2533139 2533811 0.71 - 1 transcript_id "g523.t1"; gene_id "g523"; 7 AUGUSTUS CDS 2533929 2533961 0.45 - 1 transcript_id "g523.t1"; gene_id "g523"; 7 AUGUSTUS CDS 2534044 2534189 0.63 - 0 transcript_id "g523.t1"; gene_id "g523"; 7 AUGUSTUS start_codon 2534187 2534189 . - 0 transcript_id "g523.t1"; gene_id "g523"; # protein sequence = [MPSLSLSPSQGSLSSSTSGSNYAPPSPESVNCASSSKLSLDQQDEGVYRKLPGRRARKSTREFSVHSILPLLFEPSTN # PRNHLEIQELRHKSQSNGDAASTTSIIDQSLMSLDEKLESVSKGIKSINDSLDPYLQATPTIPHNGSEAEANETAAIIRKHNTLVSEWEAVQDESEVL # REELKEDKWLTVFRTVTDQADGMMSSLEKGVNRCQVRSFYDCGEDANVVADRNLYGKFTGEVLRIRWVTRRFRLHGPKRLHQHLKHSLRCWILSKQRR # SMISCHLSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g523 ### # start gene g524 7 AUGUSTUS gene 2536383 2537054 0.75 - . g524 7 AUGUSTUS transcript 2536383 2537054 0.75 - . g524.t1 7 AUGUSTUS stop_codon 2536383 2536385 . - 0 transcript_id "g524.t1"; gene_id "g524"; 7 AUGUSTUS CDS 2536383 2536670 0.75 - 0 transcript_id "g524.t1"; gene_id "g524"; 7 AUGUSTUS CDS 2536755 2537054 0.76 - 0 transcript_id "g524.t1"; gene_id "g524"; 7 AUGUSTUS start_codon 2537052 2537054 . - 0 transcript_id "g524.t1"; gene_id "g524"; # protein sequence = [MENSSRARFELSDNDNDNDHSESILSTTPNVYIEPEVPDPFLIDSDASDEEPEAHAKRKQELSVATATQSFSQQNLIK # NGPPSPTESEEEDAPEIYLPGLTDPLTTLLNKYIHPPERRPMRDISGEWQKNNFHTLVVSNIVPRRVRITNFVQLTNSWRALARMARDRLVTTDPEDL # ALVLGVSYTTRFCAPQFNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g524 ### # start gene g525 7 AUGUSTUS gene 2537767 2539803 0.95 + . g525 7 AUGUSTUS transcript 2537767 2539803 0.95 + . g525.t1 7 AUGUSTUS start_codon 2537767 2537769 . + 0 transcript_id "g525.t1"; gene_id "g525"; 7 AUGUSTUS CDS 2537767 2539803 0.95 + 0 transcript_id "g525.t1"; gene_id "g525"; 7 AUGUSTUS stop_codon 2539801 2539803 . + 0 transcript_id "g525.t1"; gene_id "g525"; # protein sequence = [MGERGIIEKTSPGPSSSPSRVSLPKRRPRPEGSALRNQVVYAAVQKAKLRKPSTFIVPKHPAPVEKVTDLEAAHHDNT # ALLLRRWYRNDELVWVELESPIAGPKGNGDVINAWPAIVEDSWTRSNPSQKSEDSTTSSQNGLYPDYDPENPPWTVTHHTKYKLRLLATSCSMMARDD # QVLPYQAYLPPTELIYALQDVPLSKIRLDAEYTTNFTPVISENPEEAASPPPSFEDSTGPYALAIQIGSQIAGFWGLTDDWDFKFSFKSDPPPTPPSG # PSISSSAGYSLQDAIVAASNSNAYNAGPQTSYGSSDISGNRYMTVEELNRTKATTLGAPKAVGHTFTQKNFHGLWWGAERIWTGDLLRLKIGRNAIAR # DGAPHILAPSPAGPSALLHSAQNGDNLDPKELGARSRGVFMRLDALFTVEVDLGKGRKRNECRAAGTLYELADIDWVDPSEDAAKKPSSTPLGTDSAI # FGKDSNGMSKVLPQPSPLKPTALPNPNPTIPIAETAPQMLSEILPHSSVPENKANGVYKPPIPVSHYDLPQPPTGFKFRPILDPGYEAVFSLTLLSGR # YYPGILGHPLLMEAIHQALTPEGKIDPQTSHLWALEGLEPGFSNSVDPIRYKKDRLRMVVDGEVNARAQLTEHLSSNSEQADGDVLMENGNAEQSMEV # DPVSNDQMQVDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g525 ### # start gene g526 7 AUGUSTUS gene 2547718 2548560 0.79 + . g526 7 AUGUSTUS transcript 2547718 2548560 0.79 + . g526.t1 7 AUGUSTUS start_codon 2547718 2547720 . + 0 transcript_id "g526.t1"; gene_id "g526"; 7 AUGUSTUS CDS 2547718 2548560 0.79 + 0 transcript_id "g526.t1"; gene_id "g526"; 7 AUGUSTUS stop_codon 2548558 2548560 . + 0 transcript_id "g526.t1"; gene_id "g526"; # protein sequence = [MSGLDPEEILNSSLETLYDYQPITLASTGSVFTYNLKKSKDSALNVTLYTPDTDASNWSLHASSIWASSQYLVDYIDD # LHLESHIAAISQEKVRLLELGAGAGLPGIVIAKSHPDSVLVTVSDYPDENIIQTLSENIEINRVSSNCCAKAYAWGTDSGELLLAQPSNQIPRLFDVV # IAADTLWNSDLHTVFIDSLKRTLRKASGSRVHIVAGLHTGRYTLQSFLDAASQSGFDIESVEESDRSGSRRREWDISRAEQEDEKERRKWLLWIVLKW # SVFSFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g526 ### # start gene g527 7 AUGUSTUS gene 2548712 2549467 0.66 - . g527 7 AUGUSTUS transcript 2548712 2549467 0.66 - . g527.t1 7 AUGUSTUS stop_codon 2548712 2548714 . - 0 transcript_id "g527.t1"; gene_id "g527"; 7 AUGUSTUS CDS 2548712 2549467 0.66 - 0 transcript_id "g527.t1"; gene_id "g527"; 7 AUGUSTUS start_codon 2549465 2549467 . - 0 transcript_id "g527.t1"; gene_id "g527"; # protein sequence = [MSLYNVSKVASISVVREFELPETWSNTIVKFLPNSSPRSDISQSSDALFYAAPETRVFAISSTPAAISHSGYYPMNWL # FLKESYFRFPSRKDGFRVSWRQWGRYCLIKEIDVPPSAIRGPCVVGTKVFYVENALAHSSRSPTPSSRSTRLRVIDFSPFAEPDEFPRGWTFVGPRAS # LFPIESRRSIPSSSVDGLPVEGLDATEDNVILFLVKGFTFLLSDCNQPEGFVGIATRSSIRQRADFWYTHSRQWD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g527 ### # start gene g528 7 AUGUSTUS gene 2554464 2555624 0.51 - . g528 7 AUGUSTUS transcript 2554464 2555624 0.51 - . g528.t1 7 AUGUSTUS stop_codon 2554464 2554466 . - 0 transcript_id "g528.t1"; gene_id "g528"; 7 AUGUSTUS CDS 2554464 2554878 0.51 - 1 transcript_id "g528.t1"; gene_id "g528"; 7 AUGUSTUS CDS 2554930 2555624 0.55 - 0 transcript_id "g528.t1"; gene_id "g528"; 7 AUGUSTUS start_codon 2555622 2555624 . - 0 transcript_id "g528.t1"; gene_id "g528"; # protein sequence = [MKACDVIVQERQKQLNDCKENLLSAIKDGVKREKDLNKKLNNAGGESMFLEWLRICRTDGVEDLEATNIIRSLIEKAD # APTMKAKPRKDDVTLSESLKAQVWDHREKTHEIRRLTKELVGRVRSLRYFTVVRDLQKQREQPPVLSCPVCGRKALEVEDASVLSSCGHIGCNDCVRS # CAEKEECVYSASGGCKSAARVINVVKAETLGVDDVERDGTGKHFGMKLEQVISLIKKQIPKDDRILVFVQFPDLMKKVTEAFGHHKIQFLEIRGTAAQ # KSKNLEKFQNESKERVLLLNVMDESASGANLTSANHAIFLSPLLAPSQEIYNACETQAIGRLVRFGQTKHVHIYRFLTKNTIDEEIYLQRKGPHK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g528 ### # start gene g529 7 AUGUSTUS gene 2556085 2558175 0.28 - . g529 7 AUGUSTUS transcript 2556085 2558175 0.28 - . g529.t1 7 AUGUSTUS stop_codon 2556085 2556087 . - 0 transcript_id "g529.t1"; gene_id "g529"; 7 AUGUSTUS CDS 2556085 2557145 0.8 - 2 transcript_id "g529.t1"; gene_id "g529"; 7 AUGUSTUS CDS 2557197 2558175 0.29 - 0 transcript_id "g529.t1"; gene_id "g529"; 7 AUGUSTUS start_codon 2558173 2558175 . - 0 transcript_id "g529.t1"; gene_id "g529"; # protein sequence = [MQVKNKIVGIEDPVQAGEYERRLKRRPSPFVTQLMLTDDGTGTVRIGINVPSLLHRALSRLPSEDRSEKPVLSWRLDT # NFTPAASLNLPKFTILSNKLDKEHAQPPSFKLNLRKEQTRSLEWMIRQETLNAEPFVEEEISEAVLDPLGWRAEGLARRPVHVRGGVLADQVGYGKTA # ITLGLIDCTWKTVEAEFSKQKPIDGKLSLKGTLVIVPPHLTRQWDSEVRKFTGKRFKTLVLSTVSNLNSATIDDFKEADIIIVASNIFKSNVYLDNLS # SLAAVGPLPSKDGRQFNDHLRTVCIALRSQTNRLREEGSAAVKAEIAEAQRRAEDEATQVSQLQSKRLKGKSYRNAADALEKGETTEQQEVSSTKGEP # KRTRTVLDSVEIPVYRANSKLASKSSGAETSSDADHDEDGDVLTKRSRRAAARKPIVLSDDDSSDDDSKKIAPKKKATSKSAKNSRARKHVNRRQAMS # DDGDDSFVEDSSNEGGSDEADSSEVPSEDDIPSPKSKAKKIQVKKKAAPPPSSASEDDMDVDEDLQSSAKGKRKAKGDENRPAKKQRVDTDPWKLASG # KVLRDWTQMHAPPLEMFHFARVVVDEYTYLDGKVHALVNNLTAARHWVLSGTPPVHDFGALKTISAFLDVHLGIDDDGEGQSAEIKKRKKERTGKHTT # MQKLKPEDLCVFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g529 ### # start gene g530 7 AUGUSTUS gene 2558349 2559941 0.55 - . g530 7 AUGUSTUS transcript 2558349 2559941 0.55 - . g530.t1 7 AUGUSTUS stop_codon 2558349 2558351 . - 0 transcript_id "g530.t1"; gene_id "g530"; 7 AUGUSTUS CDS 2558349 2559941 0.55 - 0 transcript_id "g530.t1"; gene_id "g530"; 7 AUGUSTUS start_codon 2559939 2559941 . - 0 transcript_id "g530.t1"; gene_id "g530"; # protein sequence = [MIGLEALSMQGLPVDRMLLTRETEDQLADLAGNAMSTTVVGACIIGSMIVGLRLFKKGDEKAVYGGGDAFEEFEDVEM # KDIESSAKPPPELPVDERIVGEKSLIFEPLNLTATQSQSLAHLLGIASRTVRLCSCEGRTDITSRPLSRCVDCGASSCKRCGGRPEHNTEPIDIIANP # RLPPSTFEMELKSALPMCLSLLNVTTKLLDELNEKTLGDLNGKLWKEWCTAVLVASSSDLRYVELKRQEVWSAIFRSPHGSLELHLDPQQPEWRFFAK # PKDNEPTNAQIRQILDNPVGRLICQGSLLSGQWAFALPKSTEVEITMKGSGSLVPAWESRLGLQGEAFREKKVWSEIQVSVPKADKPKFDRDISGTYE # LLDRCGTACNALHKQKGSDLSLPQLYMLLVPHRTKDFEDCFMFSTEIRRLEFGESRPFVARLSTKWRQSSTDDSEKVACLLPFQWVESSAINLQVSYI # VFLDSMSSNNVQSPRQVKMHALESLKTQSECRVLMSRANMRKHYFLSVLLSEARRAQNGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g530 ### # start gene g531 7 AUGUSTUS gene 2560289 2561434 0.56 - . g531 7 AUGUSTUS transcript 2560289 2561434 0.56 - . g531.t1 7 AUGUSTUS stop_codon 2560289 2560291 . - 0 transcript_id "g531.t1"; gene_id "g531"; 7 AUGUSTUS CDS 2560289 2561434 0.56 - 0 transcript_id "g531.t1"; gene_id "g531"; 7 AUGUSTUS start_codon 2561432 2561434 . - 0 transcript_id "g531.t1"; gene_id "g531"; # protein sequence = [MAKEVKAKPKQKTLDRFFKGPTVSKGSKPSEDDDADDSMVIDEEEDAPQAKKGDFSGLPPLNDISAMFNDIVSRASEL # KDVATHLQGRKFRVATMCSGTESPLLALDMIVESISAQYGVKLDVEHVFSCEIEPFKQAYIERNFHPPLLFRDVCELGSDKACVFSILTDNRTLADIL # FRSHTAYGALATVPGNVDLLVAGTSCVDYSNLNNEKQDIDANGESGRTFRGMMGWVTRHRPPIVILENVCSAPWDRVKEKFEKHNYSALHIRVDTKQY # YIPHTRTRVYLVAVDQKNSPIPKKWKEWVERLRRPASSTLDSFLLPIDDPRIHHSRQKQAQESQNSLDRRTGRTDWSRCESRHQRARLEEALGLKRPL # TSWDEGMCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g531 ### # start gene g532 7 AUGUSTUS gene 2561855 2563328 0.72 - . g532 7 AUGUSTUS transcript 2561855 2563328 0.72 - . g532.t1 7 AUGUSTUS stop_codon 2561855 2561857 . - 0 transcript_id "g532.t1"; gene_id "g532"; 7 AUGUSTUS CDS 2561855 2562670 0.86 - 0 transcript_id "g532.t1"; gene_id "g532"; 7 AUGUSTUS CDS 2562753 2563328 0.72 - 0 transcript_id "g532.t1"; gene_id "g532"; 7 AUGUSTUS start_codon 2563326 2563328 . - 0 transcript_id "g532.t1"; gene_id "g532"; # protein sequence = [MSKDTAPMDAQHILSAIDQLLSLNGWVAALCPTLVRPFNQNRREDAWDDIIRQDHLYYFAIVIHSADHFLVDQLAVIV # QMAKRLGTNNIFVSMLDYDSRDSTETIVDLCEAVLTLLGVPFRIRRVPGMTEDPNTAYYPLEEAHMRNLALEPLKELQHKRQIKFHRVIWLKGFTCPN # DILETIKISFANDAAMLTNNSVSKRWRTRDIEGDQFRQSKSSSKPDAVPPRDKVGASRYAQHFPFQVFCCEAGTHVVDPAQSYYKGISYRAGTDFHNL # STPEDPPVRTPDSPCLDSSQAWFCRDLWVRTARDAMDEVDRVNGGAPIRGNRKRDVNLIDVAERDPLMDEARAAAAEEGKQKREAAAAAEDPDANVGS # DYDAMSDEEGGEVVPPLEDIEPGKLSIPNSVFRPARILVNPRCPTTYAGVSHTQLALDLFGNGENKEEVRGKYVLEDWEGAPESFVCQEQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g532 ### # start gene g533 7 AUGUSTUS gene 2564454 2565509 0.57 - . g533 7 AUGUSTUS transcript 2564454 2565509 0.57 - . g533.t1 7 AUGUSTUS stop_codon 2564454 2564456 . - 0 transcript_id "g533.t1"; gene_id "g533"; 7 AUGUSTUS CDS 2564454 2565509 0.57 - 0 transcript_id "g533.t1"; gene_id "g533"; 7 AUGUSTUS start_codon 2565507 2565509 . - 0 transcript_id "g533.t1"; gene_id "g533"; # protein sequence = [MSYSNTGPISVTTDVNANRPYGDDTSGYGSLPGGSPRNRYGSPDDDFRRDGRGGSKVYRGGRGRWNEGRGKRDGRDHF # RDRDRGAKRSRSRSPPSRYGARREIKPYSPPRRPLPAVRESFDTGDSQPSAGNSEKDEFGRDARSQAPESLKDAAELQIGIHDVAQTTPAAPSPMQPP # VTMARIAPPTSISTPSASKTVPHNPSLEQFNVATFDFTNPESWEALGKMWLVSYGTMPTTEQLMQFVMFAGASADPSQMMSQDSWDQSGWDGTENPYM # DTQNVSMGGMNGGMAYGGNHLQGQSTANGNWKAGGDPRVAHQSKSNAEEPSTEKRGGGMRKVGDKWIFVREADSPAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g533 ### # start gene g534 7 AUGUSTUS gene 2568705 2569196 0.31 + . g534 7 AUGUSTUS transcript 2568705 2569196 0.31 + . g534.t1 7 AUGUSTUS start_codon 2568705 2568707 . + 0 transcript_id "g534.t1"; gene_id "g534"; 7 AUGUSTUS CDS 2568705 2569196 0.31 + 0 transcript_id "g534.t1"; gene_id "g534"; 7 AUGUSTUS stop_codon 2569194 2569196 . + 0 transcript_id "g534.t1"; gene_id "g534"; # protein sequence = [MIEGVHESTENQITMHTNAGCTLATGQAITGTVSGTTCESSDSNNNGCATMDTTPSGWGTAFNAAGGGVFAKLWDDTG # VKIWHFSRGNIPADITSKNPDPSTWGNPVSFLPSGDSCNVAEHFKDHSLIINITLCGQWAGATFSCGGTCQSAVMDPSNFVGQCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g534 ### # start gene g535 7 AUGUSTUS gene 2576856 2577224 0.43 - . g535 7 AUGUSTUS transcript 2576856 2577224 0.43 - . g535.t1 7 AUGUSTUS stop_codon 2576856 2576858 . - 0 transcript_id "g535.t1"; gene_id "g535"; 7 AUGUSTUS CDS 2576856 2577224 0.43 - 0 transcript_id "g535.t1"; gene_id "g535"; 7 AUGUSTUS start_codon 2577222 2577224 . - 0 transcript_id "g535.t1"; gene_id "g535"; # protein sequence = [MDWNTDAIKMWFFSRDDIPSDITEKSPNPSSWGEPAALFSNSACDIGSHFSEHTLTINTDVCGGWTESAFSSSGCSGT # CADTVADPSNFDSEFLYSILFTAKYQTGVTDARWKINYIATYQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g535 ### # start gene g536 7 AUGUSTUS gene 2820652 2822223 0.65 + . g536 7 AUGUSTUS transcript 2820652 2822223 0.65 + . g536.t1 7 AUGUSTUS start_codon 2820652 2820654 . + 0 transcript_id "g536.t1"; gene_id "g536"; 7 AUGUSTUS CDS 2820652 2822223 0.65 + 0 transcript_id "g536.t1"; gene_id "g536"; 7 AUGUSTUS stop_codon 2822221 2822223 . + 0 transcript_id "g536.t1"; gene_id "g536"; # protein sequence = [MRHPENLVNLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQRPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSRDTKRSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEGSPTKEILRASGSND # PERVQEPKDPENGNPGLEQGGVVKELDEEVSKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKE # YIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g536 ### # start gene g537 7 AUGUSTUS gene 2822370 2823389 0.65 + . g537 7 AUGUSTUS transcript 2822370 2823389 0.65 + . g537.t1 7 AUGUSTUS start_codon 2822370 2822372 . + 0 transcript_id "g537.t1"; gene_id "g537"; 7 AUGUSTUS CDS 2822370 2823389 0.65 + 0 transcript_id "g537.t1"; gene_id "g537"; 7 AUGUSTUS stop_codon 2823387 2823389 . + 0 transcript_id "g537.t1"; gene_id "g537"; # protein sequence = [MPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEESHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYL # GVIISPLGVSMDPEKVKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVV # LECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELL # SGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g537 ### # start gene g538 7 AUGUSTUS gene 2823930 2824898 0.66 + . g538 7 AUGUSTUS transcript 2823930 2824898 0.66 + . g538.t1 7 AUGUSTUS start_codon 2823930 2823932 . + 0 transcript_id "g538.t1"; gene_id "g538"; 7 AUGUSTUS CDS 2823930 2824898 0.66 + 0 transcript_id "g538.t1"; gene_id "g538"; 7 AUGUSTUS stop_codon 2824896 2824898 . + 0 transcript_id "g538.t1"; gene_id "g538"; # protein sequence = [MPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNN # TPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKAYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKW # TGPYTILSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEDILDSKPKKGQPEEVEYLVKWEGYNDEFNSWVGW # EGMVGSIELLRSWHKHHPRKRHPSRLQWASLEQEAREDEEEDREGRRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g538 ### # start gene g539 7 AUGUSTUS gene 2825134 2827677 0.71 - . g539 7 AUGUSTUS transcript 2825134 2827677 0.71 - . g539.t1 7 AUGUSTUS stop_codon 2825134 2825136 . - 0 transcript_id "g539.t1"; gene_id "g539"; 7 AUGUSTUS CDS 2825134 2826306 1 - 0 transcript_id "g539.t1"; gene_id "g539"; 7 AUGUSTUS CDS 2826364 2827677 0.71 - 0 transcript_id "g539.t1"; gene_id "g539"; 7 AUGUSTUS start_codon 2827675 2827677 . - 0 transcript_id "g539.t1"; gene_id "g539"; # protein sequence = [MSPIPTRPLSRTPSPLLPTLTALGKVPSPAPESDGEVELDQLAFTIESPSRPQLQLFETVFNTGKPLSGYCQDDPLWP # LLAEVASPCSNCVKSPGKCKVLPNSPRCTNCSAKKTCSLGKVLWYRYFARRCSQDIAYSRRFLELHGTPTHQSTWGIPLSTWRQYDAALQARTSSTSI # LLELNMLDEKDTAETDHQELQKFLALQQGEAVIAANRKRDRSPSPVAGPSSKKVRSDGSKKRSRRRVPVEGAAQESPRRVRLVVPPGCSMGASTSTPA # LPRALPSSMEVSVRDESVQGPSSLVQLAAAAEAQSGVAQRFVSPSPVTSPIKGTGSDSLPSNMPPTSRPLLVPRTLIAHPYRAENQCLLARVRSLESQ # LADSQRENSSLTTALRDTSHALDARQREVEQLRSSSHEVLQHEVEYRSVLDQFHAMDRALSVFPGQTVVQRLQALEEELRVVKRDHDVAVGELSTASH # KASELKTALLQQQGLVDETNALATRQRRRLEEVQEEVHRTQDRAAFVEQMIKEYPDEGFYEVVLPPLSQLEEDLKGAQEDLRRVATYAHRLYRSDPAT # VLHHHSRYIGAIIEAVVAFLRRGLASDDPDVVAHNFQLALDYMQTARGIHGDLYMRSISSIQWFFNNAVDEDEGLHRLVLEHSRFDNDGPILTAAQHA # GFAAPPEGSLEPPLHRRMLALSTAFPHRDGSGRWDDIVPAIPSLDQSMVVWEQLMLEYLHHITDTPMSLPVPSGEPPAAVGERVSSPPASSHVPLFLP # EQASPTSPSPPPPSPSLPPLFGSVADLAIDLTGGDDELYEPEESRRARVSEADGMDAVPKEELL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g539 ### # start gene g540 7 AUGUSTUS gene 2831869 2833524 0.99 + . g540 7 AUGUSTUS transcript 2831869 2833524 0.99 + . g540.t1 7 AUGUSTUS start_codon 2831869 2831871 . + 0 transcript_id "g540.t1"; gene_id "g540"; 7 AUGUSTUS CDS 2831869 2833524 0.99 + 0 transcript_id "g540.t1"; gene_id "g540"; 7 AUGUSTUS stop_codon 2833522 2833524 . + 0 transcript_id "g540.t1"; gene_id "g540"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLCTGDGQP # VQVLTPRHGQPPVVAPARGRSTTQIDSPILQAIARRMGKQPQRCAASESPREPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPHSPISPDIPNEQRAMLELLSGFKGSIEILGTVLAALGRPSDSSESKSKVKEPEVFDGLDPRKLKTFFVNLALVFNDRPKYFTDQRKV # NYTLSYLSGSAKEWFVPDILDLDLDSLPAWTSSFKALVKELQDNFGIYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGL # AERIKDEMARLPEPATLADYRQEVLRIDNHYWKRKETRKREAGKPFIARNPKKGSSDFKTGSTNQQNDSQPSGSSAPFTPKPKPFSGGKPNNNGKPQN # SSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKQKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g540 ### # start gene g541 7 AUGUSTUS gene 2833962 2835746 0.27 + . g541 7 AUGUSTUS transcript 2833962 2835746 0.27 + . g541.t1 7 AUGUSTUS start_codon 2833962 2833964 . + 0 transcript_id "g541.t1"; gene_id "g541"; 7 AUGUSTUS CDS 2833962 2835746 0.27 + 0 transcript_id "g541.t1"; gene_id "g541"; 7 AUGUSTUS stop_codon 2835744 2835746 . + 0 transcript_id "g541.t1"; gene_id "g541"; # protein sequence = [MLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVH # HVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHD # HPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPC # TSSITAEGVADIYYQEIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVI # NSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLG # DRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSW # EPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g541 ### # start gene g542 7 AUGUSTUS gene 2837265 2837966 1 - . g542 7 AUGUSTUS transcript 2837265 2837966 1 - . g542.t1 7 AUGUSTUS stop_codon 2837265 2837267 . - 0 transcript_id "g542.t1"; gene_id "g542"; 7 AUGUSTUS CDS 2837265 2837966 1 - 0 transcript_id "g542.t1"; gene_id "g542"; 7 AUGUSTUS start_codon 2837964 2837966 . - 0 transcript_id "g542.t1"; gene_id "g542"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDFISAIGQPRRRNCGFSPATAPTTSTLPEAMEEEQQFEYSTRYTGDGQP # VQVLTPRRGQPPVVAPAQGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDASDHDDQDPPVNPDDPGANNNNDDLDDESGGLPRGEPG # DPSGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVNKLASFLCERERKESNGHSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g542 ### # start gene g543 7 AUGUSTUS gene 2839979 2840332 0.59 + . g543 7 AUGUSTUS transcript 2839979 2840332 0.59 + . g543.t1 7 AUGUSTUS start_codon 2839979 2839981 . + 0 transcript_id "g543.t1"; gene_id "g543"; 7 AUGUSTUS CDS 2839979 2840332 0.59 + 0 transcript_id "g543.t1"; gene_id "g543"; 7 AUGUSTUS stop_codon 2840330 2840332 . + 0 transcript_id "g543.t1"; gene_id "g543"; # protein sequence = [MVSVAQVKSKQCQPTTRGAVYATVNRPRALATKKAARHIVTDSRFCLDSKGVGKMEGSSGLEGSSGINRKSFFACKEN # GCLTGPADEDGQLKAPPFYSASYEAYLHSTAHTKSPHHI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g543 ### # start gene g544 7 AUGUSTUS gene 2845639 2846802 0.49 + . g544 7 AUGUSTUS transcript 2845639 2846802 0.49 + . g544.t1 7 AUGUSTUS start_codon 2845639 2845641 . + 0 transcript_id "g544.t1"; gene_id "g544"; 7 AUGUSTUS CDS 2845639 2846802 0.49 + 0 transcript_id "g544.t1"; gene_id "g544"; 7 AUGUSTUS stop_codon 2846800 2846802 . + 0 transcript_id "g544.t1"; gene_id "g544"; # protein sequence = [MKARKAAAAAKKKAEEELRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVI # YLDDILIYSDDEESHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSG # ITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPITFHARSMISAELNYDIYDKELLA # IVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPE # RLNATILMNEDLLVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g544 ### # start gene g545 7 AUGUSTUS gene 2847343 2848311 0.72 + . g545 7 AUGUSTUS transcript 2847343 2848311 0.72 + . g545.t1 7 AUGUSTUS start_codon 2847343 2847345 . + 0 transcript_id "g545.t1"; gene_id "g545"; 7 AUGUSTUS CDS 2847343 2848311 0.72 + 0 transcript_id "g545.t1"; gene_id "g545"; 7 AUGUSTUS stop_codon 2848309 2848311 . + 0 transcript_id "g545.t1"; gene_id "g545"; # protein sequence = [MPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNN # TPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKAYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKW # TGPYTILSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEDILDSKPKKGQPEEVEYLVKWEGYNDEFNSWVGW # EGMVGSIELLRSWHKHHPRKRHPSRLQWASLEQEAREDEEEDREGRRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g545 ### # start gene g546 7 AUGUSTUS gene 2848547 2851090 0.71 - . g546 7 AUGUSTUS transcript 2848547 2851090 0.71 - . g546.t1 7 AUGUSTUS stop_codon 2848547 2848549 . - 0 transcript_id "g546.t1"; gene_id "g546"; 7 AUGUSTUS CDS 2848547 2849719 0.98 - 0 transcript_id "g546.t1"; gene_id "g546"; 7 AUGUSTUS CDS 2849777 2851090 0.71 - 0 transcript_id "g546.t1"; gene_id "g546"; 7 AUGUSTUS start_codon 2851088 2851090 . - 0 transcript_id "g546.t1"; gene_id "g546"; # protein sequence = [MSPIPTRPLSRTPSPLLPTLTALGKVPSPAPESDGEVELDQLAFTIESPSRPQLQLFETVFNTGKPLSGYCQDDPLWP # LLAEVASPCSNCVKSPGKCKVLPNSPRCTNCSAKKTCSLGKVLWYRYFARRCSQDIAYSRRFLELHGTPTHQSTWGIPLSTWRQYDAALQARTSSTSI # LLELNMLDEKDTAETDHQELQKFLALQQGEAVIAANRKRDRSPSPVAGPSSKKVRSDGSKKRSRRRVPVEGAAQESPRRVRLVVPPGCSMGASTSTPA # LPRALPSSMEVSVRDESVQGPSSLVQLAAAAEAQSGVAQRFVSPSPVTSPIKGTGSDSLPSNMPPTSRPLLVPRTLIAHPYRAENQCLLARVRSLESQ # LADSQRENSSLTTALRDTSHALDARQREVEQLRSSSHEVLQHEVEYRSVLDQFHAMDRALSVFPGQTVVQRLQALEEELRVVKRDHDVAVGELSTASH # KASELKTALLQQQGLVDETNALATRQRRRLEEVQEEVHRTQDRAAFVEQMIKEYPDEGFYEVVLPPLSQLEEDLKGAQEDLRRVATYAHRLYRSDPAT # VLHHHSRYIGAIIEAVVAFLRRGLASDDPDVVAHNFQLALDYMQTARGIHGDLYMRSISSIQWFFNNAVDEDEGLHRLVLEHSRFDNDGPILTAAQHA # GFAAPPEGSLEPPLHRRMLALSTAFPHRDGSGRWDDIVPAIPSLDQSMVVWEQLMLEYLHHITDTPMSLPVPSGEPPAAVGERVSSPPASSHVPLFLP # EQASPTSPSPPPPSPSLPPLFGSVADLAIDLTGGDDELYEPEESRRARVSEADGMDAVPKEELL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g546 ### # start gene g547 7 AUGUSTUS gene 2855282 2856937 1 + . g547 7 AUGUSTUS transcript 2855282 2856937 1 + . g547.t1 7 AUGUSTUS start_codon 2855282 2855284 . + 0 transcript_id "g547.t1"; gene_id "g547"; 7 AUGUSTUS CDS 2855282 2856937 1 + 0 transcript_id "g547.t1"; gene_id "g547"; 7 AUGUSTUS stop_codon 2856935 2856937 . + 0 transcript_id "g547.t1"; gene_id "g547"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLCTGDGQP # VQVLTPRHGQPPVVAPARGRSTTQIDSPILQAIARRMGKQPQRCAASESPREPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPHSPISPDIPNEQRAMLELLSGFKGSIEILGTVLAALGRPSDSSESKSKVKEPEVFDGLDPRKLKTFFVNLALVFNDRPKYFTDQRKV # NYTLSYLSGSAKEWFVPDILDLDLDSLPAWTSSFKALVKELQDNFGIYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGL # AERIKDEMARLPEPATLADYRQEVLRIDNHYWKRKETRKREAGKPFIARNPKKGSSDFKTGSTNQQNDSQPSGSSAPFTPKPKPFSGGKPNNNGKPQN # SSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKQKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g547 ### # start gene g548 7 AUGUSTUS gene 2857592 2861116 0.99 + . g548 7 AUGUSTUS transcript 2857592 2861116 0.99 + . g548.t1 7 AUGUSTUS start_codon 