# This output was generated with AUGUSTUS (version 3.4.0). # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de), # O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff. # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), # Using native and syntenically mapped cDNA alignments to improve de novo gene finding # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 # No extrinsic information on sequences given. # Sources of extrinsic information: M RM # Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ... # saccharomyces version. Using default transition matrix. # Looks like split/input_2/input_2.fa_chunk_0000010 is in fasta format. # We have hints for 0 sequences and for 0 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 159616, name = 5_related_000102F) ----- # # Predicted genes for sequence number 1 on both strands # start gene g1 5_related_000102F AUGUSTUS gene 400 1161 0.99 - . g1 5_related_000102F AUGUSTUS transcript 400 1161 0.99 - . g1.t1 5_related_000102F AUGUSTUS stop_codon 400 402 . - 0 transcript_id "g1.t1"; gene_id "g1"; 5_related_000102F AUGUSTUS CDS 400 1161 0.99 - 0 transcript_id "g1.t1"; gene_id "g1"; 5_related_000102F AUGUSTUS start_codon 1159 1161 . - 0 transcript_id "g1.t1"; gene_id "g1"; # protein sequence = [MVEEELRIAKKDRDAAAEQLSTSSRKIAELTTTLLYQQGIVDESNALATRQRVHLEELQEEVHRSRGRAAFVEQMIQE # YPDEGFYEVVLPPLSELEGELVNIRADLRRVATLAHRLYRSDPATVLHHHDRYIGAIIEAVVAFLRRGLDSDDPDVAAHNFRLALDYMQSARGIHGDL # YMRSISSIQWFFHNAVDQDEGLYRLVLEHSRFDNDGPFLTASQHAGFIAPPSDSLEPPLHRRMLALLTALPHREGAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1 ### # start gene g2 5_related_000102F AUGUSTUS gene 3832 4134 0.87 + . g2 5_related_000102F AUGUSTUS transcript 3832 4134 0.87 + . g2.t1 5_related_000102F AUGUSTUS start_codon 3832 3834 . + 0 transcript_id "g2.t1"; gene_id "g2"; 5_related_000102F AUGUSTUS CDS 3832 4134 0.87 + 0 transcript_id "g2.t1"; gene_id "g2"; 5_related_000102F AUGUSTUS stop_codon 4132 4134 . + 0 transcript_id "g2.t1"; gene_id "g2"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSHGNTTQAQKSNQAASSTVIAVAAGQRLMSIPEQSFGDETASNIRTPEGRQPAVE # EPPPVELGMGPPQRRFTSMGYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g2 ### # start gene g3 5_related_000102F AUGUSTUS gene 4211 7159 0.46 + . g3 5_related_000102F AUGUSTUS transcript 4211 7159 0.46 + . g3.t1 5_related_000102F AUGUSTUS start_codon 4211 4213 . + 0 transcript_id "g3.t1"; gene_id "g3"; 5_related_000102F AUGUSTUS CDS 4211 7159 0.46 + 0 transcript_id "g3.t1"; gene_id "g3"; 5_related_000102F AUGUSTUS stop_codon 7157 7159 . + 0 transcript_id "g3.t1"; gene_id "g3"; # protein sequence = [MESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAVSEQSRVSSRRLPTPPVQSLNLPPPRRGSSLSS # LLKSPAMNTPNWERTHAIHHSRTNFPVPPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEILGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQW # LMNPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRILYRASNYRSGAVRFEPPPSRVNIPNYQAIQILR # NANLVAVAAKIDEESNEDANAITAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRSAQTVYTYTPVRHMHQLLVRSEESEAMLGSQETRHRTLLAESDT # LMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCESESVGEFPPEQFDQKRQLHGSDGRFLAQKHSSPRSIEVPELFNPGNTATRSPQLRSGTSPTV # HALAQNSTPPPRVNLQTKPVTPVSTQRYQFGEVRMDGAQHSSWIYGQDLTARLVPNPVHVPPRLSNPSVIPYQGSVSMQSHAVGAESQRDPNQQRTLV # VHEEAVPPQVAPLGTPFVTGAQTNRPGMVVDSAHSQESVAMIQQQARVIETLQEQLREVKKGFTAGKVPTGGPLSKTGNTAGLSGRAPRVMREYTRGG # PSPVGPQPRSWQAMEPISFNRNTPTGAKDGNPQVEQAGQIPDTLSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFS # SQSRDRERPLSQGGQGQREQGGRSGGGAPPLPPPPPPPSGGPGDSNSEGSDEGEQNQSSRNSGRREEDRGELPTGAPEVPPTRYDPDQPWYYDPRQGW # HRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLKGV # SSPCRGPPFRCSVFRRSVLIVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g3 ### # start gene g4 5_related_000102F AUGUSTUS gene 7386 9041 0.8 + . g4 5_related_000102F AUGUSTUS transcript 7386 9041 0.8 + . g4.t1 5_related_000102F AUGUSTUS start_codon 7386 7388 . + 0 transcript_id "g4.t1"; gene_id "g4"; 5_related_000102F AUGUSTUS CDS 7386 9041 0.8 + 0 transcript_id "g4.t1"; gene_id "g4"; 5_related_000102F AUGUSTUS stop_codon 9039 9041 . + 0 transcript_id "g4.t1"; gene_id "g4"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPCHGQPPVVAPARGRSTTRINSPILQAIARHTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGVDNNNDDLDDDSGGLPRGEPG # DPSGPSGPDDPGGPGGPRTPISPDIPNEQRAMLELLSGFKGSIETLGTILAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYF # TDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGIYDAQGEAEDALGNLKMKETENIRKYNIRFNTLAASTNWDSAALKW # AYGRGLAERIKDEMARLPEPATLAAYCLEVLRIDNRYWKREAGKPFIARNPKKGSSDFKTGSTNQHNNSQPSGSSAPFTPKPKPFSGGKPNTNGKPQN # SSNSGQSGSQRPAFNHLRADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKTRESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g4 ### # start gene g5 5_related_000102F AUGUSTUS gene 9374 12932 0.53 + . g5 5_related_000102F AUGUSTUS transcript 9374 12932 0.53 + . g5.t1 5_related_000102F AUGUSTUS start_codon 9374 9376 . + 0 transcript_id "g5.t1"; gene_id "g5"; 5_related_000102F AUGUSTUS CDS 9374 11365 0.53 + 0 transcript_id "g5.t1"; gene_id "g5"; 5_related_000102F AUGUSTUS CDS 11427 12932 0.97 + 0 transcript_id "g5.t1"; gene_id "g5"; 5_related_000102F AUGUSTUS stop_codon 12930 12932 . + 0 transcript_id "g5.t1"; gene_id "g5"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFCNTSHLDSPQTSVPSAINPVVAKVAV # PLPELSPSVSPTILETPPGDSPRSHSRSRSRTLRAKPLSSKFLFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTAPTVPPLPPSIPAEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALEDFIDKQLATGAITPSSSPHGTPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFSLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQNADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVITDHKNLEYFSTTKVLTRQQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQFL # EGPALRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYT # WPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSK # HGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYH # PNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVVSRPGTLSYEL # KLPDYLHRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKYCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFH # ARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g5 ### # start gene g6 5_related_000102F AUGUSTUS gene 14028 14369 1 - . g6 5_related_000102F AUGUSTUS transcript 14028 14369 1 - . g6.t1 5_related_000102F AUGUSTUS stop_codon 14028 14030 . - 0 transcript_id "g6.t1"; gene_id "g6"; 5_related_000102F AUGUSTUS CDS 14028 14369 1 - 0 transcript_id "g6.t1"; gene_id "g6"; 5_related_000102F AUGUSTUS start_codon 14367 14369 . - 0 transcript_id "g6.t1"; gene_id "g6"; # protein sequence = [MSASRTTTTTISATAGPSRSRPVPPPPPPPPSDSAAQEEEDLEDEDEDDIIRKAHARVERVRARKAAEAARKKAEEEA # ARAAAEKKRKAQEAREQARRAQQQQEEAVGRSGDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g6 ### # start gene g7 5_related_000102F AUGUSTUS gene 16484 17797 1 + . g7 5_related_000102F AUGUSTUS transcript 16484 17797 1 + . g7.t1 5_related_000102F AUGUSTUS start_codon 16484 16486 . + 0 transcript_id "g7.t1"; gene_id "g7"; 5_related_000102F AUGUSTUS CDS 16484 17797 1 + 0 transcript_id "g7.t1"; gene_id "g7"; 5_related_000102F AUGUSTUS stop_codon 17795 17797 . + 0 transcript_id "g7.t1"; gene_id "g7"; # protein sequence = [MRHPENLVDLTNSIPLELFDGQPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLCMHNPVIDWKE # LCLTFQDPYVQISAALASEIVQPGAKGGTEELAKGVNDEEIHEGTLQSPPEAPQQPPEAPQPPSEVPQQSPEAPLRAPRTGVKLEEVKDEEYEASQPG # PHKLFPSDRDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPAKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRCNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAVGMDRLLREGTPAYFLHISTTKEESPTEEMLRASDSSA # TEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g7 ### # start gene g8 5_related_000102F AUGUSTUS gene 17861 20728 0.87 + . g8 5_related_000102F AUGUSTUS transcript 17861 20728 0.87 + . g8.t1 5_related_000102F AUGUSTUS start_codon 17861 17863 . + 0 transcript_id "g8.t1"; gene_id "g8"; 5_related_000102F AUGUSTUS CDS 17861 20728 0.87 + 0 transcript_id "g8.t1"; gene_id "g8"; 5_related_000102F AUGUSTUS stop_codon 20726 20728 . + 0 transcript_id "g8.t1"; gene_id "g8"; # protein sequence = [MSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKI # FTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEVSHVEHVRKVLERLRANHLH # AKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVMDWPKSRTVKELQVFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPECSSAFELLKSAF # SEAPVLGHYNPDLPVILECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCKGSRHQIQVYSDHNNLQYFT # TTKQLTARQARWAELLSGYDFVINYCPGRLGAKPDALTRRSDVYPKKGASRDQASAGRERVLIPPERLNATILMNKDLLIKRVREAPKDTSMIEALKR # IARNEEESLVWEDGLIKRGGRIYVPDIGTLQREVLQSYHDHKLRGHPGEKRTRKLVSQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPI # GQRPWSSISLDHITQLPVTAGPEKYDAILVVVCRLTKQAIYVPCYTTDNAEDFANLFITHVFSKHGMPSDIVSDRGSLFVSQFWRELCRALGIESRLS # TAYHPQTDGQMERVNQAVEAYLRIYCSYDQDDWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLELVQGAEVNEYASNLKELHAYLQERIR # VANEVYAQYANQKRQEAPDWKEGDHVWLNMENVRTRRPMKKLDHKWTGPYSILAKIGSHAYRLDLPGDLHKIRNVFHVDRLKPHFHDKFKCQTSPPPP # IFIKGEMEHFVEDILDSKPKKGRPEEVEYLVKWEGYSEEFNSWVGWEGMAGSLKLLRSWHEKHPRKRQPSQRHWARLVKDAQEDEEDEREDRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g8 ### # start gene g9 5_related_000102F AUGUSTUS gene 20949 22307 0.98 - . g9 5_related_000102F AUGUSTUS transcript 20949 22307 0.98 - . g9.t1 5_related_000102F AUGUSTUS stop_codon 20949 20951 . - 0 transcript_id "g9.t1"; gene_id "g9"; 5_related_000102F AUGUSTUS CDS 20949 22307 0.98 - 0 transcript_id "g9.t1"; gene_id "g9"; 5_related_000102F AUGUSTUS start_codon 22305 22307 . - 0 transcript_id "g9.t1"; gene_id "g9"; # protein sequence = [MEDCRVLDQFPALDEALPGAPGQVSTSFSPRFPPLFNPSSQSVSERFRKVQEDLQNATRERRVAVEKLITSTRKNSQL # RTTLLHQQGLVDESNALATRQRRLVEELQEEVHRVRGRAVFVEQMLKEYPDEGYYEVVLPPLSQLEGDLNKAHEDLRRVATFAHRLYHCDPATVLHHH # HRYLGAIIEAVVAFLRRGLDSEDLDVIIHNFRLALDYVQAARGVHGDMYMRSISSIQWFFNNAVDEDEGLYRMILEHSRFDNDRPFLTAAHHAGFVPP # PDDSVEPPLHRRMLALSTVLPHSDGVGRWEDIVPALPSIDQLSADWEQMMLQYIHHITDTPLSGTDTQGPMSSVEPTNGSLSEVLVRQSPEAPAALES # TSSASPHPRVPLFLPEQESLTSPSPTLPPLFGSVADLVIDLTGDDDELYETEEVSAGRFSVTREVIDLAAGQDVVKDESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g9 ### # start gene g10 5_related_000102F AUGUSTUS gene 22855 24456 0.83 - . g10 5_related_000102F AUGUSTUS transcript 22855 24456 0.83 - . g10.t1 5_related_000102F AUGUSTUS stop_codon 22855 22857 . - 0 transcript_id "g10.t1"; gene_id "g10"; 5_related_000102F AUGUSTUS CDS 22855 24041 0.85 - 2 transcript_id "g10.t1"; gene_id "g10"; 5_related_000102F AUGUSTUS CDS 24135 24456 0.83 - 0 transcript_id "g10.t1"; gene_id "g10"; 5_related_000102F AUGUSTUS start_codon 24454 24456 . - 0 transcript_id "g10.t1"; gene_id "g10"; # protein sequence = [MPVSQRSRDVPHPFPRARATAALKAENDALRAEVADLRKLLEASRTETSTLTSLLRETTTSLDDRNKDLEASRRALQD # VAADRLEYGRVLAQFRAIEAELPQAPLEVEVDAYREVAVRQKQELSELRAQVDKEQKRSYEAHEELDAANARAIRLRDRLEDLEETVHRYQTRAHVAE # ELIRKYPEDEGLYEVDLPSLSSLQDKLTASEVMLRRMATFAHRLHSADPANLLHHHNTYVGGLIESVITLLSRSLLHPPEQMRTVVELALDYLSQGRL # THGELHLRSTSSLLFYYSNAADRVDGLYQDMFAHSRFSSDKVFLTAAQHAGYVDARPGSLEPPLHRRLFSFDHPIPLPRSPTSDHIPAVPMMDTVMLM # WEDMIGAYVREVLGYPASPGRILPPVEVPNSTDPLPATTSLVVDDPRPVLGASDSVSRSAPLFLPGSLSPTSPRSPSPIPSSPRVPDVAREVVDLTMD # DAEDLYESQEEFLARTGGTVTVKQEITESDVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g10 ### # start gene g11 5_related_000102F AUGUSTUS gene 29457 33173 0.9 - . g11 5_related_000102F AUGUSTUS transcript 29457 33173 0.9 - . g11.t1 5_related_000102F AUGUSTUS stop_codon 29457 29459 . - 0 transcript_id "g11.t1"; gene_id "g11"; 5_related_000102F AUGUSTUS CDS 29457 33173 0.9 - 0 transcript_id "g11.t1"; gene_id "g11"; 5_related_000102F AUGUSTUS start_codon 33171 33173 . - 0 transcript_id "g11.t1"; gene_id "g11"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPSAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLGENLRGGCIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVVAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAEIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEQE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGQRQDHWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g11 ### # start gene g12 5_related_000102F AUGUSTUS gene 33224 34390 0.87 - . g12 5_related_000102F AUGUSTUS transcript 33224 34390 0.87 - . g12.t1 5_related_000102F AUGUSTUS stop_codon 33224 33226 . - 0 transcript_id "g12.t1"; gene_id "g12"; 5_related_000102F AUGUSTUS CDS 33224 34390 0.87 - 0 transcript_id "g12.t1"; gene_id "g12"; 5_related_000102F AUGUSTUS start_codon 34388 34390 . - 0 transcript_id "g12.t1"; gene_id "g12"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQITSSTPTSASAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g12 ### # start gene g13 5_related_000102F AUGUSTUS gene 37248 38726 1 + . g13 5_related_000102F AUGUSTUS transcript 37248 38726 1 + . g13.t1 5_related_000102F AUGUSTUS start_codon 37248 37250 . + 0 transcript_id "g13.t1"; gene_id "g13"; 5_related_000102F AUGUSTUS CDS 37248 38726 1 + 0 transcript_id "g13.t1"; gene_id "g13"; 5_related_000102F AUGUSTUS stop_codon 38724 38726 . + 0 transcript_id "g13.t1"; gene_id "g13"; # protein sequence = [MCSCTTVYKQDSKKKKKKKKTPVVAPAWGQSTTQIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDAGDHDNQD # PPVDPDDPGADNNNDDLDDGSGSLPRGEPGDPSGPGGPGGPGGPGGPGGPRSPISPDIPNEQCAMLELLLGFKGSIETLGTVLAALGRPSDSSESKSK # VKEPEVFDSSDPRKLKTFFVNLALVFNDRSKYFTDQRKVNYTLSYLSGSAKERFVPDILDPDLDSLPVWTSSFKALVKELQDNIGVYDTQGEAEDSLG # NLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMAHLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFIAPNPKKGSSDFK # TGSTNQQNNSQPSGSSALFTPKPKPFSGGKPNNNGKPQNFSNSGQSGGQCPTFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKQKARESKG # RAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g13 ### # start gene g14 5_related_000102F AUGUSTUS gene 39446 41071 0.99 + . g14 5_related_000102F AUGUSTUS transcript 39446 41071 0.99 + . g14.t1 5_related_000102F AUGUSTUS start_codon 39446 39448 . + 0 transcript_id "g14.t1"; gene_id "g14"; 5_related_000102F AUGUSTUS CDS 39446 41071 0.99 + 0 transcript_id "g14.t1"; gene_id "g14"; 5_related_000102F AUGUSTUS stop_codon 41069 41071 . + 0 transcript_id "g14.t1"; gene_id "g14"; # protein sequence = [MVSQFAAQLETPEVDIALVGAAVFNRACKDAGMEPILLRAIHSEVAAHAADRSSTAPTVPPLPHSIPAEYAEFADVFD # EIAADALPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVTLKDFIDKQLATGAITPSSSPHGAPVLFVPKKDRKLRLCVDFRGLNRITKKDRYPLPLI # SDLLNAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRMHYGSYEWKVMPFGLTNAPAAFQHFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVK # EVLRCLWKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFYRHFIYNYSDIIVPMTWLAWKGAPWIWDND # CQEAFENLKIAFTSAPILAHWEPNRPIIVETDASDYTIAAILSIQTVDGEIHPLAFLSRTLHAAELNYDTHNKELLAIFEAFKAWRHYLEGSGNPVDV # VTDHKNLEYFSTTKILTRRQVHWSEYLHQFNMVIRFRPGKLGEKPDLITRRWDVYPKEGDIGYAQVNPHNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g14 ### # start gene g15 5_related_000102F AUGUSTUS gene 48351 49691 0.99 + . g15 5_related_000102F AUGUSTUS transcript 48351 49691 0.99 + . g15.t1 5_related_000102F AUGUSTUS start_codon 48351 48353 . + 0 transcript_id "g15.t1"; gene_id "g15"; 5_related_000102F AUGUSTUS CDS 48351 49691 0.99 + 0 transcript_id "g15.t1"; gene_id "g15"; 5_related_000102F AUGUSTUS stop_codon 49689 49691 . + 0 transcript_id "g15.t1"; gene_id "g15"; # protein sequence = [MLSGILSIPLATDLPTPNARKTYALSIYVIQSLRLPDTVLLPARDSIAFALGRGIDGELGKEGKKGSASDGLKVSFPS # GSTHISQVEFYQAIHDLAIYQPATFVPAFVILTDSILRNLLAPTLTLRVQACHALGGLAQGVISIPLSHIHSRISLQIVQFLLTPSTRASPKKKSGSP # TPATQESDICRTLRTTLNTEDPLHVAQGPVWALHVLGCFIVLLGSAFKTDMRLVRTITNLLTLTMRHKKVAVRKLACVVWRSITWSWHQLPLPSLGDE # ECTVVPSKSEQQMVSKKQWCLIELVLNMGVGVGTCCAIVGNELGPAERIRLERILTLMMNRGDDSRDCALRCIKQLVSLEQRVSSWDIDNLLSRNFLS # GIPGVLNADYQDLTRPLQNILEELPHVRDLRPLNKDELLELDTMGLFLELWGSAIGIRNGQHNNEVSHQKSFHK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g15 ### # start gene g16 5_related_000102F AUGUSTUS gene 50927 52612 1 + . g16 5_related_000102F AUGUSTUS transcript 50927 52612 1 + . g16.t1 5_related_000102F AUGUSTUS start_codon 50927 50929 . + 0 transcript_id "g16.t1"; gene_id "g16"; 5_related_000102F AUGUSTUS CDS 50927 52612 1 + 0 transcript_id "g16.t1"; gene_id "g16"; 5_related_000102F AUGUSTUS stop_codon 52610 52612 . + 0 transcript_id "g16.t1"; gene_id "g16"; # protein sequence = [MRLAEVIPPTQEYMQQFAPILDAIFIGPQKPVAAFDAFDTFWHTTQFSVNVPPQAWPKKVYEYIYGAPAISAAPSPKS # PYPVEETHVGEDTPEEGVESVVSSKKSRTEEASSLHDSEPCLFSSPALEFPASPYPSHSRKIEAENAGSDIRLLLPAPPILSTPPRASRAKLRIAGAP # NSPPPLLHTPGESSLVFARRFEPLFSPKTPSSKSKHVSQLALSPTIKPLPPVSPVASPNKKRRVSDSNKENLSPCPTRYSPQYRGRDVQSSPSRLLSG # NDRKRMFDSVEDGTACPEQVKVERPTKRVRISTPIPPLALPLPAGPISSSLEAADFDLALCSPSSSSSKAMSSKSSSPSSSSLDSTVDTNNAATLCRT # TSISKKRKALLMDCVEIVRITPSILGQAMKTPTHRMTRKVSIGKRKTVTIASPVQGPDAEGDLDPEFSNLSMSSESDSDYGSDPDNLRSEKQLSSDDD # PHLGQVTPGHLISPTLRRVRGLHRNLDGEMEAEDELPSSDDSDCSFSDRGERRSRQLSPSREVVLRRIQRSLSGTARAVVTPCVGSRDYST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g16 ### # start gene g17 5_related_000102F AUGUSTUS gene 56132 59446 0.24 - . g17 5_related_000102F AUGUSTUS transcript 56132 59446 0.24 - . g17.t1 5_related_000102F AUGUSTUS stop_codon 56132 56134 . - 0 transcript_id "g17.t1"; gene_id "g17"; 5_related_000102F AUGUSTUS CDS 56132 58347 1 - 2 transcript_id "g17.t1"; gene_id "g17"; 5_related_000102F AUGUSTUS CDS 58959 58987 0.25 - 1 transcript_id "g17.t1"; gene_id "g17"; 5_related_000102F AUGUSTUS CDS 59271 59446 0.24 - 0 transcript_id "g17.t1"; gene_id "g17"; 5_related_000102F AUGUSTUS start_codon 59444 59446 . - 0 transcript_id "g17.t1"; gene_id "g17"; # protein sequence = [MPLTKDEKAWAVEKLSSFVDHQNRKVVADFWPPLRAAFFSRFPLVTEISTDVDAETREALTLKSRIWATGTVDWLKES # AQSAPETGPALVSPVSENAAIPSTSTQPPPVTPSSVAPANSSTVVSPCPASVESDSPGLPAVPAFSASPSAADAVLAVSGLSTSSPPPVVNAGAPTAA # LSQVNPSAGSSAVVSISAVTSSDVVNSALLPQPPPGPISLSNACTSSESIEARATSPLPVSSATSTAFGFSTKPTESFLSTFPQSLLPQPEPIETFDP # KRSILSNMTDLEFQELSDAALRNAEGFSNEDWAHLWDNNPETNCEHPANTGSPLPEVPTPKEHFDCSHLSAFPDEQCGDFPFLPTFPEQPSNFSSSDM # VTNSISNLPQVPKSSAVVDPSENGSTTSQITSAAITSLNALPTSLPSTASTLVSLLDSTGTILSNPLLGSLPCTPSTLASVLDSNPVTGTISPDSRAD # SLPSTTSAPVSISDSMLATIDTMCVDRASPILQMVGSAEKGSPLPGTDNDLPPSSTKPVSDPQAASMTEPSREIPTSDYMSNPAILSEPISDPMVSNL # AGPALLAASLAQNPNALAQTHCDPWNPVNDFSTGPSASNILLEVSTKGKGSSKRHGILKKRRTSKQGGTAMKPVMAKTVGILKADNTLKDKLASTVGT # PKSDPPSKKITSVSTDNAPRSDPGWKQVVCLRKIKLVLRAPGVGAVHKPTHKAVISLQSTKENIPPHHSTISGPAPPAHSQSSAPEIIDDGSVCPQRV # RKPLSPREPITIKDRNDRMATAKCPADDQTVRGSSSKKRKVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g17 ### # start gene g18 5_related_000102F AUGUSTUS gene 70702 71877 0.91 - . g18 5_related_000102F AUGUSTUS transcript 70702 71877 0.91 - . g18.t1 5_related_000102F AUGUSTUS stop_codon 70702 70704 . - 0 transcript_id "g18.t1"; gene_id "g18"; 5_related_000102F AUGUSTUS CDS 70702 71877 0.91 - 0 transcript_id "g18.t1"; gene_id "g18"; 5_related_000102F AUGUSTUS start_codon 71875 71877 . - 0 transcript_id "g18.t1"; gene_id "g18"; # protein sequence = [MRNIKQGQLKVLTFSHIYTFPSHQTTAQIEDGGHKAELRVVNDVFWVRLCAMGDLGFAEAYMYGDVECDDLISLFQVC # DFPFIVISSSLSPYQIFLNNRSHLSNLSSSLSYLFTLPQKLTSYRFLNTISNSRSNISAHYDISNDMFAGFLSKDMTYSCAIFEDLDGDLKGGEQGEL # KGRWNGGHGLKKLTNGMTNGVPLLSMPSPAPKKTERGLPSPPLTALTKTEPSTSPEPNVAAELPSSSDPLEDAQYRKLHHIIRKARILPGHRVLEIGS # GWGSLSMLIAKTIPNTTVDTLTLSVEQQSLALSRIKAEGLGERVQVHLMDYRHMPEEWKGKFDRVVSVEMIEAVGKEFLEGFWAKVEWAMKEQESVGV # VQVITIPEASASYVIEILH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g18 ### # start gene g19 5_related_000102F AUGUSTUS gene 73301 74086 0.95 - . g19 5_related_000102F AUGUSTUS transcript 73301 74086 0.95 - . g19.t1 5_related_000102F AUGUSTUS stop_codon 73301 73303 . - 0 transcript_id "g19.t1"; gene_id "g19"; 5_related_000102F AUGUSTUS CDS 73301 74086 0.95 - 0 transcript_id "g19.t1"; gene_id "g19"; 5_related_000102F AUGUSTUS start_codon 74084 74086 . - 0 transcript_id "g19.t1"; gene_id "g19"; # protein sequence = [MPATITEHAMAVIVVPPLNRHPVTKERPKGIISSLPPPEDPEDSNVSRKFERPSLPLCTLHQTHTIENKSLPEDISLS # HHHSHSRVPLYNGVTLFPDPTQRAALLDLLCSILAIERKARVRNQRRTMAPKEEVLFSETNQASNSPQSLSSIPSPLPASSAEDSTRVDNRASHAFLL # YSDAHTALTADMAGVGLALWRIPMFEGMGWKSKPQGDVKGVAREASEKGGSDFHVEDSFGSSGSPWVKRYKYRSMFGDERYRVRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g19 ### # start gene g20 5_related_000102F AUGUSTUS gene 75364 75906 0.99 - . g20 5_related_000102F AUGUSTUS transcript 75364 75906 0.99 - . g20.t1 5_related_000102F AUGUSTUS stop_codon 75364 75366 . - 0 transcript_id "g20.t1"; gene_id "g20"; 5_related_000102F AUGUSTUS CDS 75364 75906 0.99 - 0 transcript_id "g20.t1"; gene_id "g20"; 5_related_000102F AUGUSTUS start_codon 75904 75906 . - 0 transcript_id "g20.t1"; gene_id "g20"; # protein sequence = [MLRFLSQPTAIDLSPQIRALNEPVGSGEFWALEIDKFYGQNAFAYAIRYDPAVRSHVGGKVEINRGLLKPQQFHDATF # EESTLKFQSIKHRNEFLKQFETVDPNNNARNLEFLENFLTKMTTQFEGNPPVLATIPLRLTELITEMKRWEQHADGVVKTSKGWETVTKVDALFAKYD # QEHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g20 ### # start gene g21 5_related_000102F AUGUSTUS gene 77001 77774 0.62 - . g21 5_related_000102F AUGUSTUS transcript 77001 77774 0.62 - . g21.t1 5_related_000102F AUGUSTUS stop_codon 77001 77003 . - 0 transcript_id "g21.t1"; gene_id "g21"; 5_related_000102F AUGUSTUS CDS 77001 77774 0.62 - 0 transcript_id "g21.t1"; gene_id "g21"; 5_related_000102F AUGUSTUS start_codon 77772 77774 . - 0 transcript_id "g21.t1"; gene_id "g21"; # protein sequence = [MLDKTTRGYMDWCHRRNSLFSASDSGNTESSSFPPSSQSQLRQYPVLGAPVPHSGSSVSLQISPHLSSTFHDSHPYLK # QYLQDLNSHPPVLPTFLALSVLGPSTPSRNNNIVGSIVMNDFGPGPGGFRGPSLGTLSAHPQSSSSGPMRLQSSSSFGTGQTQEPVYNIGSFERPAHS # YPDSHRRLQPPYYDGTGPWLPDIYSFSTVDGIGVENRYKPALAPPTPFMPSSPRVDENEKVNFEYGALTTDLEETSYMAWF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g21 ### # start gene g22 5_related_000102F AUGUSTUS gene 81132 81641 0.57 - . g22 5_related_000102F AUGUSTUS transcript 81132 81641 0.57 - . g22.t1 5_related_000102F AUGUSTUS stop_codon 81132 81134 . - 0 transcript_id "g22.t1"; gene_id "g22"; 5_related_000102F AUGUSTUS CDS 81132 81641 0.57 - 0 transcript_id "g22.t1"; gene_id "g22"; 5_related_000102F AUGUSTUS start_codon 81639 81641 . - 0 transcript_id "g22.t1"; gene_id "g22"; # protein sequence = [MLDIIIAKANNIFQRWYHGQDVPTLVLRHEDEHDTFIDQLIKMDSNPFVPAPSPPPTDDSFQHAHPLLTQCIAEAHER # AKIMFPMRKPCQCSVGNPTTCPPSHSWTPPPHIDLSRPILPYLYAEIANPFVFDAAPAIPPITSHYTGSNSVNFELGALHPNTEQSWMGWF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g22 ### # start gene g23 5_related_000102F AUGUSTUS gene 85701 87804 0.23 - . g23 5_related_000102F AUGUSTUS transcript 85701 87804 0.23 - . g23.t1 5_related_000102F AUGUSTUS stop_codon 85701 85703 . - 0 transcript_id "g23.t1"; gene_id "g23"; 5_related_000102F AUGUSTUS CDS 85701 85916 0.36 - 0 transcript_id "g23.t1"; gene_id "g23"; 5_related_000102F AUGUSTUS CDS 86339 86601 0.51 - 2 transcript_id "g23.t1"; gene_id "g23"; 5_related_000102F AUGUSTUS CDS 86696 86919 0.5 - 1 transcript_id "g23.t1"; gene_id "g23"; 5_related_000102F AUGUSTUS CDS 87323 87804 0.74 - 0 transcript_id "g23.t1"; gene_id "g23"; 5_related_000102F AUGUSTUS start_codon 87802 87804 . - 0 transcript_id "g23.t1"; gene_id "g23"; # protein sequence = [MSKASRPLKLKSSASLHTSESVPPGYVLDPRAPPMLRFQESLPHLPVPSLSSTAAKYLETVRPHVNDIAFAETEAAVK # EFISSPQVAELQKRLEARAAEPGIKNWLSDWWNDVAYMGYRDPVVVFVSYFYVHLDDKFRREPAARAASLIKAMMVFREMTEGQVGRIIQQAGSESAT # TVPIGALTSDNRDYWADARKTVIDGSPENENALREIESAMIVVCLDDTKPVTREEISWSFIVFDNGRSGFLGEHSCMDGTPTLRMNEFILAAIAQNKI # NLGPPRTSETDVSLPQPVEIKFVLNDKIRKDVASAEERFDKLVADHDLHYAAWAADGQGVDRHLFGLKKIMNKGEELPAIFKDASYAKTSHWELSTSQ # LSSDYFDGWGYGEGEIGHFISV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g23 ### # start gene g24 5_related_000102F AUGUSTUS gene 88944 90369 0.22 + . g24 5_related_000102F AUGUSTUS transcript 88944 90369 0.22 + . g24.t1 5_related_000102F AUGUSTUS start_codon 88944 88946 . + 0 transcript_id "g24.t1"; gene_id "g24"; 5_related_000102F AUGUSTUS CDS 88944 89363 0.24 + 0 transcript_id "g24.t1"; gene_id "g24"; 5_related_000102F AUGUSTUS CDS 89460 89699 0.67 + 0 transcript_id "g24.t1"; gene_id "g24"; 5_related_000102F AUGUSTUS CDS 89764 90369 0.73 + 0 transcript_id "g24.t1"; gene_id "g24"; 5_related_000102F AUGUSTUS stop_codon 90367 90369 . + 0 transcript_id "g24.t1"; gene_id "g24"; # protein sequence = [MYRRPGAMQPPLPTNAAPTSMAAPNPELAASILQAVAAQAQQGMLPSSAPPLQATESLVAPLHQITNSASLQSLLRTH # KAVVVNFSDMITCPPCRVIAPVYEQLAHEKGVKTVSGAGAAFAKIDLSTPPGKALGAEWSVRISEMKGADANELRSQINLLLFQAFPRAENSNSFGLF # EKADMLLHSPSSQFPIASSHAGLVAQPDIVYSSTRARHRCEQTYVLFNTVLPYLKSRSNTPPLSANPILLASWAKTTSTLVQALPLESLFPLVDMWRL # ALLDSSVATWCAAQQSTPNTTPIHLFLSKVISSVASAPRAYLLTLLRLLSNTFSSPVLAPQLLLGQVKFSMTALLVSTLLHEDAGVRTAAASLVFNAA # AFLQKGRVDAVKNGGGSGKSDIEDEDWEVELVSAVVEAIDREKVNEDVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g24 ### # start gene g25 5_related_000102F AUGUSTUS gene 97624 98469 0.31 - . g25 5_related_000102F AUGUSTUS transcript 97624 98469 0.31 - . g25.t1 5_related_000102F AUGUSTUS stop_codon 97624 97626 . - 0 transcript_id "g25.t1"; gene_id "g25"; 5_related_000102F AUGUSTUS CDS 97624 98469 0.31 - 0 transcript_id "g25.t1"; gene_id "g25"; 5_related_000102F AUGUSTUS start_codon 98467 98469 . - 0 transcript_id "g25.t1"; gene_id "g25"; # protein sequence = [MAVSPSSGPWITLKTLLFSIIMISDSVLSACLYIPPTDYRLSPTSSLSSPASLSLTTLLTLFRLSFVVSQFGGISSMG # GGEEASFKEMRKAAYLALDILASGPEDVSERFIDELMAHRVSVYPGSQELGHPQTIVEKGLKPPVEQIIELAKISFALSCIEQLVPVLSIKYLKGPVW # NLVEPNLDLRHSPPGTSEASSSSPNYTTQQLMDQLMRETFESAHSVVLAILAANATNADLKGPGVSGSNDGKGKAREEEDLSLSDFCTRLVPFYSRCL # IQVSFFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g25 ### # start gene g26 5_related_000102F AUGUSTUS gene 99357 99974 0.97 - . g26 5_related_000102F AUGUSTUS transcript 99357 99974 0.97 - . g26.t1 5_related_000102F AUGUSTUS stop_codon 99357 99359 . - 0 transcript_id "g26.t1"; gene_id "g26"; 5_related_000102F AUGUSTUS CDS 99357 99974 0.97 - 0 transcript_id "g26.t1"; gene_id "g26"; 5_related_000102F AUGUSTUS start_codon 99972 99974 . - 0 transcript_id "g26.t1"; gene_id "g26"; # protein sequence = [MSSHAYTNLLQHLHRAQPALPLETIQSALAFHIANHSLVPTPLAATAITSPLFLSYPFTLSRLQTLSNSFRHAIHLKF # TLLSGPRFSFFERSISAHLAQWTKELIKGLQGGNPLLRLAAASGILLGLEDLRTQAQANSLDVDSNSSDLASQDPVPNATRAKVEDEVVIAFAEVMDQ # EGVGREWESEFQQIALLSNSVQGKPCCAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g26 ### # start gene g27 5_related_000102F AUGUSTUS gene 100872 101300 0.98 - . g27 5_related_000102F AUGUSTUS transcript 100872 101300 0.98 - . g27.t1 5_related_000102F AUGUSTUS stop_codon 100872 100874 . - 0 transcript_id "g27.t1"; gene_id "g27"; 5_related_000102F AUGUSTUS CDS 100872 101300 0.98 - 0 transcript_id "g27.t1"; gene_id "g27"; 5_related_000102F AUGUSTUS start_codon 101298 101300 . - 0 transcript_id "g27.t1"; gene_id "g27"; # protein sequence = [MFPDPFEDDAPEAVVDDVDAAAEADALDADAELADAAEADETEADEAEADEADMLDKIESGNVVSKKNREISALHQNR # TYEKNSERRLTDSSEMGLGMRRCIKSSGIGCNAEIKPIRSVCSTEIRAVLTHHESFAGRVITPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g27 ### # start gene g28 5_related_000102F AUGUSTUS gene 101455 101883 0.77 + . g28 5_related_000102F AUGUSTUS transcript 101455 101883 0.77 + . g28.t1 5_related_000102F AUGUSTUS start_codon 101455 101457 . + 0 transcript_id "g28.t1"; gene_id "g28"; 5_related_000102F AUGUSTUS CDS 101455 101883 0.77 + 0 transcript_id "g28.t1"; gene_id "g28"; 5_related_000102F AUGUSTUS stop_codon 101881 101883 . + 0 transcript_id "g28.t1"; gene_id "g28"; # protein sequence = [MGSSSPMMAHVQSPGSPLLAGGAEGPSSTGHGAPGFQRAPSVVSPDGASSISHGGSAGEGGPFSGADAAIIANAFRTM # LRKPDFADAPVEEGESPDSQERGRVELSRELAEEGRDIRSVSSSRGVRVETLSDDGDTIQEADH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g28 ### # start gene g29 5_related_000102F AUGUSTUS gene 110813 112196 0.84 + . g29 5_related_000102F AUGUSTUS transcript 110813 112196 0.84 + . g29.t1 5_related_000102F AUGUSTUS start_codon 110813 110815 . + 0 transcript_id "g29.t1"; gene_id "g29"; 5_related_000102F AUGUSTUS CDS 110813 111307 0.85 + 0 transcript_id "g29.t1"; gene_id "g29"; 5_related_000102F AUGUSTUS CDS 111354 112196 0.98 + 0 transcript_id "g29.t1"; gene_id "g29"; 5_related_000102F AUGUSTUS stop_codon 112194 112196 . + 0 transcript_id "g29.t1"; gene_id "g29"; # protein sequence = [MKRHPRSTSFDFTHPGIPGDELEQDRIQLEHNLQNTDLSFRLSSQGDNDSIEYPRHNSGHLNDFGSFINHSRGNLGDG # DTHHGWSYRTGDDEEGINPYGGETMSTAAHHASALTLTAGLGGRGNRRDASLSGAEYDPDRPLENIIGGVDSRFSLFDLDPSRSKYSAPGPGTSLDPL # VVDSTAELDRILESGYALPPAPRDANPHFSRSSSSSSSSDSEGGPSSRPKIVDSLRRVSFSPKRPRVAHPTHTPRHRSSNLPGSTQSIINSARHVTSP # LVREASLSLANEQNALTPKARQSTKRTNNQSTPHPEVRLQPPTPSSSTSRFSQKARGLTRELDAEVERTYAAQSKNRSIGDSLYTNAEIPSISYDIPP # ANGTPAPKRTQKIYNTPSLSKGHNISHSKLYLPDVTGLTNAVESPAKGALSTHYPYQSSNEPREIEGDDLFFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g29 ### # start gene g30 5_related_000102F AUGUSTUS gene 112247 114033 0.36 + . g30 5_related_000102F AUGUSTUS transcript 112247 114033 0.36 + . g30.t1 5_related_000102F AUGUSTUS start_codon 112247 112249 . + 0 transcript_id "g30.t1"; gene_id "g30"; 5_related_000102F AUGUSTUS CDS 112247 112589 0.36 + 0 transcript_id "g30.t1"; gene_id "g30"; 5_related_000102F AUGUSTUS CDS 112706 114033 0.55 + 2 transcript_id "g30.t1"; gene_id "g30"; 5_related_000102F AUGUSTUS stop_codon 114031 114033 . + 0 transcript_id "g30.t1"; gene_id "g30"; # protein sequence = [MNTIQDKLEQLEDENGISRRRVRELELELEMCKKDVARERTRVIQKEEAILQNQRELERAVADAKRSMKGKTRARDTS # MHADIDASVRYKEAVEEKKGTLLYFCLLDLSFNYFWHARALKEKTSDITRLRVEVERLAGEVEVLRGVVEEGLKERRLARENSRASVSQVNSESMAQQ # EILEDTEEAVDSTGVREDEHQQELEEEEDGEEEEDEELEEEDLDDHEEPEPFDPMSIPGSSRELDALDKTVRTDRATVGTPGASQRNISRPTRFIDDD # ELERIAADVEERRSERSAAGTSRSQFDSRVLNPSRSTSPVPAPTAVTQRRATVEDVADKNDCVHNLHFQEENRSPSPALSSASVRLRRVKAREAQEVH # QPNRPSPPTPGHATTHNHRPSYRHADPDDSIAETPFPQIRGERLEKLFFSAPEHNQKTCNVCCRHRGPRGVDTRPMSPSWLPSRFAQDVNQHNHEADG # DDDEGFAEGSEEANQENFRDHFARGMKRNGKQRDMGPPRDTYEQRKNLPQQTVLARVIRELEDDFTHYKRFVPSSRYVVSVLMIDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g30 ### # start gene g31 5_related_000102F AUGUSTUS gene 115093 115835 0.62 - . g31 5_related_000102F AUGUSTUS transcript 115093 115835 0.62 - . g31.t1 5_related_000102F AUGUSTUS stop_codon 115093 115095 . - 0 transcript_id "g31.t1"; gene_id "g31"; 5_related_000102F AUGUSTUS CDS 115093 115351 1 - 1 transcript_id "g31.t1"; gene_id "g31"; 5_related_000102F AUGUSTUS CDS 115408 115562 0.62 - 0 transcript_id "g31.t1"; gene_id "g31"; 5_related_000102F AUGUSTUS CDS 115623 115835 0.97 - 0 transcript_id "g31.t1"; gene_id "g31"; 5_related_000102F AUGUSTUS start_codon 115833 115835 . - 0 transcript_id "g31.t1"; gene_id "g31"; # protein sequence = [MPVNEPSAPQHTIKATTESPSSSVKALKAKVDINDRDSHEDKPPISQPAANRPSSPNTDSSKNQNCETEAETSSSDED # EIIDMEIFNQILELDEDDTHDFSREMVEAYYTQAAQTFDDMDAALIKKDLMTLSDLGHFLKGSSATLGVAHVQNSCEKIQRYGQLRDEEKGIDLDSKQ # ALDLITLLISQVKGEYSIAEKWLRKWYTEHSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g31 ### # start gene g32 5_related_000102F AUGUSTUS gene 118497 120332 0.84 - . g32 5_related_000102F AUGUSTUS transcript 118497 120332 0.84 - . g32.t1 5_related_000102F AUGUSTUS stop_codon 118497 118499 . - 0 transcript_id "g32.t1"; gene_id "g32"; 5_related_000102F AUGUSTUS CDS 118497 120332 0.84 - 0 transcript_id "g32.t1"; gene_id "g32"; 5_related_000102F AUGUSTUS start_codon 120330 120332 . - 0 transcript_id "g32.t1"; gene_id "g32"; # protein sequence = [MILDRLIWSESFEKFIASKYPNEKRFGLEGCESLIPGMKALIDRSVEHGVSNITLGMPHRGRLNVLANVIRKPIEAIL # NEFSGAEGDEPAGDVKYHLGANYVRPTPSGKKVALSLVANPSHLEAEDPVVLGKTRAIQHFEKDEKSHNTAMGVLLHGDAAFAGQGIVYETMGMHNLP # NYGTGGTIHLIVNNQVGFTTDPRFARSTPYPSDIAKSIDAPIFHVNGDNVEAVTFVCQLAADYRAKYKKDVVIDIVCYRRYGHNETDQPMFTQPRMYK # AIEKQPTILTQYSKFLVGRGTFTEKDIEEHKKWVWGMLEKAAAGAKDYVPTSKEWLSASWQGFPSPKQLADQTLPTRATGSDEATLQRIGRAISSYPN # GFTVHRNLGRILQTRGKTIEEGKNIDWSTAEALAFGALALENIHVRVSGQDVERGTFSQRHAVLHDQANEKQYVPLNDLGSSQARFIICNSSLSEYGT # LGFELGYSLVSPDCLTMWEAQFGDFANNAQCIIDQFIASGERKWLQRSGLVMSLPHGYDGQGPEHSSARLERFLQLCDDHPNVFPSQEKIERQHQDCN # MQVVYPTTPANYVSLSVLFHLLLLTSNDVLDVLVPRPSSSNSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g32 ### # start gene g33 5_related_000102F AUGUSTUS gene 120801 121181 0.63 - . g33 5_related_000102F AUGUSTUS transcript 120801 121181 0.63 - . g33.t1 5_related_000102F AUGUSTUS stop_codon 120801 120803 . - 0 transcript_id "g33.t1"; gene_id "g33"; 5_related_000102F AUGUSTUS CDS 120801 121181 0.63 - 0 transcript_id "g33.t1"; gene_id "g33"; 5_related_000102F AUGUSTUS start_codon 121179 121181 . - 0 transcript_id "g33.t1"; gene_id "g33"; # protein sequence = [MLSKQALRNLPSRSKAAVVAVRAQQSVIPRRRDLATPAANPPSPNDIFANGTNAYYAEEMYRHWRQDPSSVHASWDAY # FKGLDKGLPSSVAFQPPPSLVAPPTDGAPALHASAGGAELDDHLKVSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g33 ### # start gene g34 5_related_000102F AUGUSTUS gene 123611 123985 0.43 - . g34 5_related_000102F AUGUSTUS transcript 123611 123985 0.43 - . g34.t1 5_related_000102F AUGUSTUS stop_codon 123611 123613 . - 0 transcript_id "g34.t1"; gene_id "g34"; 5_related_000102F AUGUSTUS CDS 123611 123985 0.43 - 0 transcript_id "g34.t1"; gene_id "g34"; 5_related_000102F AUGUSTUS start_codon 123983 123985 . - 0 transcript_id "g34.t1"; gene_id "g34"; # protein sequence = [MREFNVRLSSERIKVEHAFGKLKGRFLSLKEMGWHKNLQEMYKVIEALLILHNMCIDYGDIPEHILDFDPSDNTIPVE # VAAGDIHFGLVDVTQEANIPQYETDQWIKEEGRRKRDLIFNDLFPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g34 ### # start gene g35 5_related_000102F AUGUSTUS gene 127403 127762 0.59 - . g35 5_related_000102F AUGUSTUS transcript 127403 127762 0.59 - . g35.t1 5_related_000102F AUGUSTUS stop_codon 127403 127405 . - 0 transcript_id "g35.t1"; gene_id "g35"; 5_related_000102F AUGUSTUS CDS 127403 127762 0.59 - 0 transcript_id "g35.t1"; gene_id "g35"; 5_related_000102F AUGUSTUS start_codon 127760 127762 . - 0 transcript_id "g35.t1"; gene_id "g35"; # protein sequence = [MDSFWDVYQNLLNLFRSETINNTLLGNELQEFLVAEEQIDSEVVELMEGQAELRYNGRVIGDADEEMDNPFFHHDSEN # YLEVDITDDEEEELEDSDSGSMLIVDFSDDSVEEVANSLVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g35 ### # start gene g36 5_related_000102F AUGUSTUS gene 131662 132207 0.76 - . g36 5_related_000102F AUGUSTUS transcript 131662 132207 0.76 - . g36.t1 5_related_000102F AUGUSTUS stop_codon 131662 131664 . - 0 transcript_id "g36.t1"; gene_id "g36"; 5_related_000102F AUGUSTUS CDS 131662 132207 0.76 - 0 transcript_id "g36.t1"; gene_id "g36"; 5_related_000102F AUGUSTUS start_codon 132205 132207 . - 0 transcript_id "g36.t1"; gene_id "g36"; # protein sequence = [MFSRSIGLGFHAEAYDGEIVALSYAAGLAANMSSQDDSITHWQFFTDSASSIDSIFDTSPKPGQVYCSNFYRKVVEFL # DSDPLHSVEVAWVPSHIGIIGNERADFLAKMGTEQKNEAMWGRSRSNALWLNKVRAERKWKKKWESRSTYGCFAIANQLPPSLKPTKRLKETPREVFG # QAMPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g36 ### # start gene g37 5_related_000102F AUGUSTUS gene 132442 133719 0.73 - . g37 5_related_000102F AUGUSTUS transcript 132442 133719 0.73 - . g37.t1 5_related_000102F AUGUSTUS stop_codon 132442 132444 . - 0 transcript_id "g37.t1"; gene_id "g37"; 5_related_000102F AUGUSTUS CDS 132442 133719 0.73 - 0 transcript_id "g37.t1"; gene_id "g37"; 5_related_000102F AUGUSTUS start_codon 133717 133719 . - 0 transcript_id "g37.t1"; gene_id "g37"; # protein sequence = [MALAHNLIPAQQFGGRAGLSTTDAILSFMNDVQAAWNHDMVTLALTFDIKGFFDFVNHDRLLYELRRKGIPLQIVQFV # KYFLSDRKAAVCVDGITSNLEDVANGTPQGSPLSPILSAFYAAELLETLECRSQKYQQSPGSDGQETPPPNLFMFVDDGKLHVCSYSLELNTAILKAI # WIEVIVPWGKKVGLSFDFDKRELMHYTRRKRDNNVSPSITFHDDDGLTRVVAPQAVVRWLGVYFDRKLLFNHHVKTLAGSAGKAVGSLIMLANTVKGL # SPYHMHMMYKSCVVPVMTYASAVWWTGKITHERLLEKVQHHGLQLICAVFRTTPIAAMEIEASIPPVWVELNRLNRNCALRFNKLSTSNPIIQRLDNT # WRAGRPPSRPPAVHYKLNRKGKKDENRTTQLQNIARLTNSSDERLLPFSTPPW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g37 ### # start gene g38 5_related_000102F AUGUSTUS gene 133995 136610 0.19 - . g38 5_related_000102F AUGUSTUS transcript 133995 136610 0.19 - . g38.t1 5_related_000102F AUGUSTUS stop_codon 133995 133997 . - 0 transcript_id "g38.t1"; gene_id "g38"; 5_related_000102F AUGUSTUS CDS 133995 134815 0.71 - 2 transcript_id "g38.t1"; gene_id "g38"; 5_related_000102F AUGUSTUS CDS 135320 135336 0.34 - 1 transcript_id "g38.t1"; gene_id "g38"; 5_related_000102F AUGUSTUS CDS 135457 136610 0.32 - 0 transcript_id "g38.t1"; gene_id "g38"; 5_related_000102F AUGUSTUS start_codon 136608 136610 . - 0 transcript_id "g38.t1"; gene_id "g38"; # protein sequence = [MRKKTLVQQRKDFDKTYQNTTASEADVSDVESDMDLDAEPEAEAPPANQIIELVELLALKLQDAIKKRLLPSNIAAQI # SDSGHMLTEMLRGLGIGESVAAGTGVEMVVMTQLSAICDTIDTERKANERRLECIEEALKKQREDNPPQVTSSSPNWADDSYAARAIRGATKPPPKQK # PPPAVTPPSKRDLERESRFVAYFNGSVDPSNRTEPYEIVQDVNKDITELFPKCSGTKIATAKWNTSGNLVLSVLLGQKAKALEEIFPLIYTRYTKTNM # IPQETKLDIEWNKIIVDGVPTGTTWVNQGGIGRRPHKPEELAVEAKMYNPLLTESTFALPPRFLIPPADLMGKALYEKETANNILNLGYIIMYGKRCK # VRKYQDRSPNRPQDTASANKHPSVIDLTWSNVQALQIDATRDWAIDKDLAVGSDHMGIRWRMNSDSEEIKNPMGIWYNMKEVKPTEWIEAFDNEMELQ # KDKFQWLLESDNTLTHDDLDAVTDAFTDAMKEATAKVAPVRNPNTRAKPWWDGACAEALNWVQVAEHVRHHNRMENGFSNEWLEKSAKHEKNHFHRLT # KWKKQEWAVKTVEEAHPEDIYSFRKWSKGGRQYPMPAIERPGQLPATTHAEKCKALRDELYQPLHYQMSTQLTSQIHYQVISPTRKSQRQKWLRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g38 ### # start gene g39 5_related_000102F AUGUSTUS gene 138716 139356 0.91 + . g39 5_related_000102F AUGUSTUS transcript 138716 139356 0.91 + . g39.t1 5_related_000102F AUGUSTUS start_codon 138716 138718 . + 0 transcript_id "g39.t1"; gene_id "g39"; 5_related_000102F AUGUSTUS CDS 138716 138842 0.93 + 0 transcript_id "g39.t1"; gene_id "g39"; 5_related_000102F AUGUSTUS CDS 138891 139015 1 + 2 transcript_id "g39.t1"; gene_id "g39"; 5_related_000102F AUGUSTUS CDS 139093 139356 0.98 + 0 transcript_id "g39.t1"; gene_id "g39"; 5_related_000102F AUGUSTUS stop_codon 139354 139356 . + 0 transcript_id "g39.t1"; gene_id "g39"; # protein sequence = [MFRNDSDVNLNTHALEASAMEESCDDDDDDDDDDDDDDDEVYSAVVAQSLTRLVSVEPDDDLVHSSSSESNNVPPQLD # EPYTASLTPHNLWEECWTQPVPLEFIPVFFDDEHVEAIFKIVSEVQRDGLDCPGFNVKGTNEEELAAEFILLMKASIRCGDWSKVLSPNHHFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g39 ### # start gene g40 5_related_000102F AUGUSTUS gene 141889 142590 0.78 - . g40 5_related_000102F AUGUSTUS transcript 141889 142590 0.78 - . g40.t1 5_related_000102F AUGUSTUS stop_codon 141889 141891 . - 0 transcript_id "g40.t1"; gene_id "g40"; 5_related_000102F AUGUSTUS CDS 141889 142590 0.78 - 0 transcript_id "g40.t1"; gene_id "g40"; 5_related_000102F AUGUSTUS start_codon 142588 142590 . - 0 transcript_id "g40.t1"; gene_id "g40"; # protein sequence = [MDTQQQAFDTLRKAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREM # LAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWCTAQDLTRRQARWALYLSRFDFHMIHRPGRINTQADALSRMAAHQVLDSEDNRQQTVLKPNHFTK # IAASILRNPLEDRIRKASQREAQVLEGLKTVKEHGLQCLANGIAEWEEDNGLVYYRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g40 ### # start gene g41 5_related_000102F AUGUSTUS gene 144340 145506 0.99 - . g41 5_related_000102F AUGUSTUS transcript 144340 145506 0.99 - . g41.t1 5_related_000102F AUGUSTUS stop_codon 144340 144342 . - 0 transcript_id "g41.t1"; gene_id "g41"; 5_related_000102F AUGUSTUS CDS 144340 145506 0.99 - 0 transcript_id "g41.t1"; gene_id "g41"; 5_related_000102F AUGUSTUS start_codon 145504 145506 . - 0 transcript_id "g41.t1"; gene_id "g41"; # protein sequence = [MSTPVPPAPNTSAEDLIAQLIRQVANLATAMEEHSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQSDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQQFEPMDPGMEAHSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRECFFTA # LLPEIRQHLITINIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIHATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRCQQPRRQQISATGPAPFSLFLNESVQIASSTSTSAPVPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSLSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g41 ### # start gene g42 5_related_000102F AUGUSTUS gene 147401 148546 1 + . g42 5_related_000102F AUGUSTUS transcript 147401 148546 1 + . g42.t1 5_related_000102F AUGUSTUS start_codon 147401 147403 . + 0 transcript_id "g42.t1"; gene_id "g42"; 5_related_000102F AUGUSTUS CDS 147401 148546 1 + 0 transcript_id "g42.t1"; gene_id "g42"; 5_related_000102F AUGUSTUS stop_codon 148544 148546 . + 0 transcript_id "g42.t1"; gene_id "g42"; # protein sequence = [MPLKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTQIDSPILQAIARRTGKQPQRRAASESPRDPPPHFNLDTSDHDDQDPPVDPNDPGANNNHDDLDDDSGSLPRGEPG # DPSGPGGPGGPGSPGGPGGPSGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLTLVFN # DHLKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g42 ### # start gene g43 5_related_000102F AUGUSTUS gene 148574 149092 1 + . g43 5_related_000102F AUGUSTUS transcript 148574 149092 1 + . g43.t1 5_related_000102F AUGUSTUS start_codon 148574 148576 . + 0 transcript_id "g43.t1"; gene_id "g43"; 5_related_000102F AUGUSTUS CDS 148574 149092 1 + 0 transcript_id "g43.t1"; gene_id "g43"; 5_related_000102F AUGUSTUS stop_codon 149090 149092 . + 0 transcript_id "g43.t1"; gene_id "g43"; # protein sequence = [MTCLPKPATLADYRQEVLRIDNRYWKCEETRKREAGKLFVARNPKKGSSDFKTGSSNQHNNSQPSGSSAPFTPKPKPF # SGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g43 ### # start gene g44 5_related_000102F AUGUSTUS gene 149425 150588 0.86 + . g44 5_related_000102F AUGUSTUS transcript 149425 150588 0.86 + . g44.t1 5_related_000102F AUGUSTUS start_codon 149425 149427 . + 0 transcript_id "g44.t1"; gene_id "g44"; 5_related_000102F AUGUSTUS CDS 149425 150588 0.86 + 0 transcript_id "g44.t1"; gene_id "g44"; 5_related_000102F AUGUSTUS stop_codon 150586 150588 . + 0 transcript_id "g44.t1"; gene_id "g44"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSTYNPLIDWASRNITFRNTSHFDSPQMSVPSAINPVVAKVAV # PLPEPSPLVSPTIQETPLGDLPRSRSCSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCINFRGLNRITKKDRYPLPLISDLLVAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYGRSCRLALQTPLRLSSGLLMTSS # LTCSMFVSSSIWTIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g44 ### # start gene g45 5_related_000102F AUGUSTUS gene 150693 151472 0.85 + . g45 5_related_000102F AUGUSTUS transcript 150693 151472 0.85 + . g45.t1 5_related_000102F AUGUSTUS start_codon 150693 150695 . + 0 transcript_id "g45.t1"; gene_id "g45"; 5_related_000102F AUGUSTUS CDS 150693 151472 0.85 + 0 transcript_id "g45.t1"; gene_id "g45"; 5_related_000102F AUGUSTUS stop_codon 151470 151472 . + 0 transcript_id "g45.t1"; gene_id "g45"; # protein sequence = [MDTVEYLGYILSPNGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYHRFIYNYSDIIVPMTRLTRKGAPWIWDSSC # QEAFENLKTAFTSAPILAHWEPNRPLIVETDTSDYAIVAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVV # TDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVICFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g45 ### # start gene g46 5_related_000102F AUGUSTUS gene 151515 152984 1 + . g46 5_related_000102F AUGUSTUS transcript 151515 152984 1 + . g46.t1 5_related_000102F AUGUSTUS start_codon 151515 151517 . + 0 transcript_id "g46.t1"; gene_id "g46"; 5_related_000102F AUGUSTUS CDS 151515 152984 1 + 0 transcript_id "g46.t1"; gene_id "g46"; 5_related_000102F AUGUSTUS stop_codon 152982 152984 . + 0 transcript_id "g46.t1"; gene_id "g46"; # protein sequence = [MDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNR # TLEAVRRQYTWPKVRDFVRDYITSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLA # ELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTECVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGI # TPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHIFLREEILLAQSRYKEQADRKKISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVI # SRPGTLSYELKLPDYLRCIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLHYYIRWAGYEGTDDEFSWVAADEL # HADELVPAFHTRYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g46 ### # # ----- prediction on sequence number 2 (length = 85926, name = 5_related_000128F) ----- # # Predicted genes for sequence number 2 on both strands # start gene g47 5_related_000128F AUGUSTUS gene 4579 5408 0.7 - . g47 5_related_000128F AUGUSTUS transcript 4579 5408 0.7 - . g47.t1 5_related_000128F AUGUSTUS stop_codon 4579 4581 . - 0 transcript_id "g47.t1"; gene_id "g47"; 5_related_000128F AUGUSTUS CDS 4579 4924 0.81 - 1 transcript_id "g47.t1"; gene_id "g47"; 5_related_000128F AUGUSTUS CDS 4987 5408 0.8 - 0 transcript_id "g47.t1"; gene_id "g47"; 5_related_000128F AUGUSTUS start_codon 5406 5408 . - 0 transcript_id "g47.t1"; gene_id "g47"; # protein sequence = [MPLSTDILLSTLSKAVSSLTTEELDDDPVIDSKKLLHRCLTHFGRKQQIHAQQCARYLRRLGDNMFSHQTVILPSGNL # VSFVKQVYKLNNGSESSNDEQGEVDIQLSLGFKDGKMFTYSQVIDYWYRDVTLFDMCFYDFIRCIKKVQTDVWSSATPTHELIRHTNYEQGDVGKEFV # PVMIGIVPPRKHHKDYALFVIAHFKPFSNSHDLIQDALEVELENLALSEEHQRILCNWEEIHECADQRDAERLRKKHIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g47 ### # start gene g48 5_related_000128F AUGUSTUS gene 6243 8230 0.97 - . g48 5_related_000128F AUGUSTUS transcript 6243 8230 0.97 - . g48.t1 5_related_000128F AUGUSTUS stop_codon 6243 6245 . - 0 transcript_id "g48.t1"; gene_id "g48"; 5_related_000128F AUGUSTUS CDS 6243 7718 0.98 - 0 transcript_id "g48.t1"; gene_id "g48"; 5_related_000128F AUGUSTUS CDS 7763 8230 0.99 - 0 transcript_id "g48.t1"; gene_id "g48"; 5_related_000128F AUGUSTUS start_codon 8228 8230 . - 0 transcript_id "g48.t1"; gene_id "g48"; # protein sequence = [MSVFKELPEGELVKLKQVLRICERKSISSPVFSCLSPHGFSEMRSNDLFKLLAKCFQRDYRYFFNMDDVTLCDKYLYG # YGSVFVDMGIQGIIFKLLMLLGYTEKLLHDIVNAIPEEYVFQSKENEDRRDKRRDSRIKRANDEFNLLHKSSSIWPQIAVRYVVPEICACCGSADQLY # TGCYRSQSEWPNLSVLKVTDPLILANTPQARFTYICKDLDGLLMDKRGIHCIDIDCSLFAIYFCSECYNSLRRVSMPRLALNNYLYRGELIEGIENIT # WVEEMACAIYHTSAHVARIYGSSSAGDSLQLHGNVCAHPLDICSVAKKLPWSPADLNDLITVVFVSKAKLKQHDLQKLKPYFVRRSIIRMLLSDLCHR # NRLYVGLYTLDSSMLELYPDNDLLPGLQERIVYDCDSSVNELFGVESAGFDDHPAELLVDSEQDSVLLERSGIYDAESQDVPARFMTASSIYNIAQSL # PANNADVVLKYDKDPISEYNNPDLFPGMFPTLFPLGIGGFEDRRRSPAVSLEAHVEHLLDQSTHEFRYHHFFSFVALNVIQRRKAHLHTSLWISSNKF # SSLVPMLLSVSSSVLSDLADKLRNEKDEAEFLDEELDAFQLLKQVNIIAAKYLVHSRQKLPQGIIYAVIMVILVCHICF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g48 ### # start gene g49 5_related_000128F AUGUSTUS gene 9888 11561 0.21 + . g49 5_related_000128F AUGUSTUS transcript 9888 11561 0.21 + . g49.t1 5_related_000128F AUGUSTUS start_codon 9888 9890 . + 0 transcript_id "g49.t1"; gene_id "g49"; 5_related_000128F AUGUSTUS CDS 9888 10088 0.75 + 0 transcript_id "g49.t1"; gene_id "g49"; 5_related_000128F AUGUSTUS CDS 10454 10699 0.43 + 0 transcript_id "g49.t1"; gene_id "g49"; 5_related_000128F AUGUSTUS CDS 10776 11561 0.37 + 0 transcript_id "g49.t1"; gene_id "g49"; 5_related_000128F AUGUSTUS stop_codon 11559 11561 . + 0 transcript_id "g49.t1"; gene_id "g49"; # protein sequence = [MGPAPRERYNAKARQATAGGSKKKGKIGKRNPHINDKTPDSDPNALFHTPKTNEEKELDRKEKLKQEEDKEIRRAIEG # RSGKRKRHDGFYDVVEAEADDEEGEEEEGDFMTETGLLEEQIEPSPKLPAPQPTVGSALARNSDGTVIAPKTAFSSWKIKAKATTEVESDTSFDSSDS # AYDSPDDEEWTGIEKQENNADEEEEDNEDREEDGEEESEEEDSDQNEGDDSDQYEGDDRSSPTKLRKSLGFKDWAIKQLNVAKGYDLSPPTPRDSSLP # LSDAASKPPPAKKRKRNPSDQPEMRGPLGEDLILPSNSFAQQLFSRTPSGKVDKDGSVSKRKFISVLRPDDVQESRLLLPVVAEEQPIMEAVLLNPVV # VVCGETGSGKTTQLPQFLYEAGFGSPGSGTLRLLTAKM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g49 ### # start gene g50 5_related_000128F AUGUSTUS gene 15265 17042 0.21 - . g50 5_related_000128F AUGUSTUS transcript 15265 17042 0.21 - . g50.t1 5_related_000128F AUGUSTUS stop_codon 15265 15267 . - 0 transcript_id "g50.t1"; gene_id "g50"; 5_related_000128F AUGUSTUS CDS 15265 15860 0.83 - 2 transcript_id "g50.t1"; gene_id "g50"; 5_related_000128F AUGUSTUS CDS 15974 16463 0.6 - 0 transcript_id "g50.t1"; gene_id "g50"; 5_related_000128F AUGUSTUS CDS 16566 17042 0.35 - 0 transcript_id "g50.t1"; gene_id "g50"; 5_related_000128F AUGUSTUS start_codon 17040 17042 . - 0 transcript_id "g50.t1"; gene_id "g50"; # protein sequence = [MQGQKESSETANDMISARQEFQTVKNLRQVKIQELQKLRDSGARFDSLEVEVKQLTIKTTALRQRLDNLRDKHTSESR # KMDTARRRARDEILREADVICSTLSGTGHENLEQYEYDMVIIDEAAQAIELSSLIPLKYKCNRCVMVGDPQQLPPTVISMQRPEAVHLLSIQYRMHPD # ISRLPSKIFYEDRLQDGPNMDTKTAQPWHTHSKFGTYRFFNVKGGLEESSGRSTKNRAEAQVAVALFNRLRKDFPSVDFTFRVGIVSMYSAQIRELKI # AFEQRFGREILTQVDFRTVDGFQGQEKDVIILSCVRAGPGVVSIGHVKATLERSNETWRVIVADSKARNIFAEVRGPHIVLLLQLSFVLQVDVSYFTA # PSTMASGTPLTGTSPRKSKQTKPALPVPQHPDLSTPKELKAAALTNPPKSSSSEPLHVNDAAPTPLDKQKGKRKLEEMADPKPDSSHPKSVPPAPSAT # NTRPLPAPHPPRKRPKQSPALFIPKNKNKVRLAVFHYVVYVNSLSIVQRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g50 ### # start gene g51 5_related_000128F AUGUSTUS gene 17616 21054 0.42 - . g51 5_related_000128F AUGUSTUS transcript 17616 21054 0.42 - . g51.t1 5_related_000128F AUGUSTUS stop_codon 17616 17618 . - 0 transcript_id "g51.t1"; gene_id "g51"; 5_related_000128F AUGUSTUS CDS 17616 20015 1 - 0 transcript_id "g51.t1"; gene_id "g51"; 5_related_000128F AUGUSTUS CDS 20092 20415 0.83 - 0 transcript_id "g51.t1"; gene_id "g51"; 5_related_000128F AUGUSTUS CDS 20494 21054 0.45 - 0 transcript_id "g51.t1"; gene_id "g51"; 5_related_000128F AUGUSTUS start_codon 21052 21054 . - 0 transcript_id "g51.t1"; gene_id "g51"; # protein sequence = [MHVLNFRFRYFGAFPEHVMSAFWDSFNNWELEHTLAQISDASGWTDIPTPTLYRMICNFQIFQDSRIQTFLEQHSPSR # SPSDWPAEPIPPAMLVLMMHENDTLRDWAVKQASRCTNIPISQDDALPILYDQALEIIMLPFISTAQARSDSISTRLVTETVTLWSSFYSVLRLLHPK # HLTFFSSKGVDLMLFVIEFKTVLQCFNLVLKRLGKDLWQGEGPEYPQVVFDAFKDNPSLNALLHERDLSPEQNPWFFNWLSEFLHTIRDQPGYSEVVA # KITDFMCEELQHERFSDARPTLLKGQNRDGINSAVANVLDIHAEAFVTVAFASSHQKAEWQIAREATRGLIHTSLMQDIHNIHDAISRCTIVLALSLK # KTEENGSKPHVHDNGHNSMAPLVIREQIWKKIYVHLQPTDTDGLAFLLAVLASAAHLDTVLKNSFGPALAFPGFSALLDSVNRSLEVIRCGFPELTSA # YEMSIAATQVLHHPDVAKDIVKLMLSPVPDLHGGAMGIVTQANDAGSDGRRECFQWLFENFTEESFMGSFELLKVFNDYAPRVPEACSLSKSLVRCFT # DIIGVLCSSHRGLLHRSEYLRSDGPARRIPELWTLMCKTITVIFKRTPSWSQYYKTEVMTEWMRDALIFARDILGERAVFESAAEAADPVVTKSSEIS # KRMLMNLQEILAELSRWLRLTDEELLHQSCTLIHSLLELFREKHDPPQQVVLQKLSKQITDVRNRDSSSLSCRLDPAKLAPLEAILASFDDDDVEIVE # VSKAMPPPKVPAKPIKKAKAEVDIGLKLTSAVSRSLPASTMKTKSARFSAADQERLDAANSMPKFRKPAATSVPNVAPHSTKPSAAGGSSREKGESGS # SSSSDESEEEEEESQRSLMAGLVKLQQSPKVRKQVQRRQVKMLDLPHLKQNAQEARLLKRDEARQKALRFKPDISGLHRTLLSWDYQHDGESPPRTRL # QLRSVPDTFSDFNHYRAVFEPLLLMECWAQLLQSKDESSESYNCRITSRLYNGQWSDLEVIFLSDLRKEWFLTENDVVLLRHPEGKSTVLAKAISFRR # PGKDPAEAGLRCYFPPDARDPGIQIQSLWQISKVFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g51 ### # start gene g52 5_related_000128F AUGUSTUS gene 27692 28012 0.96 + . g52 5_related_000128F AUGUSTUS transcript 27692 28012 0.96 + . g52.t1 5_related_000128F AUGUSTUS start_codon 27692 27694 . + 0 transcript_id "g52.t1"; gene_id "g52"; 5_related_000128F AUGUSTUS CDS 27692 28012 0.96 + 0 transcript_id "g52.t1"; gene_id "g52"; 5_related_000128F AUGUSTUS stop_codon 28010 28012 . + 0 transcript_id "g52.t1"; gene_id "g52"; # protein sequence = [MSISSGPSSLTLEPPSGANPLWKLAEKNGFSEEEAGEEEEEEEIDQLASEEDQEEEDITQEPASGSAPRHYRRAPGTT # LLPGVKIENILQADGKSMKTYFIGKYHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g52 ### # start gene g53 5_related_000128F AUGUSTUS gene 38686 39090 0.96 + . g53 5_related_000128F AUGUSTUS transcript 38686 39090 0.96 + . g53.t1 5_related_000128F AUGUSTUS start_codon 38686 38688 . + 0 transcript_id "g53.t1"; gene_id "g53"; 5_related_000128F AUGUSTUS CDS 38686 39090 0.96 + 0 transcript_id "g53.t1"; gene_id "g53"; 5_related_000128F AUGUSTUS stop_codon 39088 39090 . + 0 transcript_id "g53.t1"; gene_id "g53"; # protein sequence = [MYSDFVAWAKQRLAEGGLTSVDMAEVKRRRERVREEALIEFGRQDEVEAYVKEFEGRKKLKSSFNGTVVNAWTHSKGN # WRKVKTIMTIVREQHGGEEGLLQILMTEGEEGLKERVMNALDEFNRSVAQSSVGLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g53 ### # start gene g54 5_related_000128F AUGUSTUS gene 43006 43873 0.44 + . g54 5_related_000128F AUGUSTUS transcript 43006 43873 0.44 + . g54.t1 5_related_000128F AUGUSTUS start_codon 43006 43008 . + 0 transcript_id "g54.t1"; gene_id "g54"; 5_related_000128F AUGUSTUS CDS 43006 43299 0.44 + 0 transcript_id "g54.t1"; gene_id "g54"; 5_related_000128F AUGUSTUS CDS 43385 43873 0.98 + 0 transcript_id "g54.t1"; gene_id "g54"; 5_related_000128F AUGUSTUS stop_codon 43871 43873 . + 0 transcript_id "g54.t1"; gene_id "g54"; # protein sequence = [MSFEDSVSRLGSAIKDLVASAAKDDPSLAGKSEKDQAEVVQWIEKVGQGDIVKADNFKVRIFWVNIRIIYLPNAQFQD # LNSVLLPRTYIATNYLTAADSKLQPPEYHSHPSITRYFDHIQSIPPVRKAADASSNYTLVSFDLVHTPKIDRTPEPPKKKEKKDKAAPVDSASPPAPA # AAATSTAEAPIDEGKIQKKEKKEKKEKPAVDAAKEGKKESKKGGGGGKAAPADEGEPVPSMIDLRVGHILDGKLLLAQRRASSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g54 ### # start gene g55 5_related_000128F AUGUSTUS gene 48701 49333 0.64 + . g55 5_related_000128F AUGUSTUS transcript 48701 49333 0.64 + . g55.t1 5_related_000128F AUGUSTUS start_codon 48701 48703 . + 0 transcript_id "g55.t1"; gene_id "g55"; 5_related_000128F AUGUSTUS CDS 48701 49333 0.64 + 0 transcript_id "g55.t1"; gene_id "g55"; 5_related_000128F AUGUSTUS stop_codon 49331 49333 . + 0 transcript_id "g55.t1"; gene_id "g55"; # protein sequence = [MAARSIKEEIANCLGLEVASNPKLLAECASRMIFSLMLADVVSAGQKICEIYGITPQDLQYKWEAATYDHTNNFASVR # EAARFTSDSLAGVREQIKRELEQGSGSAKKKTPARSLASGVASINRNKMPFALGRNIHAAQRVLEPQIKAEPDTFNSTELSVSLKGSGVVGPSMVKFR # GPKSDMESKKKRACMLVKNATTSSADDIYRPIHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g55 ### # start gene g56 5_related_000128F AUGUSTUS gene 52546 53052 0.75 - . g56 5_related_000128F AUGUSTUS transcript 52546 53052 0.75 - . g56.t1 5_related_000128F AUGUSTUS stop_codon 52546 52548 . - 0 transcript_id "g56.t1"; gene_id "g56"; 5_related_000128F AUGUSTUS CDS 52546 53052 0.75 - 0 transcript_id "g56.t1"; gene_id "g56"; 5_related_000128F AUGUSTUS start_codon 53050 53052 . - 0 transcript_id "g56.t1"; gene_id "g56"; # protein sequence = [MGRLVILNAPSTFTIIWNAIRPWIAKETANKVDILGADYREQLLELVDEENLPWAVGGKCRCESECQESEGPRCHTSA # TGPWLEGRVGWGPNAKQGEVKQSKPDSETADSAPKTHSEDVEPDVDSSFLRGDSKLIDGLLTPITSESSSSKDTAIEGGNAYTDEEKQIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g56 ### # start gene g57 5_related_000128F AUGUSTUS gene 54608 55429 0.44 + . g57 5_related_000128F AUGUSTUS transcript 54608 55429 0.44 + . g57.t1 5_related_000128F AUGUSTUS start_codon 54608 54610 . + 0 transcript_id "g57.t1"; gene_id "g57"; 5_related_000128F AUGUSTUS CDS 54608 55429 0.44 + 0 transcript_id "g57.t1"; gene_id "g57"; 5_related_000128F AUGUSTUS stop_codon 55427 55429 . + 0 transcript_id "g57.t1"; gene_id "g57"; # protein sequence = [MVGRAHSERQKHRAHSALVEKYMLQAIDLYKTEHEKEHGMSLKNVCNFIAQQCYVDTKQIIKLSDSTLYRRVNNGHSH # KEAKEEQRWLNDEEEEVLIGEVIYWGDRGFPLDHRRLKEHADEIARARHGSSFPINGVGKCWTRRFISDHNEQIGMYWTHSLDNSRARAVNPFNHEHY # FYLLGKVIEGEGGDDVICKDLTYGADESGLQKGVGQKTRGLGGAKKKIQHQQRSGDRENITVLVTICGDGTSIAPAVIYKGEGFQARWKQDNPLNAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g57 ### # start gene g58 5_related_000128F AUGUSTUS gene 56272 56862 0.55 + . g58 5_related_000128F AUGUSTUS transcript 56272 56862 0.55 + . g58.t1 5_related_000128F AUGUSTUS start_codon 56272 56274 . + 0 transcript_id "g58.t1"; gene_id "g58"; 5_related_000128F AUGUSTUS CDS 56272 56862 0.55 + 0 transcript_id "g58.t1"; gene_id "g58"; 5_related_000128F AUGUSTUS stop_codon 56860 56862 . + 0 transcript_id "g58.t1"; gene_id "g58"; # protein sequence = [MFPACTPYELRLQNALLESEARDSTRKDALMEAQAGLVLSNLYSVQVNRQLQAKEEKKSTKGKKRLMGDGKAKLFTGD # EFYQLCVDDEQQRQEDIENANKRRDARQAQAEKISEWKKDNEAIKERNKAKKEEFSVAVAAWEAEKEMAKAEKRKPKWNKPKWKDYNPEKMKPRPKKS # AEDDSDDGDENSGSDDDDSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g58 ### # start gene g59 5_related_000128F AUGUSTUS gene 59268 59567 0.99 + . g59 5_related_000128F AUGUSTUS transcript 59268 59567 0.99 + . g59.t1 5_related_000128F AUGUSTUS start_codon 59268 59270 . + 0 transcript_id "g59.t1"; gene_id "g59"; 5_related_000128F AUGUSTUS CDS 59268 59567 0.99 + 0 transcript_id "g59.t1"; gene_id "g59"; 5_related_000128F AUGUSTUS stop_codon 59565 59567 . + 0 transcript_id "g59.t1"; gene_id "g59"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSESISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGNE # LASFLCESERKESNGHSNQPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g59 ### # start gene g60 5_related_000128F AUGUSTUS gene 61556 63050 0.12 + . g60 5_related_000128F AUGUSTUS transcript 61556 63050 0.12 + . g60.t1 5_related_000128F AUGUSTUS start_codon 61556 61558 . + 0 transcript_id "g60.t1"; gene_id "g60"; 5_related_000128F AUGUSTUS CDS 61556 61972 0.69 + 0 transcript_id "g60.t1"; gene_id "g60"; 5_related_000128F AUGUSTUS CDS 62348 62385 0.58 + 0 transcript_id "g60.t1"; gene_id "g60"; 5_related_000128F AUGUSTUS CDS 62480 63050 0.19 + 1 transcript_id "g60.t1"; gene_id "g60"; 5_related_000128F AUGUSTUS stop_codon 63048 63050 . + 0 transcript_id "g60.t1"; gene_id "g60"; # protein sequence = [MASTSSQTRSSASTTRLPSSLLEAQVMLAGIPSKSTLPLFFESAVFKRLLEGDYSPPVVDSTNSPDYDGSGTFPAFSY # PRSLVPFCFPSDTSRPLSVALGLDLFCSAQMAVRTLQDLVDDSPPTESEIYNVFEEAAPFLMSLPRYEVRFHQRRNRELESLKADASTFCEYQFSSLI # SYFIHLIFVFDSVSSPRSIRSRDSDNELLSGFPSVSSAPVASSSTKISVGKKEPKSKTTVKVVEDSKADHPPPAGMAYKRVRLPPRSRKNTSIALKGK # ARQVVVTEEDSTSNEVESEDEDKDEDTAPPPKRLKTTSSISGNILFFIFRLILFIQFECSFTTSSFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g60 ### # start gene g61 5_related_000128F AUGUSTUS gene 63666 64289 0.42 + . g61 5_related_000128F AUGUSTUS transcript 63666 64289 0.42 + . g61.t1 5_related_000128F AUGUSTUS start_codon 63666 63668 . + 0 transcript_id "g61.t1"; gene_id "g61"; 5_related_000128F AUGUSTUS CDS 63666 63672 0.42 + 0 transcript_id "g61.t1"; gene_id "g61"; 5_related_000128F AUGUSTUS CDS 63736 64289 0.99 + 2 transcript_id "g61.t1"; gene_id "g61"; 5_related_000128F AUGUSTUS stop_codon 64287 64289 . + 0 transcript_id "g61.t1"; gene_id "g61"; # protein sequence = [MHNLANSLRRATDLNDQLKQIGSLFDTARELFLRSILDLQNAGEDPVVVLEALKAAEPNRRAINLNEWTLLATLFRWP # SPFNLSGLDFDNRTPGEWIELLRSIHSGESTASIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGTSSQVGGSIPMELDLPAIKSLAEPALSPEK # GAEPAQTLES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g61 ### # start gene g62 5_related_000128F AUGUSTUS gene 65306 66757 0.28 + . g62 5_related_000128F AUGUSTUS transcript 65306 66757 0.28 + . g62.t1 5_related_000128F AUGUSTUS start_codon 65306 65308 . + 0 transcript_id "g62.t1"; gene_id "g62"; 5_related_000128F AUGUSTUS CDS 65306 65473 0.82 + 0 transcript_id "g62.t1"; gene_id "g62"; 5_related_000128F AUGUSTUS CDS 65980 66060 0.35 + 0 transcript_id "g62.t1"; gene_id "g62"; 5_related_000128F AUGUSTUS CDS 66113 66248 0.79 + 0 transcript_id "g62.t1"; gene_id "g62"; 5_related_000128F AUGUSTUS CDS 66330 66757 1 + 2 transcript_id "g62.t1"; gene_id "g62"; 5_related_000128F AUGUSTUS stop_codon 66755 66757 . + 0 transcript_id "g62.t1"; gene_id "g62"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLMNSASEDELVSGTERSFKQKPT # LSFIKHRRSTPYPTIGSNKGSNKDEKSVVNEVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFN # ANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSVPTTGSEDTVVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g62 ### # start gene g63 5_related_000128F AUGUSTUS gene 67018 67701 0.83 - . g63 5_related_000128F AUGUSTUS transcript 67018 67701 0.83 - . g63.t1 5_related_000128F AUGUSTUS stop_codon 67018 67020 . - 0 transcript_id "g63.t1"; gene_id "g63"; 5_related_000128F AUGUSTUS CDS 67018 67701 0.83 - 0 transcript_id "g63.t1"; gene_id "g63"; 5_related_000128F AUGUSTUS start_codon 67699 67701 . - 0 transcript_id "g63.t1"; gene_id "g63"; # protein sequence = [MILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANK # VAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNESIELPNNIHEL # INLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEEEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g63 ### # start gene g64 5_related_000128F AUGUSTUS gene 67745 70176 0.68 - . g64 5_related_000128F AUGUSTUS transcript 67745 70176 0.68 - . g64.t1 5_related_000128F AUGUSTUS stop_codon 67745 67747 . - 0 transcript_id "g64.t1"; gene_id "g64"; 5_related_000128F AUGUSTUS CDS 67745 70089 0.75 - 2 transcript_id "g64.t1"; gene_id "g64"; 5_related_000128F AUGUSTUS CDS 70170 70176 0.68 - 0 transcript_id "g64.t1"; gene_id "g64"; 5_related_000128F AUGUSTUS start_codon 70174 70176 . - 0 transcript_id "g64.t1"; gene_id "g64"; # protein sequence = [MNRIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSERSCGGTLDLYVGYDERELD # QLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRM # KYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDE # LKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDTSYI # KGMLDNPSCGPNATINHWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFMMGDGETEEPYQFDDFKDQIDPRSG # YLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKNATCEVFSRNLFPTFDKEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDEFLGKMSK # DERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKCMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAP # PTLMHIPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICCWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRI # SAYNSQANGKIERAHLDIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g64 ### # start gene g65 5_related_000128F AUGUSTUS gene 70444 72457 0.16 - . g65 5_related_000128F AUGUSTUS transcript 70444 72457 0.16 - . g65.t1 5_related_000128F AUGUSTUS stop_codon 70444 70446 . - 0 transcript_id "g65.t1"; gene_id "g65"; 5_related_000128F AUGUSTUS CDS 70444 70708 0.73 - 1 transcript_id "g65.t1"; gene_id "g65"; 5_related_000128F AUGUSTUS CDS 70757 70945 0.72 - 1 transcript_id "g65.t1"; gene_id "g65"; 5_related_000128F AUGUSTUS CDS 71038 71294 0.49 - 0 transcript_id "g65.t1"; gene_id "g65"; 5_related_000128F AUGUSTUS CDS 71392 71779 0.75 - 1 transcript_id "g65.t1"; gene_id "g65"; 5_related_000128F AUGUSTUS CDS 71855 72149 0.98 - 2 transcript_id "g65.t1"; gene_id "g65"; 5_related_000128F AUGUSTUS CDS 72221 72386 0.93 - 0 transcript_id "g65.t1"; gene_id "g65"; 5_related_000128F AUGUSTUS CDS 72431 72457 0.54 - 0 transcript_id "g65.t1"; gene_id "g65"; 5_related_000128F AUGUSTUS start_codon 72455 72457 . - 0 transcript_id "g65.t1"; gene_id "g65"; # protein sequence = [MIMFNLGRITNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKILYGETEILDDPSRVQ # MIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSMDYVLPIDSYRSRNYLDP # EFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRARKVETFKLI # PHDIMNQRMLHLIMKNRQQNIVLDGYKRCEQETFSKKELSEAYVLASREHLKSQDDQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDEFN # LNPIKSLGENCDKFESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKEELNRSKIPTDQDSKDKKENIQADVVNEPPTNKLEERIKL # NQQDRSPINLIDETNKQVDNEAIGVEEPINLNTEEVFTKYKPVDKKVNPIKATLPDEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/7 # CDS introns: 0/6 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g65 ### # start gene g66 5_related_000128F AUGUSTUS gene 72732 73112 0.92 - . g66 5_related_000128F AUGUSTUS transcript 72732 73112 0.92 - . g66.t1 5_related_000128F AUGUSTUS stop_codon 72732 72734 . - 0 transcript_id "g66.t1"; gene_id "g66"; 5_related_000128F AUGUSTUS CDS 72732 73112 0.92 - 0 transcript_id "g66.t1"; gene_id "g66"; 5_related_000128F AUGUSTUS start_codon 73110 73112 . - 0 transcript_id "g66.t1"; gene_id "g66"; # protein sequence = [MSTLAGIYEKRLENASRGSKCTSFKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDR # LGNLEATEKMMSVCSTKIVQMEKNKYSNEGAGSVHENFKIQCCSSGGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g66 ### # start gene g67 5_related_000128F AUGUSTUS gene 81855 82457 0.9 - . g67 5_related_000128F AUGUSTUS transcript 81855 82457 0.9 - . g67.t1 5_related_000128F AUGUSTUS stop_codon 81855 81857 . - 0 transcript_id "g67.t1"; gene_id "g67"; 5_related_000128F AUGUSTUS CDS 81855 82457 0.9 - 0 transcript_id "g67.t1"; gene_id "g67"; 5_related_000128F AUGUSTUS start_codon 82455 82457 . - 0 transcript_id "g67.t1"; gene_id "g67"; # protein sequence = [MLHNNLNTLKEPPPGQPRLEFPVAQPSRAVPATSTNGNDGHRSLIAKAVSMSFMLSGKDYTITLSNKSIQTSSQHQGW # KAKSQHWGKIGLIGKILQECSYKDRMQKFRDKIIAKIEEKFDDEMYRLEDRVKAMRKEVEDMSNVSTKLKDKVEELVKEAEARGTTSWARLVELEAGE # VAGMDTAQLLYANAAQAKSVAQYI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g67 ### # # ----- prediction on sequence number 3 (length = 65355, name = 5_related_000139F) ----- # # Predicted genes for sequence number 3 on both strands # start gene g68 5_related_000139F AUGUSTUS gene 2312 2638 0.91 + . g68 5_related_000139F AUGUSTUS transcript 2312 2638 0.91 + . g68.t1 5_related_000139F AUGUSTUS start_codon 2312 2314 . + 0 transcript_id "g68.t1"; gene_id "g68"; 5_related_000139F AUGUSTUS CDS 2312 2638 0.91 + 0 transcript_id "g68.t1"; gene_id "g68"; 5_related_000139F AUGUSTUS stop_codon 2636 2638 . + 0 transcript_id "g68.t1"; gene_id "g68"; # protein sequence = [MITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPP # INNPNSFSRGHINLPFAADVPKTDRNYLQH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g68 ### # start gene g69 5_related_000139F AUGUSTUS gene 3006 4830 0.25 + . g69 5_related_000139F AUGUSTUS transcript 3006 4830 0.25 + . g69.t1 5_related_000139F AUGUSTUS start_codon 3006 3008 . + 0 transcript_id "g69.t1"; gene_id "g69"; 5_related_000139F AUGUSTUS CDS 3006 3327 0.26 + 0 transcript_id "g69.t1"; gene_id "g69"; 5_related_000139F AUGUSTUS CDS 3566 4830 0.49 + 2 transcript_id "g69.t1"; gene_id "g69"; 5_related_000139F AUGUSTUS stop_codon 4828 4830 . + 0 transcript_id "g69.t1"; gene_id "g69"; # protein sequence = [MSTLAGIYEKRLDDAEGGDSKRYKLRDNARMPRDDPNIPRYKKIEQMAKDLGWDRAESYFANMEDDKDDKVMDQQMNP # NVNLAVWMTRIEELSDRLGNLEAHREDDVLRFEAPKSIDRPLKKPSVTIEDVDESDDENTIKLIPSSRPTNQINSKHRPYDHVQPRTYRPIQINTPTK # VPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQ # MIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHNDHPVVVANQSNGLRAVTPEINNKDEEIE # SVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLYVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITI # SDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g69 ### # start gene g70 5_related_000139F AUGUSTUS gene 5367 6517 0.27 + . g70 5_related_000139F AUGUSTUS transcript 5367 6517 0.27 + . g70.t1 5_related_000139F AUGUSTUS start_codon 5367 5369 . + 0 transcript_id "g70.t1"; gene_id "g70"; 5_related_000139F AUGUSTUS CDS 5367 5423 0.37 + 0 transcript_id "g70.t1"; gene_id "g70"; 5_related_000139F AUGUSTUS CDS 5567 6517 0.29 + 0 transcript_id "g70.t1"; gene_id "g70"; 5_related_000139F AUGUSTUS stop_codon 6515 6517 . + 0 transcript_id "g70.t1"; gene_id "g70"; # protein sequence = [MVRYEVLKEGLNHSKDLNRQDRFPINLIEETNKQVVNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIE # RHIHGDPLLELPELLKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPI # PPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCRGTLDLYVGYDERELDQLSR # DMTTSQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPYINSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g70 ### # start gene g71 5_related_000139F AUGUSTUS gene 6711 7304 0.92 + . g71 5_related_000139F AUGUSTUS transcript 6711 7304 0.92 + . g71.t1 5_related_000139F AUGUSTUS start_codon 6711 6713 . + 0 transcript_id "g71.t1"; gene_id "g71"; 5_related_000139F AUGUSTUS CDS 6711 7304 0.92 + 0 transcript_id "g71.t1"; gene_id "g71"; 5_related_000139F AUGUSTUS stop_codon 7302 7304 . + 0 transcript_id "g71.t1"; gene_id "g71"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVQAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKNGIRDCPAL # RPINFDWDVYLVVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRLLRSCTPCNRAKATRCLSAEDE # WDSSEVINNTAVTPLVPGDRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g71 ### # start gene g72 5_related_000139F AUGUSTUS gene 7805 9772 1 + . g72 5_related_000139F AUGUSTUS transcript 7805 9772 1 + . g72.t1 5_related_000139F AUGUSTUS start_codon 7805 7807 . + 0 transcript_id "g72.t1"; gene_id "g72"; 5_related_000139F AUGUSTUS CDS 7805 9772 1 + 0 transcript_id "g72.t1"; gene_id "g72"; 5_related_000139F AUGUSTUS stop_codon 9770 9772 . + 0 transcript_id "g72.t1"; gene_id "g72"; # protein sequence = [MLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATYGPDGLSRITPGGWQTKRPEVNPEDYIDEDGGEPINFIMGDGET # EEPYQFDDFKDQIDPRSGYLHETAQEADDIELDVQEALDEERSYEIRRNHMLESKNATCEVFSRNFFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPL # IGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDNQGRLYHRNTDQPDQPQLVVEKEKRMHVLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWY # VRSCKECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEAQAVKHENARTLGEWFFDNIICRWGCPEEVVTDNAGQM # KNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATSGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNP # PNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYII # AEMDGTVLKEKVGAFRVLPHFMRNESIELPNNIYELINLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEEEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g72 ### # start gene g73 5_related_000139F AUGUSTUS gene 10033 11485 0.23 - . g73 5_related_000139F AUGUSTUS transcript 10033 11485 0.23 - . g73.t1 5_related_000139F AUGUSTUS stop_codon 10033 10035 . - 0 transcript_id "g73.t1"; gene_id "g73"; 5_related_000139F AUGUSTUS CDS 10033 10460 1 - 2 transcript_id "g73.t1"; gene_id "g73"; 5_related_000139F AUGUSTUS CDS 10542 10677 1 - 0 transcript_id "g73.t1"; gene_id "g73"; 5_related_000139F AUGUSTUS CDS 11092 11259 0.27 - 0 transcript_id "g73.t1"; gene_id "g73"; 5_related_000139F AUGUSTUS CDS 11318 11485 0.94 - 0 transcript_id "g73.t1"; gene_id "g73"; 5_related_000139F AUGUSTUS start_codon 11483 11485 . - 0 transcript_id "g73.t1"; gene_id "g73"; # protein sequence = [MPIHHKKDLDIAQVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLEKPVTLCSHVRQVSNLTARQSI # IDTLCLGHKLFPDIVSDSHFEQHLKFMAFANDARNRRSTPYPTTGSNKGSNKDEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSTNL # NTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSSSDSSASDASFATAQSIPTTGSEDTVVTPTENAVSVLK # TVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g73 ### # start gene g74 5_related_000139F AUGUSTUS gene 12504 17519 0.75 - . g74 5_related_000139F