2857592 2857594 . + 0 transcript_id "g548.t1"; gene_id "g548"; 7 AUGUSTUS CDS 2857592 2861116 0.99 + 0 transcript_id "g548.t1"; gene_id "g548"; 7 AUGUSTUS stop_codon 2861114 2861116 . + 0 transcript_id "g548.t1"; gene_id "g548"; # protein sequence = [MANIAVWFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHPDSPQTSVPSAINPVVAKVAV # PLPELSPSVSPTILETPPGDSPRSRSRTLRAKPLSSKFPFEPIYSYPMVSQFAAQLETPEVDIALVNAAVFNRACKDAGMEPILLRAIHSEVAARTAN # RSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKK # DGKLRLCVDFRGLNRITKKDRYPLPLISDLLDTPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMLFGLTNAPAAFQRFVNDIFSDM # LNVCVIVYLDDILNSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDRLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRF # IYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAVELNYDTHD # KELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIHFRPGKLGEKPDSITRHWDVYPKEGDIGYAQVNPHNFR # PIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNKRWSLGSDNLLRLDDRIYVPNHSDLRLQVLRYFHDHPLS # GHFGQNHTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTVDT # ITSEQLAELFVIHVFFKHGVPNHVTSNRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTEHINQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNA # PNASTGITPFFAHKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPEFPISSEVFVLAKHIRSTCPTEKFSEKY # LSPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFS # WVAADELHADELVPAFHA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g548 ### # start gene g549 7 AUGUSTUS gene 2861503 2861838 0.72 - . g549 7 AUGUSTUS transcript 2861503 2861838 0.72 - . g549.t1 7 AUGUSTUS stop_codon 2861503 2861505 . - 0 transcript_id "g549.t1"; gene_id "g549"; 7 AUGUSTUS CDS 2861503 2861838 0.72 - 0 transcript_id "g549.t1"; gene_id "g549"; 7 AUGUSTUS start_codon 2861836 2861838 . - 0 transcript_id "g549.t1"; gene_id "g549"; # protein sequence = [MAQLLADNRQLRDGKIKANTYHHHMTRKLEWLVMDANRRRKTPPELPEAGPSAPSKKRRRVADSDEEEEKEIEGEMEK # EREEVELEEEEEEENDEPAPKKARSDKGKEKEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g549 ### # start gene g550 7 AUGUSTUS gene 2870040 2870828 0.96 + . g550 7 AUGUSTUS transcript 2870040 2870828 0.96 + . g550.t1 7 AUGUSTUS start_codon 2870040 2870042 . + 0 transcript_id "g550.t1"; gene_id "g550"; 7 AUGUSTUS CDS 2870040 2870828 0.96 + 0 transcript_id "g550.t1"; gene_id "g550"; 7 AUGUSTUS stop_codon 2870826 2870828 . + 0 transcript_id "g550.t1"; gene_id "g550"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDFISAIGQPRRRNCGFSPATAPTTSTLPEAMEEEQQFEYSTRYTGDGQP # VQVLTPRRGQPPVVAPAQGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDASDHDDQDPPVNPTIRVPTITTTIWMMNPAVYRVVSLV # TPVDPVPQSLLTSPTSNVLCWNSSRDSRAPLRPLVPSTSLPRFCVKEKGRNLMGTPTNQSNTQYASSLLSNLFNSKGSVGKGSAKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g550 ### # start gene g551 7 AUGUSTUS gene 2872258 2875974 1 - . g551 7 AUGUSTUS transcript 2872258 2875974 1 - . g551.t1 7 AUGUSTUS stop_codon 2872258 2872260 . - 0 transcript_id "g551.t1"; gene_id "g551"; 7 AUGUSTUS CDS 2872258 2875974 1 - 0 transcript_id "g551.t1"; gene_id "g551"; 7 AUGUSTUS start_codon 2875972 2875974 . - 0 transcript_id "g551.t1"; gene_id "g551"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYQEIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g551 ### # start gene g552 7 AUGUSTUS gene 2876025 2877191 0.81 - . g552 7 AUGUSTUS transcript 2876025 2877191 0.81 - . g552.t1 7 AUGUSTUS stop_codon 2876025 2876027 . - 0 transcript_id "g552.t1"; gene_id "g552"; 7 AUGUSTUS CDS 2876025 2877191 0.81 - 0 transcript_id "g552.t1"; gene_id "g552"; 7 AUGUSTUS start_codon 2877189 2877191 . - 0 transcript_id "g552.t1"; gene_id "g552"; # protein sequence = [MSTPILPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGQCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATASPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g552 ### # start gene g553 7 AUGUSTUS gene 2878935 2879925 0.33 + . g553 7 AUGUSTUS transcript 2878935 2879925 0.33 + . g553.t1 7 AUGUSTUS start_codon 2878935 2878937 . + 0 transcript_id "g553.t1"; gene_id "g553"; 7 AUGUSTUS CDS 2878935 2878945 0.34 + 0 transcript_id "g553.t1"; gene_id "g553"; 7 AUGUSTUS CDS 2879280 2879925 0.96 + 1 transcript_id "g553.t1"; gene_id "g553"; 7 AUGUSTUS stop_codon 2879923 2879925 . + 0 transcript_id "g553.t1"; gene_id "g553"; # protein sequence = [MGICGSAKEWFVPDILDLDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAAS # TNWDSAALKWAYGRSLAERIKDEMARLPEPATLADYRQEVLRIDNHYWKRKETRKREAGKPFIARNPKKGSSDFKTGSTNQQNDSQPSGSSAPFTPKP # KPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g553 ### # start gene g554 7 AUGUSTUS gene 2881834 2883896 0.53 + . g554 7 AUGUSTUS transcript 2881834 2883896 0.53 + . g554.t1 7 AUGUSTUS start_codon 2881834 2881836 . + 0 transcript_id "g554.t1"; gene_id "g554"; 7 AUGUSTUS CDS 2881834 2881952 0.65 + 0 transcript_id "g554.t1"; gene_id "g554"; 7 AUGUSTUS CDS 2882015 2882602 0.66 + 1 transcript_id "g554.t1"; gene_id "g554"; 7 AUGUSTUS CDS 2882765 2883896 0.97 + 1 transcript_id "g554.t1"; gene_id "g554"; 7 AUGUSTUS stop_codon 2883894 2883896 . + 0 transcript_id "g554.t1"; gene_id "g554"; # protein sequence = [MLDDQDAADVDQQELRDFLALQQEEAAVAAKHKRDLSLCLSPVQETAQESPRRIRLVVPPVRSLPVTTSTPLPPRASP # SLMEVPDADLSVQGHSSLVRLAAVAEAQSGLVQQPAVSSSIKGTGQDLLSSNMPPVPRPTLVPRALATHPYRGENQRLAAWVRLLESQLSDSQRENSS # LTSALRDTSHALESRQREVEQLRSSSREVREQQVEYRRVLDQFRALDEALPGPPDRVRILLLYQQGVVDESNALATRQRRLVEELQEEVHRAHGRAAF # VEQMIKEYPDEGYYEVVLPPLSQLEGDLHKAREDLRRVATFAHRLYRSDPATVLHHHYRYLGAIIEAVVAFLRRGLDSDDLNTVVHNFQLGLDYMQAA # RGVHGDMYMRSLSSIQWFFNNAVDEDEGLYRMVLEHSRFDNDGPFLTAAQHAGFAPPPDSSLEPPLHRRIFALSTALPHGDGAGRWDDIVPALPSIDQ # LTADWEQLMLQYIHHITDTPLPVPDPPVPMSSMGPVPESSGEANVEQSLEAPIVQVPSPSAGSHPPVPLFLSEQESPTSPSPPPRSPVPPLLFGSVAS # LSIDLTGDDDKLYETEEAYASRIAVAREGTELAVGQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g554 ### # start gene g555 7 AUGUSTUS gene 2884147 2884896 0.4 - . g555 7 AUGUSTUS transcript 2884147 2884896 0.4 - . g555.t1 7 AUGUSTUS stop_codon 2884147 2884149 . - 0 transcript_id "g555.t1"; gene_id "g555"; 7 AUGUSTUS CDS 2884147 2884896 0.4 - 0 transcript_id "g555.t1"; gene_id "g555"; 7 AUGUSTUS start_codon 2884894 2884896 . - 0 transcript_id "g555.t1"; gene_id "g555"; # protein sequence = [MAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKVYAKYANQKRQEAP # DWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTVLSKVGSHAYRLDLPGDLHKIHNVFHVDRLKLHFHDKFKRQTSPPPPIFIKGKTEHFVEDILDSK # PKKGRPEEVEYLVKWEGYNDEFNSWVGWEGMVGSIELLRSWHKHHPRKRQPSRLQWASLEREAREDEEEGSGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g555 ### # start gene g556 7 AUGUSTUS gene 2885032 2886954 0.5 - . g556 7 AUGUSTUS transcript 2885032 2886954 0.5 - . g556.t1 7 AUGUSTUS stop_codon 2885032 2885034 . - 0 transcript_id "g556.t1"; gene_id "g556"; 7 AUGUSTUS CDS 2885032 2886954 0.5 - 0 transcript_id "g556.t1"; gene_id "g556"; 7 AUGUSTUS start_codon 2886952 2886954 . - 0 transcript_id "g556.t1"; gene_id "g556"; # protein sequence = [MLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRV # AQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSNDEASHVGHVRKVLERLRANHLHAKPEKCAFHVDTVEY # LGVIISPLGVSMDPEKVKAVIDWPKPRTVKELQAFLGFANFSRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPV # VLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAEL # LSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTTIEALKRIARNEGESFVWEDGL # IKRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLHPLPIGQRPWSSISLDHITQ # LPATAGPEKYDAILVVVCRLTKQAIYVPCHTTDKAEDFANLFITYVFSKHGMPSDITSDRGSLFVSQFWREL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g556 ### # start gene g557 7 AUGUSTUS gene 2887801 2888550 0.48 - . g557 7 AUGUSTUS transcript 2887801 2888550 0.48 - . g557.t1 7 AUGUSTUS stop_codon 2887801 2887803 . - 0 transcript_id "g557.t1"; gene_id "g557"; 7 AUGUSTUS CDS 2887801 2888550 0.48 - 0 transcript_id "g557.t1"; gene_id "g557"; 7 AUGUSTUS start_codon 2888548 2888550 . - 0 transcript_id "g557.t1"; gene_id "g557"; # protein sequence = [MAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKVYAKYANQKRQEAP # DWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTVLSKVGSHAYRLDLPGDLHKIHNVFHVDRLKLHFHDKFKRQTSPPPPIFIKGKTEHFVEDILDSK # PKKGRPEEVEYLVKWEGYNDEFNSWVGWEGMVGSIELLRSWHKHHPRKRQPSRLQWASLEREAREDEEEGSGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g557 ### # start gene g558 7 AUGUSTUS gene 2888686 2890608 0.6 - . g558 7 AUGUSTUS transcript 2888686 2890608 0.6 - . g558.t1 7 AUGUSTUS stop_codon 2888686 2888688 . - 0 transcript_id "g558.t1"; gene_id "g558"; 7 AUGUSTUS CDS 2888686 2890608 0.6 - 0 transcript_id "g558.t1"; gene_id "g558"; 7 AUGUSTUS start_codon 2890606 2890608 . - 0 transcript_id "g558.t1"; gene_id "g558"; # protein sequence = [MLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRV # AQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSNDEASHVGHVRKVLERLRANHLHAKPEKCAFHVDTVEY # LGVIISPLGVSMDPEKVKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPV # VLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAEL # LSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTTIEALKRIARNEGESFVWEDGL # IKRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLHPLPIGQRPWSSISLDHITQ # LPATAGPEKYDAILVVVCRLTKQAIYVPCHTTDKAEDFANLFITYVFSKHGMPSDITSDRGSLFVSQFWREL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g558 ### # start gene g559 7 AUGUSTUS gene 2891683 2892024 0.62 - . g559 7 AUGUSTUS transcript 2891683 2892024 0.62 - . g559.t1 7 AUGUSTUS stop_codon 2891683 2891685 . - 0 transcript_id "g559.t1"; gene_id "g559"; 7 AUGUSTUS CDS 2891683 2892024 0.62 - 0 transcript_id "g559.t1"; gene_id "g559"; 7 AUGUSTUS start_codon 2892022 2892024 . - 0 transcript_id "g559.t1"; gene_id "g559"; # protein sequence = [MLRASDSSATEEVQQPKDPESGDPSSEQGGVAKELDKEESKRQETEELKKSIPVQYQDYLDMFSPGEARTLPPHRPYD # IKIETEGDAIPPIGKLYNMSEKELNVMPHPKFLSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g559 ### # start gene g560 7 AUGUSTUS gene 2892090 2893109 0.46 - . g560 7 AUGUSTUS transcript 2892090 2893109 0.46 - . g560.t1 7 AUGUSTUS stop_codon 2892090 2892092 . - 0 transcript_id "g560.t1"; gene_id "g560"; 7 AUGUSTUS CDS 2892090 2893109 0.46 - 0 transcript_id "g560.t1"; gene_id "g560"; 7 AUGUSTUS start_codon 2893107 2893109 . - 0 transcript_id "g560.t1"; gene_id "g560"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEEPGRGVNGEEIHEGPLQPPHEAPQQPPEAPQPPPEVPQQTPEALRAPRTRVKLEEVKDEEYEASQPGP # HKLFPSDKDLGPDDPILMGINKWLAFANESTEEEVEEILEAGRSTMEKVAPNPAKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDLP # TLDIESLNIPKIPSRSGLTPKGSIRRNNLRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGWIVY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g560 ### # start gene g561 7 AUGUSTUS gene 2893322 2897623 0.98 - . g561 7 AUGUSTUS transcript 2893322 2897623 0.98 - . g561.t1 7 AUGUSTUS stop_codon 2893322 2893324 . - 0 transcript_id "g561.t1"; gene_id "g561"; 7 AUGUSTUS CDS 2893322 2897623 0.98 - 0 transcript_id "g561.t1"; gene_id "g561"; 7 AUGUSTUS start_codon 2897621 2897623 . - 0 transcript_id "g561.t1"; gene_id "g561"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEI # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLTEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMR # HMHQLLVRSEESEAMLCSQETRHRMLLAESDTLMLSEELSGLNLERALEFRRRLVADNRGTLYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKH # SSPRNTEVPELLKPGNTATRSPQLRSGTSPTVHALAQNATPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSN # PSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAPFGTPFVTGAQMNRPGMTFESACSQESVAMIQQQARVIETLQEQLREVKKGFTAG # EVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEY # GRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPTPPPPPPPSGEPGDSNSEGSNEGEQNQSSRNGGRRE # EDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYA # REKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTY # LKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLHGEKVLQGWLSRFPGLELAPEAPYKSPLRRERDPADVWTSNPKPVVTGRFQ # SRPNWKEGRQRASAAWGEGESYDSENREEDEDCCHCRDGGEWTEAVLRAGVTDTGRKWTPEERAEKWRRRRQELCMRCGRKEHWAKDCPNPESLERPA # EDQGSSERASKADSTRERGTANQGGGRKDDSTRPLERIRAGIVVEEREGMDDLWNVHILDSPKGGEQELLDEVGNGQGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g561 ### # start gene g562 7 AUGUSTUS gene 2899134 2900081 0.98 + . g562 7 AUGUSTUS transcript 2899134 2900081 0.98 + . g562.t1 7 AUGUSTUS start_codon 2899134 2899136 . + 0 transcript_id "g562.t1"; gene_id "g562"; 7 AUGUSTUS CDS 2899134 2900081 0.98 + 0 transcript_id "g562.t1"; gene_id "g562"; 7 AUGUSTUS stop_codon 2900079 2900081 . + 0 transcript_id "g562.t1"; gene_id "g562"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQMSVPSATNTVDAKVAV # PLPELSPSVSPTILETPPGDSLCSRSHPRSRTLWAKPLSSKFPFEPIYSYPMVSQFAAQLETPEVDIALISAAVFNRACKDAGMEPILLRAIHSEVAA # CAANRSSTAPTVPPLPHSIPAEYADFADVFDEIAADALPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVTLNDFIDKQLATGAITPSSLPHGALVLF # VPKKDGKLRLCVDFRGFNRITKKDCYPLPLISDLLDTPKRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g562 ### # start gene g563 7 AUGUSTUS gene 2900407 2901042 0.8 + . g563 7 AUGUSTUS transcript 2900407 2901042 0.8 + . g563.t1 7 AUGUSTUS start_codon 2900407 2900409 . + 0 transcript_id "g563.t1"; gene_id "g563"; 7 AUGUSTUS CDS 2900407 2901042 0.8 + 0 transcript_id "g563.t1"; gene_id "g563"; 7 AUGUSTUS stop_codon 2901040 2901042 . + 0 transcript_id "g563.t1"; gene_id "g563"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIIVPMTRLTRKGAPWIWDNDC # QEAFENLKIAFTSAPILAHWEPNHPIIVETNASDYAIAAILSIQTVDGEIHPLAFLSRTLHAAELNYNTHDKELLAIFEAFKAWHHYLEGSGDPVDVV # TDHKNLEYFSTTKILTRRQVHWSEYLHQFNMVIRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g563 ### # start gene g564 7 AUGUSTUS gene 2901229 2902698 0.8 + . g564 7 AUGUSTUS transcript 2901229 2902698 0.8 + . g564.t1 7 AUGUSTUS start_codon 2901229 2901231 . + 0 transcript_id "g564.t1"; gene_id "g564"; 7 AUGUSTUS CDS 2901229 2902698 0.8 + 0 transcript_id "g564.t1"; gene_id "g564"; 7 AUGUSTUS stop_codon 2902696 2902698 . + 0 transcript_id "g564.t1"; gene_id "g564"; # protein sequence = [MDIEALHQAIILALPKDPSSVVGLELAKDPSNERWSLGSDGLLRLDDRIYVPNHGDLHLQVLRYFHDHPLSGHFGQNR # TLEAVRRQYTWPKVRDFIRDYVTSCTTCGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVIVDRSSKQAIFIPTFDTITSEQLA # QLFVIHVFSKHGVPNHVTLDRGSEFVLAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLKQYIRIYCSYQQDDWSPLLLIAEFAYNNAPNASTGI # TLFFANKGYHPNITVRPEVNMKSDLARDFIVNLNELHVFLQEEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTHPTEKFSEKYLGPFKVI # SRPGTLSYELKLPDYLRQIHPVFHVSQLEPVTLNPFPNRTQSPPPPIEVDGEEEYNVAKILDSKLDKRYKRYPLCYYIRWAGYKGTDDEFSWVAADEL # HADGLVPAFHAQYPQKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g564 ### # start gene g565 7 AUGUSTUS gene 2903051 2903386 0.59 - . g565 7 AUGUSTUS transcript 2903051 2903386 0.59 - . g565.t1 7 AUGUSTUS stop_codon 2903051 2903053 . - 0 transcript_id "g565.t1"; gene_id "g565"; 7 AUGUSTUS CDS 2903051 2903386 0.59 - 0 transcript_id "g565.t1"; gene_id "g565"; 7 AUGUSTUS start_codon 2903384 2903386 . - 0 transcript_id "g565.t1"; gene_id "g565"; # protein sequence = [MAQLLANNRQLRDGQIKANTYHHHMTRKLEWLIMDATRRRNSPPELPEAGPSAPSKKRRRAADSDEEEAREIEGEMEK # DGEEVEMEEEGEEENDEPVPKKARLEKGKEREE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g565 ### # start gene g566 7 AUGUSTUS gene 2907083 2907829 0.53 - . g566 7 AUGUSTUS transcript 2907083 2907829 0.53 - . g566.t1 7 AUGUSTUS stop_codon 2907083 2907085 . - 0 transcript_id "g566.t1"; gene_id "g566"; 7 AUGUSTUS CDS 2907083 2907829 0.53 - 0 transcript_id "g566.t1"; gene_id "g566"; 7 AUGUSTUS start_codon 2907827 2907829 . - 0 transcript_id "g566.t1"; gene_id "g566"; # protein sequence = [MGPSNAGSPSRKHDRDEDREKYRDRVQKPRTHNVDGATTDAYGFHPHYNSNISNYESQSSLFHEQLQSAQVQYPESNS # STVFSSALPSSSYSSQHHSSSYLEIPSSSSTRTAESFNQAMAIESMMELPLHTEDLGRLPVLLGSDHHWDDQSINSPDINTYAGPAQDSRLGLTNELN # VNSAYGFAYADLDSATGGATLNSSASSVVPPKAWDFGETAGYQDHTVLAGVCSSQILNQTAVVKNVCIFRIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g566 ### # start gene g567 7 AUGUSTUS gene 2914679 2915872 1 + . g567 7 AUGUSTUS transcript 2914679 2915872 1 + . g567.t1 7 AUGUSTUS start_codon 2914679 2914681 . + 0 transcript_id "g567.t1"; gene_id "g567"; 7 AUGUSTUS CDS 2914679 2915872 1 + 0 transcript_id "g567.t1"; gene_id "g567"; 7 AUGUSTUS stop_codon 2915870 2915872 . + 0 transcript_id "g567.t1"; gene_id "g567"; # protein sequence = [MGRALYSQSYAPAIREPSSSQYEKWSISNPFDPDSEEFFEGAQYEAFLPTPTNSSTNNGESAIPTRVPISATRATMTR # DVSQPLRTSRVRISSEDPSVTSASNSLIFDSVPRDFPDMDAPTLPISPPPVTISDFIDADMETTRPTPSPMAADSDSEDPIRILAGFINASRSQGETE # ANINVSEILRQLDERWRREVREAQNLLRDDNGSRPQRYLPPLSYPSSNASSSYSRADSPSSPIFFPSPPSETLPTPPTMSRELAVFPDSESSRHLTFH # LDEDLEQVERELLDFESQSVLDATESLPAPFSESSSAPVVPASQSQTPPRPVRIRHHPSSSVGNEVGLDMSPPPSVSPRLYNWSRTGSESRPRYNSLT # TSSVNFGRHEGLRSVRGVTISEGRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g567 ### # start gene g568 7 AUGUSTUS gene 2916582 2917103 0.98 + . g568 7 AUGUSTUS transcript 2916582 2917103 0.98 + . g568.t1 7 AUGUSTUS start_codon 2916582 2916584 . + 0 transcript_id "g568.t1"; gene_id "g568"; 7 AUGUSTUS CDS 2916582 2917103 0.98 + 0 transcript_id "g568.t1"; gene_id "g568"; 7 AUGUSTUS stop_codon 2917101 2917103 . + 0 transcript_id "g568.t1"; gene_id "g568"; # protein sequence = [MGQLLHSIQLAAKEEERAVARAAASFNGNKGRLKRMSLHYPVSDLRSTSTNGDEQEMQDSDESEDGVVEVAEFFDSTS # SWVIRGPNDSFYVSSRHRPVGAIANEQAFVRDLATGRLELVEPNDYYYSDEDFEDEEEMKLGHAQEEDTSELEELGEEEEGSELSAEESDDSDPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g568 ### # start gene g569 7 AUGUSTUS gene 2918441 2918995 1 + . g569 7 AUGUSTUS transcript 2918441 2918995 1 + . g569.t1 7 AUGUSTUS start_codon 2918441 2918443 . + 0 transcript_id "g569.t1"; gene_id "g569"; 7 AUGUSTUS CDS 2918441 2918995 1 + 0 transcript_id "g569.t1"; gene_id "g569"; 7 AUGUSTUS stop_codon 2918993 2918995 . + 0 transcript_id "g569.t1"; gene_id "g569"; # protein sequence = [MRHTTRPLAPYNDSRYPVFQSFEHDFGEEAGSEDFPENFTIYCSSSSEPEFREMEQRQTRLTASEIERTWSSLAELHE # GLDLSRFTDADEDVSYSDTSEDLASHSESSYPSPPESVREERAYLHQDRTTAPRDLVDQLLDAPQRSPSMGSSINPKQESSPKAVHQSGLPPYKPKEK # RNHLGGSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g569 ### # start gene g570 7 AUGUSTUS gene 2923125 2923490 0.54 - . g570 7 AUGUSTUS transcript 2923125 2923490 0.54 - . g570.t1 7 AUGUSTUS stop_codon 2923125 2923127 . - 0 transcript_id "g570.t1"; gene_id "g570"; 7 AUGUSTUS CDS 2923125 2923490 0.54 - 0 transcript_id "g570.t1"; gene_id "g570"; 7 AUGUSTUS start_codon 2923488 2923490 . - 0 transcript_id "g570.t1"; gene_id "g570"; # protein sequence = [MAEALKALVEIISTETTALLSAYATHEVKFPSINETSTTSSMKNTDFDVDPTIIRMRQLIVAAAAQLIATVQPPGEFL # QDAAPAMFKSATLGFVIDVDVPEILMEAGPMVRRISCKRSVLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g570 ### # start gene g571 7 AUGUSTUS gene 2924358 2925756 0.26 - . g571 7 AUGUSTUS transcript 2924358 2925756 0.26 - . g571.t1 7 AUGUSTUS stop_codon 2924358 2924360 . - 0 transcript_id "g571.t1"; gene_id "g571"; 7 AUGUSTUS CDS 2924358 2925026 0.83 - 0 transcript_id "g571.t1"; gene_id "g571"; 7 AUGUSTUS CDS 2925259 2925450 0.28 - 0 transcript_id "g571.t1"; gene_id "g571"; 7 AUGUSTUS CDS 2925607 2925756 0.93 - 0 transcript_id "g571.t1"; gene_id "g571"; 7 AUGUSTUS start_codon 2925754 2925756 . - 0 transcript_id "g571.t1"; gene_id "g571"; # protein sequence = [MTAKAIEYMIVDGLKLAEPFMHIAQRIRDPEEFLWLTDDLLPEIERSKDPLVTEQRILECARDAYYELPKEQQDEMDE # AWKEAGLTLDDLTINDIKVEQSMLHYGMKEENPLDYAGYHRIQRDTPHSPGDAPETVVVKVAEGGQPIPVSDHTTRSITRGSEALMSPPVTERGLPDD # GPPTSQDLTEPSGSRSISRHESTRSISTIPDAEHSLATAATLDSTSTVPSPEIPNKSPKLSTPGAPASPHVPALGKPLSTKSSWISTVNRFTAVDPGH # GSPGKTTKPASKKRDRSKVDAEDKPVTGTIPTSRRTRSSAATLPGDREISPSPIARKQARLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g571 ### # start gene g572 7 AUGUSTUS gene 2927310 2928338 0.99 - . g572 7 AUGUSTUS transcript 2927310 2928338 0.99 - . g572.t1 7 AUGUSTUS stop_codon 2927310 2927312 . - 0 transcript_id "g572.t1"; gene_id "g572"; 7 AUGUSTUS CDS 2927310 2928338 0.99 - 0 transcript_id "g572.t1"; gene_id "g572"; 7 AUGUSTUS start_codon 2928336 2928338 . - 0 transcript_id "g572.t1"; gene_id "g572"; # protein sequence = [MGRPLWSTVYNPRSTEIPTKTPGKWSSTNIFDPDSDAFFYGAELEVPIADAPVMTEPDTTLSSFDWTAASSVERLNSL # AELVAERRRELLDVMVRRRRIEALDSIRRAREAIATQRQTQRGGTLPVARESSTSSGNPSVVIPSAGYSSGTPLSPLSESGLAELQNEPESDEEFIEV # PMRFAPAVNRRSRESSLSSNRRDTSRRLSDHAARQAFINSLREENREVALEIERRRNRLREQAQNQRLEDEGSSVDRTRVSSLSLSRQRRESLYSRLS # SAPGQPGLRSRALSTPTHTAASASEQAATSVELETEAEIRRSMAIAQSVFRRQRHRGNRIPVADSGLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g572 ### # start gene g573 7 AUGUSTUS gene 2930205 2930627 0.41 + . g573 7 AUGUSTUS transcript 2930205 2930627 0.41 + . g573.t1 7 AUGUSTUS start_codon 2930205 2930207 . + 0 transcript_id "g573.t1"; gene_id "g573"; 7 AUGUSTUS CDS 2930205 2930627 0.41 + 0 transcript_id "g573.t1"; gene_id "g573"; 7 AUGUSTUS stop_codon 2930625 2930627 . + 0 transcript_id "g573.t1"; gene_id "g573"; # protein sequence = [MTHTSEFSFFASPYDNTWQTNAGVSNFQSYNQCPEVPVQHLQPAHMSYESYTDHMAGLDPSTSVVVSPEDFQAVFGSE # YHNQHNEPDVEFPEVAPWFNLDSATTSQTQTLPLQSFEESPSTSLSMDPLFDLAQFSTSFAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g573 ### # start gene g574 7 AUGUSTUS gene 2934266 2934778 0.48 + . g574 7 AUGUSTUS transcript 2934266 2934778 0.48 + . g574.t1 7 AUGUSTUS start_codon 2934266 2934268 . + 0 transcript_id "g574.t1"; gene_id "g574"; 7 AUGUSTUS CDS 2934266 2934778 0.48 + 0 transcript_id "g574.t1"; gene_id "g574"; 7 AUGUSTUS stop_codon 2934776 2934778 . + 0 transcript_id "g574.t1"; gene_id "g574"; # protein sequence = [MTHTSEFSFFASPYDNTWQTNASVSNFQSYNQCPEVPVLHLQPEHMSYESCAGMDYVTGLDPSTSVVISPEDLEVIFG # SNTHHDQHVEHDAGFPEVFPCFNLPSYDSPAISQNQTLPFESLESLPFESIDTQTLPLEFFEPFPSTSFPSLSSSSTDPLFDLDQFAASLAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g574 ### # start gene g575 7 AUGUSTUS gene 2939238 2940241 0.12 - . g575 7 AUGUSTUS transcript 2939238 2940241 0.12 - . g575.t1 7 AUGUSTUS stop_codon 2939238 2939240 . - 0 transcript_id "g575.t1"; gene_id "g575"; 7 AUGUSTUS CDS 2939238 2939839 0.74 - 2 transcript_id "g575.t1"; gene_id "g575"; 7 AUGUSTUS CDS 2939894 2940131 0.47 - 0 transcript_id "g575.t1"; gene_id "g575"; 7 AUGUSTUS CDS 2940236 2940241 0.18 - 0 transcript_id "g575.t1"; gene_id "g575"; 7 AUGUSTUS start_codon 2940239 2940241 . - 0 transcript_id "g575.t1"; gene_id "g575"; # protein sequence = [MVRDGGGGGGGGDGGAPRTPRDDDDGEGDRGAPSPRLRVLPRHRGGDHDGRDAPSPRLQLPPHREGGGGGGGGDDGAP # RIPLLLPHRGGDDGGRDVPSPQLQLPRHREGGGGGGGGDRDRDAPSLPPRPPPHCEGGGGGDRDRGVPSLPPRSLSHHEGGGDGGDDDHGALSPQPQL # PPHRGGGGGGDDDVRHAPSPRSRVPPHRGGDGDGRGDALSLQPRFSLHHEGGDGGGDGGAPRPPPRSVPPHHEGGGGDDDDDGGDVQHQNSRRHGDAT # TTTVSNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g575 ### # start gene g576 7 AUGUSTUS gene 2940544 2940882 0.47 + . g576 7 AUGUSTUS transcript 2940544 2940882 0.47 + . g576.t1 7 AUGUSTUS start_codon 2940544 2940546 . + 0 transcript_id "g576.t1"; gene_id "g576"; 7 AUGUSTUS CDS 2940544 2940882 0.47 + 0 transcript_id "g576.t1"; gene_id "g576"; 7 AUGUSTUS stop_codon 2940880 2940882 . + 0 transcript_id "g576.t1"; gene_id "g576"; # protein sequence = [MENGPAIGGRPLQRMERRRVDEGSSTTPGSGSGSASGPGSGSLKTPPSTGSSLTPITEEVPSPTGPGAAGATKSGRPT # LQRGIPFSTALPLPTQGSLDSRSTPFGDFGDDLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g576 ### # start gene g577 7 AUGUSTUS gene 2947797 2948471 0.92 - . g577 7 AUGUSTUS transcript 2947797 2948471 0.92 - . g577.t1 7 AUGUSTUS stop_codon 2947797 2947799 . - 0 transcript_id "g577.t1"; gene_id "g577"; 7 AUGUSTUS CDS 2947797 2948471 0.92 - 0 transcript_id "g577.t1"; gene_id "g577"; 7 AUGUSTUS start_codon 2948469 2948471 . - 0 transcript_id "g577.t1"; gene_id "g577"; # protein sequence = [MRKHLASALKKRSKSIQSAITEYNTVAAKMKPKRQPVDWEEVVEYAFLSEFDILRDTREDIRERPWAVPANRVIITQF # FKVIGAEDELSRVHQEIRRLITYMQQEKNELITRERELMPTNPTLALQVRNFRRERGRFHEVHKKRLLSITKLPGFDWSTNSKYFFPGTSVERRINHT # SYAAEALTAERGVDEDNTDDDDDDEDEDEELVRRIDTFLSVATDVLEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g577 ### # start gene g578 7 AUGUSTUS gene 2954250 2955253 0.36 - . g578 7 AUGUSTUS transcript 2954250 2955253 0.36 - . g578.t1 7 AUGUSTUS stop_codon 2954250 2954252 . - 0 transcript_id "g578.t1"; gene_id "g578"; 7 AUGUSTUS CDS 2954250 2954872 0.37 - 2 transcript_id "g578.t1"; gene_id "g578"; 7 AUGUSTUS CDS 2955247 2955253 0.36 - 0 transcript_id "g578.t1"; gene_id "g578"; 7 AUGUSTUS start_codon 2955251 2955253 . - 0 transcript_id "g578.t1"; gene_id "g578"; # protein sequence = [MSEEIRKLSSPPTTPTRSGRVKHISSPKILRPPHPAASKTQPEAHDVIASPSQRKISLVWISSEDEADCPDDSEDSDD # SSGGWVPQSAAEVSSDEDEPLAGSGGVTAAEARVQRAGKSIEKTYLVYHGRNNSEGLYFEWQGTKGATGALELTDQFPDAVYKLFNNRKLAAKAYKEC # KYTGVLDIFKLPVQAKEHLIVVKGENPGVYNRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g578 ### # start gene g579 7 AUGUSTUS gene 2955412 2956857 0.64 + . g579 7 AUGUSTUS transcript 2955412 2956857 0.64 + . g579.t1 7 AUGUSTUS start_codon 2955412 2955414 . + 0 transcript_id "g579.t1"; gene_id "g579"; 7 AUGUSTUS CDS 2955412 2956857 0.64 + 0 transcript_id "g579.t1"; gene_id "g579"; 7 AUGUSTUS stop_codon 2956855 2956857 . + 0 transcript_id "g579.t1"; gene_id "g579"; # protein sequence = [MANHSFQYLLSSPDVPPSPFPQHPSQPPLENTGHYNLSSLRRPIQNPHFLREFTATPYSGPQSRTNLHQIPTQSSMPD # PKAYSQPTSRIGFSSHEAYAQPTSHMDFPSPGIEFSSGHSAPLRDNNHQMRPDIVQSFQSVNGRHYTPGSFSSGYDLPPRSDFSAVTSQKGHLRSSQR # GALQWKETVLCSNVDASRLHSPTPPRSSYSSPPLPTPNSGRSYGPGHNHHVVSILNNDINPTKTFAIPQSSQNPFPPCEPSPMLAPSAGPCFSGRPLS # HEPLSTSPSSLSLRLSGHPSTLNSLSSLAHLADPQLSGRSVSCSPLPLGEESPSSIRGSSGEADSSLVCSGTNGIQSTPVSLVHSAPDGVQPSPVSTG # QAEQVQHRTVNLGISEKSLAKATSALKTKLLNQAISQLQAEQEEKVIDLADTHGVAVSRLKKLAGTSKHHRKRRVNSVQDAILHAKSKELNQGMITWQ # RLSILANTYHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g579 ### # start gene g580 7 AUGUSTUS gene 2957508 2958011 0.73 + . g580 7 AUGUSTUS transcript 2957508 2958011 0.73 + . g580.t1 7 AUGUSTUS start_codon 2957508 2957510 . + 0 transcript_id "g580.t1"; gene_id "g580"; 7 AUGUSTUS CDS 2957508 2958011 0.73 + 0 transcript_id "g580.t1"; gene_id "g580"; 7 AUGUSTUS stop_codon 2958009 2958011 . + 0 transcript_id "g580.t1"; gene_id "g580"; # protein sequence = [MNYPNFRTKISAKYKVKIIGWPIDVPLVSPRDITDPSKLDTLYDAWRSGSAYWSTMDKREYKRFMQQLDNDKAAGLQI # EIPRKGRSDIGGTHQKATTKRSRENDIEEPPAKRKRTSLSTNKTAIIVQDQDANDDEENMEEDQDANYDEENVEEGSEDEDEGEDELDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g580 ### # start gene g581 7 AUGUSTUS gene 2962845 2964356 0.85 - . g581 7 AUGUSTUS transcript 2962845 2964356 0.85 - . g581.t1 7 AUGUSTUS stop_codon 2962845 2962847 . - 0 transcript_id "g581.t1"; gene_id "g581"; 7 AUGUSTUS CDS 2962845 2964356 0.85 - 0 transcript_id "g581.t1"; gene_id "g581"; 7 AUGUSTUS start_codon 2964354 2964356 . - 0 transcript_id "g581.t1"; gene_id "g581"; # protein sequence = [MTVLYATPSGDNSNAPSPLSEFLLDMTNTDALGAKIHLIANLLAFTPPRYSKLPGPSLAAYLRLLGDVLNIIPPGALE # GPSATSSAVRTRISDGYNSDSEDDHANIRVSIVSSFNTSAPLALPILDSRTLKRLLNLPSPTHITSILSASRSLGSSRYPLITFIYAIYGIWPSKQND # ILAHLWSWNGGGLVREIWRGWVRGGGLGSNLVSLDPKASGDMDVDNNASSNVATSRSSHLEPLKPTITSSARLRGMTAPNADEDPWAPLLLLADLYSH # GLITMGDDEFFSSDSTVIGTRPSAAHRNPLTLDEISTFTRQLLNIAWSLWMYGGDLEIEPLPSILTSAVPNPRVRLTWLEIRGKVTKCLLAINARDAR # KPFMPKGGWLVLNDAESNGAPHGEGMHLTPEMAGFVEAAIFEAQELMDDSEASLEDALMDSVSSPRRGPRSHAPSASSAYSKRKLNYLSPRLGVLNNI # PFAIPFHVRVAIFRNFIHMDLAGRRTSRSVSAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g581 ### # start gene g582 7 AUGUSTUS gene 2969230 2970477 0.3 - . g582 7 AUGUSTUS transcript 2969230 2970477 0.3 - . g582.t1 7 AUGUSTUS stop_codon 2969230 2969232 . - 0 transcript_id "g582.t1"; gene_id "g582"; 7 AUGUSTUS CDS 2969230 2969982 0.55 - 0 transcript_id "g582.t1"; gene_id "g582"; 7 AUGUSTUS CDS 2970057 2970370 0.53 - 2 transcript_id "g582.t1"; gene_id "g582"; 7 AUGUSTUS CDS 2970429 2970477 0.61 - 0 transcript_id "g582.t1"; gene_id "g582"; 7 AUGUSTUS start_codon 2970475 2970477 . - 0 transcript_id "g582.t1"; gene_id "g582"; # protein sequence = [MAWPDDREDINSFALNAVSGLLEKYKIDPKSIGRIDVGTETIIDKSKSVKTHLMDLFTECGNGDIEGIDSKNACYGGT # AALFNAVNWIESTSWDGRNAIVVAGDIAVYAEGPARPAGGAGALLIARVAVHGTHMSNTYDFYKPNLTSEYPEVDGPVSVVTYTSALDFAYNAYREKV # ARFAKRAGISGQPSFSIDSVDYAIFHSPYGKQAVKGHARMLYNDFLASPTSSKFANIADAEAFRTLSQKASLSDKNLEKAFITAGKASFKAQVDPGMA # CSKRLGNMYTASLYGCLASLIANVEPSSFKGKRVSLYSFGSGCAASFFTIKVKGDTTEMREKMDLTNRLAAMKVVPCQDFVDALNVSLIDISYFFLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g582 ### # start gene g583 7 AUGUSTUS gene 2973716 2974759 0.79 + . g583 7 AUGUSTUS transcript 2973716 2974759 0.79 + . g583.t1 7 AUGUSTUS start_codon 2973716 2973718 . + 0 transcript_id "g583.t1"; gene_id "g583"; 7 AUGUSTUS CDS 2973716 2974759 0.79 + 0 transcript_id "g583.t1"; gene_id "g583"; 7 AUGUSTUS stop_codon 2974757 2974759 . + 0 transcript_id "g583.t1"; gene_id "g583"; # protein sequence = [MGRLLIRDHSKIQFRHTLSYAVSFGCFSSYAIVLISIYSLQDKSRACPSCNFKTCDPGSLTRHRKRIHGYVPKPRKAR # ATKKQQDTSSDRSISPSLTSVSSESISGLSSPWSSSSPSSESTIDFSSLTLASEVEPTTTLHIDEEICKPFFPEVLPTDVDLFYEPDSVSGFGYSTFD # DLRPRPLFPAVESTPSLELFQPLHSNYSPNFSLLLAATHKTLPFPTINHVDDQALYNIPCGVFLENVCDESLHQPLPTPYDSFIQQMAEMDPSIFVTI # SDHDFRVVFGCDYEHFVAARARSPSPWSSTLGSSINPVTSSIPGSSIDPITSTTSSPTPKPFTGSLLAELYAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g583 ### # start gene g584 7 AUGUSTUS gene 2980631 2983329 0.72 - . g584 7 AUGUSTUS transcript 2980631 2983329 0.72 - . g584.t1 7 AUGUSTUS stop_codon 2980631 2980633 . - 0 transcript_id "g584.t1"; gene_id "g584"; 7 AUGUSTUS CDS 2980631 2982689 0.78 - 1 transcript_id "g584.t1"; gene_id "g584"; 7 AUGUSTUS CDS 2982740 2983329 0.72 - 0 transcript_id "g584.t1"; gene_id "g584"; 7 AUGUSTUS start_codon 2983327 2983329 . - 0 transcript_id "g584.t1"; gene_id "g584"; # protein sequence = [MLTGDLPSPLFSPAESDNESDGNEELSREASDPDASIHPTRPSLSQTKSDTHITRWGPNRAFRKDSPPRIEPTGAANV # VPTSNTNASQSHTSPHHVYSATNLSGYFASHIQGQSQQAELSSSSSSPRGGSAEVTPSGGIHSNGHKKKHITFNTFVEQCIAIDQPKPKETTFAAILG # DVEEDWYAKTHDSVKASYDDGYDEDAEDGFDGDWGLNECAISTDSESDADQVLGESACDDDEEEEEEEGIIQMRSRRDSFDNKNSARLRSTSKVSTSS # SSSSASSASASSNHKNIPPNIRRRRRSDGPKNVSLPRKGSISLGRNSSSTALSSSDKEMVSIAPIAPTMLKTGSQTSWDGFGVHGVQSPYGLPASGGW # SEGFGDDFSDDGSNIHVGPGGAKLYIGSSNNESEGSTPVGLVYMPPATTRYGNSIIPRVNSNTSLSSEAEVELREDANQKDADNVRGDKTVGSVEERT # SENGDKVYRHHEAYFSIGSDKDGVLGVRSSSVPIVVRTPAVNVHGNRDDDDDDVAEEDAYDYFGGPDLGEDFAHRKTKFSARRKPQRSSEAVSSPVTI # KGNSNAQAVDEERQSRSRSRSRSRTPSPSYVSQSSTPAISVPGRAEHVSSPPPSSSSLLSPPLRGREFVPAEQPSTSRGRASRTSSSFPDRSRSRSNH # SSPLGSLSPEGIGSAYSANGRGGGDRERERERSNRNGGRGRERTERHLSHSLSPDAVECVSSLGPDAASSVSSSSSGSQTVVPQYDHADTFESSVDNP # SVKVQVRTSQSTPTNSPVISMSGAAHAIARMNGKSPITIPDPHVSSPRLTYPSHSTSEPSNTNTSSSPPVSPKGSTLSGTSISTKDSDNDDTGVVGKA # VGIVSSAGSYFSFWNNGAGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g584 ### # start gene g585 7 AUGUSTUS gene 2987733 2988254 0.99 - . g585 7 AUGUSTUS transcript 2987733 2988254 0.99 - . g585.t1 7 AUGUSTUS stop_codon 2987733 2987735 . - 0 transcript_id "g585.t1"; gene_id "g585"; 7 AUGUSTUS CDS 2987733 2988254 0.99 - 0 transcript_id "g585.t1"; gene_id "g585"; 7 AUGUSTUS start_codon 2988252 2988254 . - 0 transcript_id "g585.t1"; gene_id "g585"; # protein sequence = [MAATTTKKRAAKSQSGPAPKKVKKTDTATGKLDTNTTKKAKRSIPVTLTTSPPNDSENTDDEDDWEDAEDDVDFDGQA # VDDDNAMQVDSGEGKTSARESHIAQKVLQQSRKAAKPHSDLISEAKRVWALARSQSISASERKKHITDLMNVVRGKVRQVGFGSLYQFWTKFFDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g585 ### # start gene g586 7 AUGUSTUS gene 2992971 2993882 0.92 - . g586 7 AUGUSTUS transcript 2992971 2993882 0.92 - . g586.t1 7 AUGUSTUS stop_codon 2992971 2992973 . - 0 transcript_id "g586.t1"; gene_id "g586"; 7 AUGUSTUS CDS 2992971 2993882 0.92 - 0 transcript_id "g586.t1"; gene_id "g586"; 7 AUGUSTUS start_codon 2993880 2993882 . - 0 transcript_id "g586.t1"; gene_id "g586"; # protein sequence = [MCQVNQPECNRRLNAQHNIITNAFGGKLSVAPTNLATGDRVLESAAGSGKPVYLLSVVLFYDPQLTHRSPGIWALEFF # ETNRADGITLDIECIDISSEQFPTTHPPEIKFSVNSVVNLPNPEWTERFSFAHQRLLVAAMNDALWHLAVAELFRVVKPGAWVELVEIEAQGFGSWSV # GPHSTKLAFLINTMYDKRGVIGDLSVYLPLILKEAGFVDIKCEARHAPIGGEADAAAPHKFTQVKGFDSEMWRELWMGMKVPVIEAGGYGIVKTVEEY # DSLVQGSAAEWKTSKEAYTTFYAILARKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g586 ### # start gene g587 7 AUGUSTUS gene 2998538 3001186 0.32 - . g587 7 AUGUSTUS transcript 2998538 3001186 0.32 - . g587.t1 7 AUGUSTUS stop_codon 2998538 2998540 . - 0 transcript_id "g587.t1"; gene_id "g587"; 7 AUGUSTUS CDS 2998538 3001186 0.32 - 0 transcript_id "g587.t1"; gene_id "g587"; 7 AUGUSTUS start_codon 3001184 3001186 . - 0 transcript_id "g587.t1"; gene_id "g587"; # protein sequence = [MDRSTSVSPIQGLSIPLPPSHANSPAPQSPEPNISLNQSEPNTSTNTQSMDITDAHDSPIRYLAESGSEAIEGRDESV # ERSVAGKEDTSEHTFSTDDGPTPYAVIKNENSRSPEGLASAFSSPATSMATPTPAFTRPRARFNLPEGSSSDESHEAHREDHAIHDEEMSLEEPMTPQ # TRRRSFFLSVINSTTRPRMKFPTPHPRDRIVPDTPSMMDVIPGPASRSIVQHTPIAFPSAFAGATPRPRFKPSSRLSHPLAQAHTLTSSSSTSESEPG # EETDGTVRPENNDEINNEHLPWSTPAPVASVAHLSPYDEAALNGASFVSTASSHDLTTHPRANTSFDPAMGFGGNAPGHGVGRFNANKLNTYLHGLNR # KLQEENEALMERNRILEENQGKSSSASIPPTPVASAMGSRRQSGGSRRLSAVSNLGDLQEEANEAWMEEKAELEEMVDAFKNEAEQCMKEKEEVENAL # ERETRERAKDKERWKERMSEVQKGVEDIVRDLENKLHAAQENAQNAEKDALGQAKDLEKKLAEAQAQRDDAAARAEKAEGALANNQDLGGELRNANDR # VSCLMGDLRNANSQIEELEQELVRSEEFVDGLERNLTEHKNILVDLRKTLESKDQQIEAQRIEVRHLEQAHQKTEEVLSATREYITKIEEDASTAVEH # AEALGEELEAAKEEVQHLKMVAADREAQGEQLAKEAERAAQLARQMEEALEAAEKKMAEDEDDLAAVNGKLNALEREKERQKELSTRSIDQSRLASAT # AAQVAAHEAEIEALEQELDNATKEIARLNTVLNQSPARKAVDKAKDAKIEMLEQENEALSERIKALRMTMNDFNTPSKMINNSGISPMHRRALSMSIR # APKTPGGPLRDVSYRLMTRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g587 ### # start gene g588 7 AUGUSTUS gene 3001365 3002048 0.64 - . g588 7 AUGUSTUS transcript 3001365 3002048 0.64 - . g588.t1 7 AUGUSTUS stop_codon 3001365 3001367 . - 0 transcript_id "g588.t1"; gene_id "g588"; 7 AUGUSTUS CDS 3001365 3002048 0.64 - 0 transcript_id "g588.t1"; gene_id "g588"; 7 AUGUSTUS start_codon 3002046 3002048 . - 0 transcript_id "g588.t1"; gene_id "g588"; # protein sequence = [MASMLETPSRIWRRIEAEGSRDMPSLPSVPGFDDSAEISISSDDPRPYHGEYEVNEEPSFGHIASPIHSTPAASSHHA # STIRATSSTSSTTRFAHSLARSGRSSLAHSSISRALSARRNYPDSFEISAIPSLPDDDIGRRSDCSSGEIDDDLVGSRESAPEGYTYTSDRIRMPMDE # DANFDVSLTDALESISSPYQSEPERGRTPKEQSYIDYEVSLKSSPKVRVGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g588 ### # start gene g589 7 AUGUSTUS gene 3003080 3003910 0.99 + . g589 7 AUGUSTUS transcript 3003080 3003910 0.99 + . g589.t1 7 AUGUSTUS start_codon 3003080 3003082 . + 0 transcript_id "g589.t1"; gene_id "g589"; 7 AUGUSTUS CDS 3003080 3003910 0.99 + 0 transcript_id "g589.t1"; gene_id "g589"; 7 AUGUSTUS stop_codon 3003908 3003910 . + 0 transcript_id "g589.t1"; gene_id "g589"; # protein sequence = [MEKEEGENVRHELDQAFDSLRSLLYAPDPSATGSNSTPLGAPGPSLSVAIPETALVATEKTANYDQAVRELAFDKRAK # PKDRTKTEEELAVEEKEALEQAEKRRRKRMLGLEDSDSENEGRSKKRQRGGDDLEDDFNNEELGWNGLGTGLEGAHSGEEESDDDGTGDSGESAQGAD # EDDSEEGDDHEDQDDEELVRTSQKRSLSSLKGKGKELPFTFPCPSSHEELLEIVDTVNDDDVPTVIQRIRTLYHTSLAADNKFKLQVRDPFAADFLFS # LK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g589 ### # start gene g590 7 AUGUSTUS gene 3004484 3005168 0.72 + . g590 7 AUGUSTUS transcript 3004484 3005168 0.72 + . g590.t1 7 AUGUSTUS start_codon 3004484 3004486 . + 0 transcript_id "g590.t1"; gene_id "g590"; 7 AUGUSTUS CDS 3004484 3004705 0.75 + 0 transcript_id "g590.t1"; gene_id "g590"; 7 AUGUSTUS CDS 3004758 3005168 0.97 + 0 transcript_id "g590.t1"; gene_id "g590"; 7 AUGUSTUS stop_codon 3005166 3005168 . + 0 transcript_id "g590.t1"; gene_id "g590"; # protein sequence = [MAKGLKIQQPDLNDLLTNQNHDAASKLNLLALSLDLLGRYANISKGLEAFVEVFDPINQILQNLKLEKFEDDLQARAT # STKEIIERLLKFTRQSRRPLMLQAHKAIPIPSYVPKFDSTSSSYLRHQDPDKERNEAAKLRNEYKKERKGAIRELRKDARFLAGVQQAQQKEKDKGYS # ERMKRVFGSLESERAEEKAMEREKAKEKKRAGRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g590 ### # start gene g591 7 AUGUSTUS gene 3007825 3010079 0.33 - . g591 7 AUGUSTUS transcript 3007825 3010079 0.33 - . g591.t1 7 AUGUSTUS stop_codon 3007825 3007827 . - 0 transcript_id "g591.t1"; gene_id "g591"; 7 AUGUSTUS CDS 3007825 3008536 0.55 - 1 transcript_id "g591.t1"; gene_id "g591"; 7 AUGUSTUS CDS 3009426 3009532 0.54 - 0 transcript_id "g591.t1"; gene_id "g591"; 7 AUGUSTUS CDS 3009584 3009808 0.99 - 0 transcript_id "g591.t1"; gene_id "g591"; 7 AUGUSTUS CDS 3009897 3010079 0.57 - 0 transcript_id "g591.t1"; gene_id "g591"; 7 AUGUSTUS start_codon 3010077 3010079 . - 0 transcript_id "g591.t1"; gene_id "g591"; # protein sequence = [MSEINVQDMRDPNTAATPPPDVAQRGPPSDTSDDRSDDERKKDAELAERLSRLIEDANSRVHIENMEARKDEDRDEGE # LVQQVKPLLQQAEKILNETMGMIKGADPDNRLSDRAKRHAQTHNATPEEQRLAEALKVLLEEVGGTIEWARDKLDSFPKAKKDLGPLLDALGRRAIPD # DDSHRELRELWTQYKALIFKEKEEHWKDFLDNVDTDSIFTAAKYATTPNIDQDTTTVIPELKALDENGAVRRIASTNEEKAALLAETFFPSAPRNYSL # DRNPCRDQLPNPPPITQQRIIDALQRLKSYKAPGPDGIPNIILKKCAGMLAPYLCEIYNAIGYLKAYPKEWLNSTTVVIRKPARKSYSLPKSYRPIAL # INTLAKGYTSIIAEVIILPHSTTFSQTPSSEVDRVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g591 ### # start gene g592 7 AUGUSTUS gene 3016996 3017688 0.84 - . g592 7 AUGUSTUS transcript 3016996 3017688 0.84 - . g592.t1 7 AUGUSTUS stop_codon 3016996 3016998 . - 0 transcript_id "g592.t1"; gene_id "g592"; 7 AUGUSTUS CDS 3016996 3017688 0.84 - 0 transcript_id "g592.t1"; gene_id "g592"; 7 AUGUSTUS start_codon 3017686 3017688 . - 0 transcript_id "g592.t1"; gene_id "g592"; # protein sequence = [MTSSDVVPNSIESLAPAAAPVGGDLSLMPTITIPGLFAFPVFTPAPIPHNCDIYGMLRPSVSCEKSSELSNLVNDPCS # DGIFWGPLTRSLEPKILLPAYESASPLHTTSVQLSSKHDLDGLIVLAPTSFTNDGIGNSALPELYMAIGSVTVLAYFWLFKRLRSTFENLFGSVTTQV # DYSFDNLHGFLRDSCSVPFAPDVFDNEDAVVVVEQYEEENEHDTVARPNGASVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g592 ### # start gene g593 7 AUGUSTUS gene 3021217 3021588 0.95 - . g593 7 AUGUSTUS transcript 3021217 3021588 0.95 - . g593.t1 7 AUGUSTUS stop_codon 3021217 3021219 . - 0 transcript_id "g593.t1"; gene_id "g593"; 7 AUGUSTUS CDS 3021217 3021588 0.95 - 0 transcript_id "g593.t1"; gene_id "g593"; 7 AUGUSTUS start_codon 3021586 3021588 . - 0 transcript_id "g593.t1"; gene_id "g593"; # protein sequence = [MEVALAESTALSQKSEREYITLRESLKHLTESWKSDTERLRDEIRKREEKWKGEAETLGKKYRKLVEEVQASRKGEEV # VKVLKEEDRNKAKEIEDRWMKEIDKMKQVVEQNEKDSKEDSETAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g593 ### # start gene g594 7 AUGUSTUS gene 3024603 3026498 0.51 + . g594 7 AUGUSTUS transcript 3024603 3026498 0.51 + . g594.t1 7 AUGUSTUS start_codon 3024603 3024605 . + 0 transcript_id "g594.t1"; gene_id "g594"; 7 AUGUSTUS CDS 3024603 3026498 0.51 + 0 transcript_id "g594.t1"; gene_id "g594"; 7 AUGUSTUS stop_codon 3026496 3026498 . + 0 transcript_id "g594.t1"; gene_id "g594"; # protein sequence = [MSSAQMQLTSFLPDITAYEDHGREWFSLLHVCRHWRGIIARSPTLWSTIDNTLVDSEDENNKKNNVVHERYLCRSGAA # PLRVYLGVKEMKIRRKSLGVLLKHVARFKELHVVADLWEDSSTPIYNLFVEPAPTLVSLTLRTDGKDVTNGSLPPIFAGEMPSLKELTLEHFTVWPTT # YFHNLTSLSLSDQAFNRPTTLSFLDFLQNSPVLEMLALVRAGPTLPANTDMIPATDRVVDLPRMRQLNLGGWPTTSTISRFLSYISLPPEADVFIWGS # VFSNPDTDLTALLPANTNNLHNIQGITKWYLTHYSVAQPGDLLYVPFTAIVGSSNSLHNYGVFRSSQLLATLPRYPLHNVTSFVLRDSSYQANRFKTS # VWVEIFGKLKNLQELRILAYQSTTTTRSVLTALLPASSKSAKKKDISQNGNRREIHEGQKEAGSSTSNAANTESSGTGKSKVPTDEEQEPENFHSPPR # GDHSRCEVLCPRLTTLSVEHDPDLASIFITKLVKSRKEHGCPIASLIILVFDPQYGVSPSPRPRSTRSDHDVNNQNQNQNQNHQNGHHTAGVNAADDS # SSTVSSRDILNEEYNLRSKEDEELLKRHVKEVRFEYKKPLSQDLVPRGWPTDAYRRTCLSYSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g594 ### # start gene g595 7 AUGUSTUS gene 3027547 3028712 0.38 + . g595 7 AUGUSTUS transcript 3027547 3028712 0.38 + . g595.t1 7 AUGUSTUS start_codon 3027547 3027549 . + 0 transcript_id "g595.t1"; gene_id "g595"; 7 AUGUSTUS CDS 3027547 3027613 0.83 + 0 transcript_id "g595.t1"; gene_id "g595"; 7 AUGUSTUS CDS 3027776 3028162 0.43 + 2 transcript_id "g595.t1"; gene_id "g595"; 7 AUGUSTUS CDS 3028213 3028712 0.91 + 2 transcript_id "g595.t1"; gene_id "g595"; 7 AUGUSTUS stop_codon 3028710 3028712 . + 0 transcript_id "g595.t1"; gene_id "g595"; # protein sequence = [MSDMKEILVIGGTGAQGSMVVKEGRQDNQLDLHRAFQGVCGAWVNTDGFSLNEKEELFYGIRTYEIARHERVQHFIWA # SLPYTLKNGNWDIKYHAAHSDSKGRVRDFILAQGQGDMKSSILTMVPYMEMLIDGVFVPQKQPDGSFVWLNPATTGKIPLIALDDVGHYSLWLFDNIS # ESAGMDLKVVTDYVNFEDITNTFTKVTGKRGLHKSLPLEEYLPFAEPFPNAPVNWYAGPNAARDESLLSWRDNITAFWRHWDDEVDVVADMDLLNRIH # PNRIKSLEEWMRKVEYDGSMKPIMKGPEDLRRAKIELKRGGKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g595 ### # start gene g596 7 AUGUSTUS gene 3032296 3033971 0.55 - . g596 7 AUGUSTUS transcript 3032296 3033971 0.55 - . g596.t1 7 AUGUSTUS stop_codon 3032296 3032298 . - 0 transcript_id "g596.t1"; gene_id "g596"; 7 AUGUSTUS CDS 3032296 3032610 0.77 - 0 transcript_id "g596.t1"; gene_id "g596"; 7 AUGUSTUS CDS 3032715 3033971 0.73 - 0 transcript_id "g596.t1"; gene_id "g596"; 7 AUGUSTUS start_codon 3033969 3033971 . - 0 transcript_id "g596.t1"; gene_id "g596"; # protein sequence = [MAEEVLYVLISILSESANISQMSVANQARREIVHALALGPCSYTDLIKRISERLVDDMAFEKMLRETTKFRSPEGTSD # IGTYELKDECFEEVNPFWYHYTRNKREEVEGILRRRLLKQNPTVPDPVLVPKPLNVSPSGPFAVLPSTFESEALLQVMFYAIHNVLALTDGGGSAPPS # GEAILDQALHLVMLAIVERPSIFCTLASLRAFEEGKVTLIDVLCKLETHEGFKSYKSRLGWILDQMHSWEPREVEIRRVVSGSHGTNQNSGGTLDGAT # GAAPDLEQAKKNAAKARQEAIMRQMKAQQASFAFSNFEDMEDDDEDQDMENEGEEEEVSYGTCIVCQEDLNASKAFGMLGMVQPSRFIRRQPDGHTTY # LNDVLQAPESMDRLSPVPQPAVISAFPPANAEALDATAQAKMVTAGGPFNTSETSHTGDKKPSRDHPEEGVHLSIVQEFGECHTPSSKTALGRTQCSA # VPGLDKRSRNKYTQIEAGSCIRGAPISKRDGRICVLECPGYRLFSGNEKFGQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g596 ### # start gene g597 7 AUGUSTUS gene 3034141 3036594 0.86 - . g597 7 AUGUSTUS transcript 3034141 3036594 0.86 - . g597.t1 7 AUGUSTUS stop_codon 3034141 3034143 . - 0 transcript_id "g597.t1"; gene_id "g597"; 7 AUGUSTUS CDS 3034141 3036289 0.99 - 1 transcript_id "g597.t1"; gene_id "g597"; 7 AUGUSTUS CDS 3036341 3036594 0.86 - 0 transcript_id "g597.t1"; gene_id "g597"; 7 AUGUSTUS start_codon 3036592 3036594 . - 0 transcript_id "g597.t1"; gene_id "g597"; # protein sequence = [MPGSRKYTFTSATRAEILSELYDSFWGPYAHVFLPNSNSSLPLNAMLSEVQVKLGFCGAGKEAPMIPGRPCAHILKKG # EPCFRCKDCALDDSCVLCSRCFHATDHTDHNVSFFIAQQSGGCCDCGDDEAWRTSIQCPYHPPAALVAESSVPSSSASTDTPRSAPKHLSSAIPQPVK # HYPYRVSVPPELRELMNRTVGYALDFILDTLDFSPDDPSVPSNEADLRLQPSADPMMKDQYCIMIWNDDKHSFDEVIKLLCDLTGRTKEEASESAHRI # DENGRDLVEMGTEVPRLLEIAQSISQIDLGVTMRRAYDTFREQVASVIIEWLLDLTQSRLGTDTLVMREVIAEELLSPRKRDNHSSYGYSAQSLHSLT # DVPNPTRLDHLFLSHTRLWKRPRLSLKEIYTSVLTISRDHKLAVGTFIKFCFHPLFLSPTIAGHFARVYHRVIDAYLLVDREAETSIKYFALQLFTVP # SVASHIVRHHKLITRLLAIITSFFTNQIIDKHIVYPPSNPMNSSSSSAQGLLEQTLDPESFPFKSKRFMPVFSDLRYLISNAPVQRLIASNPHLYISQ # FAKTCQLFMGVNPNKRMVGGHVEFEGDAWISVFNVTLSLGRVIKAYGAAFGVSRGTDATGESSSSGPGAGELVAAIQTVVHHILMVCTEEKFGTNGFG # NGKVQFHKIFFGGAIYQIIKFDVLEGWVSFHHSLHWLLAELFKHVDILDTGRLRREVGVEGGIRDVVIRVASERAVLTVVDFPLRGLLLLFAVFENLL # MRLISLGNDCTDTMQSLGSQRFRYSRSTASLPRLYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g597 ### # start gene g598 7 AUGUSTUS gene 3037446 3037778 0.62 + . g598 7 AUGUSTUS transcript 3037446 3037778 0.62 + . g598.t1 7 AUGUSTUS start_codon 3037446 3037448 . + 0 transcript_id "g598.t1"; gene_id "g598"; 7 AUGUSTUS CDS 3037446 3037778 0.62 + 0 transcript_id "g598.t1"; gene_id "g598"; 7 AUGUSTUS stop_codon 3037776 3037778 . + 0 transcript_id "g598.t1"; gene_id "g598"; # protein sequence = [MSALQEMKERLDASHAANVQKTAALAQLAKIENVWQKQFLTLKAEVDEQSDRSTFEARRAEAREEAAASEYHSDLTLI # KERERLAREDALRWKARYEALVAKWVYQLLHG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g598 ### # start gene g599 7 AUGUSTUS gene 3039676 3041160 0.77 + . g599 7 AUGUSTUS transcript 3039676 3041160 0.77 + . g599.t1 7 AUGUSTUS start_codon 3039676 3039678 . + 0 transcript_id "g599.t1"; gene_id "g599"; 7 AUGUSTUS CDS 3039676 3041160 0.77 + 0 transcript_id "g599.t1"; gene_id "g599"; 7 AUGUSTUS stop_codon 3041158 3041160 . + 0 transcript_id "g599.t1"; gene_id "g599"; # protein sequence = [MSTPSSSLPSTLSPTYTEPITTPSNSYTLHASPSSNTISAYTYTPHHTTHGYPILNYIPNIFETLLISTIILTIFLNS # LTQLLMTGRVDKPLLGLGVSSIKNLDEWKSMIPWEEDFGVVLLRVGTASLEATGLRGWGNEVGGVVASSLPGTSDDESRKYGRVRLTRMGVVGVTPGS # ISQTHDKLGHGKISNGKGRGKPKLLKGWHNEVRDVDLGSPPSSSGSRRQWGVNGILTLNAQWFIELGRFVRSVWGSMLGAVNAGFTIGWEMLRGRGSY # GNARRRVQDKAQDRRDTGHSGEENEGESESEDEDEVEKLYRKFVRGESVSFGSDEEQDQDYNMSDTDQADEEEESESQEEFEETSHLYADLSNRESTP # GASTTTSTMIAHMSYTGSSPLTRKKYASLLKGPHGSNEPSPFNDGGNGGGRSGDALVKDDLRGNRISDSSASGVASGDSGDTRRNCVICTIEPRVIIC # WPCRYVLYSISISSLLMESTPIYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g599 ### # start gene g600 7 AUGUSTUS gene 3043227 3043895 0.65 + . g600 7 AUGUSTUS transcript 3043227 