AUGUSTUS transcript 12504 17519 0.75 - . g74.t1 5_related_000139F AUGUSTUS stop_codon 12504 12506 . - 0 transcript_id "g74.t1"; gene_id "g74"; 5_related_000139F AUGUSTUS CDS 12504 13051 0.99 - 2 transcript_id "g74.t1"; gene_id "g74"; 5_related_000139F AUGUSTUS CDS 13865 17519 0.75 - 0 transcript_id "g74.t1"; gene_id "g74"; 5_related_000139F AUGUSTUS start_codon 17517 17519 . - 0 transcript_id "g74.t1"; gene_id "g74"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTESPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDNPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLNLANSLRRATDLNDQLKQIGSLFDTARELFLRSILD # LQNAGEDPIVVLEALKTAKPNRRAITLNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIQSGKSTVHIDEHGHLVEASPPPDSATEALEGLK # EVERGSADEGASSPVGGSVPMELDLPTIESLAERTLSPEKGKESAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g74 ### # start gene g75 5_related_000139F AUGUSTUS gene 17570 18736 0.88 - . g75 5_related_000139F AUGUSTUS transcript 17570 18736 0.88 - . g75.t1 5_related_000139F AUGUSTUS stop_codon 17570 17572 . - 0 transcript_id "g75.t1"; gene_id "g75"; 5_related_000139F AUGUSTUS CDS 17570 18736 0.88 - 0 transcript_id "g75.t1"; gene_id "g75"; 5_related_000139F AUGUSTUS start_codon 18734 18736 . - 0 transcript_id "g75.t1"; gene_id "g75"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITINIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g75 ### # start gene g76 5_related_000139F AUGUSTUS gene 20009 20713 0.61 - . g76 5_related_000139F AUGUSTUS transcript 20009 20713 0.61 - . g76.t1 5_related_000139F AUGUSTUS stop_codon 20009 20011 . - 0 transcript_id "g76.t1"; gene_id "g76"; 5_related_000139F AUGUSTUS CDS 20009 20713 0.61 - 0 transcript_id "g76.t1"; gene_id "g76"; 5_related_000139F AUGUSTUS start_codon 20711 20713 . - 0 transcript_id "g76.t1"; gene_id "g76"; # protein sequence = [MMRSVPSKDLDVFASLRGKGSLAVASSIITPSPPLEIKSSTSVSKAPVAPPRLIRRNRELESLKADASTICEYQLNSL # IYYLYSFNSVVVSSPRSTHSKDSDNELLSGFPSAGSASRAFPSSTKVPMGRKEPKPKTTVKVVEDSKASKPTPSAMVYKRVRLPPCSRKIAPTTAKGK # SRQVVVSEDDSASNEVESEDEEEDEGEEEDSAPPPKRLKTTSSISGKTFLFFLLCPFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g76 ### # start gene g77 5_related_000139F AUGUSTUS gene 27004 28473 1 - . g77 5_related_000139F AUGUSTUS transcript 27004 28473 1 - . g77.t1 5_related_000139F AUGUSTUS stop_codon 27004 27006 . - 0 transcript_id "g77.t1"; gene_id "g77"; 5_related_000139F AUGUSTUS CDS 27004 28473 1 - 0 transcript_id "g77.t1"; gene_id "g77"; 5_related_000139F AUGUSTUS start_codon 28471 28473 . - 0 transcript_id "g77.t1"; gene_id "g77"; # protein sequence = [MDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNR # TLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLA # ELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGI # TPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSCYKEQADRKRISHPELPIGSEVFVLAKHIRSTCPTEKFSEKYLGPFKVI # SRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKCCPLRYYIRWASYEGTDDEFSWVAADEL # HADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g77 ### # start gene g78 5_related_000139F AUGUSTUS gene 28562 30085 0.21 - . g78 5_related_000139F AUGUSTUS transcript 28562 30085 0.21 - . g78.t1 5_related_000139F AUGUSTUS stop_codon 28562 28564 . - 0 transcript_id "g78.t1"; gene_id "g78"; 5_related_000139F AUGUSTUS CDS 28562 30085 0.21 - 0 transcript_id "g78.t1"; gene_id "g78"; 5_related_000139F AUGUSTUS start_codon 30083 30085 . - 0 transcript_id "g78.t1"; gene_id "g78"; # protein sequence = [MEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYP # LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRITEGDE # WKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYIL # SPDGLTMSKEKVQTVLDWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETD # ASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNM # VIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g78 ### # start gene g79 5_related_000139F AUGUSTUS gene 31671 33389 0.8 - . g79 5_related_000139F AUGUSTUS transcript 31671 33389 0.8 - . g79.t1 5_related_000139F AUGUSTUS stop_codon 31671 31673 . - 0 transcript_id "g79.t1"; gene_id "g79"; 5_related_000139F AUGUSTUS CDS 31671 33389 0.8 - 0 transcript_id "g79.t1"; gene_id "g79"; 5_related_000139F AUGUSTUS start_codon 33387 33389 . - 0 transcript_id "g79.t1"; gene_id "g79"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSESISAIGQPRRCNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPSVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQHAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDSSDPRKLKTF # FVNLALVFNDRPKYFTDQWKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFN # TLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAP # FTPKPKPFSGGKPNINSKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEE # ESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g79 ### # start gene g80 5_related_000139F AUGUSTUS gene 41456 43147 1 + . g80 5_related_000139F AUGUSTUS transcript 41456 43147 1 + . g80.t1 5_related_000139F AUGUSTUS start_codon 41456 41458 . + 0 transcript_id "g80.t1"; gene_id "g80"; 5_related_000139F AUGUSTUS CDS 41456 43147 1 + 0 transcript_id "g80.t1"; gene_id "g80"; 5_related_000139F AUGUSTUS stop_codon 43145 43147 . + 0 transcript_id "g80.t1"; gene_id "g80"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFNLDTGDHEDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPIPPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKSGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g80 ### # start gene g81 5_related_000139F AUGUSTUS gene 43480 47043 1 + . g81 5_related_000139F AUGUSTUS transcript 43480 47043 1 + . g81.t1 5_related_000139F AUGUSTUS start_codon 43480 43482 . + 0 transcript_id "g81.t1"; gene_id "g81"; 5_related_000139F AUGUSTUS CDS 43480 47043 1 + 0 transcript_id "g81.t1"; gene_id "g81"; 5_related_000139F AUGUSTUS stop_codon 47041 47043 . + 0 transcript_id "g81.t1"; gene_id "g81"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHPDSPQTSVPSAINPVAAKVAV # PLPEPSPSVSPTILETPPGDSLRPRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHICSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g81 ### # start gene g82 5_related_000139F AUGUSTUS gene 51132 51822 0.44 + . g82 5_related_000139F AUGUSTUS transcript 51132 51822 0.44 + . g82.t1 5_related_000139F AUGUSTUS start_codon 51132 51134 . + 0 transcript_id "g82.t1"; gene_id "g82"; 5_related_000139F AUGUSTUS CDS 51132 51333 0.44 + 0 transcript_id "g82.t1"; gene_id "g82"; 5_related_000139F AUGUSTUS CDS 51392 51822 1 + 2 transcript_id "g82.t1"; gene_id "g82"; 5_related_000139F AUGUSTUS stop_codon 51820 51822 . + 0 transcript_id "g82.t1"; gene_id "g82"; # protein sequence = [MVSSTDLDPFVSLRGRNALSGVPKTVSSPKVPDLISPSPANKAQAVPPRALRRNREIESLKADASSFLASPQSIHSKD # SDNELLRGSPSVDPAPRTSTSTKVPVDSKKPKSKTTIKVVEDSKASISSPAGMAYKRVRLPPRSRKIAPATAKGKSRQVVVSEDDSASNEVESEDEEE # DEDEEEDSAPPPKRLKTTSSISGKISFFISLLMF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g82 ### # start gene g83 5_related_000139F AUGUSTUS gene 54131 55584 0.24 + . g83 5_related_000139F AUGUSTUS transcript 54131 55584 0.24 + . g83.t1 5_related_000139F AUGUSTUS start_codon 54131 54133 . + 0 transcript_id "g83.t1"; gene_id "g83"; 5_related_000139F AUGUSTUS CDS 54131 54298 0.43 + 0 transcript_id "g83.t1"; gene_id "g83"; 5_related_000139F AUGUSTUS CDS 54940 55075 0.65 + 0 transcript_id "g83.t1"; gene_id "g83"; 5_related_000139F AUGUSTUS CDS 55157 55584 1 + 2 transcript_id "g83.t1"; gene_id "g83"; 5_related_000139F AUGUSTUS stop_codon 55582 55584 . + 0 transcript_id "g83.t1"; gene_id "g83"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKEEKS # AVNDVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKS # RQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g83 ### # start gene g84 5_related_000139F AUGUSTUS gene 55847 58123 0.38 - . g84 5_related_000139F AUGUSTUS transcript 55847 58123 0.38 - . g84.t1 5_related_000139F AUGUSTUS stop_codon 55847 55849 . - 0 transcript_id "g84.t1"; gene_id "g84"; 5_related_000139F AUGUSTUS CDS 55847 58123 0.38 - 0 transcript_id "g84.t1"; gene_id "g84"; 5_related_000139F AUGUSTUS start_codon 58121 58123 . - 0 transcript_id "g84.t1"; gene_id "g84"; # protein sequence = [MDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLA # LEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPELNPEDYVDEDGGEPINFIM # GDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLKSKDATCEVFVRNLFPTFDEEFVQNNPYPEAHRSSEGNRLD # ELIPLIGKYLSNPSDESLGEMSKYERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYK # DVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTD # NAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVEST # WLVNPPNRILTRGELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKG # GSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPRLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g84 ### # start gene g85 5_related_000139F AUGUSTUS gene 58237 59655 0.39 - . g85 5_related_000139F AUGUSTUS transcript 58237 59655 0.39 - . g85.t1 5_related_000139F AUGUSTUS stop_codon 58237 58239 . - 0 transcript_id "g85.t1"; gene_id "g85"; 5_related_000139F AUGUSTUS CDS 58237 59655 0.39 - 0 transcript_id "g85.t1"; gene_id "g85"; 5_related_000139F AUGUSTUS start_codon 59653 59655 . - 0 transcript_id "g85.t1"; gene_id "g85"; # protein sequence = [MVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPINKLEERIKLNQQDRSPINLIDE # TNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFAPTGRYTEERKEIIDKNHPEGFLWEQERD # LMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLE # PLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDD # VPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPPVVIRLRFE # HS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g85 ### # start gene g86 5_related_000139F AUGUSTUS gene 60191 61530 0.9 - . g86 5_related_000139F AUGUSTUS transcript 60191 61530 0.9 - . g86.t1 5_related_000139F AUGUSTUS stop_codon 60191 60193 . - 0 transcript_id "g86.t1"; gene_id "g86"; 5_related_000139F AUGUSTUS CDS 60191 61234 0.9 - 0 transcript_id "g86.t1"; gene_id "g86"; 5_related_000139F AUGUSTUS CDS 61279 61530 0.9 - 0 transcript_id "g86.t1"; gene_id "g86"; 5_related_000139F AUGUSTUS start_codon 61528 61530 . - 0 transcript_id "g86.t1"; gene_id "g86"; # protein sequence = [MGCIYQKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPMIM # FNLGRITNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRV # QMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEI # ESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEIT # ISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g86 ### # start gene g87 5_related_000139F AUGUSTUS gene 61778 62053 0.49 - . g87 5_related_000139F AUGUSTUS transcript 61778 62053 0.49 - . g87.t1 5_related_000139F AUGUSTUS stop_codon 61778 61780 . - 0 transcript_id "g87.t1"; gene_id "g87"; 5_related_000139F AUGUSTUS CDS 61778 62053 0.49 - 0 transcript_id "g87.t1"; gene_id "g87"; 5_related_000139F AUGUSTUS start_codon 62051 62053 . - 0 transcript_id "g87.t1"; gene_id "g87"; # protein sequence = [MFLVQVDRSFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMED # DEDDKSHGPADES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g87 ### # # ----- prediction on sequence number 4 (length = 23041, name = 5_related_000185F) ----- # # Predicted genes for sequence number 4 on both strands # start gene g88 5_related_000185F AUGUSTUS gene 1 729 0.54 + . g88 5_related_000185F AUGUSTUS transcript 1 729 0.54 + . g88.t1 5_related_000185F AUGUSTUS CDS 83 107 0.99 + 1 transcript_id "g88.t1"; gene_id "g88"; 5_related_000185F AUGUSTUS CDS 202 205 1 + 0 transcript_id "g88.t1"; gene_id "g88"; 5_related_000185F AUGUSTUS CDS 272 729 0.56 + 2 transcript_id "g88.t1"; gene_id "g88"; 5_related_000185F AUGUSTUS stop_codon 727 729 . + 0 transcript_id "g88.t1"; gene_id "g88"; # protein sequence = [RNTGLFGLLMITRSDEALCNVCRKCSITTVCSTAPRASSSTKVPVGRKEPKSKTTIKVVEDSKASKPTPSAMAYKRVQ # LPPRSRKITPTTTKGKSQQVAVSDNDLTSNEVESEDEDEDEDTAPPPKCLKTTSSISGKFLFFILCLILLIQFDCSFTTSSFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # RM: 1 # incompatible hint groups: 0 # end gene g88 ### # start gene g89 5_related_000185F AUGUSTUS gene 6241 6945 0.31 + . g89 5_related_000185F AUGUSTUS transcript 6241 6945 0.31 + . g89.t1 5_related_000185F AUGUSTUS start_codon 6241 6243 . + 0 transcript_id "g89.t1"; gene_id "g89"; 5_related_000185F AUGUSTUS CDS 6241 6451 0.33 + 0 transcript_id "g89.t1"; gene_id "g89"; 5_related_000185F AUGUSTUS CDS 6509 6945 0.97 + 2 transcript_id "g89.t1"; gene_id "g89"; 5_related_000185F AUGUSTUS stop_codon 6943 6945 . + 0 transcript_id "g89.t1"; gene_id "g89"; # protein sequence = [MMRLAPSKDLDVFASLRGKVSPAVTSKITTPSPPLEIKPSTPAPKAPVAPPRLIRRNRELENLKTDASSFLASPRSAR # SKDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRSRKVAPAASKGKARQIVVTDEDSASNEVESED # EDEEEDSAPPPKRLKTTSSISGKVYSSFISFYFTNLMGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g89 ### # start gene g90 5_related_000185F AUGUSTUS gene 10989 12944 0.36 - . g90 5_related_000185F AUGUSTUS transcript 10989 12944 0.36 - . g90.t1 5_related_000185F AUGUSTUS stop_codon 10989 10991 . - 0 transcript_id "g90.t1"; gene_id "g90"; 5_related_000185F AUGUSTUS CDS 10989 11538 0.39 - 1 transcript_id "g90.t1"; gene_id "g90"; 5_related_000185F AUGUSTUS CDS 12131 12263 0.38 - 2 transcript_id "g90.t1"; gene_id "g90"; 5_related_000185F AUGUSTUS CDS 12515 12944 0.98 - 0 transcript_id "g90.t1"; gene_id "g90"; 5_related_000185F AUGUSTUS start_codon 12942 12944 . - 0 transcript_id "g90.t1"; gene_id "g90"; # protein sequence = [MLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGET # EEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDAHVKSSLGILVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKR # FWWPDIYKDVEXILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIR # RTKGGSYIIAEMDGTILKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEDWMSPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g90 ### # start gene g91 5_related_000185F AUGUSTUS gene 13085 13444 0.99 - . g91 5_related_000185F AUGUSTUS transcript 13085 13444 0.99 - . g91.t1 5_related_000185F AUGUSTUS stop_codon 13085 13087 . - 0 transcript_id "g91.t1"; gene_id "g91"; 5_related_000185F AUGUSTUS CDS 13085 13444 0.99 - 0 transcript_id "g91.t1"; gene_id "g91"; 5_related_000185F AUGUSTUS start_codon 13442 13444 . - 0 transcript_id "g91.t1"; gene_id "g91"; # protein sequence = [MPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFSITLDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g91 ### # start gene g92 5_related_000185F AUGUSTUS gene 13471 16778 0.89 - . g92 5_related_000185F AUGUSTUS transcript 13471 16778 0.89 - . g92.t1 5_related_000185F AUGUSTUS stop_codon 13471 13473 . - 0 transcript_id "g92.t1"; gene_id "g92"; 5_related_000185F AUGUSTUS CDS 13471 15251 0.99 - 2 transcript_id "g92.t1"; gene_id "g92"; 5_related_000185F AUGUSTUS CDS 15326 16778 0.9 - 0 transcript_id "g92.t1"; gene_id "g92"; 5_related_000185F AUGUSTUS start_codon 16776 16778 . - 0 transcript_id "g92.t1"; gene_id "g92"; # protein sequence = [MKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLK # KPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD # LSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESF # LRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTL # GLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKS # TGENDLKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFL # QNGRIKPKPIRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRIVRYEILKRGTESFQRSQPSFEKVRY # ESRQRKKGKAQDSKDKKENVQADVVTEPPINKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFR # IERHIHGDPLLELPELSKHPKPFAPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNI # PIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQL # SRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKY # AGGTFSEPKHFFVVRKQLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g92 ### # start gene g93 5_related_000185F AUGUSTUS gene 16918 17845 0.23 - . g93 5_related_000185F AUGUSTUS transcript 16918 17845 0.23 - . g93.t1 5_related_000185F AUGUSTUS stop_codon 16918 16920 . - 0 transcript_id "g93.t1"; gene_id "g93"; 5_related_000185F AUGUSTUS CDS 16918 17525 0.52 - 2 transcript_id "g93.t1"; gene_id "g93"; 5_related_000185F AUGUSTUS CDS 17665 17845 0.27 - 0 transcript_id "g93.t1"; gene_id "g93"; 5_related_000185F AUGUSTUS start_codon 17843 17845 . - 0 transcript_id "g93.t1"; gene_id "g93"; # protein sequence = [MITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSIETQSRRRIKDLLGIKL # ESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPKSSNGTQWACF # LCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWIVLNPILQTWKMTKMIKSWTSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g93 ### # start gene g94 5_related_000185F AUGUSTUS gene 18107 18307 0.42 - . g94 5_related_000185F AUGUSTUS transcript 18107 18307 0.42 - . g94.t1 5_related_000185F AUGUSTUS stop_codon 18107 18109 . - 0 transcript_id "g94.t1"; gene_id "g94"; 5_related_000185F AUGUSTUS CDS 18107 18307 0.42 - 0 transcript_id "g94.t1"; gene_id "g94"; 5_related_000185F AUGUSTUS start_codon 18305 18307 . - 0 transcript_id "g94.t1"; gene_id "g94"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGLHLTRLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g94 ### # # ----- prediction on sequence number 5 (length = 29030, name = 5_related_000175F) ----- # # Predicted genes for sequence number 5 on both strands # start gene g95 5_related_000175F AUGUSTUS gene 6369 8924 0.14 + . g95 5_related_000175F AUGUSTUS transcript 6369 8924 0.14 + . g95.t1 5_related_000175F AUGUSTUS start_codon 6369 6371 . + 0 transcript_id "g95.t1"; gene_id "g95"; 5_related_000175F AUGUSTUS CDS 6369 7464 0.23 + 0 transcript_id "g95.t1"; gene_id "g95"; 5_related_000175F AUGUSTUS CDS 7628 7669 0.26 + 2 transcript_id "g95.t1"; gene_id "g95"; 5_related_000175F AUGUSTUS CDS 7726 8924 0.75 + 2 transcript_id "g95.t1"; gene_id "g95"; 5_related_000175F AUGUSTUS stop_codon 8922 8924 . + 0 transcript_id "g95.t1"; gene_id "g95"; # protein sequence = [MPSSPSKAPTAAGPSRLPLPRSSSGREVASDGEVEQDQLAFTIESPSLPQLQLFENIFNTGKSLAVYCRDDPLWPILA # AVALPCSNCTKHPETCKVPEGSPRCSFCTGKKTCSLGKLLRYRYFARRCNQDLAYSRRFLELHGTLAQRVSWTILEDVWHRYDELLHSSTSATKVLVE # LNMLDDQDSQAVDRSELRRFQEAQEQEALLAARRKRVNASPPPKVRSKKRRLTKVVEEPVIEEVPRLVRLVIPPSRPAPSAPGSAPSTFARSSAALPL # ISVQATGQLGSVQGPSPLARLADLVDQQTDSQAEASTRSLGPGSSPIKASLGDSNLPKMSPVVRPPLFLVSSPSILIVSKTNVLLLASVCWSSDVEAC # PAWTSQRVDRFRGLEEDLRLARESRAKYLSRFESSNRRNEELETSLIQQQSLVDESNALAVRQRKKIETLQEEVHLFRERALFAEKMIREYPDEGSYS # VSLPPLAEVQGDLNDTLASLRRVSTFAHRLYRCDPASVLHQHNRYVGVIIDAVISFLRRGLDTSDEDVLARNFQLALQYLEAAHFIHAELHLRSLSSI # QWFFANAAEREEGIYRLILAHSRFSDDAPFLNVAQHAGFVAPFDDSLEPPLHRRMFALDTALPHHGAGNWEDLVPALPSLDRLTQEWEAMMSSYIRFV # TDTPLPPVDLQEEGSADHEEVSVLQEGESGGTAAVPLFLPDSLSATPVASAASPSPLPPRFGSVANLAIDMTADEDEEDIYESSGSVECRNRVEGNPG # GDDPMEGAPVGQGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g95 ### # start gene g96 5_related_000175F AUGUSTUS gene 9173 12421 0.81 - . g96 5_related_000175F AUGUSTUS transcript 9173 12421 0.81 - . g96.t1 5_related_000175F AUGUSTUS stop_codon 9173 9175 . - 0 transcript_id "g96.t1"; gene_id "g96"; 5_related_000175F AUGUSTUS CDS 9173 12421 0.81 - 0 transcript_id "g96.t1"; gene_id "g96"; 5_related_000175F AUGUSTUS start_codon 12419 12421 . - 0 transcript_id "g96.t1"; gene_id "g96"; # protein sequence = [MDRLLREGTPAYFLHISPTKEESPTEEMLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKRS # IPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPMGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALN # KITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNIRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILI # YSDDKVSHVEHVRKVLERLWANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTK # LLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHAQSMISAELNYDIYNKELLAIVDCFKQ # WRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATIL # MNKDLLVNRVREAPKDTSVIEALKRIARNEEESLVWEDGLLKRGGRIYVPDIGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYV # RSCHSCLRAKASRAKPYGNLRPLPIGQRPWSSISLDHITQLPVTAGPEKYDAILVVVGRLTKQAIYVPCHTTDNAEDFANLFVTHVFSKHGMPSDITS # DRGSLFVSQFWRELCRVLGIEARLSTAYHPQTDGQTERVNQSVEAYLRIYCAYDQDDWDLLLPIAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLER # VQGAEVNEYASNLKELHTYLQGRIRVANEAYAKYANQKRQDAPDWKEGDHVWLNMENVRTRRPMKKLDHKWTGPYSILAKIGSHAYRLDLPGDLHKIH # NVFHVDRLKPHFHDKFKRRNSPPPPVFIKGKTEHFVESVLDSKPIRGRPEEIEYLVKWEGYGDEFNSWVEWEGMVGSIELLRDWHQQHPRKRQPSRPH # WASLEREAQEDEGEDREDSRERSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g96 ### # start gene g97 5_related_000175F AUGUSTUS gene 12770 13429 0.69 - . g97 5_related_000175F AUGUSTUS transcript 12770 13429 0.69 - . g97.t1 5_related_000175F AUGUSTUS stop_codon 12770 12772 . - 0 transcript_id "g97.t1"; gene_id "g97"; 5_related_000175F AUGUSTUS CDS 12770 13429 0.69 - 0 transcript_id "g97.t1"; gene_id "g97"; 5_related_000175F AUGUSTUS start_codon 13427 13429 . - 0 transcript_id "g97.t1"; gene_id "g97"; # protein sequence = [MRHPENLVDLTDSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTQLHPTAPIVLGLPWLRTHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGVEGGTEELGRGVNSEEIHAGTLQSPPEAPQRPPEAPQPPPEASQQPPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g97 ### # start gene g98 5_related_000175F AUGUSTUS gene 14974 19275 0.96 + . g98 5_related_000175F AUGUSTUS transcript 14974 19275 0.96 + . g98.t1 5_related_000175F AUGUSTUS start_codon 14974 14976 . + 0 transcript_id "g98.t1"; gene_id "g98"; 5_related_000175F AUGUSTUS CDS 14974 19275 0.96 + 0 transcript_id "g98.t1"; gene_id "g98"; 5_related_000175F AUGUSTUS stop_codon 19273 19275 . + 0 transcript_id "g98.t1"; gene_id "g98"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRYTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPVPQLDMESASNAGGRVSGQVAAIERIQGESTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQPLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEI # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMR # HMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLTQKH # SSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSN # PSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAPFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTAG # EVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQATEPISFNRNTPIGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEY # GRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRRE # EDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYA # REKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTY # LKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRSLHGEKALQGWLSRFPGLELAPEAPYKSPLRRERDPADVWTSNPKPAATGRFP # NRPNWKEGRQRASAAWGEGESYDSENREEDEDCCHCRDGGEWTEAVLRAGVTDTGRKWTPEERAEKWRRRRQELCMRCGRKEHWAKDCPNPESLERPV # EDQGSSERASKADSTRGRGTANQGGGRKDDSTRPLERIRAGIVVEEREGMDDLWNVHILDSPKGGEQELLDEVGNGQGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g98 ### # start gene g99 5_related_000175F AUGUSTUS gene 19488 23582 0.93 + . g99 5_related_000175F AUGUSTUS transcript 19488 23582 0.93 + . g99.t1 5_related_000175F AUGUSTUS start_codon 19488 19490 . + 0 transcript_id "g99.t1"; gene_id "g99"; 5_related_000175F AUGUSTUS