3043895 0.65 + . g600.t1 7 AUGUSTUS start_codon 3043227 3043229 . + 0 transcript_id "g600.t1"; gene_id "g600"; 7 AUGUSTUS CDS 3043227 3043895 0.65 + 0 transcript_id "g600.t1"; gene_id "g600"; 7 AUGUSTUS stop_codon 3043893 3043895 . + 0 transcript_id "g600.t1"; gene_id "g600"; # protein sequence = [MRFNSMKTEKSNEVTVGWDGMVKVTLKAQEKLYKAFLEKLSELLKSQVRTLSNLRKFNLCLVKYTDADVLRKDLQALY # DEGYRSIAIVLVHSYTYPEHERFVGSIARSIGFEHVSESAQLLPMIKMVPRGVSSTADAYLTPILRDYLNGFFSGFDEKLKDGRLKSPRVEFMGSDGG # LVDYQWFSGLKSILSGPAGGVVGYALTSWDETRKRPIIGHVSSSTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g600 ### # start gene g601 7 AUGUSTUS gene 3044960 3045536 0.23 + . g601 7 AUGUSTUS transcript 3044960 3045536 0.23 + . g601.t1 7 AUGUSTUS start_codon 3044960 3044962 . + 0 transcript_id "g601.t1"; gene_id "g601"; 7 AUGUSTUS CDS 3044960 3045096 0.23 + 0 transcript_id "g601.t1"; gene_id "g601"; 7 AUGUSTUS CDS 3045185 3045536 0.98 + 1 transcript_id "g601.t1"; gene_id "g601"; 7 AUGUSTUS stop_codon 3045534 3045536 . + 0 transcript_id "g601.t1"; gene_id "g601"; # protein sequence = [MLNMRFEGTDTSLMVLPDPNERLEGEDGGDGGEDFLKAFRRVYKTEFIVPQVRGIGKTFDTLGESVYNEVEKLQSSNA # IKAVNSFDPSLSPAKPDKADATWSVYFDEPVGRVDNTPVFQLEKLEIGDEVHGPAMIIDDTQTIVVIPGARALLTSKHLFITLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g601 ### # start gene g602 7 AUGUSTUS gene 3054886 3055748 0.49 - . g602 7 AUGUSTUS transcript 3054886 3055748 0.49 - . g602.t1 7 AUGUSTUS stop_codon 3054886 3054888 . - 0 transcript_id "g602.t1"; gene_id "g602"; 7 AUGUSTUS CDS 3054886 3055607 0.67 - 2 transcript_id "g602.t1"; gene_id "g602"; 7 AUGUSTUS CDS 3055733 3055748 0.55 - 0 transcript_id "g602.t1"; gene_id "g602"; 7 AUGUSTUS start_codon 3055746 3055748 . - 0 transcript_id "g602.t1"; gene_id "g602"; # protein sequence = [MDQGKRTEIPMEVLTREESRRSDASTHRIQPEMDNESNSLSSSKSSRRASARPTYVPLPSPRTLAFDSTTSTTSSLPT # ISPTHLPPSPLANRAFPPPSPSNPLFSHPLHVLVVDDDALTRTLMRRMLERMGCEVTTAENGDLALRILLSPDSDGESSSQSCSNSEQPVASDTVSKF # HIIFLDNQMPVLSGVKAIAKLRDLGRRDFVVGVTGMLSSMSLRLKGLRTGSNYRKCAGFRSARIPRRRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g602 ### # start gene g603 7 AUGUSTUS gene 3057046 3059097 0.36 - . g603 7 AUGUSTUS transcript 3057046 3059097 0.36 - . g603.t1 7 AUGUSTUS stop_codon 3057046 3057048 . - 0 transcript_id "g603.t1"; gene_id "g603"; 7 AUGUSTUS CDS 3057046 3057182 0.44 - 2 transcript_id "g603.t1"; gene_id "g603"; 7 AUGUSTUS CDS 3057234 3057269 0.43 - 2 transcript_id "g603.t1"; gene_id "g603"; 7 AUGUSTUS CDS 3057354 3057450 0.42 - 0 transcript_id "g603.t1"; gene_id "g603"; 7 AUGUSTUS CDS 3057661 3059097 0.47 - 0 transcript_id "g603.t1"; gene_id "g603"; 7 AUGUSTUS start_codon 3059095 3059097 . - 0 transcript_id "g603.t1"; gene_id "g603"; # protein sequence = [MSTWTHSASSKWAEEVAMASMQKSSQNADEPSTTSMSFDLPIPVVQKQPSDSSLRRNFTFVSRLNCALYSKTTNIFRR # VQKTLAAPSSSTVVRESLEGIQHALDNNRYALEEDQAVKVEEVNEDEVVEEVVVDRAWNEASTKTSLKSKALSESDGGEVCSESPASIPGIQDPMKRP # ALLIVFWTLYSHWQQFFNPRFKDINKEIHYQKENWAHSKRLSLWASVFFIGNWILGAALIPTPAVLLDKVRRSAPTVSIIITNLNSIDILLRSALSQH # LLTIRRKMPILFFHLRTLPYSLRLAVSERSPPFAYMSSKYNFQLPSPSYCFVLSTFREITRDFISVSFSSQPGRGMTIKLAPFKLAYVCSIGHTTKSF # LVSFVAIQEGMIYSRVVPKTSPQHSSKLLCSQSFETFKVLHYSYTTALQTVALFGLDLKRFPALLGAIIFIVLSGFLIIPEKVKYVSLINRDLVGQSE # DRPRIAGCEFERTQKAQINERKAADSKYRLTSYDSLLLHALLAAQVRVPLNTALLAVQNMSASGTIVKSLELEFTALEGSLSMMSKGQCPTLAGPLPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g603 ### # start gene g604 7 AUGUSTUS gene 3061285 3063937 0.23 - . g604 7 AUGUSTUS transcript 3061285 3063937 0.23 - . g604.t1 7 AUGUSTUS stop_codon 3061285 3061287 . - 0 transcript_id "g604.t1"; gene_id "g604"; 7 AUGUSTUS CDS 3061285 3062120 0.48 - 2 transcript_id "g604.t1"; gene_id "g604"; 7 AUGUSTUS CDS 3062197 3063937 0.28 - 0 transcript_id "g604.t1"; gene_id "g604"; 7 AUGUSTUS start_codon 3063935 3063937 . - 0 transcript_id "g604.t1"; gene_id "g604"; # protein sequence = [MKDGRMVEAGYRYDLERSMDESGEEGEFMRLARNQGILSGDDEDESSPRSPEFDIEFAPEGFESEAFDAASLEVHQPF # SHRLTMGASMMGGWMFDVVADLTKGSTNPTQASKPPSRISRALSPSRFSRALSPVPKDRNTTLSPLPPAFSPLSINTQTRPRRPSSVSIPSPLHLDTM # SPFNDAAAVPEQSKAPRQRRYSLQFEPATPTGLTFADLQKQGLDEKRALERSAQSVSIRRRQTRREVLGLDAEKLEIVTPSASEATPIVNEIGFWQLI # RALYPSMPYKPLLFIGLLICVISGAMTPIFSFLLSRLLFEVSTGVQDVRTVNEYGGLVLGMAALDGLLMGVKFFLMQSLGWMWIERIRESAFARLVSM # PKSFFDAGVVGKEKPSPNSAARTSPVALTQILTKSAEDAKNLLAVVAGQALVVFSMLAVGLIWAFVIGWQFTLIGLAIAPVFAGVMSIQSKFVADTER # KNKAARESVASAYYDAVANIRSIRYTGLTTVFQQRFDVSLDRAMSIGVKGAMVEGCTYGVASGLIYAAEALLFYVGAVLVAKGTYTYLQMVEVLDLVV # FTVTIGSQLMAFMQAARDLHAVLELPTDTSETQGFLRPEFQHTPLPIVFHDVEFSYPSRPDVPVLKGLNLSIAPGETVALVGASGCGKSTVAQLIQRL # YEPSSGSVQVADIDTRAMDIQHLRQHVSVVSQQAHLFDASVAENIAYGNSSISEVGIRKAAKAANIHDWVMSLEKGYDTIVGENASQLSGGQAQRLQI # ARALARPCRILILDECTSALDPENQREVLDTIQGLDRKGRTTVMVTHKVPAMKMCDRILVVDNGRIVEEGKYDELVQRRGVFATLASGGEWFGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g604 ### # start gene g605 7 AUGUSTUS gene 3064102 3065337 0.5 - . g605 7 AUGUSTUS transcript 3064102 3065337 0.5 - . g605.t1 7 AUGUSTUS stop_codon 3064102 3064104 . - 0 transcript_id "g605.t1"; gene_id "g605"; 7 AUGUSTUS CDS 3064102 3065337 0.5 - 0 transcript_id "g605.t1"; gene_id "g605"; 7 AUGUSTUS start_codon 3065335 3065337 . - 0 transcript_id "g605.t1"; gene_id "g605"; # protein sequence = [MNERKDGGQLATLLERTFTFISTVKAFTAVPFHKAKLHNLLTGRMRSNEISLNAIWGLSSGSSQFVMMSMFVQAFWFG # SKLVREGTIQPGAVMSVFWACLIATSNLQMCVPQLVTVGKGKVAMAALMALVKENPDYQPDVEVLPPSHPYNTPSTPISATFPPHSPASSVTLTTYSA # RPGRSIHRSSTTKSRVLRKIRPSRFKGDINLNQVCFAYPSRPNHPVLIDVDMYIPAGEITFIVGSSGSGKSSLAGIIAGLYKLNHKEGSSGEVLLDEQ # NLQYLDPVFVAANVGIVSQSPPVLLGGQSVHDNVAVALAAHPERTMESATEAEVVNACTLAMLHEFIRDLPEGYKTILGGDGSVGRQSEDDAGIQLSG # GQKQRLALARARLRNPSLLILGEYCAVFLFVSSLIPTLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g605 ### # start gene g606 7 AUGUSTUS gene 3065575 3066135 0.87 - . g606 7 AUGUSTUS transcript 3065575 3066135 0.87 - . g606.t1 7 AUGUSTUS stop_codon 3065575 3065577 . - 0 transcript_id "g606.t1"; gene_id "g606"; 7 AUGUSTUS CDS 3065575 3066135 0.87 - 0 transcript_id "g606.t1"; gene_id "g606"; 7 AUGUSTUS start_codon 3066133 3066135 . - 0 transcript_id "g606.t1"; gene_id "g606"; # protein sequence = [MPSRRPEPIDSDLQTLSSVETIEKPEPVSEVSSTPTHTPSPPSISTGSFKQLFSLLSTRHRFLILLPAIISSVIAGGI # APFMTIVIGQNFNAFAQFPQTPNPSESAKHQLLHDVGIAALELLGLAVGSFLLSAITSSLWIWTGEHNVREVRRRVFGSVLSQEMKWFDMKTQGDSVG # AAGLMAQFNQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g606 ### # start gene g607 7 AUGUSTUS gene 3078282 3079178 0.97 + . g607 7 AUGUSTUS transcript 3078282 3079178 0.97 + . g607.t1 7 AUGUSTUS start_codon 3078282 3078284 . + 0 transcript_id "g607.t1"; gene_id "g607"; 7 AUGUSTUS CDS 3078282 3079178 0.97 + 0 transcript_id "g607.t1"; gene_id "g607"; 7 AUGUSTUS stop_codon 3079176 3079178 . + 0 transcript_id "g607.t1"; gene_id "g607"; # protein sequence = [MNALELLAEQAVARTEGHVIPTTPQQGQQSDRHQYGQPIVPTQHYQSLRPSPTQPPPSSAHSALSKTYLYNFLTPFRS # GAYLSNPPRDNMPSTFQSHCQLHQPEHWSDDWWNQQDHDDQSFNINTLHHPTVPVAQKENDQTVAELLKIDEEKKKTTTGECDIDKKEKKMKQKKPLG # TGSKSGLTNCRDGGDSDVEIEMLSPEDMKAAVLKDPGDEKKSGVSEEDKVLLVEYLTCPEQWKNFKVRQGALMINVCVHPSISIAELTYCFPGCLGHF # QDQIHRYTTLKCMERIVGEIQGCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g607 ### # start gene g608 7 AUGUSTUS gene 3084411 3085577 0.6 + . g608 7 AUGUSTUS transcript 3084411 3085577 0.6 + . g608.t1 7 AUGUSTUS start_codon 3084411 3084413 . + 0 transcript_id "g608.t1"; gene_id "g608"; 7 AUGUSTUS CDS 3084411 3085577 0.6 + 0 transcript_id "g608.t1"; gene_id "g608"; 7 AUGUSTUS stop_codon 3085575 3085577 . + 0 transcript_id "g608.t1"; gene_id "g608"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFSCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSASAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g608 ### # start gene g609 7 AUGUSTUS gene 3085628 3089332 0.94 + . g609 7 AUGUSTUS transcript 3085628 3089332 0.94 + . g609.t1 7 AUGUSTUS start_codon 3085628 3085630 . + 0 transcript_id "g609.t1"; gene_id "g609"; 7 AUGUSTUS CDS 3085628 3089332 0.94 + 0 transcript_id "g609.t1"; gene_id "g609"; 7 AUGUSTUS stop_codon 3089330 3089332 . + 0 transcript_id "g609.t1"; gene_id "g609"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQEQWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEQE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLAR # LGIKSDLTSGYRPQSNGQTEQANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREA # RQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSI # NGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVRWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g609 ### # start gene g610 7 AUGUSTUS gene 3093340 3093945 1 - . g610 7 AUGUSTUS transcript 3093340 3093945 1 - . g610.t1 7 AUGUSTUS stop_codon 3093340 3093342 . - 0 transcript_id "g610.t1"; gene_id "g610"; 7 AUGUSTUS CDS 3093340 3093945 1 - 0 transcript_id "g610.t1"; gene_id "g610"; 7 AUGUSTUS start_codon 3093943 3093945 . - 0 transcript_id "g610.t1"; gene_id "g610"; # protein sequence = [MLLFSTKEKKKCPSCNFETPDPGTLTRHRKRRHEYVPEPRKSRNPGNTSSSDRTQPQIIIETPSTYSRSTSTLTDIPT # SPSTSGEYASVTTSPFSPVQPLPHSSAWCESDNPQSLSSFAGGQTDLNPSSAGYNQWDAMNATYSTLPTTPTPTTPTLSLPLPAIPRPRIEDESPQPS # FLRRKPLGIQDILTEEGRVYWRRCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g610 ### # start gene g611 7 AUGUSTUS gene 3099313 3100407 0.3 + . g611 7 AUGUSTUS transcript 3099313 3100407 0.3 + . g611.t1 7 AUGUSTUS start_codon 3099313 3099315 . + 0 transcript_id "g611.t1"; gene_id "g611"; 7 AUGUSTUS CDS 3099313 3099386 0.3 + 0 transcript_id "g611.t1"; gene_id "g611"; 7 AUGUSTUS CDS 3099465 3100407 0.78 + 1 transcript_id "g611.t1"; gene_id "g611"; 7 AUGUSTUS stop_codon 3100405 3100407 . + 0 transcript_id "g611.t1"; gene_id "g611"; # protein sequence = [MPLATDDEHMDEEINQQPLTLLRNRTFYSTYTLNHTHLNYVPAVQNWHNGGHLLRAHKIPSSSNNPESGVVTSLALDE # DWVVVGLANCRIHVFSARTGVLARTLVGHELGVWAVCLVHKGGYMDGPGRVSKLPDGGGATKNGKRRKRRDAFPSGKGEEIEEDNLSSTHRRPEARSR # RSEGDIDMIHSNLPNWTIGGPTTNHPNANANAAGADPPLHQFVPSSLRIALGLNPDNDSNDADNIKYEEEKERGDWGDQDWEQRSGCDVFDEDAEVDD # HNMDIEGGPDDSSRQRSRYPGKPSGVSGSSEGWGQPGALVVSGGCDKSVRVWDIRSGCVRYFLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g611 ### # start gene g612 7 AUGUSTUS gene 3102446 3103694 0.57 + . g612 7 AUGUSTUS transcript 3102446 3103694 0.57 + . g612.t1 7 AUGUSTUS start_codon 3102446 3102448 . + 0 transcript_id "g612.t1"; gene_id "g612"; 7 AUGUSTUS CDS 3102446 3102719 1 + 0 transcript_id "g612.t1"; gene_id "g612"; 7 AUGUSTUS CDS 3102827 3103052 0.62 + 2 transcript_id "g612.t1"; gene_id "g612"; 7 AUGUSTUS CDS 3103161 3103317 0.86 + 1 transcript_id "g612.t1"; gene_id "g612"; 7 AUGUSTUS CDS 3103428 3103694 1 + 0 transcript_id "g612.t1"; gene_id "g612"; 7 AUGUSTUS stop_codon 3103692 3103694 . + 0 transcript_id "g612.t1"; gene_id "g612"; # protein sequence = [MLSHRYFVSIFLSTGLLTSKLSLAAPLFGFGSSDNSASTTAVSNDTVTSDFLRPALFSRVAYCSSDAVQSFQCGSPCD # ALGSDIDVFQVGGRLEQTLYPDFIAHDPSTNTIVVAHQGTDPNNLLSILNDAKFGLVDLNTTRFTAADGSEFLLQVFGNDTDTDTLCRSYWAFSGYAV # RDVSLESKLTELGAAVATLDAMFLKENLDPSVQLTTSVFGLPRLGNTLSHITNQNDPVPTVPPEFLGFVHPSNEFHITGVDSNGQATGIIACPGQDNE # NCSTGNDILDASVANHLGMWFISGLPSGKQDLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g612 ### # start gene g613 7 AUGUSTUS gene 3109524 3109922 0.88 - . g613 7 AUGUSTUS transcript 3109524 3109922 0.88 - . g613.t1 7 AUGUSTUS stop_codon 3109524 3109526 . - 0 transcript_id "g613.t1"; gene_id "g613"; 7 AUGUSTUS CDS 3109524 3109922 0.88 - 0 transcript_id "g613.t1"; gene_id "g613"; 7 AUGUSTUS start_codon 3109920 3109922 . - 0 transcript_id "g613.t1"; gene_id "g613"; # protein sequence = [MCAQRVHFLNHLFFQKLERKESRSKAKKARSDVAAAQGDSSTPTPLESSLNNSTSTSGASELAASESSSSESENSTGI # DADTEESVTSEEESDKDGSVAVNDETKKEKWVTVSPPTPSTASPTTSDTETIPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g613 ### # start gene g614 7 AUGUSTUS gene 3110318 3110767 0.7 - . g614 7 AUGUSTUS transcript 3110318 3110767 0.7 - . g614.t1 7 AUGUSTUS stop_codon 3110318 3110320 . - 0 transcript_id "g614.t1"; gene_id "g614"; 7 AUGUSTUS CDS 3110318 3110767 0.7 - 0 transcript_id "g614.t1"; gene_id "g614"; 7 AUGUSTUS start_codon 3110765 3110767 . - 0 transcript_id "g614.t1"; gene_id "g614"; # protein sequence = [MDVWVNFTHATKWQAEGIFKCFFPSQPANPVASNSSASSSSSSVATVTDASQTNLPLARRKSAHSIPLLTEEEICTLA # KAFADAIPEDELSVAALQGYLLKNKTRPRECVEEVAEWVVQERVTREKLKKEKAEVCPAKCFCSTPPDFHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g614 ### # start gene g615 7 AUGUSTUS gene 3124296 3124700 1 + . g615 7 AUGUSTUS transcript 3124296 3124700 1 + . g615.t1 7 AUGUSTUS start_codon 3124296 3124298 . + 0 transcript_id "g615.t1"; gene_id "g615"; 7 AUGUSTUS CDS 3124296 3124700 1 + 0 transcript_id "g615.t1"; gene_id "g615"; 7 AUGUSTUS stop_codon 3124698 3124700 . + 0 transcript_id "g615.t1"; gene_id "g615"; # protein sequence = [MRGPKVSSWVQNYTDDNFNDDEEEWKVTWKGFKDALNASFLDKGLTENAQEKLEHLCQGPNERAEDFFKEFEVIMRDT # EYAKDAPYVIRLIEMNVKLKLIDQVYGTSNEQIEKFDELKQKIISIDDMWWRREEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g615 ### # start gene g616 7 AUGUSTUS gene 3125164 3126267 0.94 + . g616 7 AUGUSTUS transcript 3125164 3126267 0.94 + . g616.t1 7 AUGUSTUS start_codon 3125164 3125166 . + 0 transcript_id "g616.t1"; gene_id "g616"; 7 AUGUSTUS CDS 3125164 3126267 0.94 + 0 transcript_id "g616.t1"; gene_id "g616"; 7 AUGUSTUS stop_codon 3126265 3126267 . + 0 transcript_id "g616.t1"; gene_id "g616"; # protein sequence = [MTTRTKRFVRGTRGRELKLRTTIENIDNGVQIETEALLDSGATGSCINKDFVEQHQLTVKELPVKMPVYNADGTLNKN # GSIEGYVQVQMVIEDHAKRIDMAVTNLGKTDIFLGIDWLHYHNPSIDWKESTLMFKRCPDKCGYLPHYESPEDDGTEEKLVDGEMIFWFDWDGYLSDQ # GHIKVQTATTDAATPYLAEYADVFSKKDFDQMPERRPWDHAIELTPGSKPVDCKVYPLSPPEQKALDEFLEENLRSGRIRPSRSPMASPFFFVKKKDG # TLRPIQDYQKLNDMTVKNRYPLPLIQELIDKLKNSKVFTKMDVRWGFNNIRIKEGDKWKAAFRTNRGLFKPIVMFFGLTNSPATFQAFMNHIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g616 ### # start gene g617 7 AUGUSTUS gene 3126301 3126843 0.48 + . g617 7 AUGUSTUS transcript 3126301 3126843 0.48 + . g617.t1 7 AUGUSTUS start_codon 3126301 3126303 . + 0 transcript_id "g617.t1"; gene_id "g617"; 7 AUGUSTUS CDS 3126301 3126843 0.48 + 0 transcript_id "g617.t1"; gene_id "g617"; 7 AUGUSTUS stop_codon 3126841 3126843 . + 0 transcript_id "g617.t1"; gene_id "g617"; # protein sequence = [MDDILIFMDNIEGHRVIVRKVLDILKANKLYLKPEKCTFEAREVEYLGIIVGNGQIRMDPKKVEAVRTWQPPEKKCEL # QSFLGFCNFFCRFIQDFSKIAKPLTRLTGNMAWEWTSLEQDAFDRLKDRIIEDVTLIIPRETGKFQVEADSSDYANGAVLSQNVDGKWRPVALRSRSL # NEVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g617 ### # start gene g618 7 AUGUSTUS gene 3127582 3128436 0.87 + . g618 7 AUGUSTUS transcript 3127582 3128436 0.87 + . g618.t1 7 AUGUSTUS start_codon 3127582 3127584 . + 0 transcript_id "g618.t1"; gene_id "g618"; 7 AUGUSTUS CDS 3127582 3128436 0.87 + 0 transcript_id "g618.t1"; gene_id "g618"; 7 AUGUSTUS stop_codon 3128434 3128436 . + 0 transcript_id "g618.t1"; gene_id "g618"; # protein sequence = [MIGELPESGGYNAISIFVDHFTKRLRLFATHTTITSKGMARVYRDKVFPVHGMPRKIIHDQGPQYHARFMKELYKLLG # IESNYTTAYHPQTNGQTERINQEIEHYIGLFVNHHQSDWHEWLPMMEFAYNDRVHSATKVLPFYADNGRHPYKGTAPKMTSQNPTAQEFADSMKRIRD # EVGLALKKAAEDMKRQYEKHWNEAIEYKAGDKVWLEGTNITTDCPMKKLGDKQFGLFKVLEKIGPSSYKLDIPRTWKRIHNVFNDNELASFLCERERK # ESNGHFNQPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g618 ### # start gene g619 7 AUGUSTUS gene 3132451 3133086 0.79 + . g619 7 AUGUSTUS transcript 3132451 3133086 0.79 + . g619.t1 7 AUGUSTUS start_codon 3132451 3132453 . + 0 transcript_id "g619.t1"; gene_id "g619"; 7 AUGUSTUS CDS 3132451 3133086 0.79 + 0 transcript_id "g619.t1"; gene_id "g619"; 7 AUGUSTUS stop_codon 3133084 3133086 . + 0 transcript_id "g619.t1"; gene_id "g619"; # protein sequence = [MDALNALHKASTSSTHSKFSSFYLIRFILDLANSLRWAMDLNDQLKQLGSLFDTTRDLFLRSILDLQNAGEDPIVVLE # ALKAAEPNRQAINLNEWTLMATLFRWPSPFNLSGLGFNNRTPGEWIELLRSIHSGESMAHIDNKGHLVESSPPPDPAAEVLEDLNEVEKGSADEGASS # QVGGSVPMELDLPTIESLAERTLSPEKGAESAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g619 ### # start gene g620 7 AUGUSTUS gene 3134172 3135625 0.46 + . g620 7 AUGUSTUS transcript 3134172 3135625 0.46 + . g620.t1 7 AUGUSTUS start_codon 3134172 3134174 . + 0 transcript_id "g620.t1"; gene_id "g620"; 7 AUGUSTUS CDS 3134172 3134339 0.96 + 0 transcript_id "g620.t1"; gene_id "g620"; 7 AUGUSTUS CDS 3134981 3135116 0.77 + 0 transcript_id "g620.t1"; gene_id "g620"; 7 AUGUSTUS CDS 3135198 3135625 1 + 2 transcript_id "g620.t1"; gene_id "g620"; 7 AUGUSTUS stop_codon 3135623 3135625 . + 0 transcript_id "g620.t1"; gene_id "g620"; # protein sequence = [MPIYHKKDFDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKDEKS # AVNDVAPRLSKVHCHADSHVSCNLTHSKHINHALAQVISSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKS # RQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVLKTVEQATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g620 ### # start gene g621 7 AUGUSTUS gene 3135878 3136732 0.38 - . g621 7 AUGUSTUS transcript 3135878 3136732 0.38 - . g621.t1 7 AUGUSTUS stop_codon 3135878 3135880 . - 0 transcript_id "g621.t1"; gene_id "g621"; 7 AUGUSTUS CDS 3135878 3136732 0.38 - 0 transcript_id "g621.t1"; gene_id "g621"; 7 AUGUSTUS start_codon 3136730 3136732 . - 0 transcript_id "g621.t1"; gene_id "g621"; # protein sequence = [MLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTG # AEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKYNSFIEKVRRRVDANKVAELRRFERKYKHTIRDWNFKPGQLVQVRNSGIEKSLDRKMYPR # YRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHKLIDLTAEQLDLMVEDKDEYWMTPENDYIFDAIPHLRLSDPNSDGE # LSEEEDQQLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g621 ### # start gene g622 7 AUGUSTUS gene 3137072 3137998 0.71 - . g622 7 AUGUSTUS transcript 3137072 3137998 0.71 - . g622.t1 7 AUGUSTUS stop_codon 3137072 3137074 . - 0 transcript_id "g622.t1"; gene_id "g622"; 7 AUGUSTUS CDS 3137072 3137998 0.71 - 0 transcript_id "g622.t1"; gene_id "g622"; 7 AUGUSTUS start_codon 3137996 3137998 . - 0 transcript_id "g622.t1"; gene_id "g622"; # protein sequence = [MTLNEQEARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVHNYHFTLIHV # KGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYKIRRNY # MLESKNATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDDLIPLIGKYLSNLLDEFLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQP # QLVVEKEKCMHMLNSAHDCLGYKGVFAMNDFLQK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g622 ### # start gene g623 7 AUGUSTUS gene 3138039 3139687 0.57 - . g623 7 AUGUSTUS transcript 3138039 3139687 0.57 - . g623.t1 7 AUGUSTUS stop_codon 3138039 3138041 . - 0 transcript_id "g623.t1"; gene_id "g623"; 7 AUGUSTUS CDS 3138039 3138939 0.7 - 1 transcript_id "g623.t1"; gene_id "g623"; 7 AUGUSTUS CDS 3139041 3139687 0.57 - 0 transcript_id "g623.t1"; gene_id "g623"; 7 AUGUSTUS start_codon 3139685 3139687 . - 0 transcript_id "g623.t1"; gene_id "g623"; # protein sequence = [MVRYEVLKRGTESFQRSQPSFEKVRYESRQRKKGKAQDLKDKKENAQPDLLNEPPTNKLEERIKLNQQDRSPINLIDE # TKKQVVNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKLFVSTGRYMEERKEIIDKNHPEGFLWEQERD # LMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLY # VGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYKTIPENPGIRQFVWEHFQ # NMNRVIQQMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVLFEWN # EKCDKAIDELKDGIQDCPALRPINFDWDVYLAVDTSYKAVGYLSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g623 ### # start gene g624 7 AUGUSTUS gene 3140987 3142411 0.79 - . g624 7 AUGUSTUS transcript 3140987 3142411 0.79 - . g624.t1 7 AUGUSTUS stop_codon 3140987 3140989 . - 0 transcript_id "g624.t1"; gene_id "g624"; 7 AUGUSTUS CDS 3140987 3142411 0.79 - 0 transcript_id "g624.t1"; gene_id "g624"; 7 AUGUSTUS start_codon 3142409 3142411 . - 0 transcript_id "g624.t1"; gene_id "g624"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNDNTKRLVFDGVHIPKKPGLIPGKLVETTKGNQKTVRFEAPKSIDRPLKKPSVTIE # DIDGSDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVELSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRIQMIDTCIRIEDLWQDQADMFEVLTKSRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTAEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDLEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSECHALLLRTFPFPFQSSGSSLIRVSDILCTILMIFTVHITCHSSSHMTYVPDSL # MYSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g624 ### # start gene g625 7 AUGUSTUS gene 3142441 3143331 0.99 - . g625 7 AUGUSTUS transcript 3142441 3143331 0.99 - . g625.t1 7 AUGUSTUS stop_codon 3142441 3142443 . - 0 transcript_id "g625.t1"; gene_id "g625"; 7 AUGUSTUS CDS 3142441 3143331 0.99 - 0 transcript_id "g625.t1"; gene_id "g625"; 7 AUGUSTUS start_codon 3143329 3143331 . - 0 transcript_id "g625.t1"; gene_id "g625"; # protein sequence = [MIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTE # EQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGIINPILLSGPLNQFNRFERNTTPRSSNGTQWACFLCKSTDNFMN # ECPHLLEFTKRGWMMPEGGDSKHYKLRDNARMPRDDPNIPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRMEELSERLG # NLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g625 ### # start gene g626 7 AUGUSTUS gene 3143372 3144520 0.41 - . g626 7 AUGUSTUS transcript 3143372 3144520 0.41 - . g626.t1 7 AUGUSTUS stop_codon 3143372 3143374 . - 0 transcript_id "g626.t1"; gene_id "g626"; 7 AUGUSTUS CDS 3143372 3144414 0.65 - 2 transcript_id "g626.t1"; gene_id "g626"; 7 AUGUSTUS CDS 3144505 3144520 0.53 - 0 transcript_id "g626.t1"; gene_id "g626"; 7 AUGUSTUS start_codon 3144518 3144520 . - 0 transcript_id "g626.t1"; gene_id "g626"; # protein sequence = [MTFGRRVLTPEEYRKAGVVFGRSTFGTSARTSPLNPTNESSRPSSSQIPTEASRGSSVSRGTGSSISRGRLTSLPRNL # KKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLNQTISQASNTIEPVKMTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPL # FDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDKRGSRLLLEQLVHQFNPIDAGEQ # EKMRIFRLLFNAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g626 ### # start gene g627 7 AUGUSTUS gene 3149413 3150993 0.95 + . g627 7 AUGUSTUS transcript 3149413 3150993 0.95 + . g627.t1 7 AUGUSTUS start_codon 3149413 3149415 . + 0 transcript_id "g627.t1"; gene_id "g627"; 7 AUGUSTUS CDS 3149413 3150993 0.95 + 0 transcript_id "g627.t1"; gene_id "g627"; 7 AUGUSTUS stop_codon 3150991 3150993 . + 0 transcript_id "g627.t1"; gene_id "g627"; # protein sequence = [MDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPSRVDIEEVEDEQTSHPHLVASTIDSLTREFLIKGPQCEPT # HTEMGLEENEATTATGESPIHRIRANHKTHRAWVKAGILEEHTEEVWCSAGFTYSQQLAEEANRNKPIRTFEEMVPEQYRDFKKVFSESASERLPAHQ # PWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYWKLNEYTVKNQYPLPLVADIISQLQGA # RYFTKFDVRWGYNNIRIKKGHEWKGVFATTRGLFEPKVMFFGLTNSPAKFQALMNAIFVDLIAAGKVAVYLDDILIFSNDLEEHQQVVREVLTRLEKH # DLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRHFIRNFAKIARPLNDLTKKDTSFTWTNTQQKAFDTLR # EAFISTPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g627 ### # start gene g628 7 AUGUSTUS gene 3151240 3152661 0.5 + . g628 7 AUGUSTUS transcript 3151240 3152661 0.5 + . g628.t1 7 AUGUSTUS start_codon 3151240 3151242 . + 0 transcript_id "g628.t1"; gene_id "g628"; 7 AUGUSTUS CDS 3151240 3152661 0.5 + 0 transcript_id "g628.t1"; gene_id "g628"; 7 AUGUSTUS stop_codon 3152659 3152661 . + 0 transcript_id "g628.t1"; gene_id "g628"; # protein sequence = [MAVHHVSDSNDNRQQTVLKPGHFVKIAASILRNPLEDRIWKASEREAQVLEGLETVKKHGLQCLANGIAEWEEDNGLV # YYRGRVYVPADDDLRTEVLCQCHDHPTAGYPGLHGTLDLISTHFWWPTLRSFVEKYIEGCEVCARKKIQRHPQAVTQPLDVPSGLWEEVGVDLITQLP # NSQGYNAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHLKSDRGPQFAAKLMQSLLARLGIKSDLTSGYRPQSNGQTKRANQEVEK # YICLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSLFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGNRKAHQ # FKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDHLHPVFHVNKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVDEILD # SQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g628 ### # start gene g629 7 AUGUSTUS gene 3155577 3157235 1 - . g629 7 AUGUSTUS transcript 3155577 3157235 1 - . g629.t1 7 AUGUSTUS stop_codon 3155577 3155579 . - 0 transcript_id "g629.t1"; gene_id "g629"; 7 AUGUSTUS CDS 3155577 3157235 1 - 0 transcript_id "g629.t1"; gene_id "g629"; 7 AUGUSTUS start_codon 3157233 3157235 . - 0 transcript_id "g629.t1"; gene_id "g629"; # protein sequence = [MNPDVIVLSNPLKIEGETETTKVEIELKIPYNPSSLPQPKDENALKDSLELPENDPSKLVSTQDLPDHTPLSRSLSPL # TPLPSSSPSAPSSPTPVEVSLEPENTWPRRVRQPTGFYNETRMHKAAGIAADATALAAKDVDKKNKEFNPDSWTDFALAAPEDPQTICKACAYTNELT # SLEYFHTWDLVKCPNGVNVAKNKVVLKTKRNHNDLVVLHKARLVIGGYSQIHGIDFYETFAPCVKFETLRLLLSIGASKDSKIEQVDVKNAYLQADLH # EELYMKLPPLYEEFQTLPVHPKGKDIVTKLRRVLYGSKQGGHKWYKKLRQEAINEGFTVSEFDPCVFYKYKGDRYQIFAAATDDFTMVTDNDESMVEL # KASLDRRFDMKFMGPISWLLGFEITCNIEKKTITLSQKAYIEWIIKHFGQENSRPVVTPMEPGIDLSPNSPAVSNTLLLPSEQATYCEAVGSLMYPAK # VSRPDTVYATSTVACYMQPHTTHWTVVIYVYRYLNGTTDFALVLCRKDLPSLFLFSDANWGSQINRCSISGYVLYVGVGPIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g629 ### # start gene g630 7 AUGUSTUS gene 3157959 3158618 0.67 - . g630 7 AUGUSTUS transcript 3157959 3158618 0.67 - . g630.t1 7 AUGUSTUS stop_codon 3157959 3157961 . - 0 transcript_id "g630.t1"; gene_id "g630"; 7 AUGUSTUS CDS 3157959 3158618 0.67 - 0 transcript_id "g630.t1"; gene_id "g630"; 7 AUGUSTUS start_codon 3158616 3158618 . - 0 transcript_id "g630.t1"; gene_id "g630"; # protein sequence = [MDAKHKDDFGMPDLQATSDFREQSDALAAANVTHNGEVIDTGATHHLSPIQCNFKNLVRIALSPVTAANGQLFVVTAR # GDYMTSLPMGPGKKPTPIVLLNTYYSPSLAFTLISVSCMDKAGFSLTIEDGNCTIFSPRLNRKAIGFIPVNHGLYRVSTGSNPRSVLIAAAASTQCLT # MYQFHCIMGHPGKDTLCRMLKMEMATGINVDLGTTVGFCEPCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g630 ### # start gene g631 7 AUGUSTUS gene 3162238 3162740 0.32 + . g631 7 AUGUSTUS transcript 3162238 3162740 0.32 + . g631.t1 7 AUGUSTUS start_codon 3162238 3162240 . + 0 transcript_id "g631.t1"; gene_id "g631"; 7 AUGUSTUS CDS 3162238 3162247 0.32 + 0 transcript_id "g631.t1"; gene_id "g631"; 7 AUGUSTUS CDS 3162319 3162740 0.87 + 2 transcript_id "g631.t1"; gene_id "g631"; 7 AUGUSTUS stop_codon 3162738 3162740 . + 0 transcript_id "g631.t1"; gene_id "g631"; # protein sequence = [MLLLASPRSTRSRDSDNELSSGFPLVDAAPRASSPTKIPVSRKELKSKTAVKVVEDSKASDPPTSALVYKRVRLPPRS # RKIAPAASKGKARQTIVTEVDSASSEVESEDEDEEEDSAPPPKRLKTTSSISGKSLFFIYFVLFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g631 ### # start gene g632 7 AUGUSTUS gene 3165033 3166493 0.47 + . g632 7 AUGUSTUS transcript 3165033 3166493 0.47 + . g632.t1 7 AUGUSTUS start_codon 3165033 3165035 . + 0 transcript_id "g632.t1"; gene_id "g632"; 7 AUGUSTUS CDS 3165033 3165200 0.68 + 0 transcript_id "g632.t1"; gene_id "g632"; 7 AUGUSTUS CDS 3165842 3165977 0.98 + 0 transcript_id "g632.t1"; gene_id "g632"; 7 AUGUSTUS CDS 3166066 3166493 1 + 2 transcript_id "g632.t1"; gene_id "g632"; 7 AUGUSTUS stop_codon 3166491 3166493 . + 0 transcript_id "g632.t1"; gene_id "g632"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALKQILALYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKDEKS # AVNDVSPHLSKVHCHADSHVSSNLTHSKHINYALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKS # RQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEITVPVLKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g632 ### # start gene g633 7 AUGUSTUS gene 3166754 3167083 0.57 - . g633 7 AUGUSTUS transcript 3166754 3167083 0.57 - . g633.t1 7 AUGUSTUS stop_codon 3166754 3166756 . - 0 transcript_id "g633.t1"; gene_id "g633"; 7 AUGUSTUS CDS 3166754 3167083 0.57 - 0 transcript_id "g633.t1"; gene_id "g633"; 7 AUGUSTUS start_codon 3167081 3167083 . - 0 transcript_id "g633.t1"; gene_id "g633"; # protein sequence = [MYPRYRGPMVIIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNESIELPNNIHELIDLTAEQLDLMVEDEDEYWM # TPENDYIFDAIPHLRLSDTNSDEELSEEEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g633 ### # start gene g634 7 AUGUSTUS gene 3167189 3169222 0.84 - . g634 7 AUGUSTUS transcript 3167189 3169222 0.84 - . g634.t1 7 AUGUSTUS stop_codon 3167189 3167191 . - 0 transcript_id "g634.t1"; gene_id "g634"; 7 AUGUSTUS CDS 3167189 3169222 0.84 - 0 transcript_id "g634.t1"; gene_id "g634"; 7 AUGUSTUS start_codon 3169220 3169222 . - 0 transcript_id "g634.t1"; gene_id "g634"; # protein sequence = [MPEEHIAQVVLEWPSCHDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVLFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPNEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETNASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDKETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKNATCEVFSRNLFPTFDEEFVQNNPYPEVHRSSEGNRLDELIPLIGKYLSNPSDESLGGMPKDERIKFIRLIK # KFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQ # KVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKI # ERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVR # RRVDANKVAEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g634 ### # start gene g635 7 AUGUSTUS gene 3169445 3170185 0.66 - . g635 7 AUGUSTUS transcript 3169445 3170185 0.66 - . g635.t1 7 AUGUSTUS stop_codon 3169445 3169447 . - 0 transcript_id "g635.t1"; gene_id "g635"; 7 AUGUSTUS CDS 3169445 3170185 0.66 - 0 transcript_id "g635.t1"; gene_id "g635"; 7 AUGUSTUS start_codon 3170183 3170185 . - 0 transcript_id "g635.t1"; gene_id "g635"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLQLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY # ILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYICKTCIFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g635 ### # start gene g636 7 AUGUSTUS gene 3170354 3172698 0.97 - . g636 7 AUGUSTUS transcript 3170354 3172698 0.97 - . g636.t1 7 AUGUSTUS stop_codon 3170354 3170356 . - 0 transcript_id "g636.t1"; gene_id "g636"; 7 AUGUSTUS CDS 3170354 3171192 0.98 - 2 transcript_id "g636.t1"; gene_id "g636"; 7 AUGUSTUS CDS 3171267 3172698 0.97 - 0 transcript_id "g636.t1"; gene_id "g636"; 7 AUGUSTUS start_codon 3172696 3172698 . - 0 transcript_id "g636.t1"; gene_id "g636"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRSLKKPSVTIE # DVDESDDEDTIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFNAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSKDGETEILDEPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVMDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDDQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKP # KPARKKVQKRRFVEPILENFSLGENCDKSASTEATQNQCNNENTSETVRDDNWNKPKNSQRTRKRMVRYEILKRGTELFQRSQPSFEKVRYESRQRKK # GKAQDSKDKKENVQPDLLNEPPTNKLEERIKLNQQDRPPINLIDETNKQVVNEAIAVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g636 ### # start gene g637 7 AUGUSTUS gene 3172728 3174125 1 - . g637 7 AUGUSTUS transcript 3172728 3174125 1 - . g637.t1 7 AUGUSTUS stop_codon 3172728 3172730 . - 0 transcript_id "g637.t1"; gene_id "g637"; 7 AUGUSTUS CDS 3172728 3174125 1 - 0 transcript_id "g637.t1"; gene_id "g637"; 7 AUGUSTUS start_codon 3174123 3174125 . - 0 transcript_id "g637.t1"; gene_id "g637"; # protein sequence = [MIPWFEATESIFEHGGITSDKAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDKRGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVENEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ # SHFKEGADIMTQLTAVMAQMAKENAKGMINSMPPSGPLNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLR # DNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDKDDKVMDQQMNPNINLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g637 ### # start gene g638 7 AUGUSTUS gene 3179487 3180401 0.99 - . g638 7 AUGUSTUS transcript 3179487 3180401 0.99 - . g638.t1 7 AUGUSTUS stop_codon 3179487 3179489 . - 0 transcript_id "g638.t1"; gene_id "g638"; 7 AUGUSTUS CDS 3179487 3180401 0.99 - 0 transcript_id "g638.t1"; gene_id "g638"; 7 AUGUSTUS start_codon 3180399 3180401 . - 0 transcript_id "g638.t1"; gene_id "g638"; # protein sequence = [MFARDDAKTKKKVPYITTSLAGRKRPRGAFESSHPIHMPRWGFGSASRPHPNAVALDTILEEDSAAFAGRTMSLGLSN # EESSKERKISEQRTLVFGKGAEIWYVDSVNTSHFNTYRDPFSYRFKYSPDSLRAVFTPNDDDLVERPMKRKRLDTNEPPSSKPHPPLLIKWDDSDRCC # ILRPEPADVTSLYALFVTQQSVANDYLHYHLPDSIPSIPPSSSSDVLMKDIHTKPESSQLTAISASSVSPVRELIADDWMVEPYCVHTKEEHVWLLQS # EVLEFIASGIMINKTRTLPVTKWKFILESD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g638 ### # start gene g639 7 AUGUSTUS gene 3180505 3184532 0.31 - . g639 7 AUGUSTUS transcript 3180505 3184532 0.31 - . g639.t1 7 AUGUSTUS stop_codon 3180505 3180507 . - 0 transcript_id "g639.t1"; gene_id "g639"; 7 AUGUSTUS CDS 3180505 3183752 0.33 - 2 transcript_id "g639.t1"; gene_id "g639"; 7 AUGUSTUS CDS 3183806 3184532 0.36 - 0 transcript_id "g639.t1"; gene_id "g639"; 7 AUGUSTUS start_codon 3184530 3184532 . - 0 transcript_id "g639.t1"; gene_id "g639"; # protein sequence = [MNVAALLQDSPSDDRRRNNTSGNSNSSNSGNNHSTIQQQSTHSRMSESASQNGSNPGLGGWRRIEDGVSGSGTNSPGL # TKNSSLPMQQMAQGAAHGHGLATTMRQPTLASASSTSPVLSRLNTHRRTLSHPTPPQQPSPSPSLPPASTPTVGSRGGVYGPATGRPVSGALGPDARG # EQARMADSALALPRRESYREMDRERDREKEQPRILNIMDWQGERDRPKSGEERDRPPVSRRPLVGGGLEDLASSTLPPPKSHSHSPIMRATSSRRSSS # SGGPFVDESVQENDAEHIRLPVRRHGSSRPGSAPTETIKPHHLSGPPPPRTGDFSYHANFQPPSHPHHFVPAGGPVSASIPAPAPGPGTLSLVPPQHQ # QSHQQHQLAQAQAQQQQIHVNAQGPAPIHTGTSPTGSSTGVMEPRGGIILNLNGPVPNGPPQKQFQNQFHTQFLPGLQLAQSAQPPLSQPIERERGHD # RDRERDREKEWERDERDMRERELEREMYSHHRYPSQPHHLPSNHTSRRGSPIPAHNTGVSAPDRERDRERQRYVPPPPPPSAPMASSSRRYNTSSVPP # PSASMGNFSSREKELRDFDRERETRERERERDFREREREQQQQRNRERDGGYRIIGSGMSLGPGPASGPEPPPPSQPHSRGDPREREMFHYRERERVE # RERERDRMDRIDRERDRELYYRDRERDRDRERDRERDRERERERMNMSLAMNERERERDLLRERERERTRLAVIGDMASSSSTSAPPPPGLPILMDVD # GQMYGNDPFMPVRMADHHGHGYPSFPNHDPRAMGQMGPVGQLGPMAPNGPMGMPPNMNMSMAAGGSVTMGMGMEPVVGLGPTSNTAMVPIPDGLEEPP # EREVKSRVKIDLGTYVWPKTPFPFSFAESKWQAFPDRSNKENEVDQKGETKGSGGGVYKMVVDGEVISKRDEDKREPTIVTNGGNSAANTSSTTALNV # TDLPNADKHILDSETLVTIVIPNAFIPLEKPKPGSRNKYRVWGGGLPPRNGSNELFGGTRHGRERESNPEYEQMRAGYQEKVAANPSHTSNSIPSSHK # KRPPRRRRIYTDDSDIFVCALHAGWISWSSAKKAREEGKDLKVRLRIIRCLGVREDVGASVRNEAPFQVTGNAFPGPGRNANDPNGPWVQGQRSAPPT # MNGFSASSSSGTGTDSSLSAAAGFIGGRRGREEVVVRFIGGMGEKYFGGDIKRTKAKSEPAQAQVKTMEKELEKLKEKEKKVEEEKEEGELKEEGELD # QDPLPEPDVANSVPLIVEEEEEEEEVPDGGPEDDGRSLLSASWGIGHDGSGIEVIDVEFVPVSSFNFGFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g639 ### # start gene g640 7 AUGUSTUS gene 3187965 3188576 0.69 - . g640 7 AUGUSTUS transcript 3187965 3188576 0.69 - . g640.t1 7 AUGUSTUS stop_codon 3187965 3187967 . - 0 transcript_id "g640.t1"; gene_id "g640"; 7 AUGUSTUS CDS 3187965 3188576 0.69 - 0 transcript_id "g640.t1"; gene_id "g640"; 7 AUGUSTUS start_codon 3188574 3188576 . - 0 transcript_id "g640.t1"; gene_id "g640"; # protein sequence = [MDQFSRGIFHMPHPSHAVPPSGKPLSSGAAPALDSFSRAKELFTIGSEALLVAEKLENPSERKYWASWSDSVFNQMKM # EADVDAWRGPINRARGQCCLIVGTAQAEEFEEALENGDESVLRSEDADEAREALMDAISFLEKAKSAATSTDMDQDDDELQHFLEEALLTLANLTLDE # KKREDLYLRAQKESGGAIDLSDEMDES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g640 ### # start gene g641 7 AUGUSTUS gene 3189312 3189854 0.57 - . g641 7 AUGUSTUS transcript 3189312 3189854 0.57 - . g641.t1 7 AUGUSTUS stop_codon 3189312 3189314 . - 0 transcript_id "g641.t1"; gene_id "g641"; 7 AUGUSTUS CDS 3189312 3189854 0.57 - 0 transcript_id "g641.t1"; gene_id "g641"; 7 AUGUSTUS start_codon 3189852 3189854 . - 0 transcript_id "g641.t1"; gene_id "g641"; # protein sequence = [MPSPFLVQRPTTSSLSKTASKNKNLRPKGLWKARVTDSAPRLLHGTANSEATHDSDSDNELEDLDELEIRSSTSSTKR # RRLSSSESSGSDSAAELYYWDYSRQCTPPPKRESSWTRRTRIMDTSSLALKGTQTTSKSTCDYEDWEDLKDLFSKAVEQYEGLLIIRCEVLVFINSDL # PYRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g641 ### # start gene g642 7 AUGUSTUS gene 3192063 3192464 0.95 - . g642 7 AUGUSTUS transcript 3192063 3192464 0.95 - . g642.t1 7 AUGUSTUS stop_codon 3192063 3192065 . - 0 transcript_id "g642.t1"; gene_id "g642"; 7 AUGUSTUS CDS 3192063 3192464 0.95 - 0 transcript_id "g642.t1"; gene_id "g642"; 7 AUGUSTUS start_codon 3192462 3192464 . - 0 transcript_id "g642.t1"; gene_id "g642"; # protein sequence = [MKYPKPGYNNPLVSVHVFDLGRYLDSDSVVVNGFPAANATLELDWPGRHPISNSIIMEVAWVDDTQLLLKEVNRNADS # GSVVFFDLSSSDDKARSRGTVVRKLGKEGEEGDDGWIDNVGIIQACSRTVQSLER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g642 ### # start gene g643 7 AUGUSTUS gene 3194591 3194956 0.78 - . g643 7 AUGUSTUS transcript 3194591 3194956 0.78 - . g643.t1 7 AUGUSTUS stop_codon 3194591 3194593 . - 0 transcript_id "g643.t1"; gene_id "g643"; 7 AUGUSTUS CDS 3194591 3194956 0.78 - 0 transcript_id "g643.t1"; gene_id "g643"; 7 AUGUSTUS start_codon 3194954 3194956 . - 0 transcript_id "g643.t1"; gene_id "g643"; # protein sequence = [MPATLIQPSTVPGKLLYFTPPKDGSRPITRINEDANYDSRFNWVQAEHTVPIENIRGKEDSYTLNSAGFQYYQHKSKH # TAFSNDEDIEREYYPESVELIKQLTGASKVVLFDHSALTLLLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g643 ### # start gene g644 7 AUGUSTUS gene 3201205 3202027 0.23 + . g644 7 AUGUSTUS transcript 3201205 3202027 0.23 + . g644.t1 7 AUGUSTUS start_codon 3201205 3201207 . + 0 transcript_id "g644.t1"; gene_id "g644"; 7 AUGUSTUS CDS 3201205 3201237 0.23 + 0 transcript_id "g644.t1"; gene_id "g644"; 7 AUGUSTUS CDS 3201361 3201482 0.32 + 0 transcript_id "g644.t1"; gene_id "g644"; 7 AUGUSTUS CDS 3201532 3202027 0.79 + 1 transcript_id "g644.t1"; gene_id "g644"; 7 AUGUSTUS stop_codon 3202025 3202027 . + 0 transcript_id "g644.t1"; gene_id "g644"; # protein sequence = [MGRRGTTLFYSGKLNLLLIVIARERVLLHWAMKQANRNHPRSSSTHLDRRPPQSSELILGINKLDSLSKFFESVIDGT # ADLKVVNEEAASEEFVPDEAELEIERKQEAQRIALAHGGFANFIDFEDALKKGHNPHGSQGYPGMLGDLPQKKKKPTGSESIAAEPAVETGDAKEQAA # FAASEPAPAATPEPLEVPVEEQASEQASEPEPAPAPKDEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g644 ### # start gene g645 7 AUGUSTUS gene 3202504 3203394 0.77 - . g645 7 AUGUSTUS transcript 3202504 3203394 0.77 - . g645.t1 7 AUGUSTUS stop_codon 3202504 3202506 . - 0 transcript_id "g645.t1"; gene_id "g645"; 7 AUGUSTUS CDS 3202504 3203123 1 - 2 transcript_id "g645.t1"; gene_id "g645"; 7 AUGUSTUS CDS 3203181 3203394 0.77 - 0 transcript_id "g645.t1"; gene_id "g645"; 7 AUGUSTUS start_codon 3203392 3203394 . - 0 transcript_id "g645.t1"; gene_id "g645"; # protein sequence = [MVSSFSLALLLVSAASTLLVRADVVPDTPATGTAGSTCSITWTGDSSSSSNWSDMAIEFMTGDNFNMVFLTTVATGLD # GTKSGSYSWTCPEVNPYSAIYFYQFISPVESGNPVWTTRFAIASSSGETTTPPNSTQPDGEAIPWGTGALVDASSVSAVPSFASGVTSGSVPATSATA # SASVSSSSSIAAASSVSTSATSAASASKSASKSAGVVTVSGNTSGAAGAKTTATSVSTTGADEAASTPSSANAGLVLAVDARVWTATFGVISSAVAVA # LFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g645 ### # start gene g646 7 AUGUSTUS gene 3206337 3207762 0.56 - . g646 7 AUGUSTUS transcript 3206337 3207762 0.56 - . g646.t1 7 AUGUSTUS stop_codon 3206337 3206339 . - 0 transcript_id "g646.t1"; gene_id "g646"; 7 AUGUSTUS CDS 3206337 3207042 0.84 - 1 transcript_id "g646.t1"; gene_id "g646"; 7 AUGUSTUS CDS 3207185 3207762 0.56 - 0 transcript_id "g646.t1"; gene_id "g646"; 7 AUGUSTUS start_codon 3207760 3207762 . - 0 transcript_id "g646.t1"; gene_id "g646"; # protein sequence = [MRYIDYTCSLTIEDAILIRDMQLNKVPFIPQNESLLGILDKFQEGRSHMSVLFLSLITSSQFHSHRFSVQKAKSAKKA # VKQSLARRLKKRVGINANDSDHSLSGTETDIEDVKIDVMHAPSQHEVFKSTALPPAEPQTNISEGEIFSIREGRPKRKAIINRDDIQLDKVETGIGQN # TGPDMSNLMTSMSPDVERYTPPYVQFLISILMVRRLELIGGEIYDEFDAGGAHGEPYIHQCSGLAPNVQVSKIPQGPIQKTLANVKSLSFFRSRSVPP # SLPDEKETSTFTEATISKAGMDNLNQAKQDGNQRNNVIKTTNISGSPLAIEALLLDRKRHLVAASTWTAGSSGMNRIVSKGKFKSGPIKKSYSHPTEL # IGTAPLGAFPSVVYSPTRSQSWKKKVVEGRPDDDLDLTLVKTLTDHSNDGVQSQF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g646 ### # start gene g647 7 AUGUSTUS gene 3209730 3211157 0.94 - . g647 7 AUGUSTUS transcript 3209730 3211157 0.94 - . g647.t1 7 AUGUSTUS stop_codon 3209730 3209732 . - 0 transcript_id "g647.t1"; gene_id "g647"; 7 AUGUSTUS CDS 3209730 3211157 0.94 - 0 transcript_id "g647.t1"; gene_id "g647"; 7 AUGUSTUS start_codon 3211155 3211157 . - 0 transcript_id "g647.t1"; gene_id "g647"; # protein sequence = [MWSGKGFQEVVSLPFLNCGARKSSCFNLSTLCAFLTSLSVPPFPVDLVDASPDIGHSSPSIGAGTITNPNVHSSMGGA # GSSNGPSSPNIYITSPTATSGPRYQTPISALGHAHSQSNHNSIGHSPFAFTSPGSSPTAPEFGANIHQPFSQGHHHGQLGHQQHPSMSRAHSFHHLQG # HAGPFDSSRSGSPIGAGGQPHSSSITGERGSDMNLEMFDDMSPAGQSGDGMNSASSSSASVNLTGSSCGEGHSPDESGTSGLSARHGDGPGDEPGSQP # VTGRGSAKRQRMNVLDTVSSSTHSHEQEMLMNGVFGGMNTNIGSVPSMLGGMNNSQMINVGGMNGSSASSDSLLSMESGMANMNGHPLNMSLSNASLS # PPDNPKRFSTRARSDSAPLYHQQHLSASPSSSSVSPQGWGGVGRPRSGSGLGVLGNPPHGQYGGSHLQRGLTIPSISMPRTGLNGVGGMGVQTVPSNV # QGQSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g647 ### # start gene g648 7 AUGUSTUS gene 3211941 3212621 0.76 - . g648 7 AUGUSTUS transcript 3211941 3212621 0.76 - . g648.t1 7 AUGUSTUS stop_codon 3211941 3211943 . - 0 transcript_id "g648.t1"; gene_id "g648"; 7 AUGUSTUS CDS 3211941 3212621 0.76 - 0 transcript_id "g648.t1"; gene_id "g648"; 7 AUGUSTUS start_codon 3212619 3212621 . - 0 transcript_id "g648.t1"; gene_id "g648"; # protein sequence = [MDSPYDEHPPHSLPPPAHLSHLSRNLSGLSMNPGSSATSATHPHHPDRPFGLRISTSISNPGSHNPSPNAPPSRKRSF # TSNPPSLPSLSTTVMVGAGLVSGSATPLLEEDISVRGMDLDLDYDKYDKYHEPKYEKYDPDLPPNSGLTSAPPSALPISASGSRGSITPSGGTSPIEG # GGSGSGEEGTVSSTMGHSRMGSVHGSGMLTGMGSMGKPMPTNNFVTKLYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g648 ### # start gene g649 7 AUGUSTUS gene 3218690 3219154 0.58 + . g649 7 AUGUSTUS transcript 3218690 3219154 0.58 + . g649.t1 7 AUGUSTUS start_codon 3218690 3218692 . + 0 transcript_id "g649.t1"; gene_id "g649"; 7 AUGUSTUS CDS 3218690 3219154 0.58 + 0 transcript_id "g649.t1"; gene_id "g649"; 7 AUGUSTUS stop_codon 3219152 3219154 . + 0 transcript_id "g649.t1"; gene_id "g649"; # protein sequence = [MPTHDFTNAPPLDVLIIPGGYGVLADDLDPLLEFVRRTYPTLKYLLTICTGSWIAARAGVLDGKRATSNKNGWAMTKE # IGPNVKWIAHARWVVDGNIWTASGVTAGMDSALAFVEEVYGKDQAQKIAGEMEYERHEDPSWDPFADKYNLPKDTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g649 ### # start gene g650 7 AUGUSTUS gene 3219550 3220303 0.19 + . g650 7 AUGUSTUS transcript 3219550 3220303 0.19 + . g650.t1 7 AUGUSTUS start_codon 3219550 3219552 . + 0 transcript_id "g650.t1"; gene_id "g650"; 7 AUGUSTUS CDS 3219550 3219717 0.19 + 0 transcript_id "g650.t1"; gene_id "g650"; 7 AUGUSTUS CDS 3219812 3220303 0.99 + 0 transcript_id "g650.t1"; gene_id "g650"; 7 AUGUSTUS stop_codon 3220301 3220303 . + 0 transcript_id "g650.t1"; gene_id "g650"; # protein sequence = [MSSSNPPPPSERASEIINKLPSSPNLITKTGTALLGTGLAAAAISQELYVVNEETIALREPYANWAESQVQKIKGVLD # TARAEHTQAVKDRIDSVGQMKDVVALTQSLFALSKVRSRKKHFLIFSAEQMAQETAQIEAEAFVQKQKVVMASELKSVLDSWVRYEQQQKESEQADLT # KSVIDKVLANLKDEKTQRDLLLSAVAEVERKSDLHSVSYVLVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g650 ### # start gene g651 7 AUGUSTUS gene 3221770 3221976 0.43 - . g651 7 AUGUSTUS transcript 3221770 3221976 0.43 - . g651.t1 7 AUGUSTUS stop_codon 3221770 3221772 . - 0 transcript_id "g651.t1"; gene_id "g651"; 7 AUGUSTUS CDS 3221770 3221976 0.43 - 0 transcript_id "g651.t1"; gene_id "g651"; 7 AUGUSTUS start_codon 3221974 3221976 . - 0 transcript_id "g651.t1"; gene_id "g651"; # protein sequence = [MAATPMLEFADTETDVFPAETAISNDAFEDGEVERNSADARSGMEVNQLIDQGKSNHPHREIAKTFGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g651 ### # start gene g652 7 AUGUSTUS gene 3224210 3226856 0.42 + . g652 7 AUGUSTUS transcript 3224210 3226856 0.42 + . g652.t1 7 AUGUSTUS start_codon 3224210 3224212 . + 0 transcript_id "g652.t1"; gene_id "g652"; 7 AUGUSTUS CDS 3224210 3224297 0.42 + 0 transcript_id "g652.t1"; gene_id "g652"; 7 AUGUSTUS CDS 3224821 3226856 0.69 + 2 transcript_id "g652.t1"; gene_id "g652"; 7 AUGUSTUS stop_codon 3226854 3226856 . + 0 transcript_id "g652.t1"; gene_id "g652"; # protein sequence = [MPGGVAEFLPQPEDRTDNFPFEDVTNHETSAGNVWDSAVQEAMTTLEKNEEKYGVSVQISHSCLTPPSSTLVTPFSPA # STLRIALHSALLTTQSQCDNVRQLLSALASHSELSQISEMYAPPSPMPFKSFSPLSPSRPSSYPEAIQLRTRTRSVPDSVENKRATWNGSYSYLANAG # SPSLQLTRRREKRRSDLSALLQTAGTTSTLQQSRSAPATPLVEEQLAGVLEERSGTENDASGAAAIFDHDHDSEEYQSFGPSALRLRRTRTIGGLKVL # GASTSLPSSPPVKSTFSSSSLTNFPARSPRTSQFATVPSASRFTAMQAPRHPLSLSSLNTALQNALASKRYTCSHLLALRFVEEGDDETYWENVKSVM # MLLTSTFADASARLTEALDFVEDQRLNDETPSPGPSRVDLTFDETKWSSGHRNSHRESFAPMRSDLSRFATHVEAISSALDDAREQLIACVAAIKSSR # HRSEADDDTVTTPQLSTSAEPFVREEHPALQAYERLRRELGLALRECERGRERLLDIISPPRQHSDESEDENSSQISPHDLPTLGHDASDESSDRPES # MAPLEYELSVDPADPVAIVNSLDDVTSHLLLTSTSKHLPPPGIEQVYEGDSGAAGVYRRERSKLSREERIQLAKKANEEGGQKRQSGDQSSSIPSERW # GPGGEVVQELKDVIWKVGERRRKIVDGQIHNVVPEAPRALD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g652 ### # start gene g653 7 AUGUSTUS gene 3229021 3233392 0.4 + . g653 7 AUGUSTUS transcript 3229021 3233392 0.4 + . g653.t1 7 AUGUSTUS start_codon 3229021 3229023 . + 0 transcript_id "g653.t1"; gene_id "g653"; 7 AUGUSTUS CDS 3229021 3232394 0.52 + 0 transcript_id "g653.t1"; gene_id "g653"; 7 AUGUSTUS CDS 3232528 3232735 0.77 + 1 transcript_id "g653.t1"; gene_id "g653"; 7 AUGUSTUS CDS 3232856 3233392 0.99 + 0 transcript_id "g653.t1"; gene_id "g653"; 7 AUGUSTUS stop_codon 3233390 3233392 . + 0 transcript_id "g653.t1"; gene_id "g653"; # protein sequence = [MLLNIPTVSGRDSVVLKTVYKSPTAIHVFSFSADDSHLFPNIPSVDPNVIRTQVDLQGWAIEALSPNTTLLTLLEQSD # PKGWTNKTSIPIQMINALAGIGEFAIKFGGPPIVTRLAGAKANDLRYDHERFNFRLEYEPHASRRMVGGSPTDNSAATSTSTTSDENSSTPTSPVIEC # EIRCDMDTWGHSLDIVVDPPPQSISCLRRHKLSDEGGGLWLTITHDAVFVDDERLQVIVRRGPGKEKGLVMVNGAKTSVDIEELPEHEIKTLVRRKRI # KPPRIPLDQPPVMGVIRRRRAEWDADVLDSPTSENVLNTDGASSTLPKVSSPLARFFTYAVDQATATTQQTIAAISPMAAGANDALLSSSKLPMQYVL # DALSWTQNYHCSTTPQAGWAPVNDKGLSVRRKLVSDISPVIPIHKGEKVIEGISAEELVAVITEPDCRKKWDDRFDSETVFESYGSGCKTSFMVSKGG # FPFRDRGFYIAFVVARAQGSPLGSMRNTDTGTPGSGSGDASGRTGCRNAIYCVSTSFSPDSVSQFSAAKYNQYGLPIGRVYIDAWILETLDPYTKENY # AVPSSKCTRLVAVDYAGSLPAAMNSLINTNIPRAILTVESYVKSISSMPITRLPAAGFILADRKDDDVEAETYAKFGWKLRKRDEYKTLLRTNYDSSS # RVYTSSIFVDYPGGAKSENLSAGGKASRSNVSLSPTRQFPLEKQVTPRASRVELNTLPESSSSDSSLHTIQGVISTSASSPLSAPITPTKFLPSSTPP # SFSNIASLSSLSSMTHLSTNGTFNSLNNINNVNLTQAMPGQRERTASVSNSGFRGRSSSAFTLKGEVRHTTDLLVGEVVIDSKLYPEGYIITLKSKTL # KITGKEGKGVKEGERRDESKSPPRANDSSITKSSANLNATPINLDSLFSSSTSYSTGVATKASISSPSSPSIPPASNSNLNSDSELLEHQLPLSYTLH # TIPLSPLHSSGSGMGTGTSSDSHYTYDYESESPTRHLLKLTLPTAQYCVSTIQDPLTGETQVAPPKPSWLLEMEEGGAVVYVEVKPVQKDADGVGMVK # GKVWVVDGRNGVNDSKVGHDTKNKVWNAKRNIWEVAVVGEKESLTTLGREELLDDRVSKMSILLRSVATNESEALPDDLKTPVGIADSLLDAKTADVY # GQMIVADGMDRQSLGDSTEVSSSRTESGTSDGVVQQGTQAPEPPETPRLNLTQQGSAGGGIFSFKFLPSYPYPLSRFITLGTATNITPAETSGPNGSS # GGNMNTTGGGKVAVMGPKLRKTSDSVERPTVANPTRLYPVSTLMIVALIAFLIGSLFRSLLSPADFVYVVRDLGEAADAQILGDVAGTGTGWREMRRL # FEIKYVFAGWDFQVAVVRRH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g653 ### # start gene g654 7 AUGUSTUS gene 3234296 3234958 0.99 + . g654 7 AUGUSTUS transcript 3234296 3234958 0.99 + . g654.t1 7 AUGUSTUS start_codon 3234296 3234298 . + 0 transcript_id "g654.t1"; gene_id "g654"; 7 AUGUSTUS CDS 3234296 3234958 0.99 + 0 transcript_id "g654.t1"; gene_id "g654"; 7 AUGUSTUS stop_codon 3234956 3234958 . + 0 transcript_id "g654.t1"; gene_id "g654"; # protein sequence = [MRGQPLPPPGQPRPGVNGLPLPASRPFPATGPMTNGGPPGFPSGSHVNGIPQPPNQSFPQQPIAGPQRTAIGPRGSTG # GGPPFPSPTMANSPHNPGQPPMNIGQSPHLNSRMPPPPPNGIHQGPGQIPGYPMNRPPSRTASPGQMGGMIHSSPSMSSRLVSNDPRSSQDPLTQELL # RIPPAALSGLREELGLVGKEIQNMTLDEKASLNFSSIELIELKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g654 ### # start gene g655 7 AUGUSTUS gene 3235727 3236497 1 + . g655 7 AUGUSTUS transcript 3235727 3236497 1 + . g655.t1 7 AUGUSTUS start_codon 3235727 3235729 . + 0 transcript_id "g655.t1"; gene_id "g655"; 7 AUGUSTUS CDS 3235727 3236497 1 + 0 transcript_id "g655.t1"; gene_id "g655"; 7 AUGUSTUS stop_codon 3236495 3236497 . + 0 transcript_id "g655.t1"; gene_id "g655"; # protein sequence = [MNPPGRPPPLDGPIQYRNSLANFHQRQLGGGGAGSPSDPGSTFGGGPVPGGPGPNNRISKHGPGLPMPPPSPGMNKDG # SAKDMNMKIEGSPRGGLPPSSAGMTPTASGPANGPSSTPVPPGRPPSSQNPTPNSGPHPGMPSLPPPNMDPSPGSMLGNTPMSGMSGPMSGMPNGIGP # GGMGSGMVSINSSINAMNGAGSDIPFFGSDFMNDIEVGGLDTFDPNLFRDPGGDLNFERDFGQWFNPNDQGLDDSLDPMK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g655 ### # start gene g656 7 AUGUSTUS gene 3244830 3250490 0.78 - . g656 7 AUGUSTUS transcript 3244830 3250490 0.78 - . g656.t1 7 AUGUSTUS stop_codon 3244830 3244832 . - 0 transcript_id "g656.t1"; gene_id "g656"; 7 AUGUSTUS CDS 3244830 3248639 0.91 - 0 transcript_id "g656.t1"; gene_id "g656"; 7 AUGUSTUS CDS 3249171 3250490 0.81 - 0 transcript_id "g656.t1"; gene_id "g656"; 7 AUGUSTUS start_codon 3250488 3250490 . - 0 transcript_id "g656.t1"; gene_id "g656"; # protein sequence = [MDNGNDEDYPLDYDDGDYDDSTNEVGDSQTLQEEETDNDVSHMAQDNEFQITDSPSQEPGLRSPTTASPNPAALASRM # LQLSGMLHRRAQHSRTMNEPPPPSLSTPLPSSRRSLANQSADSFTSAGGTSVAPTPARLQPPPPSRGRRARKPGTTSTTRKPKDPDNVPRTITYPPSS # ELEQRPKVGKETNSNQILRVEANLVRVEQLTQRRAGEMHSSMLSALATHRREILNDTRAELDKIISNSLREEITNIVSTELNRLEPNLVTRLTSLLPI # DTINTLLSSMEDMLNASTPVTPPHGPSPLHLPSRPNNHLFTLSKTAPHSSRFPSSSPLPSSPSLLARLRNGPSTTQPGPLIPADNSPSTNVGAPQTTI # GSSIKAGKRRADDVDANNRDPKRHRYDARSAHTVTIDLPPNWEPLPTTIDYIFEMYNTWSTDFDAAARETRLQHHSTIRCPCGFTAYTRNRRTLHTDI # ENPWGGVATLVRDGLQCRVRLDLCGPDILAVEINAVVFFNVYILPESSRTDWTEWAELHPWDSLAQCIRLAVALDIPFVVAGDFNARTGHVLPYPTHP # TRFSPDSVVSTRGRRLLQLCAELELTIHSDSASPDPNNGWTSFQKRRDSLGQLITLPSVIDYLLSSSLTSYFISDFTISLETKWSDHAYLYWDFILPG # PQPHQQTAAPRRRPQIFAPCTSDIDLLQMRILSADPPTLTDLLLQVYGHAQPNVYTQPLKIYTDGSCLAANSASARAGLGVYYGPSNPHNLAARVVGP # QRNNRAELYAVLAAIQRSTPTRRLELFSDSTYTIQSIVYGAGDNYQCNWDCPNGDLLKAIALWIASRPSTIVLTHVRSHTGNAHNDAADLLAKQGASL # PPPAPFSDLDFIALPSPPTFHPAHPTFIPKVSTLLPDPQSHPNLPNSRRILTDEFTVGHRRRSYRRLLEDKALLKLRNAAEAGGAAFWNHYKSLRKPD # RTTPKVTISQLTDCFIPRMNPPDTTSTSFDPRILEQLDASANEIPFPSPQSSHPDFNLAVTEHDVGSVKAYLKRTTHSDATGVDAATYSQLMGIPNNL # LASLFSRAFRCNEFPSSWLIAIIIAVPKPGKDPSDANNYRAIALESCVLKFASLLIHLKLSHALEQAQVIPPSQNGFRSGYRTNNNAFILRTLIEKAR # ASGNTLFAAFVDISNAFPSTNQSSLWIKLASLGLTGQYFDWLRSLYKRMTYVISHDGSLSAYFQAMCGVLMGDPSSPTLWNIFLSTFHLWHDPDDLEL # LGVVISHLEHADDMVLITRSALSLQRHLTTFEHYCHNNNLTVSAGKSWVMLFGYLPPTLPTLWLAGSALPFKDAVTYVGIQFQSSHRHLFAAHYTTKR # DAAVTAAGGISGCELIIGHQRLDPSIAKQLYSALVDCHLINGCEVIIDTDNLLISMLEQVQLLCLRRLLGLSRRSMTTPLFTETGIMPIRARRVILAL # RYLIYLINLPRNHYASLALHENHNMRASGIPCWLSDLDWVIQHLPGCSLSLPPLPIISEEIILALIKSITAETNSRLQTEIDYSNRLSLLQHRLEPQK # TGPNKLITRTLRHYLTHVYKSHHRLSLTRLLCGDMVPITFHSSPARIHSLNLGENHSKRCRACLSPLQPESPQHVILQCTAIAAITTLRNEFLVDVAV # FIPLPTTRTFTNVESLYYLKAFIFNWSTVRRVARFIHEVVVIWKAFTHQELDGSYDESSNEND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g656 ### # start gene g657 7 AUGUSTUS gene 3253037 3254266 0.95 + . g657 7 AUGUSTUS transcript 3253037 3254266 0.95 + . g657.t1 7 AUGUSTUS start_codon 3253037 3253039 . + 0 transcript_id "g657.t1"; gene_id "g657"; 7 AUGUSTUS CDS 3253037 3254266 0.95 + 0 transcript_id "g657.t1"; gene_id "g657"; 7 AUGUSTUS stop_codon 3254264 3254266 . + 0 transcript_id "g657.t1"; gene_id "g657"; # protein sequence = [MVGSSMFVFDANPHAVHKITSGEEALVCMLFANFDTTWGHPALQDRLRRAGQQPSSQLILNGMTLFGAIWTASRLPEY # QSYKVVWHAMRAHLENEGVLAAVVSRFNAYVVRKGDSAHLDRVSKSKPQRNTYPKIPPRMESTMLTDLEDVGCQTRGDRPSNLSPENPRSFNRVLSTF # SIHDFPPSPVHTSSSPKPLFSHLPIPQMGPSEWAACYEDKEIYNPTTHSFSDLQPHPFPSLCSSPALAQSQTHICQESGHGIATVPNATSSLYRTHGI # EYQQDHLQQPEQHLHLYPPSLASPSFFPETYPETQQPLPEFGASMPSILTSHYPHKHEAQVNSNLTTGRTYWQMTNVPPPYLPYQHNQSPTTFSSNST # VSQDTAFVTLQNNHWRGYADGKFADEYASDAYKLQHE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g657 ### # start gene g658 7 AUGUSTUS gene 3255280 3256800 0.13 - . g658 7 AUGUSTUS transcript 3255280 3256800 0.13 - . g658.t1 7 AUGUSTUS stop_codon 3255280 3255282 . - 0 transcript_id "g658.t1"; gene_id "g658"; 7 AUGUSTUS CDS 3255280 3256053 0.47 - 0 transcript_id "g658.t1"; gene_id "g658"; 7 AUGUSTUS CDS 3256149 3256280 0.21 - 0 transcript_id "g658.t1"; gene_id "g658"; 7 AUGUSTUS CDS 3256333 3256598 0.62 - 2 transcript_id "g658.t1"; gene_id "g658"; 7 AUGUSTUS CDS 3256671 3256800 0.65 - 0 transcript_id "g658.t1"; gene_id "g658"; 7 AUGUSTUS start_codon 3256798 3256800 . - 0 transcript_id "g658.t1"; gene_id "g658"; # protein sequence = [MSHQLEHKARSAELHHKRAHLNRADILDPLDVTTSSTSVKTASAATTAAAAATTTSQTAATTTSSSHAVTSAANTTSA # TTSATTSSSSSSSTSATSSPTSNTTSSTSSTSRATSTGSSTSAASTPAVATSAETVVVASRTVATYITYTPSSSGTGTAAVASSSTTTTSSGVSAGSI # ETPFNRCPIQRRIRNRRRDDEHFDAAQFRNSAVLLDDEFGTDNFSARPPTMIARHMANAPAAPPVTYGNYPGADPYAGGDPFTTGEQFHTGDPYNHYN # AYPTYTQEPVYTLHPGETFARNPIAPNGSAEMDPTSAHNSYLNRQPTLRGPDTQFAGAPQQHYLDMNRVGSPPNMPASAEYNTGMPSPTSATPLYNPH # SSAEHSSVLPTPTTATVSQKPHAPVEYPSVGTPAPAPPAYYGDAQKRPETVYDPEDAYGGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g658 ### # start gene g659 7 AUGUSTUS gene 3260127 3261617 0.21 + . g659 7 AUGUSTUS transcript 3260127 3261617 0.21 + . g659.t1 7 AUGUSTUS start_codon 3260127 3260129 . + 0 transcript_id "g659.t1"; gene_id "g659"; 7 AUGUSTUS CDS 3260127 3260325 0.87 + 0 transcript_id "g659.t1"; gene_id "g659"; 7 AUGUSTUS CDS 3260371 3260670 0.27 + 2 transcript_id "g659.t1"; gene_id "g659"; 7 AUGUSTUS CDS 3260793 3260947 0.24 + 2 transcript_id "g659.t1"; gene_id "g659"; 7 AUGUSTUS CDS 3261003 3261617 0.49 + 0 transcript_id "g659.t1"; gene_id "g659"; 7 AUGUSTUS stop_codon 3261615 3261617 . + 0 transcript_id "g659.t1"; gene_id "g659"; # protein sequence = [MSLHNAAIDRRTGHFRRAGTAAAANGNGAGDNDDGNGNNTGNGSGNGSGQGSSSAAASSSTAGKFLEPTTAAATSANT # QPTSQSANASGTSQSNSTSASAAAAQTSSSSSSSSVAPTTTSTSSATSTSTSSSTTSSATLSATSQTSSSTISSTSQSSIPASTSTSVISHISTTSSA # SAASSTSSAKVSGAINTGAVVGGIAGSLAAVAIVGFLMAFFLRRYNRKKRAARFEASQFRRSAMVLDEPAFTPRPPEMVQNRENNYISSVTSTTSPGM # AGAGAYRFQQDHQDANQGQGHGASFDTEHEYYRDQAGQQYYDEAPPVPAVPMQRAPLQPRQQYTFGQVSVGQPAVAENANPFGVDDYDGEHVAYGSQP # AAGYYDNSQAYGNYAAYSPPQTAHTAGAHPSGQQASRASIIDESDAYGGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g659 ### # start gene g660 7 AUGUSTUS gene 3263231 3265209 0.7 - . g660 7 AUGUSTUS transcript 3263231 3265209 0.7 - . g660.t1 7 AUGUSTUS stop_codon 3263231 3263233 . - 0 transcript_id "g660.t1"; gene_id "g660"; 7 AUGUSTUS CDS 3263231 3264877 1 - 0 transcript_id "g660.t1"; gene_id "g660"; 7 AUGUSTUS CDS 3264943 3265209 0.7 - 0 transcript_id "g660.t1"; gene_id "g660"; 7 AUGUSTUS start_codon 3265207 3265209 . - 0 transcript_id "g660.t1"; gene_id "g660"; # protein sequence = [MIAFNARFTLLAALLSLIAVSLNPLVEAAAISARRPDTSSSASGTHHKTTREPVLPLPTRSEKALSSKKSEKGEKKKK # EGSSKGHKHDGRALDEFIQVSPWDHTHNVISVNIEHRDELRVLPGHHDHDDGHRNDLVDIDIKKRGEQAHFHTRRHSEFHDGKVIIGGKNDHVHIHAR # RHHDHDHDKVVVKGDNDHVHIHGRDHDHDHDHNHDHDHDHDHRRARRFRPHPRSLETMQKRACQATPGYIDINVSIIYCVLCFPSLTFRILSLSQSDG # KRLASMAYNQTMQEYDVSESEASTFNLMNCGTSEASSLVTLACNDIPQGGCLTYMYNGTSEDMTCQRCVDQSSVPPTACQTFMYNITSGQVNPTNCNM # VATQADDADTEPNTGDGPDAGDEIPDGEGEEPNAEQAASINARDASSTNSSSVTPVSLVFRPLAKELEVEDTGSNNTSFNSTNTSGNSTSFNATSIDS # DPDSTSPNNTSTTSANQTFTTTITVTSTSTSTGSSSSAVQSAAVASPSTTGMKVEVFNDPNETNAPPFSSSTDSPLSSTMTSSSANTTPTSSMMDADA # VASSIAASSSTDMMAASFTTSSSSTGTSSVSASTSSSSSNSPSATAAAAGLNARSTEPYLWQFKRFDQD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g660 ### # start gene g661 7 AUGUSTUS gene 3271234 3271863 0.53 + . g661 7 AUGUSTUS transcript 3271234 3271863 0.53 + . g661.t1 7 AUGUSTUS start_codon 3271234 3271236 . + 0 transcript_id "g661.t1"; gene_id "g661"; 7 AUGUSTUS CDS 3271234 3271863 0.53 + 0 transcript_id "g661.t1"; gene_id "g661"; 7 AUGUSTUS stop_codon 3271861 3271863 . + 0 transcript_id "g661.t1"; gene_id "g661"; # protein sequence = [MPIASPPTTYQLERPGCSGIACGPYLSIRDPSNIEHELPRGKTGAVSVRGLPTFAGYEVSPDINVPLDTSAFSSEGWF # DSGDMGYMDEDGYLFITGRSKEIINKGGEVISPFEVEEAIITAAKDHVKVTPFAHISTGSILTESAQTTLAFAIDHSVLQEAIGVVIVPVPGRPVIGL # AQLLDLLKEHLHPSKWPFAIVYMQDLPKNRQVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g661 ### # start gene g662 7 AUGUSTUS gene 3271956 3273842 0.93 + . g662 7 AUGUSTUS transcript 3271956 3273842 0.93 + . g662.t1 7 AUGUSTUS start_codon 3271956 3271958 . + 0 transcript_id "g662.t1"; gene_id "g662"; 7 AUGUSTUS CDS 3271956 3273842 0.93 + 0 transcript_id "g662.t1"; gene_id "g662"; 7 AUGUSTUS stop_codon 3273840 3273842 . + 0 transcript_id "g662.t1"; gene_id "g662"; # protein sequence = [MSDSVPALDRHFEAVVPPPSASLSDPIHCTVVQIDLREINRLLADIKGVKNVAVRSRQDGTPEAFVSVGPQENLDSTV # IKSSLANFLPGYAIPDIHVLARPLPLIAGDFDFASMEADIIQQNTASMSASAAVVRDIVAELLDIEPGMVSGESDFFLLGGNSLLLGKLSYLIRKRTN # ASIAVAAIFTNSSINGIASLVEVEQRKLSLESLVDERMQPYPSTRNNSELTLGSNGNRSPNSEGQKERGQNHPLNLIVQAIPMALFYPLKTAVTWSIL # LFILSYLAPAINQDYFQRMLALICAIVIARLCVRVCAPVAAIVCKWVVIGKYKPGNHRMWSLYYLRWWLVNQSLVSAGRGIFAMHPELNKLYYRLLGA # HIGKDVSISKHAHLGEFDLLTLEDGCRIDSSLVRGFCVEREGYFRLAPITIGRRAVVNSYTQISPGAIIPEGSVYGPHASSHESPSPPSYAAYNRTLF # MEPNWPLKFFVAWPIIIAVTFVSYIPWFIILWLMVSKTAIVEPGTNNALVSVVYWFSNPERVLWHAVSRMVRAICTPLLQVVFGIMVKRTLGLNSEHQ # ASDATQLVLLRRYINSILLSQGKLKEAFSLIGTHYEGVSVSSLFFSSDIQLTLSASSYTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g662 ### # start gene g663 7 AUGUSTUS gene 3278412 3278999 0.84 - . g663 7 AUGUSTUS transcript 3278412 3278999 0.84 - . g663.t1 7 AUGUSTUS stop_codon 3278412 3278414 . - 0 transcript_id "g663.t1"; gene_id "g663"; 7 AUGUSTUS CDS 3278412 3278999 0.84 - 0 transcript_id "g663.t1"; gene_id "g663"; 7 AUGUSTUS start_codon 3278997 3278999 . - 0 transcript_id "g663.t1"; gene_id "g663"; # protein sequence = [MWFGESEANVRDVFDKARAAAPCVMFFDELDSIAKARGGSSGDAGGAGDRVLNQILTEMDGMNAKKNVFIIGATNRPD # QIDSALLRPGRLDQLIYIPLPDEPSRVSILKATLKNSPLAPDVDLNFLAKSTHGFSGADLTEICQRSAKLAIRESIDADIRRTREKQEKEGDDAKMEE # DVEDEDDPVPEITRYALSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g663 ### # start gene g664 7 AUGUSTUS gene 3279032 3280368 0.65 - . g664 7 AUGUSTUS transcript 3279032 3280368 0.65 - . g664.t1 7 AUGUSTUS stop_codon 3279032 3279034 . - 0 transcript_id "g664.t1"; gene_id "g664"; 7 AUGUSTUS CDS 3279032 3279560 0.89 - 1 transcript_id "g664.t1"; gene_id "g664"; 7 AUGUSTUS CDS 3279791 3280368 0.66 - 0 transcript_id "g664.t1"; gene_id "g664"; 7 AUGUSTUS start_codon 3280366 3280368 . - 0 transcript_id "g664.t1"; gene_id "g664"; # protein sequence = [METDPAEFCIVAQDTVIHTGMFSSISYNRQISDSVLSEGDPVKREDEESNLNDVGYDDIGGCRKQMAQIRELVELPLR # HPQLFKSIGIKPPRGILMFGPPGTGKTLMARAVANETGAFFFLINGPEIMSKMAGESESNLRKAFEEAEKNSPAIIFIDEIDSIAPKREKVSFTVTMN # VELLVNFFVSDQRRSRTYAVPLPLTNSLISKTYQIAADTHGYVGSDVASLCSEAAMQQIREKMDLIDLDEDTIDAEVLDSLGVTMENFRFALGTSNPS # ALRETVVEVPTTTWDDIGGLEKVKQELQETVQYPVDHPEKFLKYGMSPSKGVLFYGPPGTGKTLLAKAIAHECNANFISIKVTDIYYVLFIDHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g664 ### # start gene g665 7 AUGUSTUS gene 3285266 3285868 0.96 - . g665 7 AUGUSTUS transcript 3285266 3285868 0.96 - . g665.t1 7 AUGUSTUS stop_codon 3285266 3285268 . - 0 transcript_id "g665.t1"; gene_id "g665"; 7 AUGUSTUS CDS 3285266 3285868 0.96 - 0 transcript_id "g665.t1"; gene_id "g665"; 7 AUGUSTUS start_codon 3285866 3285868 . - 0 transcript_id "g665.t1"; gene_id "g665"; # protein sequence = [MLNKTTELFQKEFVGKVGQKQEFVRGYELRQLGINYRGAPLVSDEKYTDKDEVNDPYRSGDDGTVRAGDRAPDAPCLA # QLGVNETSSTVSLFDLLNTTQHSALVFPGSTGRDFADEVSGTLREYPSNLLKSIFILPRTSSASSFTLSDMTLVDTEGHAYSGYDVAHDTPTVFIVRP # DGYIGALVTSGRLGIRNYFSNIFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g665 ### # start gene g666 7 AUGUSTUS gene 3286602 3287525 0.62 - . g666 7 AUGUSTUS transcript 3286602 3287525 0.62 - . g666.t1 7 AUGUSTUS stop_codon 3286602 3286604 . - 0 transcript_id "g666.t1"; gene_id "g666"; 7 AUGUSTUS CDS 3286602 3286963 0.93 - 2 transcript_id "g666.t1"; gene_id "g666"; 7 AUGUSTUS CDS 3287038 3287209 0.64 - 0 transcript_id "g666.t1"; gene_id "g666"; 7 AUGUSTUS CDS 3287505 3287525 0.63 - 0 transcript_id "g666.t1"; gene_id "g666"; 7 AUGUSTUS start_codon 3287523 3287525 . - 0 transcript_id "g666.t1"; gene_id "g666"; # protein sequence = [MSVNVLIPRTLELYKLLGILPDIIDRSSPPPTNLRSFAMPDDGKPPNFTPIAQSLVNTPDRPLVSQNRQEQLLREHIL # ADYGIQVELGTELKSFEQQPDHVVAHVVNIVDSKIVEESFTVDWLVGADGARGVVRKQLGLTFLGESPEMDAVTGDIYVLGDPLDHVRMGIFIRLTGV # TLNMLLNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g666 ### # start gene g667 7 AUGUSTUS gene 3299454 3299813 0.73 - . g667 7 AUGUSTUS transcript 3299454 3299813 0.73 - . g667.t1 7 AUGUSTUS stop_codon 3299454 3299456 . - 0 transcript_id "g667.t1"; gene_id "g667"; 7 AUGUSTUS CDS 3299454 3299813 0.73 - 0 transcript_id "g667.t1"; gene_id "g667"; 7 AUGUSTUS start_codon 3299811 3299813 . - 0 transcript_id "g667.t1"; gene_id "g667"; # protein sequence = [MDAAQTPEYGTCKLVLFFLGVTASHTAMCVDQENFVTVVRGVEAAVGVKTQGLDSPQSTANASQAILDFASAQSSIRF # NSDVKTAMGNTANILAQIASDGSTQFNLRGSGHGQTSLVTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g667 ### # start gene g668 7 AUGUSTUS gene 3309558 3310864 0.6 + . g668 7 AUGUSTUS transcript 3309558 3310864 0.6 + . g668.t1 7 AUGUSTUS start_codon 3309558 3309560 . + 0 transcript_id "g668.t1"; gene_id "g668"; 7 AUGUSTUS CDS 3309558 3309770 0.6 + 0 transcript_id "g668.t1"; gene_id "g668"; 7 AUGUSTUS CDS 3309893 3310864 0.93 + 0 transcript_id "g668.t1"; gene_id "g668"; 7 AUGUSTUS stop_codon 3310862 3310864 . + 0 transcript_id "g668.t1"; gene_id "g668"; # protein sequence = [MLLQALVSWTNSTEKDGGIDLVSKLATQISDTTAECDKLTQELVSVVDQINQVTKLIENHWASALAIALRKLQAELND # AWSEAEKLAEEMDGLTRELDDIDDTGVYSDEGEIFIRTAAVVTVPKPASHDAVSASGKLIDLKPSNVASTSSQFLRPPSAVEPKEGEESKSSPEDNDT # RSLRSRRSARSGKSSSRVGMITAARTRSMRTSLGSLRLPGRSSRSIHSPSGIQSAPVDGPHPPVPSIPKVFTPDTSHPPSSNSLTPTSNAPHSSTPSP # LDRKQSRNISTESLVDEPAPELPPPPSIPILSPAPQPRLRKTEIEDIRIEPNRRLGEPSAEPPLSVMDDIIVMPTSSNHGIEEVPRILRKSVDDVNMS # ANSQRKMGRGELVFFDLLQEGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g668 ### # start gene g669 7 AUGUSTUS gene 3312063 3312419 0.85 - . g669 7 AUGUSTUS transcript 3312063 3312419 0.85 - . g669.t1 7 AUGUSTUS stop_codon 3312063 3312065 . - 0 transcript_id "g669.t1"; gene_id "g669"; 7 AUGUSTUS CDS 3312063 3312419 0.85 - 0 transcript_id "g669.t1"; gene_id "g669"; 7 AUGUSTUS start_codon 3312417 3312419 . - 0 transcript_id "g669.t1"; gene_id "g669"; # protein sequence = [MSAQTALLIGASGQTGQHLLKELLNSPKFSQVFEYGRRVTDLETISHGKEKLQQKVIDFEKLNESGLKDGQWDVVFIT # YVSSLNLNCARSLTSYTILRLGTTRKNAGSAEAFEKIDRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g669 ### # start gene g670 7 AUGUSTUS gene 3314131 3315393 0.65 + . g670 7 AUGUSTUS transcript 3314131 3315393 0.65 + . g670.t1 7 AUGUSTUS start_codon 3314131 3314133 . + 0 transcript_id "g670.t1"; gene_id "g670"; 7 AUGUSTUS CDS 3314131 3315393 0.65 + 0 transcript_id "g670.t1"; gene_id "g670"; 7 AUGUSTUS stop_codon 3315391 3315393 . + 0 transcript_id "g670.t1"; gene_id "g670"; # protein sequence = [MNFPQSQTDIEYMYTLGTLILVAGVPPQQFADYLVGFNPQVISVSTFLLGPFPTEINPTTVIILLGPALDLISSSLLS # NLSQFLPHFTSLINIEIRIHDSVWSRRLVDKLPIFPPSVKNAKMLVSNLLPNGPELVRIVYNANATPFATTFAAAFYGMHLAMKGHRASDLSFMLALH # EALAAVDLQENCVVEIEISHGRSMFSRVSGRLRDVCKVVECVMDTAATPELASRLYAVKSLVVDVPMLHHRDEFGHFVHAVHSKAPRLQILEVNFRTV # NSIETHEWMGSVRMLDSLRELIRIVIAHPHPLDLTDADVARLLRSWRKVEHVSLNPKASGALITHRQVLLTINALRIAAFQAPTSLRHLSLFLNADED # SVHGFSGLQPRYDVEKIELRLATPSTHRARVAIRVAETLFPNANIKEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g670 ### # start gene g671 7 AUGUSTUS gene 3323936 3324268 0.7 + . g671 7 AUGUSTUS transcript 3323936 3324268 0.7 + . g671.t1 7 AUGUSTUS start_codon 3323936 3323938 . + 0 transcript_id "g671.t1"; gene_id "g671"; 7 AUGUSTUS CDS 3323936 3324268 0.7 + 0 transcript_id "g671.t1"; gene_id "g671"; 7 AUGUSTUS stop_codon 3324266 3324268 . + 0 transcript_id "g671.t1"; gene_id "g671"; # protein sequence = [MADSSSSASSSLSSSSSSLSSSSSSDSDSDDTDSESELDSEEILSFCIPSSFLSRSPSAATQSFDSIESNGKTKAPRL # MRPLPRRSGSSASHSKSSIVVLSESLNDSSVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g671 ### # start gene g672 7 AUGUSTUS gene 3328521 3329399 0.73 - . g672 7 AUGUSTUS transcript 3328521 3329399 0.73 - . g672.t1 7 AUGUSTUS stop_codon 3328521 3328523 . - 0 transcript_id "g672.t1"; gene_id "g672"; 7 AUGUSTUS CDS 3328521 3329399 0.73 - 0 transcript_id "g672.t1"; gene_id "g672"; 7 AUGUSTUS start_codon 3329397 3329399 . - 0 transcript_id "g672.t1"; gene_id "g672"; # protein sequence = [MNSKFWILYDHFTKLNLKTDNHLYLPTRYFFQSHFGSYHHINEYQPDSFEAVLNDEYAIILRPKTLALYSLRAFRRGS # HPPSASLSPSQVHEFQWRIDSCVMQRQISPSAPYLSNDSKPSSLNILIRYSSLFPWPVNLLHHYILYPNDSYISSATNKHSSTTAGFAITSNNLPYKF # PPVLSQTIVSPVRLFAITDMALGPYGTAVWFDSHTDYDGEVGQRLAGLMLEFSKHRDETGSNNITAADQVSTTPSMVFGAHETDDWNRLAIDEGEGRI # AVGSTTGEIIIEDYAERQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g672 ### # start gene g673 7 AUGUSTUS gene 3331688 3333307 0.27 - . g673 7 AUGUSTUS transcript 3331688 3333307 0.27 - . g673.t1 7 AUGUSTUS stop_codon 3331688 3331690 . - 0 transcript_id "g673.t1"; gene_id "g673"; 7 AUGUSTUS CDS 3331688 3333307 0.27 - 0 transcript_id "g673.t1"; gene_id "g673"; 7 AUGUSTUS start_codon 3333305 3333307 . - 0 transcript_id "g673.t1"; gene_id "g673"; # protein sequence = [MSFQISDALLITHTLATVPVELLSCAHMSLLLQSLRAQLQAAIDGLSSITSLANVDSASGITKPSSSSKSTHTTSYTS # TLASLHLIPFSVIHTLLALLDGYLLAQWAPSREVDHANCRRLLDEARDEWLADGLVAVGITAELSTTLALPMKRKDKHRTGMGEYSQWPLLPFGLISV # ADASSRCTEIIFRVLVSLTHSDPLWGQTLTKNSQAMMFIVRTIVRADDFWGTIMAGARRSSISLLTGRTAINGKHNSKNTEKPTTRTKVEKVEEDGKT # TDYDSEDYGNGNFDQPTTVTERSSPTRALDWLCLSLGLITNLVQVVDEAKIILRETSPYFIWNERLLRAHVSLKFLVLDPDCIQKTIPCIRVCSCRRP # TSVLKLLVSTYEHQLPFISVHSTRPVVKIPEIPLTLETEQQEQQAEADASFLLGHLSVLFGLLMMDSSENQEIVLDSLPLLHLGHEDIKPNSNSKHKL # KQQKLGQLVENASELGVFYTVISRRGLSGNGIAADTPDPGQSHEENDAARGADVAKGVISFLRYLLDSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g673 ### # start gene g674 7 AUGUSTUS gene 3333827 3334657 0.98 - . g674 7 AUGUSTUS transcript 3333827 3334657 0.98 - . g674.t1 7 AUGUSTUS stop_codon 3333827 3333829 . - 0 transcript_id "g674.t1"; gene_id "g674"; 7 AUGUSTUS CDS 3333827 3334657 0.98 - 0 transcript_id "g674.t1"; gene_id "g674"; 7 AUGUSTUS start_codon 3334655 3334657 . - 0 transcript_id "g674.t1"; gene_id "g674"; # protein sequence = [MSAVRTYGKKGTKRNLDSGPVQSSSKKPKIDSIVPSTPKAAQDYLSHIFDTDLPSPAPSTPNRLSKRMLGRSKTEPTL # GDSKDSLESSSKSLLDKTSSLPSFTSPPKRSIPPPSEPSSSPQRPAMNHKRTYAGKSRSFLVAMPADRSLPEELQDDYNNRESYAVLRSRWGVDNSED # DPYPEPLSPLKSNTTTPSGSPSKGKGKGRLKQEVNVPADIIQPLRSITEIRNKGESRRFLDEVGYLLEGMGKDETPALKKARFVAFLFLHSLLIYATV # VL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g674 ### # start gene g675 7 AUGUSTUS gene 3334811 3335134 0.66 + . g675 7 AUGUSTUS transcript 3334811 3335134 0.66 + . g675.t1 7 AUGUSTUS start_codon 3334811 3334813 . + 0 transcript_id "g675.t1"; gene_id "g675"; 7 AUGUSTUS CDS 3334811 3335134 0.66 + 0 transcript_id "g675.t1"; gene_id "g675"; 7 AUGUSTUS stop_codon 3335132 3335134 . + 0 transcript_id "g675.t1"; gene_id "g675"; # protein sequence = [MDVFKTRLESFTRPKRGKGGTKSQSNLKWPHPEYFMATPETLAEAGFYFDPSSEDKDNVTCYMCGKELSEWDEKDNPF # EIHFKKCGKKCAWANVRCGLGAEMDSDGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g675 ### # start gene g676 7 AUGUSTUS gene 3335406 3337907 0.33 + . g676 7 AUGUSTUS transcript 3335406 3337907 0.33 + . g676.t1 7 AUGUSTUS start_codon 3335406 3335408 . + 0 transcript_id "g676.t1"; gene_id "g676"; 7 AUGUSTUS CDS 3335406 3335416 0.33 + 0 transcript_id "g676.t1"; gene_id "g676"; 7 AUGUSTUS CDS 3335528 3337907 0.6 + 1 transcript_id "g676.t1"; gene_id "g676"; 7 AUGUSTUS stop_codon 3337905 3337907 . + 0 transcript_id "g676.t1"; gene_id "g676"; # protein sequence = [MTPPEEHRDRVKKAGNPCPMFPDIVFPPPPLKSSTSHTRSKSKSSHVDVTMPMKTYDGSDDDTITSHTTRTGSVASTS # TAKTPKAPRTAKKGAKTPRSRSVSRTRNIPVEVDDEDEVEDLPPPAAKTTRKAPTTTTRSRSISRTRSVASIVDSDGGTGTEDEVFLKRSTSTRSKGK # AKETGASSRSTDDEGGVSSKKKGNKGRSQSKTRVSVIPEDMSDNGAVEPPPPPPKSTKKSVARKPSTRAGAASKSTSSAKQNHQHEEDQDSDVLEPAP # SSQGSKPFSNSVAAAAALFDDNVEIDITEQIHDPQPVRPTRTTRKSTKPPVGLGTSTTTKKSTLTRSASAASVRGAKSRAKEEVDDDDPLDDIHMHVP # PISPPSVELGLKAEGESQRESVPQLSAAKPTNSQRKLNTKKKLPPVNLKTDFSDQDAVLPPPPVPPRSPSRPKTKPLPTHTPEIDDGGEVVPERHTEE # TEPVERSGMSSRSRSGTRESSSTDTNSKESMSKPTTLLKSATMKKKGSFLNSRSSTQSRTGVSIDQVMNISSDEGDEDEVENVIRMVEPVQTKSRILT # HVKPPPQGKTKGKDTPALTSTTDPTSDDSLIPAWGSVQAKIAQIEKTVETESGTSSLKPKLANSFIDEPKPDVSTVTTLEVEDRDVQMDEPPDLAKNE # INEEVKEDVREVSPLPRPAVTPPRPQQQQVPTSPFKTPFRFGMGPGNPFNVPPTPGAPMESIPAGIPIPLSREPFVPTQKLSETELSMTVEEWVRYHM # QIEYDKFKEDGEREIDAFLRTAEQVRKTIEAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g676 ### # start gene g677 7 AUGUSTUS gene 3339436 3339717 0.78 + . g677 7 AUGUSTUS transcript 3339436 3339717 0.78 + . g677.t1 7 AUGUSTUS start_codon 3339436 3339438 . + 0 transcript_id "g677.t1"; gene_id "g677"; 7 AUGUSTUS CDS 3339436 3339717 0.78 + 0 transcript_id "g677.t1"; gene_id "g677"; 7 AUGUSTUS stop_codon 3339715 3339717 . + 0 transcript_id "g677.t1"; gene_id "g677"; # protein sequence = [MSFILSSGAADMAMAWQTLSASQRSTIKQQYQAAGIKLLVSAFGSTETPTTSGKDPQQLASTMAAWVKQYGVDGIGKF # EGIFTKGNVVSCPFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g677 ### # start gene g678 7 AUGUSTUS gene 3340407 3341024 1 + . g678 7 AUGUSTUS transcript 3340407 3341024 1 + . g678.t1 7 AUGUSTUS start_codon 3340407 3340409 . + 0 transcript_id "g678.t1"; gene_id "g678"; 7 AUGUSTUS CDS 3340407 3341024 1 + 0 transcript_id "g678.t1"; gene_id "g678"; 7 AUGUSTUS stop_codon 3341022 3341024 . + 0 transcript_id "g678.t1"; gene_id "g678"; # protein sequence = [MSWEYPDANSQWITAVRGSAYPIDGSSDSGSSGSSTSTADAASPTSVGSSGGSSTDAASPTSLGSSGSSTDGASPTSS # SSTVADSDSASPTSLGSSSSSTPTPDGASPTSTDADSGSTAASTDAGSVPTTDSSSPTTPATSASTAASTGTFNNGMWTPSASTATFNNGMWTPTTAP # ATTVATPVPQRREERTTHRMVRRRGFPVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g678 ### # start gene g679 7 AUGUSTUS gene 3344218 3344968 0.54 + . g679 7 AUGUSTUS transcript 3344218 3344968 0.54 + . g679.t1 7 AUGUSTUS start_codon 3344218 3344220 . + 0 transcript_id "g679.t1"; gene_id "g679"; 7 AUGUSTUS CDS 3344218 3344319 0.82 + 0 transcript_id "g679.t1"; gene_id "g679"; 7 AUGUSTUS CDS 3344357 3344968 0.66 + 0 transcript_id "g679.t1"; gene_id "g679"; 7 AUGUSTUS stop_codon 3344966 3344968 . + 0 transcript_id "g679.t1"; gene_id "g679"; # protein sequence = [MKLFSVLIFGIASLSGIGGLPVAGSVSVGFARIITTTSSVSSSPPHAQDGHIELKANVTFPGWFSKKSDADQNSVQEA # VEIILDLAATKLFGNEKSVAITVSKWKGYPRKSTSQRVQYYPFTVTFSKDDQSLPLETGTYKGRFKAHDFDRGFEKWKYFAVYGNLVSPTGNLVVDVQ # SGKIAVQKTSYIGVDHDPNGETAASKVSSGPTAVPQWDRVGLFFSCRYGTCYSFSKLDIQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g679 ### # start gene g680 7 AUGUSTUS gene 3346854 3347378 0.25 - . g680 7 AUGUSTUS transcript 3346854 3347378 0.25 - . g680.t1 7 AUGUSTUS stop_codon 3346854 3346856 . - 0 transcript_id "g680.t1"; gene_id "g680"; 7 AUGUSTUS CDS 3346854 3347264 0.25 - 0 transcript_id "g680.t1"; gene_id "g680"; 7 AUGUSTUS CDS 3347361 3347378 0.99 - 0 transcript_id "g680.t1"; gene_id "g680"; 7 AUGUSTUS start_codon 3347376 3347378 . - 0 transcript_id "g680.t1"; gene_id "g680"; # protein sequence = [MDDISQLALDHSSSTLTSSDTSTILPSATQSTNMAPVDAGPSANRGAPPVIPAGIDNVGTSIDVDRSVPIVAADVSTD # GHGVPGVPVGGSGAMLNAETQSNESKKNSKAKTRTTSAGNSIVRPNTSTGMKYVFIFMSGQKVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g680 ### # start gene g681 7 AUGUSTUS gene 3348961 3351140 0.64 - . g681 7 AUGUSTUS transcript 3348961 3351140 0.64 - . g681.t1 7 AUGUSTUS stop_codon 3348961 3348963 . - 0 transcript_id "g681.t1"; gene_id "g681"; 7 AUGUSTUS CDS 3348961 3349308 0.99 - 0 transcript_id "g681.t1"; gene_id "g681"; 7 AUGUSTUS CDS 3349362 3351140 0.64 - 0 transcript_id "g681.t1"; gene_id "g681"; 7 AUGUSTUS start_codon 3351138 3351140 . - 0 transcript_id "g681.t1"; gene_id "g681"; # protein sequence = [MQYRQNCTKAAFEELERNNGVKVSAYKDFFDGSDYLEAVAEGKIADNDMVVLLSIDGAQLYRNKASDCWMYIWVVLDH # DPSNRYKVQHVLLGGVIPGPNKPKNLDSFLFTGLYHISAIQQAGGFRIWNAKSGQIFMSNIFLALVSADGPAMSCLNGFVGHHGRVHCRFYCPLIGRH # KPGGPHYYPARLKPLGFTVTGCDHDDVDINALLSSFTSRDAEKAYNHNLSRVVVSRTKTEYQARRLQTGVVKPTIFSGLDPNMMLGVPGIFAGDCMHL # PALNIPDLYIPLWRGTFDCDSTDTKGNWSWAVLKTQAAWKAHGQDVVAATPFIPGSFGRPPRNPAEKISSGYKAWEFLLYFFGLGPCLFYNLLPKDYY # EQYCKIVQGIRLLIQEEILPDEIRLADKLITEASNSFEELYVQRRTDRLHFVRASVHAPSHMPYETIRIGPGIIYSQWTMERMIGFLGMDIRLHSNAF # ANLTNIAITRAQNNALIAMFPDFRPKPKLLPRGAVDIGDGYQLRRARDSCSRAVTELEAQAISRYFLDLGFSTDDDGTPFDDNYNPVVVRWARVLLPN # GQIARSRWKENLKPINKLRAARSVRVTLSGRLQYAEVHFYLSWHIHNIEKHFAVASFYGEPHQGILKQSSHSYYTVQHKCDVDVRAFDIKSISAVVMM # APDPRYGTVFQDGSEKDRYYLMEKPGLKLGRLFGWEEDDTES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g681 ### # start gene g682 7 AUGUSTUS gene 3352680 3353183 0.74 - . g682 7 AUGUSTUS transcript 3352680 3353183 0.74 - . g682.t1 7 AUGUSTUS stop_codon 3352680 3352682 . - 0 transcript_id "g682.t1"; gene_id "g682"; 7 AUGUSTUS CDS 3352680 3353183 0.74 - 0 transcript_id "g682.t1"; gene_id "g682"; 7 AUGUSTUS start_codon 3353181 3353183 . - 0 transcript_id "g682.t1"; gene_id "g682"; # protein sequence = [MHSLTAEIELLKNQISILEIEKNSSELQVQHLHSRCNELTEKVLSLRAHAQCQATNHAFSKAEMKDKLEEALKAEERT # KVNSNRWLERYVLQKEKLRRHENALATERHRKAKELNEVIQRAEKAETEAMFWRQEYVRTAEELRNAASDLLTNGDKMIALANTRPLPM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g682 ### # start gene g683 7 AUGUSTUS gene 3354197 3354604 0.44 - . g683 7 AUGUSTUS transcript 3354197 3354604 0.44 - . g683.t1 7 AUGUSTUS stop_codon 3354197 3354199 . - 0 transcript_id "g683.t1"; gene_id "g683"; 7 AUGUSTUS CDS 3354197 3354604 0.44 - 0 transcript_id "g683.t1"; gene_id "g683"; 7 AUGUSTUS start_codon 3354602 3354604 . - 0 transcript_id "g683.t1"; gene_id "g683"; # protein sequence = [MKEVSILFTALKNSPVTTQRITKDKATKSPAQKVVEAMFESAWKELGLEQSGKLPVMHFFTYQYLHNWNPREVLKYEI # TRDAAKHGKGTCNDNCYATATPVEGKNDHFDFEIELDVEREDGKLQVFSKKGVKVDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g683 ### # start gene g684 7 AUGUSTUS gene 3360071 3361243 0.93 + . g684 7 AUGUSTUS transcript 3360071 3361243 0.93 + . g684.t1 7 AUGUSTUS start_codon 3360071 3360073 . + 0 transcript_id "g684.t1"; gene_id "g684"; 7 AUGUSTUS CDS 3360071 3360331 0.93 + 0 transcript_id "g684.t1"; gene_id "g684"; 7 AUGUSTUS CDS 3360395 3361243 1 + 0 transcript_id "g684.t1"; gene_id "g684"; 7 AUGUSTUS stop_codon 3361241 3361243 . + 0 transcript_id "g684.t1"; gene_id "g684"; # protein sequence = [MTLGISIPSPMTRGSPSSDDSSQVHTPVSPTFAEPSQRHSTAAEPSSRLANGGNKRKSTRRVNTAERRATHNAVERAR # RETLNGRFLDLAALLPNLSQIRRPSKSAIVNSSIAHIHASRRHRLLASRELRTLKLESDALRRELNDWRDRAGIPRIQEPQRGDAFSTILSGEIEILP # IPDADEEEGEYMYGDEEGAGEGAVYATGGSPEFAAPPPPQMNTNGYDLSIEQQQMMRRAAAPMVASPSGMVVENPVMGMIYNNNMGSGPYPAVSFAPD # LDQNKWRPSVNEQGIMASVSRRSSIATSDVRRNRDRAMSTSTTGSSGGGSPAHMAYYDPGWNATMGGMAPNMGANMGAMITNGNMGNGGAYSTVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g684 ### # start gene g685 7 AUGUSTUS gene 3367235 3368032 0.55 + . g685 7 AUGUSTUS transcript 3367235 3368032 0.55 + . g685.t1 7 AUGUSTUS start_codon 3367235 3367237 . + 0 transcript_id "g685.t1"; gene_id "g685"; 7 AUGUSTUS CDS 3367235 3368032 0.55 + 0 transcript_id "g685.t1"; gene_id "g685"; 7 AUGUSTUS stop_codon 3368030 3368032 . + 0 transcript_id "g685.t1"; gene_id "g685"; # protein sequence = [MENKRPLSPEVPDEDLQQLYDQVWAGFGSEDTQSIESASSYTPSTASVLSPRDGVRRQDTSEQDREDIGRIYSVYATD # NLPDVVYNYGSPSTTGGSNIYQHQQDTDNYSGYISSPISPVSTAAATYARSARSASIRSNGRERSGSGSARRLPLPPTPANGWNAPTQMTTAKEYQRQ # GHVSSMSTSSISSVASSRKLPATPTSAPVVTLGGKDLYRLGVGLPTSPRPSKSPSPTRGRGGVDSGLSLAADYLQPEGESIYVTHYQFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g685 ### # start gene g686 7 AUGUSTUS gene 3368106 3370646 0.55 + . g686 7 AUGUSTUS transcript 3368106 3370646 0.55 + . g686.t1 7 AUGUSTUS start_codon 3368106 3368108 . + 0 transcript_id "g686.t1"; gene_id "g686"; 7 AUGUSTUS CDS 3368106 3370646 0.55 + 0 transcript_id "g686.t1"; gene_id "g686"; 7 AUGUSTUS stop_codon 3370644 3370646 . + 0 transcript_id "g686.t1"; gene_id "g686"; # protein sequence = [MQVVSGSSANTSPALVAAPLPPSQSPRSYFDEKSRKDPGLSMNRWNSTTSSIVNGVNAQGLRIPPPPPLLSFQRPSQL # TQPQYSMPEPDLYADPNAGPSNIVRRPTDMLRELKDGAKYDRYHPEERHDQLGVDADEASYDWDEDYELQQQRFAADAPRSYQSYSSSQSQLQGSSSR # RNRKPKNRRDWTYEYSEGNDNEYSSDEFINYSLLSHLAVQLRDKVPRGVHVKASIPYEGAFTGKDIVDTVQSLIRKHLLLNHSLSLTNSTLYPASSSS # SLSVDRRAALHVARSLQCQLLFYEVDGGGRELCDGVEEVYIFFSEDNISSSPSGSGFGFGTMPPRMTSGHSTVLPLPTAVVTMLTRCYVPTCVDDKPC # YAWDCPKRGLSIQRMLSSSSSNIVPVVVNIPIISSYPYLEEERKPWKETVPEEVFSRIPEGEVKRQVAIHDLITKETDYLADLIVLETQFMLPLSEWV # VSISGSQNSENGLVATTTSSHSPPPTPSGSTAAFVSPLPMRNSSSSFSSSSSKSSPLLAFSPALQTLFPLLQALITAQTRLLDNLRVRARESQYGIIE # GIGDLYLERAASSEWRAGWGGGWVQGRGFVSTADRAKEGWTGGRGYDEWVGVWATCGLGGLGIFSPAISTTTDEYGNEDWKKIIVEQEMQRQQKQRES # NLTAAEDESTGEVGTETGRIKEPREPRGYPLPDIDLKKFTELLALPAAHLKSYPSLLSTILAESSRSADPVSSPSSLIDTAANSTSPAALKTNKKKAG # KEKEENSDASYLREAIRAMRALWGYGKVKTFQLSMNVGASGGDDNKGSMGVMGEAAIKWEWFNLVSEEERKEIGKTEVKRQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g686 ### # start gene g687 7 AUGUSTUS gene 3371054 3372367 0.39 + . g687 7 AUGUSTUS transcript 3371054 3372367 0.39 + . g687.t1 7 AUGUSTUS start_codon 3371054 3371056 . + 0 transcript_id "g687.t1"; gene_id "g687"; 7 AUGUSTUS CDS 3371054 3371568 0.57 + 0 transcript_id "g687.t1"; gene_id "g687"; 7 AUGUSTUS CDS 3371803 3372367 1 + 1 transcript_id "g687.t1"; gene_id "g687"; 7 AUGUSTUS stop_codon 3372365 3372367 . + 0 transcript_id "g687.t1"; gene_id "g687"; # protein sequence = [MEYIPNYPIAAYTIDSEMRTNPAFKDFVQRCTRHPDAHRLDMKNFINRPIPRLLRYELLLKGILEETPVGPIAASNRQ # GGSSTSSRGANAEHEDHSSIPQVLDVIRRLGKDTEPGVVNAKSKVELWKYNEGLVFKQGEWIDMDLLDESRSLIHSGKLLRQTDGLEWSGWTEFLTEP # PVQRGTGPGLLRGLRSQGTIGQGLEASSPNELLASPEGSTPIETSSSEMSPSPSSRLLYPITLHHLGRQSVSPTTSSLIPPLPAGPSSSRTAQQAKPP # PNVILYTESATARAEWGAKLQEALGIRRVVQESNKVFEIETLSSETFVTPAGLDAPGVGSAGVLGIGYSPDTVTGKVTCSVPFSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g687 ### # start gene g688 7 AUGUSTUS gene 3375016 3378297 0.23 - . g688 7 AUGUSTUS transcript 3375016 3378297 0.23 - . g688.t1 7 AUGUSTUS stop_codon 3375016 3375018 . - 0 transcript_id "g688.t1"; gene_id "g688"; 7 AUGUSTUS CDS 3375016 3376985 0.41 - 2 transcript_id "g688.t1"; gene_id "g688"; 7 AUGUSTUS CDS 3377040 3378297 0.25 - 0 transcript_id "g688.t1"; gene_id "g688"; 7 AUGUSTUS start_codon 3378295 3378297 . - 0 transcript_id "g688.t1"; gene_id "g688"; # protein sequence = [MGASMIDYVLASKPALVSLTEGALKVSRSPLSDHAALELTIPYHPPAAPVPVLQSDMLTHHQISPLLSPTNLDLMVQD # ALRSTRTTAEAIDTLYGPVYADNGGIVVYLTASSGRDDMGSPQAAFSLFWGENSENNVSFRIQTVPKPTINRALLSAMIPALQIANRLPERTLHINVT # SEYLVRSLCYWAADNAEHAWDCAHSDILKVVVSHLCARVAAVEFHVIPTRGNGHLQRAKDIAYKTVRDVNANVWSLLAPHPLPHPEHLAQSIPNVRKV # STRLPEHVPPKLRTAVGPNDPDHEDEDCIPRESHRGRAHEREQRRGNLVKLINCETALSFWSCVREWTDAKKCPVSVSAQQLSTVFEACLNPLPHPPA # YFDRDVRQLNTLLSSAIPRQTTDHTASRFFSRSITDDDVALCKKKLRERIPNTTLAALFNRCIFDLDAPQQWFTTVLIGKVGLNAKEPDSYHIIGLES # CLLKMLTLIIDHPVRAWAEEAGILPNSQNGFREGYRTHNNSFILRCAIETARANDKPLYVAFVDLKNAFPSTDIPTLWRKLFNRGMSGPLFDWLRLLY # ARMTYVVHHGDEVTAAFCSLIGVLTGDTLSPMLWNIYFSDLHIPVHADDVYLNGNPVSHVEQADDVAIWSMSPEGLQNKLNHFFCWCQLNSMVISVKK # TKWMLFGPLPPLLPIFLIDSKQIELVPSYKYVGLNFTSVHRYILQAIYNIKAGKARNVTRATFALEPAIGCLPPQEGITLYMARVDPHLIFGCEIVLD # IDLTLLEDLENVQHLYLRCLLGVNWRSTLAFLFTELGIEPIRYRRIKLALSYLHSLLSLQGHRLVTDALAHSFHLVRMGQPAWISDLRNVLCHLPVPV # LCTVDNLADPEALPHIIKEVELSCEESLSSMVRDSVKAHLLHNRTDYNEMGLPALLSATMSLRPYLKVLNVPKHRHTFTRLLLSCHCLSVERLRYNEQ # YRPPIPRIWRLCRFCRLSIEDEYHALLQCRQDVTLVYLRERYLADVGVAAPELTLLRQTLSDYDFLKRLLFDVRVMSVTAKYIYDVLNVFSGHEPYVP # SPDLYSSTIQSTVNSPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g688 ### # start gene g689 7 AUGUSTUS gene 3379094 3380448 0.16 - . g689 7 AUGUSTUS transcript 3379094 3380448 0.16 - . g689.t1 7 AUGUSTUS stop_codon 3379094 3379096 . - 0 transcript_id "g689.t1"; gene_id "g689"; 7 AUGUSTUS CDS 3379094 3379708 0.31 - 0 transcript_id "g689.t1"; gene_id "g689"; 7 AUGUSTUS CDS 3379846 3380448 0.5 - 0 transcript_id "g689.t1"; gene_id "g689"; 7 AUGUSTUS start_codon 3380446 3380448 . - 0 transcript_id "g689.t1"; gene_id "g689"; # protein sequence = [MDPSPPKSIAALPSPPISSSGTPAALAPLAPMALSRIQNSSPHTGVSTTPSQHGPTASLAPPPSVPLGRPLELSIPTT # NTRTLQRQSSRTFSTATASSKGKESAEARPEAGSSMLSAVEPAEKEAFDHLSLTPPPPSETATQARNRTNDNITRLAVVVHHLKQNTESEQRIVIEGI # QDLAAVQASLRETLDMRLTESVMQDMGEVRDRVPDLEKQIAELRGRLSQATNNPPLQPLPSLASSVAPPSSLFASPYLSAHKHASVDLTQPGAKRFHH # DPTYTDVLVEGVKADEGTSSLVKKILNAADTAFPTVIAGYRMNDHSLPPHVVIRFKTADSASQFVWIATERCPASLQGCRFTLIQRPPVQSMHSYEFL # QPKSNGTGSASIRAPGFGMSDAVTALGPRPMGW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g689 ### # start gene g690 7 AUGUSTUS gene 3381920 3384091 0.93 - . g690 7 AUGUSTUS transcript 3381920 3384091 0.93 - . g690.t1 7 AUGUSTUS stop_codon 3381920 3381922 . - 0 transcript_id "g690.t1"; gene_id "g690"; 7 AUGUSTUS CDS 3381920 3383490 0.98 - 2 transcript_id "g690.t1"; gene_id "g690"; 7 AUGUSTUS CDS 3383545 3384091 0.95 - 0 transcript_id "g690.t1"; gene_id "g690"; 7 AUGUSTUS start_codon 3384089 3384091 . - 0 transcript_id "g690.t1"; gene_id "g690"; # protein sequence = [MDVKTNVFCASGMHLPNGSYATFGGNGAITVGGNIGSNTTDGGSAASYDMTYQDYDGRKAIRILNPCTNDDDFTSEEC # QWFDNPDVLSMQKERWYSAAEPLGDGTIVLIGGFVNGGYINRNYPNTDPTYEGGAAEPTYEFYPANGTTATIMQFMVKTSGLNSYAHTYLMPSGKMLV # QANYSTMLWDPATNTETDLPDMPGEVVRVYPASGGVAMLPLTPANNYTPTVLFCGGSNMTDEMWGNYSWPVIDTFYYPASNDCQRLTPEPADGSTPAY # EQDDDMLEGRTMGQFIILPTGELLMVNGGENGTAGYSENTDTTLEYGQMPYGMSLAAAPVGKPALYNPNAPAGSRWSNDGFATSTIPRLYHSSAILLP # DASVMIAGSNPNVDVNLTTYFPTTYKAEIFYPPYFSSSNRPVPTGIPTTLSYGGAYFDISLPASSYTGSANDAAANTTVVVVRPGWTTHALNMGQRFL # QLNTTYTVNSNGTIVMHTSQMPPNANIFQPGPAMVFVVVNGIPSNGTFVIVGTGNIETQPTSSAALLPTNQLASTDTSGTGSGSNSSSSTDNSASSSH # TGAIVGGVVGALVIVGILGALIGICLSRRRRAANRAPNAYAMSDPKTPANAFNVNYGGAGAGAAAGAKEGLTADPYYRQDYNASSDWAQSNVALNAPT # SPYQDLPRRENGMSMDIDPYAAESRMSTSTPDGGRRQRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g690 ### # start gene g691 7 AUGUSTUS gene 3386340 3390971 1 + . g691 7 AUGUSTUS transcript 3386340 3390971 1 + . g691.t1 7 AUGUSTUS start_codon 3386340 3386342 . + 0 transcript_id "g691.t1"; gene_id "g691"; 7 AUGUSTUS CDS 3386340 3390971 1 + 0 transcript_id "g691.t1"; gene_id "g691"; 7 AUGUSTUS stop_codon 3390969 3390971 . + 0 transcript_id "g691.t1"; gene_id "g691"; # protein sequence = [MSLRTNPPRKADNRPTKPTAACAHREHIFDKDDVKDRYHDPDGSKYRVCKDQPCPNRYDKITTGYIPSFARLIDRKQE # DLILGRGAPPEQVASSSSQKPEGTPEAAPAPEPEYPVFPPPPSPVLDRPSSPISSLPRSSPPPPDPEDPDPGAEVSDPESDDDDDNMSKVFKAFDKVS # TLKSDGSNWDTWKNRVELATRSIGFSDHLTSNPKDNTEAWEAKKDNDGNLLNAIVGRLSDQIYRRYKNYENVFDLWKNLLSDFDSKSALTEAHLQQQL # HSMHCHEPSKVNEHLDKLLEIRDSLEARKITIPEEMFNNTIIASIPNIFKPTINALVVVAARTSVPLTTRELVSTIRAEASGHTRGQSGKKESANYAG # GNSNRGRGGFNRNRGNFRGQSRGRGNGNRGGGQSRPNSNNSTCYNCGGKGHFANKCSSPKRQQANEAQDSSQKKEKTQPSGSSSNSWRSKNKEVGSSA # TIEEVPESSWAAVEVTTTTSQEIFNFSEIASSYETAFIASHSSGAILFDSGCSSHMTPLQDKLRNTRSVPTRIIQAANAETFTSNTAGNLQIDLPINE # DGISKSLTLQNTLLCPNTPNTLVSLGKLDDAGYVMVIKDGTLKIINRQGETIGIVPKTNGLYQIPSAEYAYTGKAARMVSLYEAHCIAGHQNYAYVKH # MFKSNQVHGIKLDPKQMEEPECRTCMLAKAARFPISKIRTSPRAEKFGDVFHMDVWGPASVQTLNHYVYALTVIDEATSWLEEPLMKGKDEAFAQYVI # LQTGLQTQYGVTVKKLHSDRGGEFLSGEFTAYLERLGTKRSLTVHDTPEHNGIAERSHRTLLNGVRSLMISSGLPKWLWGFMMGYTVYVWNRTPKKAN # GMISPWEKRFGTIPDISNFHIFGSMVYVKREKEPGKLDPQAQEGRWVGIEPESNGYFIYWPDRHTVSTERNVQFSDRQIQPVEGEDQDLGNLETSITG # SEQPIIPVPEEIAEPINPDIITGKRVRKPTKKIQDIINGLGEPNRELRHLTASLGQVTGEIIADPTSVAEAMRRPDWSQWREAMNEEIRRLQQRGTYD # IVIPPDNANILTSKWVFRTKRDEQGKVTGHRARLVVRGFNQIPDVDYFPDETFASVTKLAAARAILSTGAEQNMFIHQMDVKSAYLYGKLDDNEQIYM # KAPPGVDIEVKAGQVLKLKLALYGLKQAGRRWYMRFREIMTSVGLTRSNFDHAVFYRTDPFCIIFIHVDDMTMLTKTMAVMDTLKKKIRDQIEVVDSG # EIHWLLGIEIRRSLHTRSIHLSQRAYIDAILSRYGFADVKPLSIPFDPHIHLTKDQMPTTVEDITYMRDKPYREAVGALQYLSVATRPDITYAVGILA # KFLQNPGITHWNAVKRVYAYLKYTRDLWLTFGGTQAEIEGYTDADGMSQEDRHAISGYVFMLNGGAVSWSSKRQDTISLSTTEAEYIALTHAAKEAIW # FRNLLSELFGPITKPIILNADNQSAIALAKDDRFHARTKHIDIRYHFIRYVIEEGKIRLVYCPTEDMTADIFTKALPSLKAKHFAASMGLTKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g691 ### # start gene g692 7 AUGUSTUS gene 3394882 3395313 0.7 + . g692 7 AUGUSTUS transcript 3394882 3395313 0.7 + . g692.t1 7 AUGUSTUS start_codon 3394882 3394884 . + 0 transcript_id "g692.t1"; gene_id "g692"; 7 AUGUSTUS CDS 3394882 3395313 0.7 + 0 transcript_id "g692.t1"; gene_id "g692"; 7 AUGUSTUS stop_codon 3395311 3395313 . + 0 transcript_id "g692.t1"; gene_id "g692"; # protein sequence = [MSATQTIHLYDRSVFSDEERAVLQVAENFLDGIGARNKTLMTEQVLPSGGAVLMRNGAPIITTLTGVIDRIPFDSPNK # IEERISGQPIVKIDTNIAMLWTPYDFLINDKVDHIGTDIWSFAKLNGKWVVSSVADNALAPETVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g692 ### # start gene g693 7 AUGUSTUS gene 3397093 3397599 0.5 + . g693 7 AUGUSTUS transcript 3397093 3397599 0.5 + . g693.t1 7 AUGUSTUS start_codon 3397093 3397095 . + 0 transcript_id "g693.t1"; gene_id "g693"; 7 AUGUSTUS CDS 3397093 3397117 0.54 + 0 transcript_id "g693.t1"; gene_id "g693"; 7 AUGUSTUS CDS 3397217 3397599 0.94 + 2 transcript_id "g693.t1"; gene_id "g693"; 7 AUGUSTUS stop_codon 3397597 3397599 . + 0 transcript_id "g693.t1"; gene_id "g693"; # protein sequence = [MLPLLIVNKPLKEVLTGRAFAGNGKEPSQEDLNRRAFAGNGKEPSPEDLNRRAFAGNGEEPSPEDLNRRSFAANGGEP # SPEDLSGRAFAGNGKEPSPEDLNRRAFAGNGEEPTQGDLNRRAFAGNGEEPTEEDLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g693 ### # start gene g694 7 AUGUSTUS gene 3398042 3398443 0.93 + . g694 7 AUGUSTUS transcript 3398042 3398443 0.93 + . g694.t1 7 AUGUSTUS start_codon 3398042 3398044 . + 0 transcript_id "g694.t1"; gene_id "g694"; 7 AUGUSTUS CDS 3398042 3398443 0.93 + 0 transcript_id "g694.t1"; gene_id "g694"; 7 AUGUSTUS stop_codon 3398441 3398443 . + 0 transcript_id "g694.t1"; gene_id "g694"; # protein sequence = [MTDRNFSSIPLLDYSLALSSSTKSQFITDLRHALINVGFLYLSNTDSMVDPQLIDTLKDYIPKLFALPQEEKDKIQMA # NSPHFLGYSRLGAELTKGKTDNREQFDIATEHVSRWKPGDPDFWNIWGPSQVRNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g694 ### # start gene g695 7 AUGUSTUS gene 3399977 3400786 0.84 - . g695 7 AUGUSTUS transcript 3399977 3400786 0.84 - . g695.t1 7 AUGUSTUS stop_codon 3399977 3399979 . - 0 transcript_id "g695.t1"; gene_id "g695"; 7 AUGUSTUS CDS 3399977 3400708 0.94 - 0 transcript_id "g695.t1"; gene_id "g695"; 7 AUGUSTUS CDS 3400763 3400786 0.84 - 0 transcript_id "g695.t1"; gene_id "g695"; 7 AUGUSTUS start_codon 3400784 3400786 . - 0 transcript_id "g695.t1"; gene_id "g695"; # protein sequence = [MNSGVQDAINLGWKLALVSKNLSPPSILTSYTAERVPVIATMLSKTTELFHKTFQPASPEKMAEGWRRGYELRMFGVN # YRKSGIILDEKYSYGADEAVDPYRSGDDGTVRAGDRAPDAPKLSPVGQTNATTYTTFLDLYNPAYHTILVFADPGRNREAIETILETIRGLPSSKDII # KTVVVLPQTSSSNDASTSSADMVLLDTEGYAYKHYDVAGDSQQPTVFIVRPDGFIGGLVFGVEGIKKYFGLILKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g695 ### # start gene g696 7 AUGUSTUS gene 3401345 3401698 0.8 - . g696 7 AUGUSTUS transcript 3401345 3401698 0.8 - . g696.t1 7 AUGUSTUS stop_codon 3401345 3401347 . - 0 transcript_id "g696.t1"; gene_id "g696"; 7 AUGUSTUS CDS 3401345 3401698 0.8 - 0 transcript_id "g696.t1"; gene_id "g696"; 7 AUGUSTUS start_codon 3401696 3401698 . - 0 transcript_id "g696.t1"; gene_id "g696"; # protein sequence = [MLMQERQEHLLRTRIEKDYGVTVELSTELSSFEEHEDHVIAHIVKHVPNAGENTEETVKVDFLVGADGGRSTVRKQLG # LPFMGDDSESLKEIGMVAGDIEALEGTLDQKVGPSVNSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g696 ### # start gene g697 7 AUGUSTUS gene 3402658 3403752 0.99 + . g697 7 AUGUSTUS transcript 3402658 3403752 0.99 + . g697.t1 7 AUGUSTUS start_codon 3402658 3402660 . + 0 transcript_id "g697.t1"; gene_id "g697"; 7 AUGUSTUS CDS 3402658 3403752 0.99 + 0 transcript_id "g697.t1"; gene_id "g697"; 7 AUGUSTUS stop_codon 3403750 3403752 . + 0 transcript_id "g697.t1"; gene_id "g697"; # protein sequence = [MSLRLPFTPTFPSFGAKTKKSSAEWLRRQSRDPYVKQRALGAVIASTKTSSILGNLGSNNDGISSSISSPLAFRSRSA # FKLIEIHEKYDQFLLKPDVQVVVDLGAAPGGWSQVVSQVVHGKDPTQVDAREDVDEVVEYPVDQGEEGTEDSDTKDTWHRKRKSKIKAKNRPKPLPPK # PLEFYDPLNFDAEIEHLSSSSLDLQSKVKIIAVDRLSMDPITGVQTLKADFLHPRTEGMIRSLIDGPSITPYKLTLSTPDTPKVDVVLSDIAPNTVGV # PAVDSEANFQVAQAVFQFAYKYLRTADEIGRTRGGVLVMKHFAHPKMDVFRKEVLEEYFKDVIYTKPRASRQESKEGYFLCRGFWPREYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g697 ### # start gene g698 7 AUGUSTUS gene 3406215 3407221 0.16 + . g698 7 AUGUSTUS transcript 3406215 3407221 0.16 + . g698.t1 7 AUGUSTUS start_codon 3406215 3406217 . + 0 transcript_id "g698.t1"; gene_id "g698"; 7 AUGUSTUS CDS 3406215 3406230 0.31 + 0 transcript_id "g698.t1"; gene_id "g698"; 7 AUGUSTUS CDS 3406321 3406669 0.3 + 2 transcript_id "g698.t1"; gene_id "g698"; 7 AUGUSTUS CDS 3406781 3406823 0.59 + 1 transcript_id "g698.t1"; gene_id "g698"; 7 AUGUSTUS CDS 3406979 3407221 0.57 + 0 transcript_id "g698.t1"; gene_id "g698"; 7 AUGUSTUS stop_codon 3407219 3407221 . + 0 transcript_id "g698.t1"; gene_id "g698"; # protein sequence = [MPGEARGTKQIVIPSDFVDGGDAHRWSTVVGNSVGYAMSQVAPCAKPATACDAGGTTQILIPSDFVDGGKACRWLTVV # GNGVGYAMSQVAHCAKPATACDAGGTKQILIPSDFVDGGEACRCDFVDGGEAHRWLTVDGGEACRWSTVVGNSVEYAMSQVAHGAMPVTACDAGGTTQ # IVILSDFVDGGEARRWSTVVRNRVGYAMSQVAHCAKPATA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g698 ### # start gene g699 7 AUGUSTUS gene 3412228 3413705 0.62 - . g699 7 AUGUSTUS transcript 3412228 3413705 0.62 - . g699.t1 7 AUGUSTUS stop_codon 3412228 3412230 . - 0 transcript_id "g699.t1"; gene_id "g699"; 7 AUGUSTUS CDS 3412228 3413228 0.95 - 2 transcript_id "g699.t1"; gene_id "g699"; 7 AUGUSTUS CDS 3413285 3413705 0.62 - 0 transcript_id "g699.t1"; gene_id "g699"; 7 AUGUSTUS start_codon 3413703 3413705 . - 0 transcript_id "g699.t1"; gene_id "g699"; # protein sequence = [MSQKDRDRLKNIAANLHSTTGPPATASASDQISPPAPAPTATTPRIPRTDPQIARAALTGFKPFPSDPVKQARYTAYL # QSQADTSSTIMLEPLPHQSIPEFNSEMEEYAQSAIVFKPVSGAMAGRFTSAAVVEHGPKVIEAEEKELSPKENAARMGMYGHLTRETVPWQPARLLCK # RFGVKDPNPEPKTEDPTQSSVPDFQDPSAFDPSVPSGTAAADYGIVSINNNNTGASTSGPRDLANVGLGDEDDTQGRDTLTYERPSVDVFKAIFASDD # EDSSDEEGGDEGDERDKGPNDIETSGPISETTMSTKISPLASIPVVVDDRPVDPNTFKPTFVRREARTTNTDSDKQEKKERKEKKKKEKRKAIVSFMD # DEAGDTLNVVVEKPKKKRKKDKEKDREKDKETGGLKLKGVEKEVKSKRRNAVDENEDDMWVEKPAPPAVTVASDVEMADTSTALSVGSEVPRGRKRAI # DFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g699 ### # start gene g700 7 AUGUSTUS gene 3414189 3414770 0.27 - . g700 7 AUGUSTUS transcript 3414189 3414770 0.27 - . g700.t1 7 AUGUSTUS stop_codon 3414189 3414191 . - 