CDS 19488 23582 0.93 + 0 transcript_id "g99.t1"; gene_id "g99"; 5_related_000175F AUGUSTUS stop_codon 23580 23582 . + 0 transcript_id "g99.t1"; gene_id "g99"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGKEIHAGTLQSPPEAPQRPPEAPQPPPETSQQPPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASDSSA # TEGVQQPKDPESGDPSSEQGGVVRELDKEESRRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKE # YIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGS # FEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEASHVGHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEK # VKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTSQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILS # QLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLG # AKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALKRIARNEEESFVWEDGLIKRGGRIYVPDVGTLR # REVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPATAGPEKYDAILVV # VCRLTKQAIYVPCHTTDKAEDFANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQD # DWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQEAEVNEYASNLKELHTYLQERIEVANKVYAKYANQKRQEAPDWKEGDQVWLNME # NVRTRRPMKKLDHKWTGPYTVLSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGKTEHFVEDILDSKPKKGRPEEVEYLV # NGKGIMMSSTPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g99 ### # start gene g100 5_related_000175F AUGUSTUS gene 23972 24313 0.77 - . g100 5_related_000175F AUGUSTUS transcript 23972 24313 0.77 - . g100.t1 5_related_000175F AUGUSTUS stop_codon 23972 23974 . - 0 transcript_id "g100.t1"; gene_id "g100"; 5_related_000175F AUGUSTUS CDS 23972 24313 0.77 - 0 transcript_id "g100.t1"; gene_id "g100"; 5_related_000175F AUGUSTUS start_codon 24311 24313 . - 0 transcript_id "g100.t1"; gene_id "g100"; # protein sequence = [MSSTGPVPESSDETNVEQSFEAPIVPVSSPSGGSHPPVPLFLSEQESPTSPSPPPRSSVPPLLFGSVASLSIDLTGDD # DELYETEEAYASRIDVAMEGTELAVDQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g100 ### # # ----- prediction on sequence number 6 (length = 90170, name = 5_related_000125F) ----- # # Predicted genes for sequence number 6 on both strands # start gene g101 5_related_000125F AUGUSTUS gene 1928 5641 0.47 - . g101 5_related_000125F AUGUSTUS transcript 1928 5641 0.47 - . g101.t1 5_related_000125F AUGUSTUS stop_codon 1928 1930 . - 0 transcript_id "g101.t1"; gene_id "g101"; 5_related_000125F AUGUSTUS CDS 1928 4204 0.54 - 0 transcript_id "g101.t1"; gene_id "g101"; 5_related_000125F AUGUSTUS CDS 4292 5641 0.5 - 0 transcript_id "g101.t1"; gene_id "g101"; 5_related_000125F AUGUSTUS start_codon 5639 5641 . - 0 transcript_id "g101.t1"; gene_id "g101"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWERGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSRSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSE # SASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLV # ADIISRLQGARYFTKFDVCWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAHDLYLRPEKCEFEQQQIEYL # GLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALWAPDRPTR # IEVDASGFATGGALMQQQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLS # RFDFHMIHHPGRVNTQADALSRMAVHHVSDSDNNQQQTVLKPGHFTKIAASILWNPLEDRIRKASEREAQVLEGLETVKKHGLQRLANGIAEWEEDNG # LVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQ # LPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEV # EKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYVPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKA # HQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEI # LDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g101 ### # start gene g102 5_related_000125F AUGUSTUS gene 5920 6729 0.93 - . g102 5_related_000125F AUGUSTUS transcript 5920 6729 0.93 - . g102.t1 5_related_000125F AUGUSTUS stop_codon 5920 5922 . - 0 transcript_id "g102.t1"; gene_id "g102"; 5_related_000125F AUGUSTUS CDS 5920 6729 0.93 - 0 transcript_id "g102.t1"; gene_id "g102"; 5_related_000125F AUGUSTUS start_codon 6727 6729 . - 0 transcript_id "g102.t1"; gene_id "g102"; # protein sequence = [MNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLK # EFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPT # MTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLAHMRGRCFGCGAQGHVKQNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g102 ### # start gene g103 5_related_000125F AUGUSTUS gene 11078 12007 0.64 + . g103 5_related_000125F AUGUSTUS transcript 11078 12007 0.64 + . g103.t1 5_related_000125F AUGUSTUS start_codon 11078 11080 . + 0 transcript_id "g103.t1"; gene_id "g103"; 5_related_000125F AUGUSTUS CDS 11078 12007 0.64 + 0 transcript_id "g103.t1"; gene_id "g103"; 5_related_000125F AUGUSTUS stop_codon 12005 12007 . + 0 transcript_id "g103.t1"; gene_id "g103"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLWERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g103 ### # start gene g104 5_related_000125F AUGUSTUS gene 12295 16011 0.92 + . g104 5_related_000125F AUGUSTUS transcript 12295 16011 0.92 + . g104.t1 5_related_000125F AUGUSTUS start_codon 12295 12297 . + 0 transcript_id "g104.t1"; gene_id "g104"; 5_related_000125F AUGUSTUS CDS 12295 16011 0.92 + 0 transcript_id "g104.t1"; gene_id "g104"; 5_related_000125F AUGUSTUS stop_codon 16009 16011 . + 0 transcript_id "g104.t1"; gene_id "g104"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFKEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGAKYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDNPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGIADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKQKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVQWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g104 ### # start gene g105 5_related_000125F AUGUSTUS gene 16492 18735 0.91 - . g105 5_related_000125F AUGUSTUS transcript 16492 18735 0.91 - . g105.t1 5_related_000125F AUGUSTUS stop_codon 16492 16494 . - 0 transcript_id "g105.t1"; gene_id "g105"; 5_related_000125F AUGUSTUS CDS 16492 18735 0.91 - 0 transcript_id "g105.t1"; gene_id "g105"; 5_related_000125F AUGUSTUS start_codon 18733 18735 . - 0 transcript_id "g105.t1"; gene_id "g105"; # protein sequence = [MPFGLTNAPSTFQFFINEIFHDMVDVCVVIYLDDILIYSDDEESHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYL # GVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSKAPVLGHYNPDLPVV # LECDASDLAIAGILSQLDPETGEIHPITFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELL # SGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALRRIARKEEESLVWEDGLI # KRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLNHITQL # PATAGPEKYDAILVVVCRLTKQAIYVPCHTTDNAEDFANLFITHVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQ # SVEAYLRIYCSYDQDDWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIRVANEAYARYANQRRQE # APDWKEGDYVWLNMENVRTRRPMKKLDHKWTGPYSILSKIGTHAYRLDLPGDLHKIHNVFHVDRLKPHFHDNVTKRQRRSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g105 ### # start gene g106 5_related_000125F AUGUSTUS gene 19129 20730 0.96 - . g106 5_related_000125F AUGUSTUS transcript 19129 20730 0.96 - . g106.t1 5_related_000125F AUGUSTUS stop_codon 19129 19131 . - 0 transcript_id "g106.t1"; gene_id "g106"; 5_related_000125F AUGUSTUS CDS 19129 20730 0.96 - 0 transcript_id "g106.t1"; gene_id "g106"; 5_related_000125F AUGUSTUS start_codon 20728 20730 . - 0 transcript_id "g106.t1"; gene_id "g106"; # protein sequence = [MHNPVIDWKELCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHEGTLQPPPEAPQQPPEAPQPPPEVPQ # QSLEAPLRAPRMGVKLEEIKDEEYEASQPGPHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSR # DTERSSSWPGAKQKVRWRKKRREHGPYPDLPTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTMQGNPISLIGAAGMDRLLR # EGTPAYFLHISPTKKESPTEEILRASDSNDPERVQQPKDPENGNPGPEQGGVIKELDEEVSKRQETEELKKSIPVQYQDYLDIFSPGEARTLPLHRPY # DIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLWKAKIF # TKIDLCVIKYAAPIIFPFSPSRRLYLYNTSSHRCQSPSITDLSITDPPDPPSLSIGFRLLPCP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g106 ### # start gene g107 5_related_000125F AUGUSTUS gene 21147 23249 0.96 - . g107 5_related_000125F AUGUSTUS transcript 21147 23249 0.96 - . g107.t1 5_related_000125F AUGUSTUS stop_codon 21147 21149 . - 0 transcript_id "g107.t1"; gene_id "g107"; 5_related_000125F AUGUSTUS CDS 21147 23249 0.96 - 0 transcript_id "g107.t1"; gene_id "g107"; 5_related_000125F AUGUSTUS start_codon 23247 23249 . - 0 transcript_id "g107.t1"; gene_id "g107"; # protein sequence = [MIQQQAQVIETLQEQLREVRKGFATGEIPTGGPIPKTGNMAGVSGQAPMVMIEGTRGGPSPVVPQPRSWQATEPISFT # RRTPIGVKEGNPQEGQTAPLPATPSVDRGRIQEWGARVQRAELGEYVRPEGGRYAVEDDGVAASGGGRGGFCPPDREPPPHLSSQTRDRERPLSQGGR # DQRRQEERSGGGAPPPPPPPPPPSGGPGDNDSEGSNKGERTQSSRNGGRNGDDGVELPTGAPEVPPTRYDLDQPWYYDPKQGWHRKAAPRNPNEGRNT # WESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLSREYTCLKDWTEFKREFG # SKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTRFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDRAVRAQAESLRNL # HGEKVLQGWLSRFPGLELAPEAPYKSPLRREREPAEVWTSNSKPAATGRFPNRSNWKEGRQRASAAWGEGESYDSKNREEDEDCCHCRDGGEWTEAVL # RAGVTDTGRKWTPEERAEKWRRRRQELCMRCGRKEHWAKDCPNPESLECPVEDQGSSDRASKADSTRGRGTANQGGGRKDDSTRPLERIRAGIVVEER # EGMDDLWNVHILDSPKGGEQELLDEVGNGQGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g107 ### # start gene g108 5_related_000125F AUGUSTUS gene 23990 25615 1 + . g108 5_related_000125F AUGUSTUS transcript 23990 25615 1 + . g108.t1 5_related_000125F AUGUSTUS start_codon 23990 23992 . + 0 transcript_id "g108.t1"; gene_id "g108"; 5_related_000125F AUGUSTUS CDS 23990 25615 1 + 0 transcript_id "g108.t1"; gene_id "g108"; 5_related_000125F AUGUSTUS stop_codon 25613 25615 . + 0 transcript_id "g108.t1"; gene_id "g108"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSESISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRCGQPPMVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSSVSPDIPNEHRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPFGSSAPFTPKPKPFS # GGKPNCHALATTRPVLVPTARYHTSYPPPVCPLHLPKYHQTPPQVFLTQLPKRPSPRHAYENPLADNPFKY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g108 ### # start gene g109 5_related_000125F AUGUSTUS gene 27565 30645 0.87 + . g109 5_related_000125F AUGUSTUS transcript 27565 30645 0.87 + . g109.t1 5_related_000125F AUGUSTUS start_codon 27565 27567 . + 0 transcript_id "g109.t1"; gene_id "g109"; 5_related_000125F AUGUSTUS CDS 27565 30645 0.87 + 0 transcript_id "g109.t1"; gene_id "g109"; 5_related_000125F AUGUSTUS stop_codon 30643 30645 . + 0 transcript_id "g109.t1"; gene_id "g109"; # protein sequence = [MEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGTSLPLGRIYP # LSEKELVALKDFIDKQLATAAITPSSSLHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDE # WKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYTNPKKCEFNMDTVEYLGYIL # SPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWELNCPLIMETD # ASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRQQVRWSEFLHQFNM # VIRFRLGKLGEKPDSITRRWDVYPNEGDIGCAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIMGIEALHQAIILALPADPSSVAGLELAKDPS # NERWSLGSDKLLRLDDHIYVPNHGDLRPQVLHYFHDHPLSGHFGQNCTLEAVRRQYTWPKVRDFVGDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRP # WDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDCGSKFVSAFFQALGKALSMELHYTSGYHPEA # DGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHIFLREEILLAQSRY # KEQADRKRISHPEFPIGSEVFVLAKHIRSTCPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDG # EEEYNVAEILDSKRDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g109 ### # start gene g110 5_related_000125F AUGUSTUS gene 33014 35227 1 - . g110 5_related_000125F AUGUSTUS transcript 33014 35227 1 - . g110.t1 5_related_000125F AUGUSTUS stop_codon 33014 33016 . - 0 transcript_id "g110.t1"; gene_id "g110"; 5_related_000125F AUGUSTUS CDS 33014 35227 1 - 0 transcript_id "g110.t1"; gene_id "g110"; 5_related_000125F AUGUSTUS start_codon 35225 35227 . - 0 transcript_id "g110.t1"; gene_id "g110"; # protein sequence = [MSATSTERPSSSKIEPKKQKSALSHGNTTQAQKSNQAASSTVITVAAGQHLMSIPEQSFGDETASNVRTPEGRQPAVE # EPPPVELGMGPPQRRYTSMGYAQPASSPMGGFAYSPTWGMRGPPPGLVPQLDMESALNTGGRVSGQVAAIERIQGESTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLRSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGVEI # LGDGLEFSDVRVQFLTVGTQLEIDLPEKAQQWLMTLANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQVIQILRNANLAAAAAKIDEESNEDANAIAAKNRRRRRYTMAHLLAPVESMPDQDSPVRVRSGQTVYTYTPMR # HMHQLLVMSEESEAMLCLQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPREQFDQKGQLHGSDGRFLAQKH # SSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSN # PSVIPYQGSVSMQSQAVGMESQRGPNQRRTLAVHEEAVPPQGAPFGTPFVTGAQTNRPGVAFDSARSQESC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g110 ### # start gene g111 5_related_000125F AUGUSTUS gene 37664 38623 0.3 - . g111 5_related_000125F AUGUSTUS transcript 37664 38623 0.3 - . g111.t1 5_related_000125F AUGUSTUS stop_codon 37664 37666 . - 0 transcript_id "g111.t1"; gene_id "g111"; 5_related_000125F AUGUSTUS CDS 37664 38623 0.3 - 0 transcript_id "g111.t1"; gene_id "g111"; 5_related_000125F AUGUSTUS start_codon 38621 38623 . - 0 transcript_id "g111.t1"; gene_id "g111"; # protein sequence = [MPAPHSPTIWTISHILVSFQRAIAEFDLPGKIIATHSHPGGIDLQAIRKVAGFLSHAAGLFCSFCNCHKDDIEDLDYN # SWQMRDGATVCAQAMEWQNLVTVTAKETLAWQTRVRWTPMHNFPYWNPAKYVVLGFMHNFLEGILAFQLRALWGIGRTKEMLKSITQILDDESSSSID # TDELVQESQDLEIEAEHASQHESATGLTENFDHMDVDDEGGEVDDEHEPTPMPQLFIPLDDEGDEIDEDFVPLDVETAFDFTPEQLSNIRNCILHVLL # PASSDRPPQTLEKLAMVNSKHMNYLYCLLSFCPLLFRNYGGKAMK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g111 ### # start gene g112 5_related_000125F AUGUSTUS gene 38947 39757 0.51 - . g112 5_related_000125F AUGUSTUS transcript 38947 39757 0.51 - . g112.t1 5_related_000125F AUGUSTUS stop_codon 38947 38949 . - 0 transcript_id "g112.t1"; gene_id "g112"; 5_related_000125F AUGUSTUS CDS 38947 39422 0.52 - 2 transcript_id "g112.t1"; gene_id "g112"; 5_related_000125F AUGUSTUS CDS 39490 39757 0.9 - 0 transcript_id "g112.t1"; gene_id "g112"; 5_related_000125F AUGUSTUS start_codon 39755 39757 . - 0 transcript_id "g112.t1"; gene_id "g112"; # protein sequence = [MPPKPKVICTCSICSKLTCENKHGIRVPGCKVSPQTRNEHLKKDRESRDKGNIPFTPEPPTAPSSETSGNQLSEENTP # SQSQKVPDLSAEPVFQMCWLLAAWLSLCAGVSRKTVNTVLKCLHLIITTILILIYTSLQGLGYGVSTVIPKIDIPKDIRTVYARAQLEPELVRIFCCP # TCFTQYPADSTTRKCTWKKSPRSKPCGTDMWTTRHTRTGLKQIPKCLYTTQDLGSWLKFFLSRPQIDECLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g112 ### # start gene g113 5_related_000125F AUGUSTUS gene 39990 43097 1 - . g113 5_related_000125F AUGUSTUS transcript 39990 43097 1 - . g113.t1 5_related_000125F AUGUSTUS stop_codon 39990 39992 . - 0 transcript_id "g113.t1"; gene_id "g113"; 5_related_000125F AUGUSTUS CDS 39990 43097 1 - 0 transcript_id "g113.t1"; gene_id "g113"; 5_related_000125F AUGUSTUS start_codon 43095 43097 . - 0 transcript_id "g113.t1"; gene_id "g113"; # protein sequence = [MVNIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHFDSPQTSVPSAVNTVDAKVAV # PLPEPSLSVSPTILETPPGDSPRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVNIALVSAAVFNRACKDAGMEPILLRAIHSEVAARA # ADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGTSLPLGRIYPLSEKELVALKDFIDKQLATAAITPSSSLHGAPVLFVP # KKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFS # DMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYTNPKKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFY # RRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWELNCPLIMETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYD # THDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRQQVRWSEFLHQFNMVIRFRLGKLGEKPDSITRRWDVYPNEGDIGCAQVNPH # NFRPIFTNEQLTASLRATFLEGPVLRASIIMGIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDHIYVPNHGDLRPQVLHYFHDH # PLSGHFGQNCTLEAVRRQYTWPKVRDFVGDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPT # HDTITSEQLAELFVIHVFSKHGVPNHVTSDCGSKFVSAFFQALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAY # NNAPNASTGITPLFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHIFLREEILLVQSRYKEQADRKRISPGAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g113 ### # start gene g114 5_related_000125F AUGUSTUS gene 44026 44592 0.99 - . g114 5_related_000125F AUGUSTUS transcript 44026 44592 0.99 - . g114.t1 5_related_000125F AUGUSTUS stop_codon 44026 44028 . - 0 transcript_id "g114.t1"; gene_id "g114"; 5_related_000125F AUGUSTUS CDS 44026 44592 0.99 - 0 transcript_id "g114.t1"; gene_id "g114"; 5_related_000125F AUGUSTUS start_codon 44590 44592 . - 0 transcript_id "g114.t1"; gene_id "g114"; # protein sequence = [MKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREA # GKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQAGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGG # KHQIADCNKRKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g114 ### # start gene g115 5_related_000125F AUGUSTUS gene 44626 45405 1 - . g115 5_related_000125F AUGUSTUS transcript 44626 45405 1 - . g115.t1 5_related_000125F AUGUSTUS stop_codon 44626 44628 . - 0 transcript_id "g115.t1"; gene_id "g115"; 5_related_000125F AUGUSTUS CDS 44626 45405 1 - 0 transcript_id "g115.t1"; gene_id "g115"; 5_related_000125F AUGUSTUS start_codon 45403 45405 . - 0 transcript_id "g115.t1"; gene_id "g115"; # protein sequence = [MEEEQQFKYSTLYTGDGQPVQVLTPRRGQPPVVAPAQGRSTTRIDSPILQAIAHRTGKQPQCHAASESPRDLPPHFDL # DAGDHDDQDPPADPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPRSPISPDIPNEQRAMLKLLSGFKGSIETLGTILTALGRPSDSSESKSKVKEPEV # FDSSDPRKLKTFFVNLALVFNDRPEYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g115 ### # start gene g116 5_related_000125F AUGUSTUS gene 52125 52799 0.29 + . g116 5_related_000125F AUGUSTUS transcript 52125 52799 0.29 + . g116.t1 5_related_000125F AUGUSTUS start_codon 52125 52127 . + 0 transcript_id "g116.t1"; gene_id "g116"; 5_related_000125F AUGUSTUS CDS 52125 52386 0.29 + 0 transcript_id "g116.t1"; gene_id "g116"; 5_related_000125F AUGUSTUS CDS 52453 52799 0.64 + 2 transcript_id "g116.t1"; gene_id "g116"; 5_related_000125F AUGUSTUS stop_codon 52797 52799 . + 0 transcript_id "g116.t1"; gene_id "g116"; # protein sequence = [MAVSHPDSPDYGKHWTPQQVVDTFKPKAESVDSVLGWLREFGFEREKIRTSANKGWVEVMASVEEVERLLGTEYHVYK # HVETGEEQISCETYSVPADIRKHIDLIKPTVHFNHRPSPKTTTKFKRAASGANLGKPGVSTVGPKKSPDATPVPPSLENCDKMITLDCLKALYDVPDF # NPVSTDTNSYGIREWDYYNFFEKKIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g116 ### # start gene g117 5_related_000125F AUGUSTUS gene 61052 61702 0.99 + . g117 5_related_000125F AUGUSTUS transcript 61052 61702 0.99 + . g117.t1 5_related_000125F AUGUSTUS start_codon 61052 61054 . + 0 transcript_id "g117.t1"; gene_id "g117"; 5_related_000125F AUGUSTUS CDS 61052 61702 0.99 + 0 transcript_id "g117.t1"; gene_id "g117"; 5_related_000125F AUGUSTUS stop_codon 61700 61702 . + 0 transcript_id "g117.t1"; gene_id "g117"; # protein sequence = [MSAAVTPHPCTVTQQTACTGSTCSSPNSTAGVCDQAGCDFNSFRLGDTTFYGPGQTVDTTKPFTVVTQFVSSNNQSTG # TLSAIRRLYVQNGKVIQNSETNIPGITATNEIDATFCEQQKVAFGDTDTFDSKGGLSGMGKAMSAGMVLVLSLWDDYAVNMLWLDSDFPTNGGTKPGV # ARGSCAVSSGVPATVEAQSPNAQVIYSNIKFGAIGTTFTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g117 ### # start gene g118 5_related_000125F AUGUSTUS gene 65418 66149 0.97 + . g118 5_related_000125F AUGUSTUS transcript 65418 66149 0.97 + . g118.t1 5_related_000125F AUGUSTUS start_codon 65418 65420 . + 0 transcript_id "g118.t1"; gene_id "g118"; 5_related_000125F AUGUSTUS CDS 65418 66149 0.97 + 0 transcript_id "g118.t1"; gene_id "g118"; 5_related_000125F AUGUSTUS stop_codon 66147 66149 . + 0 transcript_id "g118.t1"; gene_id "g118"; # protein sequence = [MQPGSVQAIYDSVFRPLFTCAVQNVPVEHSTELFMKLAEEQKRLDEKFQTGFGLKMRPCIISDNISKELLRPDSEDTE # MVPILLMATFAGNGLDTLSSMHQSFCAPVLTTGQNPHFRDYFSYINPFEKELSMDRRFISTTPKWRTGRRNTQQYIICYEHLVPVAKLSAWHCTDASE # YMLDSDNQFKLEILCRVKEKGWIIAAKSHSGFYDSMIIDLLVGCLMIIQLKSKTDVVHVELQTLPQM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g118 ### # start gene g119 5_related_000125F AUGUSTUS gene 70263 70559 0.4 + . g119 5_related_000125F AUGUSTUS transcript 70263 70559 0.4 + . g119.t1 5_related_000125F AUGUSTUS start_codon 70263 70265 . + 0 transcript_id "g119.t1"; gene_id "g119"; 5_related_000125F AUGUSTUS CDS 70263 70559 0.4 + 0 transcript_id "g119.t1"; gene_id "g119"; 5_related_000125F AUGUSTUS stop_codon 70557 70559 . + 0 transcript_id "g119.t1"; gene_id "g119"; # protein sequence = [MAETQTGKKLKRIRIDGGRELNNGEVDKYCAENGIIIEKVPHDSSAGNGVAEWAFRTVMEGTRTLLEDAKLPYSFWGE # AASTFIYIDSPTASRWRLGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g119 ### # start gene g120 5_related_000125F AUGUSTUS gene 70679 71104 0.55 + . g120 5_related_000125F AUGUSTUS transcript 70679 71104 0.55 + . g120.t1 5_related_000125F AUGUSTUS start_codon 70679 70681 . + 0 transcript_id "g120.t1"; gene_id "g120"; 5_related_000125F AUGUSTUS CDS 70679 71104 0.55 + 0 transcript_id "g120.t1"; gene_id "g120"; 5_related_000125F AUGUSTUS stop_codon 71102 71104 . + 0 transcript_id "g120.t1"; gene_id "g120"; # protein sequence = [MGRRGYRVWIPETKWIEESHDVTFEEGEPHRTRKRRIEDEGEDSVEDMTPTTPDNCDTGPATGPGINTNDPDNPAERN # LPPTTTTEDELPLATRPQRTPVPPEPTRRSERGHVPSRRYLESAEYEGREDEARSRGEQWSTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g120 ### # start gene g121 5_related_000125F AUGUSTUS gene 72846 74537 0.97 + . g121 5_related_000125F AUGUSTUS transcript 72846 74537 0.97 + . g121.t1 5_related_000125F AUGUSTUS start_codon 72846 72848 . + 0 transcript_id "g121.t1"; gene_id "g121"; 5_related_000125F AUGUSTUS CDS 72846 74537 0.97 + 0 transcript_id "g121.t1"; gene_id "g121"; 5_related_000125F AUGUSTUS stop_codon 74535 74537 . + 0 transcript_id "g121.t1"; gene_id "g121"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTARIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPNSPDIPNEQRAMLDLLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPLAPKPKPFS # GGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g121 ### # start gene g122 5_related_000125F AUGUSTUS gene 74870 78433 0.97 + . g122 5_related_000125F AUGUSTUS transcript 74870 78433 0.97 + . g122.t1 5_related_000125F AUGUSTUS start_codon 74870 74872 . + 0 transcript_id "g122.t1"; gene_id "g122"; 5_related_000125F AUGUSTUS CDS 74870 78433 0.97 + 0 transcript_id "g122.t1"; gene_id "g122"; 5_related_000125F AUGUSTUS stop_codon 78431 78433 . + 0 transcript_id "g122.t1"; gene_id "g122"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINTVVAKVAV # PLPEPSPSVSPTILETPPGDSPRSRSRSRSRTSRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTAPTVPLLPPSIPAEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVNFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDPAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRHHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWELNCPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDHIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGFTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLQEEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVVSRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g122 ### # # ----- prediction on sequence number 7 (length = 53655, name = 5_related_000151F) ----- # # Predicted genes for sequence number 7 on both strands # start gene g123 5_related_000151F AUGUSTUS gene 3102 3899 0.5 - . g123 5_related_000151F AUGUSTUS transcript 3102 3899 0.5 - . g123.t1 