0 transcript_id "g700.t1"; gene_id "g700"; 7 AUGUSTUS CDS 3414189 3414770 0.27 - 0 transcript_id "g700.t1"; gene_id "g700"; 7 AUGUSTUS start_codon 3414768 3414770 . - 0 transcript_id "g700.t1"; gene_id "g700"; # protein sequence = [MLPPSKDSVGARILKKMGWRVGQGIGPRISLKQRRLQDLQASTGSAFSVDTSKTMPDEDAEEASKHTYAPRDTPVLVV # ERKDNSHGLGYRPGMSLNDSLGVKGSGGSSTGPNISCKCLSNMQFDRQGLMRVFCSKAGFGLGALNDADEDDLDVYDGSSANVRNRLAYDASDDPERD # RTFLSGSKSKLVGNSHF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g700 ### # start gene g701 7 AUGUSTUS gene 3417105 3417332 0.58 + . g701 7 AUGUSTUS transcript 3417105 3417332 0.58 + . g701.t1 7 AUGUSTUS start_codon 3417105 3417107 . + 0 transcript_id "g701.t1"; gene_id "g701"; 7 AUGUSTUS CDS 3417105 3417332 0.58 + 0 transcript_id "g701.t1"; gene_id "g701"; 7 AUGUSTUS stop_codon 3417330 3417332 . + 0 transcript_id "g701.t1"; gene_id "g701"; # protein sequence = [MSFLLTSGAADQAKAWETLAQAQKSSIKSAYQKAGIKLIVSAFGSTDLPTSSDAKSTAATMAKWVQDNNVDGIGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g701 ### # start gene g702 7 AUGUSTUS gene 3436287 3436592 0.39 + . g702 7 AUGUSTUS transcript 3436287 3436592 0.39 + . g702.t1 7 AUGUSTUS start_codon 3436287 3436289 . + 0 transcript_id "g702.t1"; gene_id "g702"; 7 AUGUSTUS CDS 3436287 3436592 0.39 + 0 transcript_id "g702.t1"; gene_id "g702"; 7 AUGUSTUS stop_codon 3436590 3436592 . + 0 transcript_id "g702.t1"; gene_id "g702"; # protein sequence = [MVRVLLLGGHGKVALHMTKLLAAHNHKISSVIRNPDHAIEISDQYPENPSLIEPVVASIEETDEEGAKELMKGVEWVI # WSAGKPQNPDASNLNAYICYRLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g702 ### # start gene g703 7 AUGUSTUS gene 3436700 3437104 0.35 + . g703 7 AUGUSTUS transcript 3436700 3437104 0.35 + . g703.t1 7 AUGUSTUS start_codon 3436700 3436702 . + 0 transcript_id "g703.t1"; gene_id "g703"; 7 AUGUSTUS CDS 3436700 3437104 0.35 + 0 transcript_id "g703.t1"; gene_id "g703"; 7 AUGUSTUS stop_codon 3437102 3437104 . + 0 transcript_id "g703.t1"; gene_id "g703"; # protein sequence = [MVSASSSRRSPASYWTDSDRVAFKKTWDSIGVYSEAKTVADEYLYHESRKSSKPIWVDICLRPGSLSDSHGTGKVDLG # KAKLVGSVPREDVAAVAVELLEKETGGGLWVDLIGGSEPISSAVERVVSQRITSRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g703 ### # start gene g704 7 AUGUSTUS gene 3439927 3440373 0.86 + . g704 7 AUGUSTUS transcript 3439927 3440373 0.86 + . g704.t1 7 AUGUSTUS start_codon 3439927 3439929 . + 0 transcript_id "g704.t1"; gene_id "g704"; 7 AUGUSTUS CDS 3439927 3440373 0.86 + 0 transcript_id "g704.t1"; gene_id "g704"; 7 AUGUSTUS stop_codon 3440371 3440373 . + 0 transcript_id "g704.t1"; gene_id "g704"; # protein sequence = [MVYRFPLPFAKTLVPFDEHGKESLAAKAVVDMIMQQVAGELHLPMSSKGTGTGSAQLPEIVIDNACSSSLKGYTPSKT # FEFEITNEDGTGCCRGGCTCFVRPALKKPGVYEVGITDIWADKYVIGRSLTMDPEALQALNTTFPFRWPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g704 ### # start gene g705 7 AUGUSTUS gene 3445756 3446757 0.45 + . g705 7 AUGUSTUS transcript 3445756 3446757 0.45 + . g705.t1 7 AUGUSTUS start_codon 3445756 3445758 . + 0 transcript_id "g705.t1"; gene_id "g705"; 7 AUGUSTUS CDS 3445756 3446757 0.45 + 0 transcript_id "g705.t1"; gene_id "g705"; 7 AUGUSTUS stop_codon 3446755 3446757 . + 0 transcript_id "g705.t1"; gene_id "g705"; # protein sequence = [MPLSRSLLGCSDPSVSLDHFDPTAPTRHLFTQFNFLRSTYTALQDGFTLTQLGNWTYEIQRPGSGGVSTEMGLWSISR # EGMQNVQVLNGTHNGTVWMFMTNENVTKSYDFNCSTNPDWIKAPYPVEPGNSTGAVVRNLLYPFENYTLQASLSPYFNDGNAPYFGCLESITMDPYGF # KVLVVDSDWVGAPPVLTLFTPGHDARLLSASSGSNGLDNVDISLGFNLDMDCDSVTNSITLNMSTSGHGSAPSIGNVSCLSVSPLNSTGLSGVPQTAW # VWNATLTNFPDGLLTITVANPTSAVGVETGVSSLRSQPTSKKFHSQFLFTYIGNRPSHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g705 ### # start gene g706 7 AUGUSTUS gene 3447087 3448757 0.38 + . g706 7 AUGUSTUS transcript 3447087 3448757 0.38 + . g706.t1 7 AUGUSTUS start_codon 3447087 3447089 . + 0 transcript_id "g706.t1"; gene_id "g706"; 7 AUGUSTUS CDS 3447087 3448757 0.38 + 0 transcript_id "g706.t1"; gene_id "g706"; 7 AUGUSTUS stop_codon 3448755 3448757 . + 0 transcript_id "g706.t1"; gene_id "g706"; # protein sequence = [MTTENVVQADAGGYTGPPRRVPQFLARGDFNEWGNNQGVDSQFTLNTASSSSLSTGSSGNLWELKIMAAWPTFVQLNV # WGFDVADYYYGDTDGDGVLDRLPPNTEAPNYVNMSAPPYPYLSWSILVDDTTMRWTLQPRGRSAISMVVYSLLVSVPLITATLAVLIFMIAFYGVEHN # KYGVALKSKYLPVFWDRKAQTVTDLNSELGLVDEKLNAAHDKKGKHLAIGWPEDTNKTRRTVLIATLEYEIIDWKLKVKIGGLGVMSSLMGKAMTDVD # LIWVVPKVKDLEYPAGDPDDPIEVVIFNETYLVDVEVHVFDHITYVIIDSPVFRAQTKADPYPSRMDDLSSAIFYSTWNQAIAATIRRYPHIDIYHIN # DYHGALAPIYLLPKVFPVCLSLHNAEFQGLWPLRTKEEMREVCSAFNISKKHCVKYVQFGNTFNLLHAAAEFVSLHQKSVGVAGVSDKYGKRSWARYP # ALWTLKHVDSLPNPDPTDIAALDEKPIKSKGVKVDRIAEKARPESKRQAQEWAGIEQNPNSNLFVFVGRWSKQKGVDLIADVMPGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g706 ### # start gene g707 7 AUGUSTUS gene 3449208 3449945 0.15 + . g707 7 AUGUSTUS transcript 3449208 3449945 0.15 + . g707.t1 7 AUGUSTUS start_codon 3449208 3449210 . + 0 transcript_id "g707.t1"; gene_id "g707"; 7 AUGUSTUS CDS 3449208 3449254 0.39 + 0 transcript_id "g707.t1"; gene_id "g707"; 7 AUGUSTUS CDS 3449348 3449945 0.2 + 1 transcript_id "g707.t1"; gene_id "g707"; 7 AUGUSTUS stop_codon 3449943 3449945 . + 0 transcript_id "g707.t1"; gene_id "g707"; # protein sequence = [MALKSTEEERAFLRARANAWRPSDGYAFYEAANDPNEWDPELEVYHTGPRSGISSRNSSARVSVEALVPIANTNEPLH # LHPPSESHQDSESNRNSYISDPGDEIHAALDGVSEAQQSTDYENFLERVNRMVARDRRRVPDPFLDGSSTRIRLGGHSRTESSESIASIVETKSDSPL # NKAIASVGSTSVTIGMTLTIVNSSLMPTVGLLQNLSLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g707 ### # start gene g708 7 AUGUSTUS gene 3455208 3456530 0.3 - . g708 7 AUGUSTUS transcript 3455208 3456530 0.3 - . g708.t1 7 AUGUSTUS stop_codon 3455208 3455210 . - 0 transcript_id "g708.t1"; gene_id "g708"; 7 AUGUSTUS CDS 3455208 3455441 0.8 - 0 transcript_id "g708.t1"; gene_id "g708"; 7 AUGUSTUS CDS 3455527 3455664 0.7 - 0 transcript_id "g708.t1"; gene_id "g708"; 7 AUGUSTUS CDS 3455721 3456530 0.34 - 0 transcript_id "g708.t1"; gene_id "g708"; 7 AUGUSTUS start_codon 3456528 3456530 . - 0 transcript_id "g708.t1"; gene_id "g708"; # protein sequence = [MTKARAKDDITKYFVNRRPIPLDLLTLVNFTDPPTQRGAGLLRNLRGGERHNTSDTSPSPLTTSSSTGASGLSSSTST # AGPGTSAPPPGDTSRTDSRSVYPCTIHHNGRMGGNYILYAESASARSEWKEKLEEAVGLRKVVQESNKVFEIETLSSDTFLVPSMGLGADRGERGAAG # GGLGPSYENAFTGKVTCSVPFNTPDGRGLVAIGCAEGVWIGFRHDSRCKSLSILHPATTFLIDHTAMRRVLHLKMVTQCAMLEDFGIFLVLADKSLFA # YHIEALVPSSPSSSHSSQTPQKLSGNKDVYFFSVGTLHGRTLLDSIFHVVEPVVERINERSKAPQGLMGSRFGFRQAKSDWFRAYREFFLPSESYDLI # FLKVKIAILCAKGFEIMDLME] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g708 ### # start gene g709 7 AUGUSTUS gene 3459843 3461225 0.99 - . g709 7 AUGUSTUS transcript 3459843 3461225 0.99 - . g709.t1 7 AUGUSTUS stop_codon 3459843 3459845 . - 0 transcript_id "g709.t1"; gene_id "g709"; 7 AUGUSTUS CDS 3459843 3461225 0.99 - 0 transcript_id "g709.t1"; gene_id "g709"; 7 AUGUSTUS start_codon 3461223 3461225 . - 0 transcript_id "g709.t1"; gene_id "g709"; # protein sequence = [MSNNQVYADYSDYAAYASYTDEIPEYSPNPTPTSVLISNASISNTPTPPYTSPPPPPPPPPSASLISTLPEFSEGRTD # DELETLYDKVWTGYGAGELRNFENGAGIEGSGYGDGYGAGPSSPTNRNSSYLASPTSTTSYSSANSISMATNGSATPSSVPRPPSLPGSSLAYPPTPR # SSRPLPLPPGAHGPPSATIPPSLSSASVPAHSAAASIFRNSVASGSDGRSTPTLDSPLSARGRQLPTAPGASNATSPASSNISPAGYFESVPGVPSNA # GGLVPPPPPPLGLGSGLGLSSGSPLSAGLNSAEIEFSSAGLDSGSAAIYSSGYASSEDPYGTGGNHTPVAGGSSSATLRHNYIDEHSWEDGIHAGPSH # LGFASPQSYEQYEQFTSPHTYDEYIDDDASSSSSSFASRYVNFSLLSHIAVQLKDKVPRGTHVKGSIPYPGGFTGKDIVVSITGTVYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g709 ### # start gene g710 7 AUGUSTUS gene 3463591 3463851 0.62 + . g710 7 AUGUSTUS transcript 3463591 3463851 0.62 + . g710.t1 7 AUGUSTUS start_codon 3463591 3463593 . + 0 transcript_id "g710.t1"; gene_id "g710"; 7 AUGUSTUS CDS 3463591 3463851 0.62 + 0 transcript_id "g710.t1"; gene_id "g710"; 7 AUGUSTUS stop_codon 3463849 3463851 . + 0 transcript_id "g710.t1"; gene_id "g710"; # protein sequence = [MNAYSHVMAIDRHREYVSCGGVDDSETVSSPLNYVDDEEWYFRSTVEPAYTVEGTTVRNWDYSSCYIACEQGKSGVVP # PISDLPDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g710 ### # start gene g711 7 AUGUSTUS gene 3470004 3471398 0.73 - . g711 7 AUGUSTUS transcript 3470004 3471398 0.73 - . g711.t1 7 AUGUSTUS stop_codon 3470004 3470006 . - 0 transcript_id "g711.t1"; gene_id "g711"; 7 AUGUSTUS CDS 3470004 3471398 0.73 - 0 transcript_id "g711.t1"; gene_id "g711"; 7 AUGUSTUS start_codon 3471396 3471398 . - 0 transcript_id "g711.t1"; gene_id "g711"; # protein sequence = [MRISLTVFIHVYWLAQGSALQGILFNSTKVVSEVSNILQALTTLITDERLGLRFSPFSFMDGAHTTNFLQLYIGIIEY # LKHIHPSLAFVHFLGSTSFEDFEYSQNKSLDVFRAAIAFPMSMDSMDSDGTRFISSASYSPDAFKLESTRTGELISFSLPSIANPDIVSLLRQGLPLQ # NLPRVTQRLSDILTSFKEGKEYVFYWDSLQREQVLQAMQCLGQYLGQFEPALSYEGTDKRVVWRKSCWFASEGIAYPLLDTEHEISKFDGDLKDGLSG # LVALRNSDVRASLEYLKRVLDSTLVSCCHAIGLSKDLIQRCTVRYRIIKYVAHAGNPGGIGLHPDGNLLSALITDGPGLGVYDFDGTYREPGVGGTIL # MGGSTLYRWSKGTYLPTFHDVSIGQEQKKTSIVAFFNLPDMEDIPQSAGPDTEKNSFFHDIRVIKEDDKSPAGELAPLWKTIIQRHNLILPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g711 ### # start gene g712 7 AUGUSTUS gene 3477828 3478408 0.42 - . g712 7 AUGUSTUS transcript 3477828 3478408 0.42 - . g712.t1 7 AUGUSTUS stop_codon 3477828 3477830 . - 0 transcript_id "g712.t1"; gene_id "g712"; 7 AUGUSTUS CDS 3477828 3478153 0.42 - 2 transcript_id "g712.t1"; gene_id "g712"; 7 AUGUSTUS CDS 3478240 3478408 0.42 - 0 transcript_id "g712.t1"; gene_id "g712"; 7 AUGUSTUS start_codon 3478406 3478408 . - 0 transcript_id "g712.t1"; gene_id "g712"; # protein sequence = [MAWCYLVSSPVPEALDSAGQSLGQSRVRKVDLKVQGHDQGWGKLSFPVTVILYMLRFWLPAALNGPVDPASVLAGSSF # DQTFEGFTRWHIAANAIATQVKQVHSVVWTEQEAQTPGNVKGLRGRESLGHELVRALQPGDRIAILALAEVRVKRSLADVAGAYMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g712 ### # start gene g713 7 AUGUSTUS gene 3483106 3484310 0.16 - . g713 7 AUGUSTUS transcript 3483106 3484310 0.16 - . g713.t1 7 AUGUSTUS stop_codon 3483106 3483108 . - 0 transcript_id "g713.t1"; gene_id "g713"; 7 AUGUSTUS CDS 3483106 3483712 0.35 - 1 transcript_id "g713.t1"; gene_id "g713"; 7 AUGUSTUS CDS 3483768 3483886 0.19 - 0 transcript_id "g713.t1"; gene_id "g713"; 7 AUGUSTUS CDS 3484020 3484310 0.32 - 0 transcript_id "g713.t1"; gene_id "g713"; 7 AUGUSTUS start_codon 3484308 3484310 . - 0 transcript_id "g713.t1"; gene_id "g713"; # protein sequence = [MPISVLPTPPNFPPSKPPSKPTRGPVKTNYEPPNGSSAVDPTSSSSATESIALLKQEAQLSVQASAKGASAMALLRNT # RNQYLLATNCETQVCSNQLNALKRELKDFMEKDSNVWSRLKAVEAKLRMSEESMATSSLTSPSEGNSVSQKSGGSIADRKKALQNSGLSISTSNKRSS # KDLHVNGTPISAAFSGANGVSPPSPNTSASSTISSSSGSTAAALSTLTGLTAPSTVPGSSTSNPIHSSSSTSSSSSSTSTSNTASSFTSTSASFGSSP # ASASTSSISASNSSIYSHAFVSPSTFGPPSPGSSPSSSPTLPTRSFSTSSEYNASMPNFRVSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g713 ### # start gene g714 7 AUGUSTUS gene 3486016 3486309 0.51 + . g714 7 AUGUSTUS transcript 3486016 3486309 0.51 + . g714.t1 7 AUGUSTUS start_codon 3486016 3486018 . + 0 transcript_id "g714.t1"; gene_id "g714"; 7 AUGUSTUS CDS 3486016 3486309 0.51 + 0 transcript_id "g714.t1"; gene_id "g714"; 7 AUGUSTUS stop_codon 3486307 3486309 . + 0 transcript_id "g714.t1"; gene_id "g714"; # protein sequence = [MSQQKALLLEKAKGAFVVSTVPISKPGPGQISIKVIAAALNPVDWKIQAWDFFMKKYPAILGTDIAGDVEEIGEGVEG # FSKGDKVYVLIPRLRTFRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g714 ### # start gene g715 7 AUGUSTUS gene 3497264 3498292 0.33 + . g715 7 AUGUSTUS transcript 3497264 3498292 0.33 + . g715.t1 7 AUGUSTUS start_codon 3497264 3497266 . + 0 transcript_id "g715.t1"; gene_id "g715"; 7 AUGUSTUS CDS 3497264 3497669 0.36 + 0 transcript_id "g715.t1"; gene_id "g715"; 7 AUGUSTUS CDS 3497736 3498292 0.62 + 2 transcript_id "g715.t1"; gene_id "g715"; 7 AUGUSTUS stop_codon 3498290 3498292 . + 0 transcript_id "g715.t1"; gene_id "g715"; # protein sequence = [MGGFALFDGSDFNCILRCSGDPRPPDDSLESYIDLISLFKAEEIQDRSHSDALAKFLAIGQTGWFVVQLVARRVENLS # ITVLEIMTVAFAAMNVMIYIFWWNKPQGVRYPIHIQNQNRNNNLDDVKTSPTPEPQPEWLLNIITNDLIWFNVKFESAGMPLKIFLCVAFPAIKFFVI # VINVVFDEDPEVDPLDKISSFERVVKLEPSWHQDKVIAYSAAMIFGAIHCAAWAFIFPTQVEQTLWRIFSLIVTFVPLALICTDLWKDKLDGHIENIV # SIILCFVVFFYVLARLGLIVQAFLALRSLPTNSFAIVEWVNFLPHI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g715 ### # start gene g716 7 AUGUSTUS gene 3502878 3503321 0.15 + . g716 7 AUGUSTUS transcript 3502878 3503321 0.15 + . g716.t1 7 AUGUSTUS start_codon 3502878 3502880 . + 0 transcript_id "g716.t1"; gene_id "g716"; 7 AUGUSTUS CDS 3502878 3503321 0.15 + 0 transcript_id "g716.t1"; gene_id "g716"; 7 AUGUSTUS stop_codon 3503319 3503321 . + 0 transcript_id "g716.t1"; gene_id "g716"; # protein sequence = [MLVKEGKINIVAPARVASYSSDGESVILNNGGKLKADTVVLATGYTSSWHPLFDGTFLIVVTSIFVPFTNVQAEQTAA # GLGINRHPPDPTLVKIEDEWNNYISLSNPPAAHPSSEQWASSIYRGIVPAKNLFNRDFAINGAVVCQFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g716 ### # start gene g717 7 AUGUSTUS gene 3509395 3510078 0.99 - . g717 7 AUGUSTUS transcript 3509395 3510078 0.99 - . g717.t1 7 AUGUSTUS stop_codon 3509395 3509397 . - 0 transcript_id "g717.t1"; gene_id "g717"; 7 AUGUSTUS CDS 3509395 3510078 0.99 - 0 transcript_id "g717.t1"; gene_id "g717"; 7 AUGUSTUS start_codon 3510076 3510078 . - 0 transcript_id "g717.t1"; gene_id "g717"; # protein sequence = [MTFEEGEPHRTRKREAEEDDAEDVLPDGNIRPGNPGINNNAGSSPEDPEPSGDDPDNLAPTSDIPTIPANPTVPTRRS # ERGHVPSRRFIESEEYEGREEAARRNGEQWSTDQLANEPSPLALISQNRYAFAATSGELWVPQTYKQAMRRPDLWFTPMEREFNMLLDKDCWELVLLP # ADANLTGGRWTYAIKFDAQGNILKHKARYVAQGYTQIQGQDYDKTYGGEDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g717 ### # start gene g718 7 AUGUSTUS gene 3517904 3518392 0.86 - . g718 7 AUGUSTUS transcript 3517904 3518392 0.86 - . g718.t1 7 AUGUSTUS stop_codon 3517904 3517906 . - 0 transcript_id "g718.t1"; gene_id "g718"; 7 AUGUSTUS CDS 3517904 3518392 0.86 - 0 transcript_id "g718.t1"; gene_id "g718"; 7 AUGUSTUS start_codon 3518390 3518392 . - 0 transcript_id "g718.t1"; gene_id "g718"; # protein sequence = [MQDWEQQDQDLKECEIALKERELSLYQREVLLWESEADLARRERQDADALYERWKRAGDYHITAIESEKRMRAEIKDK # RKRLEKYEKEVVRREKNAKKLEEFNDLNSLEAHHKLASLQQQLDKAEKANADLLAFCETVGRMLSTVPACEPGQMLRAAEKLVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g718 ### # start gene g719 7 AUGUSTUS gene 3518882 3520722 0.75 - . g719 7 AUGUSTUS transcript 3518882 3520722 0.75 - . g719.t1 7 AUGUSTUS stop_codon 3518882 3518884 . - 0 transcript_id "g719.t1"; gene_id "g719"; 7 AUGUSTUS CDS 3518882 3519240 0.87 - 2 transcript_id "g719.t1"; gene_id "g719"; 7 AUGUSTUS CDS 3519291 3520722 0.77 - 0 transcript_id "g719.t1"; gene_id "g719"; 7 AUGUSTUS start_codon 3520720 3520722 . - 0 transcript_id "g719.t1"; gene_id "g719"; # protein sequence = [MTSGDGLQRRCHPILAAFVGDYPEQILATTAYSGDCASCDAEKKDLGIYPCIHPYRDIEAVLEAIHTSTPDLWVEKCL # ECNVKLIQHPFWEDLPYTNIFTSITPDILHQLYQGVMKHLISWVTDICGADEIDARVRRLPPNHTIRTFHKGISTLSRVSGTEHKQMCSFILGVVTDI # PHLSIHQSGTLLAATQALLDFLYLSCYPIHTTESLSQIDEALAQFHAHRGVFVELGVRKHFNIPKLHFLCHYSCSITYYETTDNYNTDTTERLHIDYA # KDAYRASNRKDEYIQMTHWLERREKIMHHTNYISWRLSQVLNSPSSERSSHPTPITLSSDFGKQYDFPGAQRTLVDMKCIYTQKLTRFSSMRRVPLSR # LEDTCSNGYCAVQFMHVLKQFLVQYRYPNIPINQIDEWARFVVLPFSLLPVWHKLKFINTELFSKKTLDSFSAHPSSSKRSNKSIKPSRFDTVLVRLK # QGNDWTKDMRVGRVRVIFSLPSDKLDTLVPSDIPPPQHLAYIEWFTKFVAHPEPYSGLYRVRRDVGADGLCTASIIALDSIVCSAHLFPQWGGSVPPE # WTSETILDHASSFLLNIFKDEHAYFNLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g719 ### # start gene g720 7 AUGUSTUS gene 3521396 3522019 1 - . g720 7 AUGUSTUS transcript 3521396 3522019 1 - . g720.t1 7 AUGUSTUS stop_codon 3521396 3521398 . - 0 transcript_id "g720.t1"; gene_id "g720"; 7 AUGUSTUS CDS 3521396 3522019 1 - 0 transcript_id "g720.t1"; gene_id "g720"; 7 AUGUSTUS start_codon 3522017 3522019 . - 0 transcript_id "g720.t1"; gene_id "g720"; # protein sequence = [MPATVDDGPARLIEQPVYKPDQVPPMRFVGDFFGQDYTTEDFPGLEDVEDNSDDDEGNDDDESDDDEGKVVTTELQWE # PERQVQTCQSHDDMVIDPPITNAPHTSNPLLRSLPSHWDGIHIQRFGGQAGAPLPTSQPHYLSSQKSDPGFQQYQSSIVDSESNIWAPFTSKTDWEMA # RWAKIRGSGSTAFSELLLIDGVRAITHIWDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g720 ### # start gene g721 7 AUGUSTUS gene 3522762 3523244 0.91 + . g721 7 AUGUSTUS transcript 3522762 3523244 0.91 + . g721.t1 7 AUGUSTUS start_codon 3522762 3522764 . + 0 transcript_id "g721.t1"; gene_id "g721"; 7 AUGUSTUS CDS 3522762 3522876 0.96 + 0 transcript_id "g721.t1"; gene_id "g721"; 7 AUGUSTUS CDS 3523039 3523244 0.94 + 2 transcript_id "g721.t1"; gene_id "g721"; 7 AUGUSTUS stop_codon 3523242 3523244 . + 0 transcript_id "g721.t1"; gene_id "g721"; # protein sequence = [MARTPSTAIGQASVAMVESHTLEPAIPTTTIKIPSLARNNSSSKRLQAQQEFEDAQENDSDSDSESDMIEDIEDIKML # NQEFERENDSGSAAKYYAEEVRFHSGSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g721 ### # start gene g722 7 AUGUSTUS gene 3524356 3525041 0.32 + . g722 7 AUGUSTUS transcript 3524356 3525041 0.32 + . g722.t1 7 AUGUSTUS start_codon 3524356 3524358 . + 0 transcript_id "g722.t1"; gene_id "g722"; 7 AUGUSTUS CDS 3524356 3524451 0.53 + 0 transcript_id "g722.t1"; gene_id "g722"; 7 AUGUSTUS CDS 3524529 3524667 0.33 + 0 transcript_id "g722.t1"; gene_id "g722"; 7 AUGUSTUS CDS 3524791 3525041 0.51 + 2 transcript_id "g722.t1"; gene_id "g722"; 7 AUGUSTUS stop_codon 3525039 3525041 . + 0 transcript_id "g722.t1"; gene_id "g722"; # protein sequence = [MSKKAKIFKSSLPQKPLELELPKAMVAMAACVSIEENFPPTGLNSLWTTFIAVLTNLETASRVNYHKLMHKLYLKSLY # ANGNDDDSSLSESDLDQRASQDAQRATTAFSSVDGNATLDSPGSSNGDGPSDDRPGNDGDGSGDNGDGSGGNGDGSASDVHDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g722 ### # start gene g723 7 AUGUSTUS gene 3531265 3533115 0.6 - . g723 7 AUGUSTUS transcript 3531265 3533115 0.6 - . g723.t1 7 AUGUSTUS stop_codon 3531265 3531267 . - 0 transcript_id "g723.t1"; gene_id "g723"; 7 AUGUSTUS CDS 3531265 3533115 0.6 - 0 transcript_id "g723.t1"; gene_id "g723"; 7 AUGUSTUS start_codon 3533113 3533115 . - 0 transcript_id "g723.t1"; gene_id "g723"; # protein sequence = [MLKPLLDIPFLSRLSTESLTRTIQLFKEGISSKNATEGPSIQELFLKINRFHISLERSPLDMRTMKAAIDVWPSINLL # LKSSKVYDASARILHHTIMLSHYRLYTWVSDSIEHVLDHPSSHWWYCLIKAVGEVVERGVYGTFDFDSSNFLPMIEPPRTYSWNFQRKKHDQRTANVL # LSSRIIFHWLDLPLESDDKHNVQSLFLKSLMDSCGTASILLLDEVWTAYSAPRDLCSARSKQAYPSRIAMKKLAQMFLDHPILGCNRSLEIQQLIGML # QAAHSQFIGLPASHNSPSSAIFAESLSTLSLPQPTLSNNTPLKVSLPISSMPISENDRVIFFRDWLLEIAEAYTQSPPLPMDQLNPEQRRVRENSDSS # CPFRELAYSRRRVSGPNGLFAHHTRAGTFSALLFRGILFNTEALRETGHTGFFESFEAWSQFKAQYADRGEKYICNSCAYGTTRGRTSSNDKYFWIAS # EVLHQKLQDPNISFTSIWQFIVNTKDNKKNKLFRSFGDLSAYLLTVDLTYARRIPWPHLDEVAQAVSVLAKGALHGLQKMNLVPTNAYTEDEVKEGFK # ALYRLLDGDSKFKTVKGAVVFDPFMVEHALCKISKDRVYERANRNVGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g723 ### # start gene g724 7 AUGUSTUS gene 3538916 3539356 0.6 - . g724 7 AUGUSTUS transcript 3538916 3539356 0.6 - . g724.t1 7 AUGUSTUS stop_codon 3538916 3538918 . - 0 transcript_id "g724.t1"; gene_id "g724"; 7 AUGUSTUS CDS 3538916 3539356 0.6 - 0 transcript_id "g724.t1"; gene_id "g724"; 7 AUGUSTUS start_codon 3539354 3539356 . - 0 transcript_id "g724.t1"; gene_id "g724"; # protein sequence = [MLDRKLTMAYVASRIAESFKSDLFIIWSEDNAEKLVIRCRVLGGADKDEDGTEMLEEDIFLRQLENTMLNSVSLRGVQ # GINRVFLTRHDLVETKDDGSIVAEKDKQWVLVGVNLKTAMCIDGVDFTLTYSNSCVEVFNVLGIEAAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g724 ### # start gene g725 7 AUGUSTUS gene 3540556 3541416 1 + . g725 7 AUGUSTUS transcript 3540556 3541416 1 + . g725.t1 7 AUGUSTUS start_codon 3540556 3540558 . + 0 transcript_id "g725.t1"; gene_id "g725"; 7 AUGUSTUS CDS 3540556 3541416 1 + 0 transcript_id "g725.t1"; gene_id "g725"; 7 AUGUSTUS stop_codon 3541414 3541416 . + 0 transcript_id "g725.t1"; gene_id "g725"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNPAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERVQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEV # LGDGLEFSDLRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g725 ### # start gene g726 7 AUGUSTUS gene 3542155 3543861 0.42 + . g726 7 AUGUSTUS transcript 3542155 3543861 0.42 + . g726.t1 7 AUGUSTUS start_codon 3542155 3542157 . + 0 transcript_id "g726.t1"; gene_id "g726"; 7 AUGUSTUS CDS 3542155 3543861 0.42 + 0 transcript_id "g726.t1"; gene_id "g726"; 7 AUGUSTUS stop_codon 3543859 3543861 . + 0 transcript_id "g726.t1"; gene_id "g726"; # protein sequence = [MVQCEPESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRSIEVPEFFNPGNTATRSPQLRSGTSPTVHALAQNSTPPP # RVNLQTKPVTPVSTQRYQFGEVRMDGAQHSSWIYGQDLTARLVPNPVHVPPRLSNPSVIPYQGSVSMQSHAVGAESQRDPNQRRTLVVHEEAVPPQGA # PLGTPFVTGAQMNRPGMVVDSAHSQESVAMIQQQARVIETLQEQLREVKKGFTAGEVPTGGPPSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSW # QATEPISFNRNTLTGAKDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGEGKGGFNPPPRVPPPHFSSQSRDREQPPS # QGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEDSDEGEQNQSGRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNE # GRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g726 ### # start gene g727 7 AUGUSTUS gene 3545070 3548159 0.45 + . g727 7 AUGUSTUS transcript 3545070 3548159 0.45 + . g727.t1 7 AUGUSTUS start_codon 3545070 3545072 . + 0 transcript_id "g727.t1"; gene_id "g727"; 7 AUGUSTUS CDS 3545070 3548159 0.45 + 0 transcript_id "g727.t1"; gene_id "g727"; 7 AUGUSTUS stop_codon 3548157 3548159 . + 0 transcript_id "g727.t1"; gene_id "g727"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGDTEELGRGVNGEEIHTGTLQSPPEAPQQPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFANESTEEEVEEILEAGRSTMEEVTPNPAKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREQGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPAIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEDSPTEEMLRASDSSA # TEGVQQPKDPESADPSSEQGGVVRELDKEESRRQETEELKKSIPVQYQDYLDMFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKE # YIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLQKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTQYGS # FEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEVSHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEK # VKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILS # QLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLG # AKPDALTRRSDVYPKKGASRDQALAGRERVLIPPECLNATILMNEDLLVNRVREAPKDTSTIEVLKRIARNEEESLVWEDGLIKRGGRIYVPDVGTLR # REVLQSYHDHKLRGHPGEKRTRKLVSQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g727 ### # command line: # augustus --species=saccharomyces split/input_2/input_2.fa_chunk_0000012