5_related_000151F AUGUSTUS stop_codon 3102 3104 . - 0 transcript_id "g123.t1"; gene_id "g123"; 5_related_000151F AUGUSTUS CDS 3102 3899 0.5 - 0 transcript_id "g123.t1"; gene_id "g123"; 5_related_000151F AUGUSTUS start_codon 3897 3899 . - 0 transcript_id "g123.t1"; gene_id "g123"; # protein sequence = [MVTCGGYWDWSGCSQGMTHPLSGHFGQNRTLEAVRCQYTWPKVRDFVRDYITSCTICGRNKPRRHRPYGLLKPLLVLV # RPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTFDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHP # EADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g123 ### # start gene g124 5_related_000151F AUGUSTUS gene 4864 7185 0.56 - . g124 5_related_000151F AUGUSTUS transcript 4864 7185 0.56 - . g124.t1 5_related_000151F AUGUSTUS stop_codon 4864 4866 . - 0 transcript_id "g124.t1"; gene_id "g124"; 5_related_000151F AUGUSTUS CDS 4864 7185 0.56 - 0 transcript_id "g124.t1"; gene_id "g124"; 5_related_000151F AUGUSTUS start_codon 7183 7185 . - 0 transcript_id "g124.t1"; gene_id "g124"; # protein sequence = [MANIAIRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASQNITFRNTSHFDSPQTFVPSAINPVVAKVAV # PLPELSPSVLPTILETPPGDSLRSCSRTSRAKPLLSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGTEPILLRAIHSEVAARAAD # RSSTAPTVPPLPPSIPAEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLFEKEVVALKDFIDKQLANGAITPSSSPHGAPVLFVPKK # DSKLRLCVDFRGLNGITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDKWKTTFRTHYGSYEWKVMPFGLTNAPAAFQWFVNDIFSDM # LNVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRHHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRR # FIYNYSDIVVPMTRLTQKGAPWIWDNSCQEAFENLKSAFTSAPILAHWEPNRPLIVETDTSDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTH # NKELLAIFEAFKAWRHYLEGSGDPVDVITDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVICFRPGKLGEKPDLITRRWDIYPKEGDIGYAQVNPHNF # HPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVIGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGERRLQVLRYFHHHPV # RPGLKWVLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g124 ### # start gene g125 5_related_000151F AUGUSTUS gene 7518 8279 0.59 - . g125 5_related_000151F AUGUSTUS transcript 7518 8279 0.59 - . g125.t1 5_related_000151F AUGUSTUS stop_codon 7518 7520 . - 0 transcript_id "g125.t1"; gene_id "g125"; 5_related_000151F AUGUSTUS CDS 7518 8279 0.59 - 0 transcript_id "g125.t1"; gene_id "g125"; 5_related_000151F AUGUSTUS start_codon 8277 8279 . - 0 transcript_id "g125.t1"; gene_id "g125"; # protein sequence = [MTLPAWTSSFTALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERI # KDEMARLPEPATLAAYRLEVLRIDNRYWKREETKKREAGKPFIARNPKKGSLDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNS # GQSSGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIPDCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g125 ### # start gene g126 5_related_000151F AUGUSTUS gene 9084 9827 0.99 - . g126 5_related_000151F AUGUSTUS transcript 9084 9827 0.99 - . g126.t1 5_related_000151F AUGUSTUS stop_codon 9084 9086 . - 0 transcript_id "g126.t1"; gene_id "g126"; 5_related_000151F AUGUSTUS CDS 9084 9827 0.99 - 0 transcript_id "g126.t1"; gene_id "g126"; 5_related_000151F AUGUSTUS start_codon 9825 9827 . - 0 transcript_id "g126.t1"; gene_id "g126"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFTESISAIGQPRRCNCGFGPATVPTTSTLPEAMEEEQQFEYSTLFTSDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARHTGKQPQRRAASESPRDPPPHFDLDIGDHDDQDPLVDPDDPGADNNHDNLDDDSGGLPRGGPG # DPGGPGGPGGPRSPNTPDIPNEQRAMLDLLSGFKGSIETLSTILAALGRPSDSSESKSKVKEPEVFDGSDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g126 ### # start gene g127 5_related_000151F AUGUSTUS gene 17539 18267 0.66 + . g127 5_related_000151F AUGUSTUS transcript 17539 18267 0.66 + . g127.t1 5_related_000151F AUGUSTUS start_codon 17539 17541 . + 0 transcript_id "g127.t1"; gene_id "g127"; 5_related_000151F AUGUSTUS CDS 17539 17556 0.9 + 0 transcript_id "g127.t1"; gene_id "g127"; 5_related_000151F AUGUSTUS CDS 17620 18267 0.66 + 0 transcript_id "g127.t1"; gene_id "g127"; 5_related_000151F AUGUSTUS stop_codon 18265 18267 . + 0 transcript_id "g127.t1"; gene_id "g127"; # protein sequence = [MTPLILVTGGTGFLGSHVVAQLLEKGYRVRSAARSATKQRKIFPDNPNLEVVEIPTLTSDYTESLKGVDAVIHIAAQL # FAKTNSVDEIYEVCPLYFFVSLLAIYSVLQAACDGTINIVHQSIDAGVKKIIITGTFASLFDSEAFIYISHRSCADSSLAQLKTGSGTELVNEEFYNP # VTPETFHRDQPLMAAYQESKTLASKRVWQVAEKHPDVDITICGST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g127 ### # start gene g128 5_related_000151F AUGUSTUS gene 18299 18784 0.86 + . g128 5_related_000151F AUGUSTUS transcript 18299 18784 0.86 + . g128.t1 5_related_000151F AUGUSTUS start_codon 18299 18301 . + 0 transcript_id "g128.t1"; gene_id "g128"; 5_related_000151F AUGUSTUS CDS 18299 18784 0.86 + 0 transcript_id "g128.t1"; gene_id "g128"; 5_related_000151F AUGUSTUS stop_codon 18782 18784 . + 0 transcript_id "g128.t1"; gene_id "g128"; # protein sequence = [MNLSVLPTLIFGPHVPNFPVTDAQTSIGSNFNLIKIITTGTDAYPTFPHGHLVDVRDIARAHVAALCVPPIPGRKKRF # IISNTTFKWKDVADLIRRERPELAHRLPREDIVPPKQSDAPLDTSFAAKVLGLKEYIPWEETVLAGVDVQIAWEKRKDLLSSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g128 ### # start gene g129 5_related_000151F AUGUSTUS gene 20874 21177 0.57 - . g129 5_related_000151F AUGUSTUS transcript 20874 21177 0.57 - . g129.t1 5_related_000151F AUGUSTUS stop_codon 20874 20876 . - 0 transcript_id "g129.t1"; gene_id "g129"; 5_related_000151F AUGUSTUS CDS 20874 20930 0.57 - 0 transcript_id "g129.t1"; gene_id "g129"; 5_related_000151F AUGUSTUS CDS 21034 21177 0.61 - 0 transcript_id "g129.t1"; gene_id "g129"; 5_related_000151F AUGUSTUS start_codon 21175 21177 . - 0 transcript_id "g129.t1"; gene_id "g129"; # protein sequence = [MTIELKPLPLPNSAEPSHFINFGREVKGINPGNCTSEQLEDIKQALYQQLKLTKVDSSLVYVQVMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g129 ### # start gene g130 5_related_000151F AUGUSTUS gene 23395 23841 0.52 - . g130 5_related_000151F AUGUSTUS transcript 23395 23841 0.52 - . g130.t1 5_related_000151F AUGUSTUS stop_codon 23395 23397 . - 0 transcript_id "g130.t1"; gene_id "g130"; 5_related_000151F AUGUSTUS CDS 23395 23841 0.52 - 0 transcript_id "g130.t1"; gene_id "g130"; 5_related_000151F AUGUSTUS start_codon 23839 23841 . - 0 transcript_id "g130.t1"; gene_id "g130"; # protein sequence = [MPMHFTPQKHTLDITKAVFLQLCIPIYRPDFNTSKKGNFLPDYRSLPTRTSSFRVGEAALDPSGSMRLTVSDWGQIAP # NAVGNEQKFTVEVNFTPELPPTTSGLRIKSQTATKHYTGWVSWEKAPKVSGELRDDHTTLKVENSKLKDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g130 ### # start gene g131 5_related_000151F AUGUSTUS gene 28927 29772 0.48 - . g131 5_related_000151F AUGUSTUS transcript 28927 29772 0.48 - . g131.t1 5_related_000151F AUGUSTUS stop_codon 28927 28929 . - 0 transcript_id "g131.t1"; gene_id "g131"; 5_related_000151F AUGUSTUS CDS 28927 29040 0.59 - 0 transcript_id "g131.t1"; gene_id "g131"; 5_related_000151F AUGUSTUS CDS 29093 29128 0.49 - 0 transcript_id "g131.t1"; gene_id "g131"; 5_related_000151F AUGUSTUS CDS 29242 29772 0.59 - 0 transcript_id "g131.t1"; gene_id "g131"; 5_related_000151F AUGUSTUS start_codon 29770 29772 . - 0 transcript_id "g131.t1"; gene_id "g131"; # protein sequence = [MSSSSLRKNQPESIDPPNLNTLESQVETEFPGQSSFQKRIAFAKRKVTTKDGWFGDYDYAWLCIPALPFSAKASRKQP # PFYSLDADLPLALAISSGLQHALAMLAGMCPIGIMRTWNLLAHRTYIGLITPPIIFASSLNLDSTTSSYMISASLIGCGASKITIVNQLLIDGTGILS # LSLVPALQHYLPRIFDAMYQDGTCTSTVGSDGTVVRNACPDAYGKVLGSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g131 ### # start gene g132 5_related_000151F AUGUSTUS gene 31048 31989 0.71 + . g132 5_related_000151F AUGUSTUS transcript 31048 31989 0.71 + . g132.t1 5_related_000151F AUGUSTUS start_codon 31048 31050 . + 0 transcript_id "g132.t1"; gene_id "g132"; 5_related_000151F AUGUSTUS CDS 31048 31989 0.71 + 0 transcript_id "g132.t1"; gene_id "g132"; 5_related_000151F AUGUSTUS stop_codon 31987 31989 . + 0 transcript_id "g132.t1"; gene_id "g132"; # protein sequence = [MNVATYQNTRSNHKLIVIVKFQQVVSEGNWFLKGDFSYKHCTLRNIELITCSRIPCALPELTQPHGMSYTTPFYRPAH # PNELEAQAFQLHRAPTHRPLGLWAYVDPTWNTTQHVQNRTSVAIPSPATYCIPNPYIQTPPPATRTRDGQQNYNDDEAATFSVCGSFDDRLRNRDLLD # VVQNENVLQLIFGRFDSSVDSAIPLGPGTDVTDPVPVTVAGLEKLIQDHARRNQNYFDYHSSSTTTTIISLPPLTELNLSTHNSQSTHDCLRPVEAVA # CCDEEIGTKSQSAMELPLAMGGRRSKSIEKVMRWRMGCI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g132 ### # start gene g133 5_related_000151F AUGUSTUS gene 34440 35129 0.81 - . g133 5_related_000151F AUGUSTUS transcript 34440 35129 0.81 - . g133.t1 5_related_000151F AUGUSTUS stop_codon 34440 34442 . - 0 transcript_id "g133.t1"; gene_id "g133"; 5_related_000151F AUGUSTUS CDS 34440 35129 0.81 - 0 transcript_id "g133.t1"; gene_id "g133"; 5_related_000151F AUGUSTUS start_codon 35127 35129 . - 0 transcript_id "g133.t1"; gene_id "g133"; # protein sequence = [MQSGSVQAIHDSVFRPLFTCAMDTVQSLPTEYSTNSELVMRLAEQQKRLDDEFYKGYRLKKRPCIITRSTSKALWRPS # EHTRLVPILLMATFAGNCLNTLSNMHQCFSAPVFTTGQNQHFHDYFSHVHPFEKGLSTEERFISKTPEWKINAQQYIICYEYLVPTSQINVWRCPSAT # EYTLDDDNQFKLTTLCKRKRQGWITASKLYPQFLHNMVTDLLACRLIDLDEPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g133 ### # start gene g134 5_related_000151F AUGUSTUS gene 47353 48879 0.31 + . g134 5_related_000151F AUGUSTUS transcript 47353 48879 0.31 + . g134.t1 5_related_000151F AUGUSTUS start_codon 47353 47355 . + 0 transcript_id "g134.t1"; gene_id "g134"; 5_related_000151F AUGUSTUS CDS 47353 48879 0.31 + 0 transcript_id "g134.t1"; gene_id "g134"; 5_related_000151F AUGUSTUS stop_codon 48877 48879 . + 0 transcript_id "g134.t1"; gene_id "g134"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDKRGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPKVRR # GVLETVVKDVSVISMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNMTPRSSNG # TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g134 ### # start gene g135 5_related_000151F AUGUSTUS gene 48909 49907 0.96 + . g135 5_related_000151F AUGUSTUS transcript 48909 49907 0.96 + . g135.t1 5_related_000151F AUGUSTUS start_codon 48909 48911 . + 0 transcript_id "g135.t1"; gene_id "g135"; 5_related_000151F AUGUSTUS CDS 48909 49907 0.96 + 0 transcript_id "g135.t1"; gene_id "g135"; 5_related_000151F AUGUSTUS stop_codon 49905 49907 . + 0 transcript_id "g135.t1"; gene_id "g135"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFVGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPMNQINSEHRPYDHVQPRMYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSMDYVLLLLKSIIKMKRLKVYWTKVHRLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g135 ### # start gene g136 5_related_000151F AUGUSTUS gene 49967 50344 0.97 + . g136 5_related_000151F AUGUSTUS transcript 49967 50344 0.97 + . g136.t1 5_related_000151F AUGUSTUS start_codon 49967 49969 . + 0 transcript_id "g136.t1"; gene_id "g136"; 5_related_000151F AUGUSTUS CDS 49967 50344 0.97 + 0 transcript_id "g136.t1"; gene_id "g136"; 5_related_000151F AUGUSTUS stop_codon 50342 50344 . + 0 transcript_id "g136.t1"; gene_id "g136"; # protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV # GTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g136 ### # start gene g137 5_related_000151F AUGUSTUS gene 51265 51740 0.86 + . g137 5_related_000151F AUGUSTUS transcript 51265 51740 0.86 + . g137.t1 5_related_000151F AUGUSTUS start_codon 51265 51267 . + 0 transcript_id "g137.t1"; gene_id "g137"; 5_related_000151F AUGUSTUS CDS 51265 51287 0.86 + 0 transcript_id "g137.t1"; gene_id "g137"; 5_related_000151F AUGUSTUS CDS 51344 51740 0.92 + 1 transcript_id "g137.t1"; gene_id "g137"; 5_related_000151F AUGUSTUS stop_codon 51738 51740 . + 0 transcript_id "g137.t1"; gene_id "g137"; # protein sequence = [MEGSSLNLLGENCDKSESTETAQNQCNNENTSKTNRDDNWNKPKNSQRTRKRMARYEVLKRGTESFQRSQPSFEKVRY # ESRQRKKGKDQDSKDKKENVQPDLLNEPPTNKLEERIKLNQQDRSPINLIDERINKWIMKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g137 ### # # ----- prediction on sequence number 8 (length = 61167, name = 5_related_000141F) ----- # # Predicted genes for sequence number 8 on both strands # start gene g138 5_related_000141F AUGUSTUS gene 2 1213 0.97 + . g138 5_related_000141F AUGUSTUS transcript 2 1213 0.97 + . g138.t1 5_related_000141F AUGUSTUS start_codon 2 4 . + 0 transcript_id "g138.t1"; gene_id "g138"; 5_related_000141F AUGUSTUS CDS 2 1213 0.97 + 0 transcript_id "g138.t1"; gene_id "g138"; 5_related_000141F AUGUSTUS stop_codon 1211 1213 . + 0 transcript_id "g138.t1"; gene_id "g138"; # protein sequence = [MEEFLGGLGEERYGVLVGLGRKITDYYTGEGEEGGEGEGEGGGRGKGEGEIDDEVGVAVVFDDEDEESEDDGEGFEVR # DDDDDDDDDEESSSEPEVDGPRVAIEGDDDEEIVIGDKPSSSKKQTSKSKNTSSKDDDLVSPHSIDAFWVQRQISQVYPDPHTSSTKASEVLSILSST # TTPAGGTAPTNLRDAENQLMEVFEYAHFDLVRKLLKNRDVVVWCTKLMRSSREERADVEVAMRERGVGWILRELDGERRPNTTSNDEEGEQMDVDDPK # PPTTTTPPNPTLRLPKTIDLTAMAFSQGSHLMSNKKCVLPEGSFKRARKGWEEIHVPAVKSRYSTTVGGSSDELVPISALPFWARAAFTVPNLNRVQS # KLFPVAFGTDEPILLCAPTGAGKVLVSCSYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # RM: 1 # end gene g138 ### # start gene g139 5_related_000141F AUGUSTUS gene 1254 2141 0.78 - . g139 5_related_000141F AUGUSTUS transcript 1254 2141 0.78 - . g139.t1 5_related_000141F AUGUSTUS stop_codon 1254 1256 . - 0 transcript_id "g139.t1"; gene_id "g139"; 5_related_000141F AUGUSTUS CDS 1254 2141 0.78 - 0 transcript_id "g139.t1"; gene_id "g139"; 5_related_000141F AUGUSTUS start_codon 2139 2141 . - 0 transcript_id "g139.t1"; gene_id "g139"; # protein sequence = [MVDPDSEGEEIPQGGVLDRLRFGGEDLADGGRRVDEGRYRVFCQGSVAEVHSGFRGFFSGMHEYQGLVSSSGGGRGEL # VEDFLVRDFVHQGVSFDCFFFGDTDELLVEGTGAEGGVEVEKTGGGVDAEEGGDVGVVGEGGGETDETHVGVGLGLHFANSTRDDGFENGTALVVEEV # DLVDDNHFHCAFGDTITAACTAPLAGNDVPFFWGGDDDLGFADLVFGHLAVSCEFADGEVERGGGTEAGTEVADHFLDEGFHWCDVDDFKVGVGGSEG # GGGGVGVGRRRVVLGEFREDC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g139 ### # start gene g140 5_related_000141F AUGUSTUS gene 15997 16568 0.76 - . g140 5_related_000141F AUGUSTUS transcript 15997 16568 0.76 - . g140.t1 5_related_000141F AUGUSTUS stop_codon 15997 15999 . - 0 transcript_id "g140.t1"; gene_id "g140"; 5_related_000141F AUGUSTUS CDS 15997 16243 0.94 - 1 transcript_id "g140.t1"; gene_id "g140"; 5_related_000141F AUGUSTUS CDS 16294 16568 0.79 - 0 transcript_id "g140.t1"; gene_id "g140"; 5_related_000141F AUGUSTUS start_codon 16566 16568 . - 0 transcript_id "g140.t1"; gene_id "g140"; # protein sequence = [MLQAATIQDGGDDDDTSLYTRMVAYDIANATVTPPTMVGEWVVPLPVSTSKSKTRKCSEIHFVSENVFFALSRDGNGN # GAGTSSSDTTSKYKQADLFSIANATNIAGSKFDDPSNPVAPGGVLDDSVTPATYVSFVNYIDDDQLARFGLHNGTLNAAYSVYVLDPFGLNFRRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g140 ### # start gene g141 5_related_000141F AUGUSTUS gene 23132 26314 0.99 + . g141 5_related_000141F AUGUSTUS transcript 23132 26314 0.99 + . g141.t1 5_related_000141F AUGUSTUS start_codon 23132 23134 . + 0 transcript_id "g141.t1"; gene_id "g141"; 5_related_000141F AUGUSTUS CDS 23132 26314 0.99 + 0 transcript_id "g141.t1"; gene_id "g141"; 5_related_000141F AUGUSTUS stop_codon 26312 26314 . + 0 transcript_id "g141.t1"; gene_id "g141"; # protein sequence = [MCELSLTKICIPLSPPQLPSADNWAFQVEWCPRNPDLLASAFFDGTVGIHSIQSTNESAVPQPATVSSTDGSDVFDVP # GFTRSSQGGTLSLKQPPKWLRRPITSSFGFGGKLVSVSNLPSAQGKNQSSVIHLRNVVTEEEIVERAKALQSAIADESVKAFAEGKASQNEEVWKALL # SMYQAESRDELVTLLGFSKSEIAARIGEAVEKLKAGVEVKQEDENVVGMKPPVVSFAEPEREPTPVGSPDVDEPDSADFEKTPSEVSASAASDATRQA # ETESTTTAPSLFGDDNGIADDGDFFSNIGVGGNGFTRQVLVPHTNYGVDSSVAATIGSRPSSIASEVTKSNTFKIYPADESETETLVTKALVLGDFTS # AVELCLSTNRFADALLLAVRGGPELLQKTQKIYFERQTTVAPYLRLFQSIVANDLSDIVQNADLQEWQEIFVVLCTFASKEEFPGLAEQLGRRLEFQY # TISKSSNNPEVSHKAVEYRKYATLTYLAAARLERLVNIWSEELSEEEASLALDESLPGGSQYTAHAHALQTFIEKVTVFRSATKYTDADLASATASTA # VEVDVETYKLSVLYDRYFEYADLLASQGLLKEAASILRLTPADYKGSGSADLSEERKRLLVATSIVAPVASTSTATASSSRAPYGGYAQPTAPTHNRV # PPGPAPAPSGPYGGGYQPASNYQTAPQSTYTQNGPSASQGPYGAPQAVNSFTPAANAYAPAVNTFVPPAPSYNPYGQNANTGQQMPTNQAPPLAPPAR # GPATLPPPPKRDSNSGWNDAPIVNPARTSSAMANKPAAIMSPFPNSTPTPLSPPISGSYMQQAQPLAGLPPPPRPGSVTGRVPPQGLPGRAGPPGPGM # YPPPAGTGVRPASVAGGGPGGMGMPPPSRMMSPPQVHPPPPISHHGPPPPRNSMSGHTPPPGPSQFARHPPPQAGQSHLPPSGPYAQATPPPMQPLQQ # PPPGPYGPPPGQAPQVPQASGGMYAPPPGVRTGPVQPPPPGAAPGAGGPPPPPPGAGPVGVAPPPRAALQKAGPPPPKYRESFFRLRIFHLFIQTVSI # MT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g141 ### # start gene g142 5_related_000141F AUGUSTUS gene 28610 30145 0.42 - . g142 5_related_000141F AUGUSTUS transcript 28610 30145 0.42 - . g142.t1 5_related_000141F AUGUSTUS stop_codon 28610 28612 . - 0 transcript_id "g142.t1"; gene_id "g142"; 5_related_000141F AUGUSTUS CDS 28610 30145 0.42 - 0 transcript_id "g142.t1"; gene_id "g142"; 5_related_000141F AUGUSTUS start_codon 30143 30145 . - 0 transcript_id "g142.t1"; gene_id "g142"; # protein sequence = [MTPQLYGDIQAMIKNAIFLVAHTKSLDPLLKVLVALLGDDVLEVLFGRTRMLGSHDPNCDVLQFGQRVESALRADKIF # TKYPELEQKPRRLMTRRMGSSDHHTPRYFTGDLTAGSCDLDKVFAEAETEVLEDLACAGYELVPGKTFSFRELFAQEDCDLQRPVGGRYPGLSTAVDR # SISEASELVSATSDNAESLGSASGNSEELQSILKILKVDAAAMLEEERKEDELAASSAQESHSNSAQRPSPFFYPDPDKPKLRISKRTALREQMNPGF # DLNNGKSHDRLLRVRYFAEGKDWDTKAVATDIDNDNSFKVGSIFTTLIYIPDKKLVSLAILHCTSIRSKGACTHAPIDEIPLSESRYNLGGQVLDLLP # FFDGKELHWDWTTLSIELETGKPKKKAKNNNHGLVPVLNRNLRIEVNGSLTYPFRRNSFEELPFDQLPPETKTHFGSQRSTWRFPDSLLSSSFSTLSQ # RLIDNRDLLDLMPVHCISRGVFPYSFKSGPTSRAYHFYSMY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g142 ### # start gene g143 5_related_000141F AUGUSTUS gene 35413 39720 0.75 + . g143 5_related_000141F AUGUSTUS transcript 35413 39720 0.75 + . g143.t1 5_related_000141F AUGUSTUS start_codon 35413 35415 . + 0 transcript_id "g143.t1"; gene_id "g143"; 5_related_000141F AUGUSTUS CDS 35413 39720 0.75 + 0 transcript_id "g143.t1"; gene_id "g143"; 5_related_000141F AUGUSTUS stop_codon 39718 39720 . + 0 transcript_id "g143.t1"; gene_id "g143"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSCGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPVPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLSVRQQEKLPERRVSPAI # SEQSRTSSRRLPMPPVQSLNLPLPRRGSSLSSLLKSPAMNMPNWECTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEI # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMR # HMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKH # SSPRNIEVPELLNPGNTATRSPQLRSGTSPTVHALAQNSTPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSN # PSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPLQGAPFGTPFVTGAQTNRPGMAFESAHSQESVAMIQQQARVIETLQEQEQLREVKEGFT # AGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELG # EYGRPEGGAYALENEGGGKGGINPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGR # REEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLNVGKIESFAGDDRSAWKTWVLSLERMFGVRPTI # YAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALV # TYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLHSEKVLQGWLSRFPGLELAPEAPYKSPLRRERDPADVWTSNPKPVVTGR # FQSRPNWKEGRQRASAAWGEGESYDSESREEDEDCCHCKDGGEWTEAVLRAGVTDTGRKWTPEERAEKWRRRRQELCMRCGQKEHWAKDCPNPESLER # PAEDQGSSERASKADSTRGRGTANQGGGRKDDSTRPLERIRAGIVVEEREGMDDLWNVHILDSPKEGEQQLLDEVGNGQGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g143 ### # start gene g144 5_related_000141F AUGUSTUS gene 41020 41463 0.58 + . g144 5_related_000141F AUGUSTUS transcript 41020 41463 0.58 + . g144.t1 5_related_000141F AUGUSTUS start_codon 41020 41022 . + 0 transcript_id "g144.t1"; gene_id "g144"; 5_related_000141F AUGUSTUS CDS 41020 41463 0.58 + 0 transcript_id "g144.t1"; gene_id "g144"; 5_related_000141F AUGUSTUS stop_codon 41461 41463 . + 0 transcript_id "g144.t1"; gene_id "g144"; # protein sequence = [MLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYD # IKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVCLPRKRMVPCDSAWTIEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g144 ### # start gene g145 5_related_000141F AUGUSTUS gene 44413 44754 0.89 - . g145 5_related_000141F AUGUSTUS transcript 44413 44754 0.89 - . g145.t1 5_related_000141F AUGUSTUS stop_codon 44413 44415 . - 0 transcript_id "g145.t1"; gene_id "g145"; 5_related_000141F AUGUSTUS CDS 44413 44754 0.89 - 0 transcript_id "g145.t1"; gene_id "g145"; 5_related_000141F AUGUSTUS start_codon 44752 44754 . - 0 transcript_id "g145.t1"; gene_id "g145"; # protein sequence = [MSSTGPVPESSDETNVEQSFEAPIVPVSSPSGGSHPPVPLFLSEQESPTSPSPPPRSSVPPLLFGSVASLSIDLTGDD # DELYETEEAYASRIDVAMEGTELAVDQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g145 ### # start gene g146 5_related_000141F AUGUSTUS gene 48382 49908 0.75 + . g146 5_related_000141F AUGUSTUS transcript 48382 49908 0.75 + . g146.t1 5_related_000141F AUGUSTUS start_codon 48382 48384 . + 0 transcript_id "g146.t1"; gene_id "g146"; 5_related_000141F AUGUSTUS CDS 48382 49908 0.75 + 0 transcript_id "g146.t1"; gene_id "g146"; 5_related_000141F AUGUSTUS stop_codon 49906 49908 . + 0 transcript_id "g146.t1"; gene_id "g146"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRTVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNG # TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g146 ### # start gene g147 5_related_000141F AUGUSTUS gene 49938 51375 0.99 + . g147 5_related_000141F AUGUSTUS transcript 49938 51375 0.99 + . g147.t1 5_related_000141F AUGUSTUS start_codon 49938 49940 . + 0 transcript_id "g147.t1"; gene_id "g147"; 5_related_000141F AUGUSTUS CDS 49938 50519 1 + 0 transcript_id "g147.t1"; gene_id "g147"; 5_related_000141F AUGUSTUS CDS 50569 51375 0.99 + 0 transcript_id "g147.t1"; gene_id "g147"; 5_related_000141F AUGUSTUS stop_codon 51373 51375 . + 0 transcript_id "g147.t1"; gene_id "g147"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVYIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRMEKLKFLDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAY # EDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQN # KAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g147 ### # start gene g148 5_related_000141F AUGUSTUS gene 51471 52790 1 + . g148 5_related_000141F AUGUSTUS transcript 51471 52790 1 + . g148.t1 5_related_000141F AUGUSTUS start_codon 51471 51473 . + 0 transcript_id "g148.t1"; gene_id "g148"; 5_related_000141F AUGUSTUS CDS 51471 52790 1 + 0 transcript_id "g148.t1"; gene_id "g148"; 5_related_000141F AUGUSTUS stop_codon 52788 52790 . + 0 transcript_id "g148.t1"; gene_id "g148"; # protein sequence = [MFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFYDQLNNEQFNLNPIKSFFLQNG # RIKPKPVRKKVQKRRFVEPILQKFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESR # QRKKGKAQDSKDKKENVQADVVTEPPINKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIER # HIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIP # PGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSVYLLQLQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g148 ### # start gene g149 5_related_000141F AUGUSTUS gene 53285 54465 0.4 + . g149 5_related_000141F AUGUSTUS transcript 53285 54465 0.4 + . g149.t1 5_related_000141F AUGUSTUS start_codon 53285 53287 . + 0 transcript_id "g149.t1"; gene_id "g149"; 5_related_000141F AUGUSTUS CDS 53285 53705 0.53 + 0 transcript_id "g149.t1"; gene_id "g149"; 5_related_000141F AUGUSTUS CDS 53843 54465 0.79 + 2 transcript_id "g149.t1"; gene_id "g149"; 5_related_000141F AUGUSTUS stop_codon 54463 54465 . + 0 transcript_id "g149.t1"; gene_id "g149"; # protein sequence = [MASCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLA # VDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGE # PINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSS # EGNRLDELIPLIGKYLSNPSDESLSEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKKSVCTC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g149 ### # start gene g150 5_related_000141F AUGUSTUS gene 54562 55417 0.37 + . g150 5_related_000141F AUGUSTUS transcript 54562 55417 0.37 + . g150.t1 5_related_000141F AUGUSTUS start_codon 54562 54564 . + 0 transcript_id "g150.t1"; gene_id "g150"; 5_related_000141F AUGUSTUS CDS 54562 54564 0.39 + 0 transcript_id "g150.t1"; gene_id "g150"; 5_related_000141F AUGUSTUS CDS 54875 55417 0.82 + 0 transcript_id "g150.t1"; gene_id "g150"; 5_related_000141F AUGUSTUS stop_codon 55415 55417 . + 0 transcript_id "g150.t1"; gene_id "g150"; # protein sequence = [MLGLEEKYGIKGIRISAYNSQANGKIERAHLDICQALIKATGGDISKWFYFLKMILWADRVTPRCGLGCSPYFLVTGA # EPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIERVWIERCTQDI # EDLWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g150 ### # # ----- prediction on sequence number 9 (length = 3948103, name = 6) ----- # # Predicted genes for sequence number 9 on both strands # start gene g151 6 AUGUSTUS gene 168840 169887 0.58 - . g151 6 AUGUSTUS transcript 168840 169887 0.58 - . g151.t1 6 AUGUSTUS stop_codon 168840 168842 . - 0 transcript_id "g151.t1"; gene_id "g151"; 6 AUGUSTUS CDS 168840 169115 0.89 - 0 transcript_id "g151.t1"; gene_id "g151"; 6 AUGUSTUS CDS 169267 169887 0.64 - 0 transcript_id "g151.t1"; gene_id "g151"; 6 AUGUSTUS start_codon 169885 169887 . - 0 transcript_id "g151.t1"; gene_id "g151"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEAHRFMAQFQNWASEQSDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFRRNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLREHFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISLACEDDASAAVPKVMSSKTAHTEKPPAVTVDAEDIWKQSAKTSSWDSDETEANASNLNANRYPLRDP # RHSPCSQMNPSRLLPRPQHLLLHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g151 ### # start gene g152 6 AUGUSTUS gene 179948 180895 0.97 + . g152 6 AUGUSTUS transcript 179948 180895 0.97 + . g152.t1 6 AUGUSTUS start_codon 179948 179950 . + 0 transcript_id "g152.t1"; gene_id "g152"; 6 AUGUSTUS CDS 179948 180895 0.97 + 0 transcript_id "g152.t1"; gene_id "g152"; 6 AUGUSTUS stop_codon 180893 180895 . + 0 transcript_id "g152.t1"; gene_id "g152"; # protein sequence = [MHGTPAQRVSWTIPEDVWHRYDELLHLSTSATRVLVELNMLDDQDSRAVDRSELRHFQEAQEQEALLAAKRKRVNASP # QPRVRPKKRQLMKVVEEPVVEEVPQLVRLVIPPSRPAPSTSGSAPLVSKRSSVSLPLVSAPMTGRLGSVQGPSPLARLANLVDQRTSSQAEASTRSLG # PRSSSIKASREDPAVPKMSPVVCPPLVPHILSQHPYRVENERLAARVHLLESQLASSRQENATLTSALRDTSVSLEARQGELDQLRESVSSAAQQQEL # YNCLLDQVQTLEHALPGPPNGVCFTLLLIDHLLMSLPVFGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g152 ### # start gene g153 6 AUGUSTUS gene 181601 182065 0.83 + . g153 6 AUGUSTUS transcript 181601 182065 0.83 + . g153.t1 6 AUGUSTUS start_codon 181601 181603 . + 0 transcript_id "g153.t1"; gene_id "g153"; 6 AUGUSTUS CDS 181601 182065 0.83 + 0 transcript_id "g153.t1"; gene_id "g153"; 6 AUGUSTUS stop_codon 182063 182065 . + 0 transcript_id "g153.t1"; gene_id "g153"; # protein sequence = [MFALETPLPHHGAGNWEDPVPAVPSLDRLMQEWEAMMSSYIRFVTDTPLPQGDPQEEGSGHHKEVSALQEGEGAGTAA # VPLFLPDSLSPTPVASAASPPSLPPRFSSIANLAINMTADEDNEDIYESPGSIEHCNRLEGNPDENDPMGGGPVVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g153 ### # start gene g154 6 AUGUSTUS gene 185745 186104 0.97 + . g154 6 AUGUSTUS transcript 185745 186104 0.97 + . g154.t1 6 AUGUSTUS start_codon 185745 185747 . + 0 transcript_id "g154.t1"; gene_id "g154"; 6 AUGUSTUS CDS 185745 186104 0.97 + 0 transcript_id "g154.t1"; gene_id "g154"; 6 AUGUSTUS stop_codon 186102 186104 . + 0 transcript_id "g154.t1"; gene_id "g154"; # protein sequence = [MSTPIPPATPAPPASAEDLMTQLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS # QAKLIKSALGFFTESAGDWATPHLLHFNAEHPPLEEIGRSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g154 ### # start gene g155 6 AUGUSTUS gene 186970 188280 0.57 + . g155 6 AUGUSTUS transcript 186970 188280 0.57 + . g155.t1 6 AUGUSTUS start_codon 186970 186972 . + 0 transcript_id "g155.t1"; gene_id "g155"; 6 AUGUSTUS CDS 186970 188280 0.57 + 0 transcript_id "g155.t1"; gene_id "g155"; 6 AUGUSTUS stop_codon 188278 188280 . + 0 transcript_id "g155.t1"; gene_id "g155"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFATRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDVILGLPWLRKVNPEIDWEKGRLSVKPSRVTIEEVPDEEISYSHRAAANTESPIPELPN # PEPPTEPTQIEVPLEATLEESKSAVVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLIPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLKGLDISPSLMYAGAITMSESRKAMNGKGPLQPHEGCSSLRLCSLVSPTPLQRFKHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g155 ### # start gene g156 6 AUGUSTUS gene 188670 190013 0.5 + . g156 6 AUGUSTUS transcript 188670 190013 0.5 + . g156.t1 6 AUGUSTUS start_codon 188670 188672 . + 0 transcript_id "g156.t1"; gene_id "g156"; 6 AUGUSTUS CDS 188670 190013 0.5 + 0 transcript_id "g156.t1"; gene_id "g156"; 6 AUGUSTUS stop_codon 190011 190013 . + 0 transcript_id "g156.t1"; gene_id "g156"; # protein sequence = [MDTQQQAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREM # LAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRINTQADALSRMAAHQVLDNEDNRQQTVLKPNHFTK # IAASILRNPLEDRIRKASQREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFW # WPTLRSFVEKYVEGCETCARKKIQRHPRAVTQPLDVPLGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHALPCTSSITAEGVADIYYKEIFRLH # GLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRGRMTGQSTFQWLNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g156 ### # start gene g157 6 AUGUSTUS gene 191174 193218 0.56 - . g157 6 AUGUSTUS transcript 191174 193218 0.56 - . g157.t1 6 AUGUSTUS stop_codon 191174 191176 . - 0 transcript_id "g157.t1"; gene_id "g157"; 6 AUGUSTUS CDS 191174 192303 0.6 - 2 transcript_id "g157.t1"; gene_id "g157"; 6 AUGUSTUS CDS 193065 193218 0.82 - 0 transcript_id "g157.t1"; gene_id "g157"; 6 AUGUSTUS start_codon 193216 193218 . - 0 transcript_id "g157.t1"; gene_id "g157"; # protein sequence = [MFGGILKSWNQYGPNKDMKIQIKWYLTECRSFLAVPNVYCIKLIVLCDSIFXKPCTSKNSEKAGVLTPEEYRKAGVVF # GRSTFGTSARTSLLNPTNESSCPSSSQIPTEESRGSSVSRGTGSSISRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSVE # STRLIDTLTQTISQASNMIEPVKMTTNNYGMPALSAEAKAEIDKASAKLPRKYKTVPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTS # YKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDKRGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPE # VRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNCHEAAEAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g157 ### # start gene g158 6 AUGUSTUS gene 194323 196098 0.99 + . g158 6 AUGUSTUS transcript 194323 196098 0.99 + . g158.t1 6 AUGUSTUS start_codon 194323 194325 . + 0 transcript_id "g158.t1"; gene_id "g158"; 6 AUGUSTUS CDS 194323 194830 0.99 + 0 transcript_id "g158.t1"; gene_id "g158"; 6 AUGUSTUS CDS 194909 196098 0.99 + 2 transcript_id "g158.t1"; gene_id "g158"; 6 AUGUSTUS stop_codon 196096 196098 . + 0 transcript_id "g158.t1"; gene_id "g158"; # protein sequence = [MIDSGATGLFLHQKFVNKHHIYVRSLPRPIELYNIDGTANLAGRITHSARLLARVDQNQPQILEFLVTNIGSEDVILG # LPWLCKVNPDINWRDGQIQIPAKPKVQHHVAIEEIPEPKEPNVGGNTEQILEPNRAESNGLPHTVPRTELGPETAETGTSSEDELVFEESGKELWCTA # GYTYSQQLAEAANKDKPQKTFEEMVPEPYRRHAKVFSEKESERLPEHKPWDHAIDLKPDAPETLRTKIYPMSVNEQKELDRFLEDNLRKGYIRPSKSP # LSSPVFFVKKKDGKLRFIQDYRRLNEYTVKNRYPLPLVADIINCLRQAKYFTKFDVRWGYNNVRIKEGHEWKAAFSTNRGLFEPLVMFFGLTNSPAMF # QALMNSIFADLIMAGKVAMYLDDILIFSASLQEHQKIVHEVLERLAQNDLYLRPEKCEFEQTSIEYLGLIISEGEVRMDPVKVEAVKNWPAPTCLRDV # QGFLGFANFYRRFIDGFAKKARALNDLTKKGVGWSWGTNEQVAFEALKEAFTTAPILVLWDPDKPTHIKVDASGFATGGALLQQQGDGLWHPVAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g158 ### # start gene g159 6 AUGUSTUS gene 196390 198003 0.99 + . g159 6 AUGUSTUS transcript 196390 198003 0.99 + . g159.t1 6 AUGUSTUS start_codon 196390 196392 . + 0 transcript_id "g159.t1"; gene_id "g159"; 6 AUGUSTUS CDS 196390 198003 0.99 + 0 transcript_id "g159.t1"; gene_id "g159"; 6 AUGUSTUS stop_codon 198001 198003 . + 0 transcript_id "g159.t1"; gene_id "g159"; # protein sequence = [MDADDNQQQIVLRPEHFLQAATAILFQNPLEERIRKASEQESEVLEGLRKLKTHGPHKLVNGLAEWEEKEGIVYYKGR # VYVPPDPQLCRDVVAQCHDALTAGHPGRHRTLELVSRQFWWPTVRSFVDKYVEGCDNCQRRRVRPQPQSSLEPLPVPGGPWQDIGVDLIGELPMTQDG # HNAAITFTDHYSKMIHCFPTTTELTAEGVADFYYKEIFRLHGLPRRFISDRGPQFAADIMKALLKWLGIESALTTSYHPETNGQTERANQEIERYIRM # YVSRRQDDWDRLLPTAEFVINSQVHFAHDKAPFEVLYGYTPEFSIPIGSWKEYPSITDRLDALRHAREDAEAALRMSKQRIADTIAEHPNQPSFEVGQ # PVWLSVNNLKIRRKSEKLGSRRLGPSEVIEKTGAHTYRLALPTWMKIHDNINVKRLAPWKGNKVNGILPALPEPEVIDGEEFYDVDRILDSRIHGRWK # KLQYLVRWKGYDEGHDTWENEENVVGSSDETINEFYAAHPNAPRKISATIFHSLPWQPMVNFTEVNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g159 ### # start gene g160 6 AUGUSTUS gene 200851 201186 0.93 + . g160 6 AUGUSTUS transcript 200851 201186 0.93 + . g160.t1 6 AUGUSTUS start_codon 200851 200853 . + 0 transcript_id "g160.t1"; gene_id "g160"; 6 AUGUSTUS CDS 200851 201186 0.93 + 0 transcript_id "g160.t1"; gene_id "g160"; 6 AUGUSTUS stop_codon 201184 201186 . + 0 transcript_id "g160.t1"; gene_id "g160"; # protein sequence = [MSANSIPSVEQSLGKEEENWDAYTESSLAPSDSVSRVVWSFSQGKKKVRPLATSTTLATQSSTAANDSRESKPDATPD # SGRYRSANIDLPYKIPMIIMTTATPSPPSTTVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g160 ### # start gene g161 6 AUGUSTUS gene 201736 202891 0.43 - . g161 6 AUGUSTUS transcript 201736 202891 0.43 - . g161.t1 6 AUGUSTUS stop_codon 201736 201738 . - 0 transcript_id "g161.t1"; gene_id "g161"; 6 AUGUSTUS CDS 201736 202344 0.5 - 0 transcript_id "g161.t1"; gene_id "g161"; 6 AUGUSTUS CDS 202415 202891 0.45 - 0 transcript_id "g161.t1"; gene_id "g161"; 6 AUGUSTUS start_codon 202889 202891 . - 0 transcript_id "g161.t1"; gene_id "g161"; # protein sequence = [MFHPYSVFQTAIAIGAASTVLAIPLPPAPGAVNVAGIPGLQGVNSFSTRDEPEVRGLKNEAVYGLSRRDHHRDGDLFA # VDVELNEQQARRYGENGLDIEAESSPHYDDEEFTHHDVSRSCLFCLYHFYLVNTPSSSPCHQDDASVVPTEFVNVEESEHGLSVIGMEELSVDEPLLG # EMNHRQDLRRTVVSSVPSGGSPASSIPDHSRLYPRQSGMNVNPPINGVISKIPSSSSLRDSADPKASFISLDSNEDEGPVYRSLSPEEKEEYGSKWRP # MRKESQKEWKEIDCNWTRYLKETSTGKQLNTESRKFQAFVKEALLRHKRYPQRDTPGTGVPLSPPGDDSPSHYRRSGNFGPFGADLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g161 ### # start gene g162 6 AUGUSTUS gene 207796 208257 0.57 - . g162 6 AUGUSTUS transcript 207796 208257 0.57 - . g162.t1 6 AUGUSTUS stop_codon 207796 207798 . - 0 transcript_id "g162.t1"; gene_id "g162"; 6 AUGUSTUS CDS 207796 208257 0.57 - 0 transcript_id "g162.t1"; gene_id "g162"; 6 AUGUSTUS start_codon 208255 208257 . - 0 transcript_id "g162.t1"; gene_id "g162"; # protein sequence = [MVPSMKTKPVTPAVLQLVNNGLAADDEDGDDAVVDAAGAVVEPRPAVVSEFFVLVVLVPFRLSGGNVLIVVEAEAGDV # DEDPASALALTLEARGREDENGPMAGNGKVAGSVVNKGSEVTDRPPGILLSISQRSLRSLSIVSWSSSVHEIAEH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g162 ### # start gene g163 6 AUGUSTUS gene 209138 211144 0.56 + . g163 6 AUGUSTUS transcript 209138 211144 0.56 + . g163.t1 6 AUGUSTUS start_codon 209138 209140 . + 0 transcript_id "g163.t1"; gene_id "g163"; 6 AUGUSTUS CDS 209138 211144 0.56 + 0 transcript_id "g163.t1"; gene_id "g163"; 6 AUGUSTUS stop_codon 211142 211144 . + 0 transcript_id "g163.t1"; gene_id "g163"; # protein sequence = [MAASIIYLNIVDPVGLGVEREKPAYHIWAELKKKYERRDEMRVHQADTKLRAARFDPSNTTIEEHEKTMKNHLKELRN # LGGSCLDSQFRLIVIASMPKSWRDLLINVKGISSDDAFIHLRQVYDNKKEDEEDIRQRSQVRALIAQEMASFHSANAASAPKKDRPMCTNPNCPPRRR # RTHPIEKCWAPGGRDEGGGPKKAETSANYASDGGNHTVMELFDLCTSPSAPISSTQLPNAHTCRNCVSVSTEYGANKEVIRSVEILDSSISYSLSTFD # EYTACSARNEKTLLYAASKPRIPQTFLDSAASDHFWVRRVDFIEYENLYGKAGKSAIAGKAGEFEIHGKGTVEFETVVDGIKRRCRLNGVYHTPSFHH # NLISLRTLDAKGMKGEWGRGSLTVRTANGSIVMRGEGKGTMYEVQAHFTPPVVNFARSHNKPVDIHTWHCRLGHPATDRILQMHRHNLVDGLQITSKK # VDGKCEPCIFGKLTHRPFDEKLTHETKVLECIHLDLFGPTRTQSIGGAIWMFLATDGRSSVKAPSFLTNKRKETVLAAVHDWCTMAERQTGLKVLIFR # IDGGGEFDNGWFRDYCRTHGIVIEMIPPRSSAANGVAERANRTVLDGVRTFLVDAGFPPSMWAEAALTFCYVNMFIPSSRFPNEVPIEIYTKKRHDVS # HL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g163 ### # start gene g164 6 AUGUSTUS gene 211191 211663 0.35 + . g164 6 AUGUSTUS transcript 211191 211663 0.35 + . g164.t1 6 AUGUSTUS start_codon 211191 211193 . + 0 transcript_id "g164.t1"; gene_id "g164"; 6 AUGUSTUS CDS 211191 211213 0.43 + 0 transcript_id "g164.t1"; gene_id "g164"; 6 AUGUSTUS CDS 211300 211663 0.8 + 1 transcript_id "g164.t1"; gene_id "g164"; 6 AUGUSTUS stop_codon 211661 211663 . + 0 transcript_id "g164.t1"; gene_id "g164"; # protein sequence = [MENLELGLVEFEEGDPRRSAPAVPDEVDGEVFVDVDVGPAPNAVPDSPANENQIDIPNTSIPSTPTTPSTPSYDGIPE # LFAAQPSFQPLALPIQEPEAGPRRGTRIREPSARQLQSEESTERERSAFE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g164 ### # start gene g165 6 AUGUSTUS gene 212048 212713 0.6 + . g165 6 AUGUSTUS transcript 212048 212713 0.6 + . g165.t1 6 AUGUSTUS start_codon 212048 212050 . + 0 transcript_id "g165.t1"; gene_id "g165"; 6 AUGUSTUS CDS 212048 212713 0.6 + 0 transcript_id "g165.t1"; gene_id "g165"; 6 AUGUSTUS stop_codon 212711 212713 . + 0 transcript_id "g165.t1"; gene_id "g165"; # protein sequence = [MESVRIVLAVIAVLGLFMFQVDFKAAFLNSPIQHDVYIKQPEGFIKEGEEHKVCKLNKSIYGTMQGSHDWQDTLGKGY # EEDGYIASKADPCVRYRRIDDEYTLSTTYSDGVNGASSTEDGRKKAIADLGKRWESSEVNSGVLLGMTISQDPISKSITISQKSYFERMLEHFGMENV # RIRRTPLDPKVKIIESTNPLPELDRKFMSDKPYRSFVGSLLWGLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g165 ### # start gene g166 6 AUGUSTUS gene 214040 215395 0.62 + . g166 6 AUGUSTUS transcript 214040 215395 0.62 + . g166.t1 6 AUGUSTUS start_codon 214040 214042 . + 0 transcript_id "g166.t1"; gene_id "g166"; 6 AUGUSTUS CDS 214040 215395 0.62 + 0 transcript_id "g166.t1"; gene_id "g166"; 6 AUGUSTUS stop_codon 215393 215395 . + 0 transcript_id "g166.t1"; gene_id "g166"; # protein sequence = [MIQQLRGLSPEALGIVPGFNTSFMKDPTTLQYPGPANDNEHPSSGKIQGSFYTCPYGKKETRTVKVGRVLFRSNGIFG # QGPLVMRVKCVCEGSGQCVWCGKKLVLKLSWPSKTQASEKTFMYECKEKATGEHAWVLNHLPEIYYSFDIDFSAESPQAQLKEIFGEKYEMRVVRGII # MEELHPLSSLETERECAQVFYDIVQCELWTFILTIIYLTPNFLGHHWAWKYPQILHRDISEGNIMVREKNGQKYGVLNDWDLASWLNTQNEVSTSKFR # TGTKPYMAYEQHSSQWQGPHRFRHDLESVFYVILLLVSLYSSPTEKVRFPSTGDHRYERWHKQDDGVLLGQKGNIVCAGNWQPFPQPFFSGFNSWLIA # LQRSLLYGFIGLNMHIMMEIDAQQARENNEESMGVPYFDDDTLGGHFSYEKVVSVMHRFKKEELNTRGREWQKILQVPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g166 ### # start gene g167 6 AUGUSTUS gene 218020 218679 0.99 + . g167 6 AUGUSTUS transcript 218020 218679 0.99 + . g167.t1 6 AUGUSTUS start_codon 218020 218022 . + 0 transcript_id "g167.t1"; gene_id "g167"; 6 AUGUSTUS CDS 218020 218679 0.99 + 0 transcript_id "g167.t1"; gene_id "g167"; 6 AUGUSTUS stop_codon 218677 218679 . + 0 transcript_id "g167.t1"; gene_id "g167"; # protein sequence = [MNGRKYGVLNDWDLASWFNTQNEVSTSKFRTGTKPYMAHEQHSSDWQGPHRFRHDLESVFYVILLLVSLYSSPTEKVR # FPSTGDHRYEKWHKEDDSFLDGRKLKIINSGNWQPFPQPFFSGFTLWLAALQENLRRGIFNLENHNHAVLAASEPLKPGRRPPKVPFFDEDTLGGYFS # YKKVVMIMHQFNQEELRTWGHEWQATLEEASSKDWELEELEEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g167 ### # start gene g168 6 AUGUSTUS gene 224602 225105 0.27 - . g168 6 AUGUSTUS transcript 224602 225105 0.27 - . g168.t1 6 AUGUSTUS stop_codon 224602 224604 . - 0 transcript_id "g168.t1"; gene_id "g168"; 6 AUGUSTUS CDS 224602 224877 0.96 - 0 transcript_id "g168.t1"; gene_id "g168"; 6 AUGUSTUS CDS 225100 225105 0.28 - 0 transcript_id "g168.t1"; gene_id "g168"; 6 AUGUSTUS start_codon 225103 225105 . - 0 transcript_id "g168.t1"; gene_id "g168"; # protein sequence = [MEKAEALALEELEKESKHAQELEEQLMLDSARQQVAREREYKARKRASSEATEVPMTNEYPTESFADEIEFQGIRFDT # VKYFHPRIGTPFLLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g168 ### # start gene g169 6 AUGUSTUS gene 231944 232264 0.95 - . g169 6 AUGUSTUS transcript 231944 232264 0.95 - . g169.t1 6 AUGUSTUS stop_codon 231944 231946 . - 0 transcript_id "g169.t1"; gene_id "g169"; 6 AUGUSTUS CDS 231944 232264 0.95 - 0 transcript_id "g169.t1"; gene_id "g169"; 6 AUGUSTUS start_codon 232262 232264 . - 0 transcript_id "g169.t1"; gene_id "g169"; # protein sequence = [MGANSSRAFDTSTVMKFVGDILNEEVRKINQAKLKEYQVKLRAYTENVTTGDSASDLPTATTNTMAEPVLERVEEFCT # TSRDNRCLQNDVTGNLLCPAEFDWNDTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g169 ### # start gene g170 6 AUGUSTUS gene 235445 236806 0.97 + . g170 6 AUGUSTUS transcript 235445 236806 0.97 + . g170.t1 6 AUGUSTUS start_codon 235445 235447 . + 0 transcript_id "g170.t1"; gene_id "g170"; 6 AUGUSTUS CDS 235445 236806 0.97 + 0 transcript_id "g170.t1"; gene_id "g170"; 6 AUGUSTUS stop_codon 236804 236806 . + 0 transcript_id "g170.t1"; gene_id "g170"; # protein sequence = [MGHITPRVLLTPEPDMFNAGGMDGHPNGPELVPTEMTAAGRPICSSHGHLPARYLDVLPRSAPAVGSLQVENEVQPTE # QRTSTHTLPRIILIVRDKLKTQLNIFGLWREYPDRPSHDPDGEVGLEDLSNLPHSEEHQDNEHSESENSRDDSPLNPTQTLLAGWQNNGNSTKSNNEM # DGLAHILQRPDFQVKELEGYNAQAANEKITKADEDWGRNQFKDSFIETAVEIEVPSGDPQIPSKKFQIPQLLYRNPLSVIRAAFADRLASQFHFVPFK # LFQEIDSDDGKTISQRVQTDLYNSDVFLEEHKNLRRAPTDDKDCKREKVVAALMCWSDATQLANFGTAKLWPIYMLFGNLSKYVRASPNSGAVHHLAY # IPTIPDSVKHEISKFNVNWKTQAKEIIAHCNRELYHAVWRFLLNDAFLHAYKYGIVIKCFDGVERRVYPRFFTYSADYPEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g170 ### # start gene g171 6 AUGUSTUS gene 238994 239293 0.96 + . g171 6 AUGUSTUS transcript 238994 239293 0.96 + . g171.t1 6 AUGUSTUS start_codon 238994 238996 . + 0 transcript_id "g171.t1"; gene_id "g171"; 6 AUGUSTUS CDS 238994 239293 0.96 + 0 transcript_id "g171.t1"; gene_id "g171"; 6 AUGUSTUS stop_codon 239291 239293 . + 0 transcript_id "g171.t1"; gene_id "g171"; # protein sequence = [MFMRYFPGGGVGHVANRKFFKQVEDTSNDDAVSDISSDPGADELEIPDTEEVDLDEMSENGSDDDIGLDGDDDDSNSD # DDDDPDVGGDDWQWDDGYGSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g171 ### # start gene g172 6 AUGUSTUS gene 240212 241108 1 + . g172 6 AUGUSTUS transcript 240212 241108 1 + . g172.t1 6 AUGUSTUS start_codon 240212 240214 . + 0 transcript_id "g172.t1"; gene_id "g172"; 6 AUGUSTUS CDS 240212 241108 1 + 0 transcript_id "g172.t1"; gene_id "g172"; 6 AUGUSTUS stop_codon 241106 241108 . + 0 transcript_id "g172.t1"; gene_id "g172"; # protein sequence = [MAHNHSADSSDDDEAPETLTLTESKGAFRKRNAEIREVEEARKKMRKDKRRERERILKERKQQREREELKAVKSRRVS # DNAEEEEDDGGEGDEEEDGENDVEKRMLRAMQQAEEEEEEEESGNEVDSVEEGESVDEDVDEDDIDAETREDVDEDEEDKEMVVDEDDDGGHEDEHEE # GSDAEMFSVDSSPPRSKSKSTLNAKSSMPKLKTNHLPDYLFASAFSSGSQKNQSKNNNLSFTGLSTTKKLQEKKTRRRKRSGGIARDHIIGYVLCTAS # TNTCIRYCSLITRSLHVLLIVSTH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g172 ### # start gene g173 6 AUGUSTUS gene 242826 245124 0.89 + . g173 6 AUGUSTUS transcript 242826 245124 0.89 + . g173.t1 6 AUGUSTUS start_codon 242826 242828 . + 0 transcript_id "g173.t1"; gene_id "g173"; 6 AUGUSTUS CDS 242826 243288 0.9 + 0 transcript_id "g173.t1"; gene_id "g173"; 6 AUGUSTUS CDS 243338 245124 0.89 + 2 transcript_id "g173.t1"; gene_id "g173"; 6 AUGUSTUS stop_codon 245122 245124 . + 0 transcript_id "g173.t1"; gene_id "g173"; # protein sequence = [MIASSELLQEPWYKATTNGSDLSSVDGLSASAGSIIRPTPKPNRKASLYSLIAGKDNSLFSNSSQQTVTPYTSLQSST # TSFSTLSSNISPLEKFRLKKAKSSFNMQGPASPSAIAGPSDLSRIHSVTAISQSNLRKDLWAPAHDNDTDAVLRIIDRPPNLSRISTETDTPKVSVRV # VGRGGQGSRPRPTNQRISHLHQSLQDQQISPTSLVDSFDNVSRTHAKAPAVPGPISIARVVGRGGLGSKRRVHLNSSSTFLSPSLSNDPRVYPHQRTQ # STPTHSRNFAGSSSSLQSPAIRVSGRGGAGSRLRVKSPSPASGPSLATMCKIKWKNRKRAQSKSDTSPFPEPSISPRPKISRFVSLKRAKVDNNIPQS # NDNNDDESQPLPVIPASPPLPNTVDLEHDPTSTSTTLSVYVHPSDVRLPAAAPRNKLERTLGDAVPSHMLLSANANHIPDIPLGKPDRRRSRGSIHSL # SSLSSTAKSNHRRSVARSLSSLGSFIRLSNSRPSSDVFVYSEEGGNDVFDVIEGDDDKEEVCWIDNEFDSYPREGTVTPISPMVFSVRPPSPMPPSKP # KLIVDSNISVDGTSASVVSVGTEADGQDSSVLSSDDDHRSAHSEVHTQATSLNDSSLSDTPFSFTDVCDTAPQPASPIIFFSEPEPESERPSSTVHPF # SPRSDAESDVTESTPRTQLEALLSEPIQSLTNSPSSTSLFRSSFPFHPRREEREVVEPHAHGWTGEWNRKNMQDVIRSLRELK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g173 ### # start gene g174 6 AUGUSTUS gene 249632 250102 0.64 + . g174 6 AUGUSTUS transcript 249632 250102 0.64 + . g174.t1 6 AUGUSTUS start_codon 249632 249634 . + 0 transcript_id "g174.t1"; gene_id "g174"; 6 AUGUSTUS CDS 249632 250102 0.64 + 0 transcript_id "g174.t1"; gene_id "g174"; 6 AUGUSTUS stop_codon 250100 250102 . + 0 transcript_id "g174.t1"; gene_id "g174"; # protein sequence = [MKRQNKLKNSKAIAVDITRQEKMNFIHSMGIELLPSTRLPDDAIERKFRGAIDASQSFSKLIQKPPFNPSSFPLWSKK # NASKSLLDSVKRGNMMEAFANAQARSQGKENAWDMYENVFVDIRQTIMSLASGFDKGVISAIAQDKDYSYAICIRVRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g174 ### # start gene g175 6 AUGUSTUS gene 251572 252495 0.14 + . g175 6 AUGUSTUS transcript 251572 252495 0.14 + . g175.t1 6 AUGUSTUS start_codon 251572 251574 . + 0 transcript_id "g175.t1"; gene_id "g175"; 6 AUGUSTUS CDS 251572 251610 0.3 + 0 transcript_id "g175.t1"; gene_id "g175"; 6 AUGUSTUS CDS 251696 251819 0.97 + 0 transcript_id "g175.t1"; gene_id "g175"; 6 AUGUSTUS CDS 252021 252052 0.57 + 2 transcript_id "g175.t1"; gene_id "g175"; 6 AUGUSTUS CDS 252181 252495 1 + 0 transcript_id "g175.t1"; gene_id "g175"; 6 AUGUSTUS stop_codon 252493 252495 . + 0 transcript_id "g175.t1"; gene_id "g175"; # protein sequence = [MLSLIGDEATCWVPKAKTGASKKPAAAPFGSKTTKTKKNPLFEASPKNFGIGAPTVQAFEQVPSRETKKPLFVKYGLN # HIVALIEAKKAALVVIAHDVDPIELVVFLPALCRKMGVPYVIVKGKARLGTVTHKKTAAVVALQEVKSEDQRELATLVSAAKANLYVIIMY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g175 ### # start gene g176 6 AUGUSTUS gene 262024 262434 0.43 + . g176 6 AUGUSTUS transcript 262024 262434 0.43 + . g176.t1 6 AUGUSTUS start_codon 262024 262026 . + 0 transcript_id "g176.t1"; gene_id "g176"; 6 AUGUSTUS CDS 262024 262031 0.47 + 0 transcript_id "g176.t1"; gene_id "g176"; 6 AUGUSTUS CDS 262095 262434 0.43 + 1 transcript_id "g176.t1"; gene_id "g176"; 6 AUGUSTUS stop_codon 262432 262434 . + 0 transcript_id "g176.t1"; gene_id "g176"; # protein sequence = [MRGIVERERKRDSFGSYKSITNLNGDAGRLNFGSIESVSNVQALIPNNNAEVDERAPLLGSRTLTPTTITARDYAHVP # QRRDDDSVVSDGENGPIYGSYKSQRSQISQGTETGGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g176 ### # start gene g177 6 AUGUSTUS gene 270712 271557 0.5 - . g177 6 AUGUSTUS transcript 270712 271557 0.5 - . g177.t1 6 AUGUSTUS stop_codon 270712 270714 . - 0 transcript_id "g177.t1"; gene_id "g177"; 6 AUGUSTUS CDS 270712 271557 0.5 - 0 transcript_id "g177.t1"; gene_id "g177"; 6 AUGUSTUS start_codon 271555 271557 . - 0 transcript_id "g177.t1"; gene_id "g177"; # protein sequence = [MSLKSSKEYAQVFYDVVQCVFPFIITPVRGSSHTIFLGHYWGWKYPRILHRDISIGNIMVREKDRQKYGVLNDWDLAI # WLNERKEGSTSKFRTGTKPYMAHEQHSSDWQGPHRFRHDLESVFYVILLLVSLYSSPTEKVRFPSTGDHRYEKWHQQDDGVLHGQKLNIVHNGKWRAF # PQPFFSGFTLWLAALQENLRHGIFNLENHNHAVLAASEPLKPGRRPRKVPFFDEDTLGGNFSYKKVVMIMHQFNQEELRTRGHEWQATLEEASSEDWE # LEESEEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g177 ### # start gene g178 6 AUGUSTUS gene 272200 273123 1 + . g178 6 AUGUSTUS transcript 272200 273123 1 + . g178.t1 6 AUGUSTUS start_codon 272200 272202 . + 0 transcript_id "g178.t1"; gene_id "g178"; 6 AUGUSTUS CDS 272200 273123 1 + 0 transcript_id "g178.t1"; gene_id "g178"; 6 AUGUSTUS stop_codon 273121 273123 . + 0 transcript_id "g178.t1"; gene_id "g178"; # protein sequence = [MSASTGEAELRQNSHSENSATSPEHQSSPNSWTLGDRTSNDHSRAKSPHQTASEEPEGHDRSDKDSLQGSTEKSKPKD # KVKANATAEKFKGKEKAIEKEKVTSPQKKPMPNRRSSTRLQTNDNSSLSILSDDDDPSPPSSECLPDDQAAIADTLKVQILGKKRSTAVVASALNRNT # LALGGHQLELVEIQCKNEERVRGEIGELRVRVDALEVSGLGAHVDESVISDGSGSPKVPAASLLRDIRTRIKALEGNNHLLKDGVDWKRTLDKEFRTL # KDKVEVYEGFRKLSPSQRMSWRYAHTPQRSLRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g178 ### # start gene g179 6 AUGUSTUS gene 274764 275414 0.52 - . g179 6 AUGUSTUS transcript 274764 275414 0.52 - . g179.t1 6 AUGUSTUS stop_codon 274764 274766 . - 0 transcript_id "g179.t1"; gene_id "g179"; 6 AUGUSTUS CDS 274764 275414 0.52 - 0 transcript_id "g179.t1"; gene_id "g179"; 6 AUGUSTUS start_codon 275412 275414 . - 0 transcript_id "g179.t1"; gene_id "g179"; # protein sequence = [MVREKDRQKYGVLNDWDLAIWLNEWKEGSTSKFRTGTKPYMAYEQHSSQWQGPHRFRHDLESVFYVILLLVSLYSSPT # EKVRFPSTGDHRYEKWHKQDDGVLLGQKGNIVRAGDWQPFPQPFFSGFTLWLAALQKNLRRGIVNLENHKEAVLAAKQPLKPGRRPPEVPFFDEDTLG # GYFSYKKVVMIMHQFKQEELRTRGHEWQVTLEEASSEDWE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g179 ### # start gene g180 6 AUGUSTUS gene 276823 277494 0.79 - . g180 6 AUGUSTUS transcript 276823 277494 0.79 - . g180.t1 6 AUGUSTUS stop_codon 276823 276825 . - 0 transcript_id "g180.t1"; gene_id "g180"; 6 AUGUSTUS CDS 276823 277494 0.79 - 0 transcript_id "g180.t1"; gene_id "g180"; 6 AUGUSTUS start_codon 277492 277494 . - 0 transcript_id "g180.t1"; gene_id "g180"; # protein sequence = [MVREKNGQKYGVLNDWDLASWLNTPNEVSTSKFRTGTKPYMAHEQHSSKWQGPHRFRHDLESVFYVILLLVSLYSSPA # EKVRFPSTGDDRYEKWHKQNDEYLRGKKVDIILNGQWQAFPQPFFSGFTLWLIALQRSLMYGFIGLNVHNATKTDTKQPPKPGRRPRKMPFFDEDTLG # ENFSYEKVVMIMHQFNQEELRTWGHEWQVTLDDASSEDWESEELAES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g180 ### # start gene g181 6 AUGUSTUS gene 280056 281054 0.98 - . g181 6 AUGUSTUS transcript 280056 281054 0.98 - . g181.t1 6 AUGUSTUS stop_codon 280056 280058 . - 0 transcript_id "g181.t1"; gene_id "g181"; 6 AUGUSTUS CDS 280056 281054 0.98 - 0 transcript_id "g181.t1"; gene_id "g181"; 6 AUGUSTUS start_codon 281052 281054 . - 0 transcript_id "g181.t1"; gene_id "g181"; # protein sequence = [MSNNQPTNYPRTRKATALQNTGARDVTVSSSQVPSSAQREGASRRNEPPRSAHIPSTEEVPSRLSEGTINLPTGVGTG # GPALISAPGQIDPTMLAPSMQGFPLPTGTNPERPSTPLRIHHVSDSVTYFATPSSHHSGSYTGALPVDESHTVEEAYRYLQMDLEAVRILPVEKWALC # CLNIDINKGREKLLPGVKKAFDKYLEIVDDAKNEKDPRLYPALVATFDLCTNGDSDTLVFYRQDPSKIAGSLVLESPDIGAVFKELLEDPTKVKRKNL # ELKEGERTMWAHMHGLIEVKHQHGAIVDGECKCLLTLSLSLCSHWSFQSEEMQARYTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g181 ### # start gene g182 6 AUGUSTUS gene 287153 287614 0.97 - . g182 6 AUGUSTUS transcript 287153 287614 0.97 - . g182.t1 6 AUGUSTUS stop_codon 287153 287155 . - 0 transcript_id "g182.t1"; gene_id "g182"; 6 AUGUSTUS CDS 287153 287488 0.97 - 0 transcript_id "g182.t1"; gene_id "g182"; 6 AUGUSTUS CDS 287585 287614 0.97 - 0 transcript_id "g182.t1"; gene_id "g182"; 6 AUGUSTUS start_codon 287612 287614 . - 0 transcript_id "g182.t1"; gene_id "g182"; # protein sequence = [MHLTFPYFVFPRVAGPPQRTEPKFHLKFIEPSVGSLKPEELIRDRIRAAIKTAPNYGSIFEYVVYDNQCNIEDPRFAG # EITVKFWTNVKDATDGCTEKSPCTGKVVQNGDSNSLIRVVEGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g182 ### # start gene g183 6 AUGUSTUS gene 290052 292778 0.54 - . g183 6 AUGUSTUS transcript 290052 292778 0.54 - . g183.t1 6 AUGUSTUS stop_codon 290052 290054 . - 0 transcript_id "g183.t1"; gene_id "g183"; 6 AUGUSTUS CDS 290052 292778 0.54 - 0 transcript_id "g183.t1"; gene_id "g183"; 6 AUGUSTUS start_codon 292776 292778 . - 0 transcript_id "g183.t1"; gene_id "g183"; # protein sequence = [MGGTGKSQVIKALLQFFAERNSSFAIVTSAPTGNAAALLGGSTYHFLLGLNNKVEEVGRGTMAQVCTRLEHIQYMILD # EVSMLSCLDLYRISVQLCEAKNKHDIAFGGMNMIFAGDFAQLPPVGGESVSLYSYRKPTDANKYNGQCAAMGKSLWHNVTHVVILRKNMRNTGSSKMD # ISFRLALDNMWYKSCTKEDILFLNTLVSSKLPDRPFVGKSPWRDAAIIVGENKYKDEINRLGCLRFAADTKQKLTNFYSDDLVSGNADQGAPAKSKNK # KRSMSSISKDLQQHLWELPTCAHEYHAPPVLSLCIGLPIIICHNIATELSITKGQRGTVYAWHESTGAFGQCTLDVLFVLLDDPPTPIQVPDLPPNVV # PLTRRKTKGIVTLKNDVKISVTRFQVDVLPGFSMTAYASQGQGLIPNATDLNTLSDHHAMYTALSRSRSAASTVILQGFDSRAITGGASGPLRKEYRE # LEILDEITHLKYEGTLDPSVVGVTRNLLIESFLVWKGTSYVPSQIHSAVSWFAKDPYIQQSEQPLSWSRVQKKAVKRLMKQNKKSNTSENTTTSPAPL # VPPDISKFEVKSKKRNLSDVYGSTDIPLPSAVRQHTTNQHIVPLSNELRRSSAARQASQKRARKNRITSGNQRQLAILPTGLTWSNNSCAFDSVLLIL # LYIWMELDITGDEYSNLPQLIKGFSEYKQGKHTLETVRDDLRISLNSRRPREFNLTGFCSSTAILEEMLKMKSPFMTTKLQCEQGHLSRRRPHNVKVS # LLEEPRLVLPSSTNEWISVNGPASSSIMCNVCNLPLRKLFHIKCAPNILAFACDGRPQLKIDYSVHLQCNNEDVHYVLKGVIYYIPMREHFISRIVAS # DNMVYVYDGMFNNGVPILESSDYSVLDWAQCQSGSASAVIYSRTDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g183 ### # start gene g184 6 AUGUSTUS gene 292958 295106 0.27 - . g184 6 AUGUSTUS transcript 292958 295106 0.27 - . g184.t1 6 AUGUSTUS stop_codon 292958 292960 . - 0 transcript_id "g184.t1"; gene_id "g184"; 6 AUGUSTUS CDS 292958 294995 0.43 - 1 transcript_id "g184.t1"; gene_id "g184"; 6 AUGUSTUS CDS 295096 295106 0.27 - 0 transcript_id "g184.t1"; gene_id "g184"; 6 AUGUSTUS start_codon 295104 295106 . - 0 transcript_id "g184.t1"; gene_id "g184"; # protein sequence = [MVTSNNPVAGARFFHLLVNLFLKHVVDIESSDGGLFGPTSGYYCTVEQQGRLALHLHGLIFNRKTLSPQEIRDKILDP # ASSFQSQLVSFLESVRIGEFLSGSHAYVKETIASQTKSNPNYVSPERTLPTPPPPYCDCGTSDCHKCSTFIQWFEQFKLTVDDLLLKSNVHDCFRGIS # PDGSVLNQDKFETSCLNNVHKKCKARFPRECFQQTLVDPENGHINLKKLEEWLNDISPGLTYLVRGNTDVSSILSGTAIKSAVIYIADYITKTGLKTH # VVFDSIKTIFDKSTEIIDGSFSTKEKSRRLISRIVNLLSTKLELGSPIISLYLLNNPDHYTSHHFIPFYWRTYVSTARSVFEENDATSEPKVILTKRW # GKIIGLSSSLDYTHRPVQHAHYNLYDWICCFYKTAKNKSKGVIEHDPELISSRSSKGNKQLLFLPGHPLVDTHAIATRQDSSMTVPNFVGSLPHPDKD # DREYYCCTMLTLFKPWRSGEDLKNKNQSWHEAFEAYVFSDQSLLYMKNMNIRFECLDARDDFRAQLKSGKLDVTKLPSSIPVQLHEDLVNKLDGSQLD # VNSSVIEDSNYSYDQYTQDKKGSFFLKRESAMKAMKDILFNSGWVTPLTSNIQPKPIPICSPIPLPKEKPQHWDLILKGMRDHVLAAREKVEAYPLLT # IIPTKIMSQVNIGQIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g184 ### # start gene g185 6 AUGUSTUS gene 295561 296136 1 + . g185 6 AUGUSTUS transcript 295561 296136 1 + . g185.t1 6 AUGUSTUS start_codon 295561 295563 . + 0 transcript_id "g185.t1"; gene_id "g185"; 6 AUGUSTUS CDS 295561 296136 1 + 0 transcript_id "g185.t1"; gene_id "g185"; 6 AUGUSTUS stop_codon 296134 296136 . + 0 transcript_id "g185.t1"; gene_id "g185"; # protein sequence = [MSFGSDPESFLEYALSLPDPVGPDPEPSDPSDQSSPSDHNSEQESVQSGTNSDPDQSSYDSEFPGPFDYDYLHESSDF # DSDHPGPYDLRYLHSYPSSSASDSVESFHSFASDNSEAPELRPGDDRSGHPHLGPDGRLLDSERERRRVLGLCFYCGGEHMKVHCLKLQARTGQNYDA # DNSESDVPGSDDGSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g185 ### # start gene g186 6 AUGUSTUS gene 298075 299865 0.28 - . g186 6 AUGUSTUS transcript 298075 299865 0.28 - . g186.t1 6 AUGUSTUS stop_codon 298075 298077 . - 0 transcript_id "g186.t1"; gene_id "g186"; 6 AUGUSTUS CDS 298075 299865 0.28 - 0 transcript_id "g186.t1"; gene_id "g186"; 6 AUGUSTUS start_codon 299863 299865 . - 0 transcript_id "g186.t1"; gene_id "g186"; # protein sequence = [MVLCLLSIKLIVHCFFVVTFKVLDCILEIVYLRSLSKKRHFGGGRPPTNSESGIVSTLVTEAFTFKCPIQKTSTVPPK # TGDNIAFNFPPPPISESHMALVIDKWCKSSSPVNFEEAGCAVCGQLTLRTDLSALKNMKNYLHVLEAQSVTRAFRTSPDELISEIEGPVLDKSAGDNI # CNNCRSSLRAGNVPKLALCRGLWLGVIPDELKGLTFYEKMLIARVRHTKCFVRVQKGSTNYSKLVSNVIAFENPIPKIYDTLPPPKEEIEEVLAVMFS # GSTKPTQDDYARALLLVRRNVVAKALQILILNHFDYNDVVFSSANLESYAEDAPIVTVEYFQKGSNRNAEGISVHDDLNDDGTEKGDCVFTVHGIVGP # SIKNMTRDQMIGIAAMHLDNEGKFMRTSHAENPESLWNNPQLYPKMFPWLFPFGLGGIGTSDIKAFSESSHIKFLLLYHDKRFQLDSNFPLIAFSHQQ # IKANSSQSYLLAESKKFSEISDQFLSVDKSILQNIATRMANGEHVKPANESEIQCFKLLGDLTHAGAKTQGSISSKKTMQSEIWSLINHIGGPSWYIT # VSPCDFKHPICIYYADTKEKFDVPLRTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g186 ### # start gene g187 6 AUGUSTUS gene 302978 304201 0.54 - . g187 6 AUGUSTUS transcript 302978 304201 0.54 - . g187.t1 6 AUGUSTUS stop_codon 302978 302980 . - 0 transcript_id "g187.t1"; gene_id "g187"; 6 AUGUSTUS CDS 302978 304201 0.54 - 0 transcript_id "g187.t1"; gene_id "g187"; 6 AUGUSTUS start_codon 304199 304201 . - 0 transcript_id "g187.t1"; gene_id "g187"; # protein sequence = [MVSGIIPSHEKLVVCIFVICRVLILHSFRCIRQVVNFIRCANVFNGAHFDPTSPSAIACPTVNNKIHLVLAEDHFFNA # VFLTVGRVNESYIFNPKSFLAKDKAVRYIRGLRIHGLMQESQRLFACFGSLIGSTKFGCPVSEGVIDFRSNQRFDSDVWKDDPDNLSPLEPGLSSSSL # FDVSSQIIFLLSVTPGKKREVSNIPKNIHCKDPMPFCRAGKLRMRFPHSSILTQATVPIFDGRGSFVASAAQLNQISSRTYPLYLDSQEEAPPDSIVC # VGYTAHTWQSSGSFKAPPLCLSLGLQFVVVLALPPGYDGPAPPSSGSSGPFPKPIYNTPTRTKDFPGPPRRNHSRTQASSSRVSPEAARPLRVTRRNQ # ADSEDESPYLSAGRLKEGYEYHEDLMATKSISRAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g187 ### # start gene g188 6 AUGUSTUS gene 304272 306242 0.73 - . g188 6 AUGUSTUS transcript 304272 306242 0.73 - . g188.t1 6 AUGUSTUS stop_codon 304272 304274 . - 0 transcript_id "g188.t1"; gene_id "g188"; 6 AUGUSTUS CDS 304272 305397 0.85 - 1 transcript_id "g188.t1"; gene_id "g188"; 6 AUGUSTUS CDS 305954 306190 0.83 - 1 transcript_id "g188.t1"; gene_id "g188"; 6 AUGUSTUS CDS 306238 306242 0.91 - 0 transcript_id "g188.t1"; gene_id "g188"; 6 AUGUSTUS start_codon 306240 306242 . - 0 transcript_id "g188.t1"; gene_id "g188"; # protein sequence = [MLLSLPRTARPSLGVIGSPDTSHSDGHFSEVEAAASDADCSDGVYETNAHDHSSNSVIVGEQVGDQSPIEWSPTPPRG # QALRTYYASDDPDFTKLVSSPSSSQHHGGNLLSGVANTPTSHGHPHPSSTSSASADVSVGLQVDEDSFELCYPPEDPVVPTAVETFSRRLSVDEYDDM # DIDLPADFRSIRALRTPSPDLPSNPLEGWSPTPRSQSTLGSLTRPGLFANSSTNPHISPSKLKRGMSPLKALSSASPSPPRSLLSSQSHSFSGTSTAN # TSPSKASAQGSPKSRGKDHVRFHPFKQSTPNHSVPSSLIAGTLPVKSPSKSSTAGKRYRDDIIRHALSDGQCSPSTPSAVANKQGVSSPHREFRNALI # RDALGENDLSNGVNSSGTAIAQELNHPQEVPPFVDNNLGDTGVLNPAWIDRRFAESFRSVTNLPLVSASQPLCYLLLIYCAWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g188 ### # start gene g189 6 AUGUSTUS gene 315819 316805 0.41 - . g189 6 AUGUSTUS transcript 315819 316805 0.41 - . g189.t1 6 AUGUSTUS stop_codon 315819 315821 . - 0 transcript_id "g189.t1"; gene_id "g189"; 6 AUGUSTUS CDS 315819 316272 0.44 - 1 transcript_id "g189.t1"; gene_id "g189"; 6 AUGUSTUS CDS 316330 316805 0.41 - 0 transcript_id "g189.t1"; gene_id "g189"; 6 AUGUSTUS start_codon 316803 316805 . - 0 transcript_id "g189.t1"; gene_id "g189"; # protein sequence = [MEIKPVVTAPPRNQSRFDKRQTEALIDEGDDELWAGQISIGSPAQKFLVDIDSTFPFSLYYFHARFLNTLVTAGSSDL # WIPSSSCKSSVCSSKHKYNAGSSSTSKKLSGTFSIQYGDGSSVSGPIYDDTVTVAGITVTEQTLSGVTELSSDFENDPTDGVFGFAYPKISNLQANTF # FVNAFLQDAVPSNEFSLFLASFGSELFLGGTNTEKYSGVPEFHNVDLSTGFWQISGASITYGSSTAVSGFETIIDSGTTIMYGPPAAVKKFYAKISGS # QLYDATNGLYSFPCSTSSSISFSWGGKSFAISSKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g189 ### # start gene g190 6 AUGUSTUS gene 318230 318598 0.53 + . g190 6 AUGUSTUS transcript 318230 318598 0.53 + . g190.t1 6 AUGUSTUS start_codon 318230 318232 . + 0 transcript_id "g190.t1"; gene_id "g190"; 6 AUGUSTUS CDS 318230 318263 0.53 + 0 transcript_id "g190.t1"; gene_id "g190"; 6 AUGUSTUS CDS 318363 318598 0.67 + 2 transcript_id "g190.t1"; gene_id "g190"; 6 AUGUSTUS stop_codon 318596 318598 . + 0 transcript_id "g190.t1"; gene_id "g190"; # protein sequence = [MLGNAGMQSTAEGNELEDIPWQKQPPLGSFLGDSEPLSDESNDSSLRTSLLFGGPWSDLTFFPLDFELDWEELGLGGG # AILSEGREECF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g190 ### # start gene g191 6 AUGUSTUS gene 320906 322417 0.88 - . g191 6 AUGUSTUS transcript 320906 322417 0.88 - . g191.t1 6 AUGUSTUS stop_codon 320906 320908 . - 0 transcript_id "g191.t1"; gene_id "g191"; 6 AUGUSTUS CDS 320906 322417 0.88 - 0 transcript_id "g191.t1"; gene_id "g191"; 6 AUGUSTUS start_codon 322415 322417 . - 0 transcript_id "g191.t1"; gene_id "g191"; # protein sequence = [MPPKRTKQAKGKRIQRTPKICHINRLSNDLLLEILRHFCDSRTAERFKRTCSYPDFDANFLAVSFVNKRWRSIILATP # SLWGKIYVALDSISPEKTPPFINSLVDLYLERSKGAALDICVLYSDYGVEDEDYNSEQEGEEGGNAGLLFPVLPKLFQHAFRWRSAVLRLPQSSVLDS # MRVPSDFPVLQKLDIQCVPAPDMDAGTTSFPGFLSPLLRKLSVTKFAFEGDFGSTCLDVISLTWVTPATAVDFFENASSKCTANIHTLFSPYRYFGSS # HVTSKLMALTVTATREENMAPDPLGNLLDCLTLRNVEKLTFVDERDNSCNTLSQSWLFPTKSLLSLFDRSLLTTTNLTYLHFTGRYISDSDLMKILDR # LPALKHLVFKEASPKIDESNPLTEHFFQSFVARYNPVKDHSNDVGISAPFLPDLTHIELGFNSKSFPSIALAEFIKSRLPPLSEDVGQSDPLPQNGIS # NWNIVSVQIYELMQDAPQLADALKAESIQISLW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g191 ### # start gene g192 6 AUGUSTUS gene 329822 330883 0.67 + . g192 6 AUGUSTUS transcript 329822 330883 0.67 + . g192.t1 6 AUGUSTUS start_codon 329822 329824 . + 0 transcript_id "g192.t1"; gene_id "g192"; 6 AUGUSTUS CDS 329822 330883 0.67 + 0 transcript_id "g192.t1"; gene_id "g192"; 6 AUGUSTUS stop_codon 330881 330883 . + 0 transcript_id "g192.t1"; gene_id "g192"; # protein sequence = [MLCDFTQGVLVEAINLRSRSRGGPGPGGPGRGPGGPGGGPGGPGRHLEELLPPPEIHPHHESSYTRKAHVNSSAFPNI # GFSESTNSGSWHRYYPGETRIQLDLTCLVSFYDTDLVPSLVAERYGKERIRHRLLGISPEDIHTVVRKVEELIAVSEAGSGIDWATLIRLIVKRYSER # LEMVQYILNSTNPANSAAENKVLAENIQVQLTAMLQPYMLFTIKPPQNSTSTNWVSPMYELCATTYTNYITTSSLHSRLTASENLILDGVQKTTREIC # RVVTGMWVDGIMSGLEPDFYKSSATENDGNVDLAPLLNSWKERIFGLMKWLDWSVWLKCRPACGFEVGVFNVPSCIVSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g192 ### # start gene g193 6 AUGUSTUS gene 331805 332302 0.99 + . g193 6 AUGUSTUS transcript 331805 332302 0.99 + . g193.t1 6 AUGUSTUS start_codon 331805 331807 . + 0 transcript_id "g193.t1"; gene_id "g193"; 6 AUGUSTUS CDS 331805 331863 0.99 + 0 transcript_id "g193.t1"; gene_id "g193"; 6 AUGUSTUS CDS 331984 332302 1 + 1 transcript_id "g193.t1"; gene_id "g193"; 6 AUGUSTUS stop_codon 332300 332302 . + 0 transcript_id "g193.t1"; gene_id "g193"; # protein sequence = [MPKQEDARGNTLESPRRRRSLGISDFPTSPVAIVSAEQLRVTSLPPYDPRTASALAGSSTSELSEQSIVDEPTNFHDL # YDAELEQIIDGIETSSASSSSLSATVYIPPGNAYCIDFVTEFELIQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g193 ### # start gene g194 6 AUGUSTUS gene 335170 336141 0.66 + . g194 6 AUGUSTUS transcript 335170 336141 0.66 + . g194.t1 6 AUGUSTUS start_codon 335170 335172 . + 0 transcript_id "g194.t1"; gene_id "g194"; 6 AUGUSTUS CDS 335170 336141 0.66 + 0 transcript_id "g194.t1"; gene_id "g194"; 6 AUGUSTUS stop_codon 336139 336141 . + 0 transcript_id "g194.t1"; gene_id "g194"; # protein sequence = [MKANLLLLLKVIQDEVTLPLLVHLQNTGITVRIVFLSGFLIIDVERLASSSSSYPSYSGSLSYGSSQKPSRSWSNDSG # PGVEASFPRNVNSYDASLRSTDLRQHSIYNTNVNLWSPPQLSSQWSNTGVPDQSWRNMSMPGIDSFEETKPIIHHNHVSVSSCSPLSTISSPSPSPSP # IHTTPNTTPKLGRRPSATGTAKVCAHCHATSTPLWRREPATLRTLCNACGLYLQQRNKLRPQELIDADGDDESESSSEHDGTGPECSHCHTHHTSVWR # RSKTGAQLCNACGVYVRLRGKDRPLSLKRNKIKPRTKHPKPSPELEKHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g194 ### # start gene g195 6 AUGUSTUS gene 337332 338081 0.88 - . g195 6 AUGUSTUS transcript 337332 338081 0.88 - . g195.t1 6 AUGUSTUS stop_codon 337332 337334 . - 0 transcript_id "g195.t1"; gene_id "g195"; 6 AUGUSTUS CDS 337332 338081 0.88 - 0 transcript_id "g195.t1"; gene_id "g195"; 6 AUGUSTUS start_codon 338079 338081 . - 0 transcript_id "g195.t1"; gene_id "g195"; # protein sequence = [MCFIRPHFVYLVLGTVDQLPGNNPVQYGPEDATIHAATSVPAILSPAYVYTGSTPTATGSIVTAASGVSAAAATTAAA # SATSTAAAVSATSSVSSSVTDSEASSSDSAASATSAATTTAIAESATSSALSSDVASGTSSSDSVTADSATTSGNEELVAPTSASSSSVSASTSDSVA # SATISSSSSATASASAVSSSGSGSNSSSSGDDDDDDDDYEYCERHTKSKHHSRSISNARRHHDAHRRLTSSDF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g195 ### # start gene g196 6 AUGUSTUS gene 345023 345391 0.5 + . g196 6 AUGUSTUS transcript 345023 345391 0.5 + . g196.t1 6 AUGUSTUS start_codon 345023 345025 . + 0 transcript_id "g196.t1"; gene_id "g196"; 6 AUGUSTUS CDS 345023 345391 0.5 + 0 transcript_id "g196.t1"; gene_id "g196"; 6 AUGUSTUS stop_codon 345389 345391 . + 0 transcript_id "g196.t1"; gene_id "g196"; # protein sequence = [MPGFTAHAAENWMMFNGINTGFNGSGTFTPMTPVETAFAEELIAYWLSFVRSGDPNTFKQEKSPFWPEYFITGPTSEF # KQRIVFQQDQNNSTILSGSFVEMEPESESTRCKFVASKAQEEQN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g196 ### # start gene g197 6 AUGUSTUS gene 348577 350556 1 + . g197 6 AUGUSTUS transcript 348577 350556 1 + . g197.t1 6 AUGUSTUS start_codon 348577 348579 . + 0 transcript_id "g197.t1"; gene_id "g197"; 6 AUGUSTUS CDS 348577 350556 1 + 0 transcript_id "g197.t1"; gene_id "g197"; 6 AUGUSTUS stop_codon 350554 350556 . + 0 transcript_id "g197.t1"; gene_id "g197"; # protein sequence = [MATIVHRASSAVHDHPPTPLIPQRRRRETSPEIIDVDSLEEVEYVPRPRAGPLQNLPSQRRRVSAFDVTFPPGEIIVL # DSDDEDYDPSVFGTSSTQSQASSSQGGYPPPLHMLRSKEKTIKYFLTCYMLVVHSRDISPLSPARTSARPTGSIFPRMEDGSSVPMRRHPPPFPTNAP # PVTANPVEMDYERFLQTNIIPRPSSSSTFQASGSRNRRGVATADANGSSHNSQTPPSPRASRAAVRAGGGIITSARAHAAERRAERERNAQLRASGAA # RPRFRARRPTAAPGDNMHFVGLIRYDVFDPFDPRNYAAFNNIGFERYGPGFVHPIVQRKTDEPDYLAEYTHPQPATPGFCFDFEPPEKAETIDPSSYN # KPIPVSSQDNPFVLDDDGEIVQEPEPQEVDVDVGGSSNMKSSAPSPTVVSFVCSKCLEPLLLGEGASATALKMAAAGASAEQVEMERKARKVWGLKCG # HLIDGKCLDALGYPAGALDAQPKDVKGKGKGKSFSEEVDLADACDGELEAEKAKGATDEDVHPSLVPPSESNSIRSRLRSAAHSNNASASVSGATIGT # STGGGSTTPSPQFSTFAHRYLPTPIAHLFGHGPGSSSTSPKSKSHRKPRVQQTYSWKCPVNNCGRVHTSVRLEGVWGPEKVKGEGAIPLFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g197 ### # start gene g198 6 AUGUSTUS gene 353346 354200 0.99 - . g198 6 AUGUSTUS transcript 353346 354200 0.99 - . g198.t1 6 AUGUSTUS stop_codon 353346 353348 . - 0 transcript_id "g198.t1"; gene_id "g198"; 6 AUGUSTUS CDS 353346 354200 0.99 - 0 transcript_id "g198.t1"; gene_id "g198"; 6 AUGUSTUS start_codon 354198 354200 . - 0 transcript_id "g198.t1"; gene_id "g198"; # protein sequence = [MPDPPKVDPFASPKDGAHEDIQVVPPTPVVAGAAPSFLSQARDNIASTLANATAYAVRRDSSALFGNHSRSSSFIGSY # PSSPTMGAQFPIGTPNGSMYRSSSAMMTGLASAATSTGVNLTAPRTAPRLRTTLLPFLLRPSSMTSLPPAQVKASDGSLVEKPWREGPSAAELSKTPF # MKRIFTRKRISRMLPHLLALVGLGLGVLQCVLTYIDVSTERMDRQPLCLVMEEDFNGGEDVVFGSGLGGEGGSFWREVNMDGFGYVIDAHFELCFIVE # VLLKEMANSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g198 ### # start gene g199 6 AUGUSTUS gene 358394 360342 0.98 + . g199 6 AUGUSTUS transcript 358394 360342 0.98 + . g199.t1 6 AUGUSTUS start_codon 358394 358396 . + 0 transcript_id "g199.t1"; gene_id "g199"; 6 AUGUSTUS CDS 358394 358947 0.99 + 0 transcript_id "g199.t1"; gene_id "g199"; 6 AUGUSTUS CDS 358998 360342 0.98 + 1 transcript_id "g199.t1"; gene_id "g199"; 6 AUGUSTUS stop_codon 360340 360342 . + 0 transcript_id "g199.t1"; gene_id "g199"; # protein sequence = [MASSHARNLKKAAAARAREGRARKRLGLDVTFELLPDSEPATRAQEGRAHEHLGLDVTSELRPDLEPEELGELILEED # DLEMLADMLEDLDLWDPADGPMDSGQESDSEVEELKGEELVRSLEEKEARTESAFEVLMKERSVKEWGHAENSSRMGVYNGRSDRTKRYHAQKVVKKK # KKDAAMRNTNTAKAFTSFFIPIQKAVVVAPESIPRTCTPESDPTPTLPNPSPMFSVTGNSECPELEGFLSDAEEDPGDDFDLSDGDKTATPDYRCGIN # EQSASLVGPPRKRQKRAERAEASAKYQQTRDHQLTSALKDIEKLLASKKDSFVNGHDGLQATRARSIRSTLTMVVEKKKGLIDVSHIAAEANNFSLNW # GSRCIRQWTQNWIKTRVLPQSSRGRHTKVYSLLSEPAARDAIRGYLRTNKWSVNPPRLKKLFANELAPDEAREYAKQIISQEMPRGLKGFVEEHLLPR # MQCRPGRFGLSLSSMRWLMLREGFVFIEHKKAVYFDGHERPDVVQDRQTRFIPQANIFRHQLVRYDTKDVTKELPPEEGFADKPKYVLCSHDEMVAQA # HDGQKKGWVLEGEQPLKKKGPGRGIHQSDFICSTVGWLKDASVTLEYGKNHEGYWNCELFIRQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g199 ### # start gene g200 6 AUGUSTUS gene 378502 379278 0.55 + . g200 6 AUGUSTUS transcript 378502 379278 0.55 + . g200.t1 6 AUGUSTUS start_codon 378502 378504 . + 0 transcript_id "g200.t1"; gene_id "g200"; 6 AUGUSTUS CDS 378502 379278 0.55 + 0 transcript_id "g200.t1"; gene_id "g200"; 6 AUGUSTUS stop_codon 379276 379278 . + 0 transcript_id "g200.t1"; gene_id "g200"; # protein sequence = [MGSVEEEDRVRVATNAVHPHSYTPRPILSPIEFGQESRIDPDGVSRAGQQMYAEQVFKNPGIAPSHSTTSSTSMLKLA # STSPSVLSASLFGSSPMNHIPVPSLVSLYSIYPVYPNHPIHANPLVTIGQLQSNLMTPTSDPGLAYFNQISHSNPGNLTSFPSPGPPTVASASGLTSV # SASASASPVLPISTETFQRKMHTYIRNIRDFCDGLEYQLQFNDLRMLQELEEKGNGFLEYVKTCLEREGRLKSDQSQDETGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g200 ### # start gene g201 6 AUGUSTUS gene 380289 381315 0.51 + . g201 6 AUGUSTUS transcript 380289 381315 0.51 + . g201.t1 6 AUGUSTUS start_codon 380289 380291 . + 0 transcript_id "g201.t1"; gene_id "g201"; 6 AUGUSTUS CDS 380289 380643 0.51 + 0 transcript_id "g201.t1"; gene_id "g201"; 6 AUGUSTUS CDS 380732 381315 0.62 + 2 transcript_id "g201.t1"; gene_id "g201"; 6 AUGUSTUS stop_codon 381313 381315 . + 0 transcript_id "g201.t1"; gene_id "g201"; # protein sequence = [MFHIFITFVVDSYIERIEQRDRIQNLIFEPKPIHTAPLHAYLNDLFTSTPEATDALETLRSELRSFGDEILSESISDE # SMVPLIRSLLSRDLLSAEKTAILKSFLDNKVILSEVASVLSQSKVASCQLLPFISSSRAYMDTEIIQALLFQYIGMKWSITMKNAFREFAESRAWKNE # IDPLSRKQLIRRQQFGVDVPGSEDAGDGNFSGDLWGQEPTPAKPSTGSNTAAPLVGSIQAQRKTLQLKQFFMTQLPDLMEGTADYDQEPAVDSGGAQK # PNPGINAQQVLLRLVSTETYLKKILHGSCTIMRADLEW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g201 ### # start gene g202 6 AUGUSTUS gene 382197 382721 0.83 + . g202 6 AUGUSTUS transcript 382197 382721 0.83 + . g202.t1 6 AUGUSTUS start_codon 382197 382199 . + 0 transcript_id "g202.t1"; gene_id "g202"; 6 AUGUSTUS CDS 382197 382721 0.83 + 0 transcript_id "g202.t1"; gene_id "g202"; 6 AUGUSTUS stop_codon 382719 382721 . + 0 transcript_id "g202.t1"; gene_id "g202"; # protein sequence = [MVSKRFAVKDIPAGWCYFPVSEGGLEIVNPIMHLLTIRDSLASYPDKQFLDCMDEDKSKYGQAKADWVNGAGTRNEHN # PESNFMPFEEYVLGREDRLAYWGDKWKYMQEMALPVSPTSPEGYSSYGKPVIEEWIMALYAHEIKTFFGGLKIVEPTLIPVGMLSVFRTAKVAWDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g202 ### # start gene g203 6 AUGUSTUS gene 384960 385841 0.97 + . g203 6 AUGUSTUS transcript 384960 385841 0.97 + . g203.t1 6 AUGUSTUS start_codon 384960 384962 . + 0 transcript_id "g203.t1"; gene_id "g203"; 6 AUGUSTUS CDS 384960 385841 0.97 + 0 transcript_id "g203.t1"; gene_id "g203"; 6 AUGUSTUS stop_codon 385839 385841 . + 0 transcript_id "g203.t1"; gene_id "g203"; # protein sequence = [MQGRRRSSESRRELALLDRQQQGRTSDEGNDGDDESETIFVAGEASDSDSDSGQAQKGQFEREERRITLLRLGEAGSS # SMNVTPAVTNYREDDEDVLDEGAVLVGRPRDEEEGEEDEGMDEHSGGGLSAKAGIILVRSSPQYLALSTYLQNVVMLILSWQHTSQGIHNIFVVIPQF # LVTGLSSIIFALVDPAKSVLRGSHPGGTLGPVLNHTTLGGAIPRYIVRDDTEDELEMIQELQASATSNSVVYIFRYVCPTLLSLLIRLDSSFMLVILA # ISCADIPSFMTGSVESQLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g203 ### # start gene g204 6 AUGUSTUS gene 390893 391426 0.28 + . g204 6 AUGUSTUS transcript 390893 391426 0.28 + . g204.t1 6 AUGUSTUS start_codon 390893 390895 . + 0 transcript_id "g204.t1"; gene_id "g204"; 6 AUGUSTUS CDS 390893 391426 0.28 + 0 transcript_id "g204.t1"; gene_id "g204"; 6 AUGUSTUS stop_codon 391424 391426 . + 0 transcript_id "g204.t1"; gene_id "g204"; # protein sequence = [MSPPSMPLHFASPSPQSAERPLSPSPSLRLSQTSSPAFQPPYPASFCDDSHEFSIAEFSQFSPLGATTSTPFRPFGVV # PSSPSAHDFSPPSRRSSLALSGFRLPSIKGKFRRNSETAFSKSDEMKIRLALARKVGGETGVGGGDEGYVYRGGMTNVKMHMRRLSRGLKDFVMINQR # S] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g204 ### # start gene g205 6 AUGUSTUS gene 391662 392242 0.98 - . g205 6 AUGUSTUS transcript 391662 392242 0.98 - . g205.t1 6 AUGUSTUS stop_codon 391662 391664 . - 0 transcript_id "g205.t1"; gene_id "g205"; 6 AUGUSTUS CDS 391662 392037 0.99 - 1 transcript_id "g205.t1"; gene_id "g205"; 6 AUGUSTUS CDS 392100 392242 0.98 - 0 transcript_id "g205.t1"; gene_id "g205"; 6 AUGUSTUS start_codon 392240 392242 . - 0 transcript_id "g205.t1"; gene_id "g205"; # protein sequence = [MSLYFYEPSYQWDRFFDNAFGALASRGNQGQSQALTERSDLPRFIRPKMDLHEDKEKNLVTATFEFPGVKKEEIQLDM # HNGRLTVSAETKVSEEHEQDGYAVRERSVGKFSRTLQLPQGVKVSLGSHLVVHWKIFTTMFQEEEIKASMENGVLTVTFPKATAEEKPKKITIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g205 ### # start gene g206 6 AUGUSTUS gene 393427 395235 0.96 - . g206 6 AUGUSTUS transcript 393427 395235 0.96 - . g206.t1 6 AUGUSTUS stop_codon 393427 393429 . - 0 transcript_id "g206.t1"; gene_id "g206"; 6 AUGUSTUS CDS 393427 395235 0.96 - 0 transcript_id "g206.t1"; gene_id "g206"; 6 AUGUSTUS start_codon 395233 395235 . - 0 transcript_id "g206.t1"; gene_id "g206"; # protein sequence = [MAQFLSRPQIEGFGIWLDKAEKSFLKKRIFRLENHIDGLDDQLDELKRAYEARRTPLLQERAAKLYEHNSVVNLLAPI # RRLSLDVLSEIFEQALFSEEDARIQVRLLCRFCRVSAAWRKAAIATPKIWSLLYFDIDRYPELVFEEDVSWIKDWICRSRGLPLNVHLNLSTELLDPV # PSEWTARAGQILEYVLEPQCRSRIWTLGLHGDLKPYLPLLNLPRDSFTGLENLTIASTSYRERNPSEEVAYLFPRQVQTFIGASKLRRLTVQEFNDSA # NPSLSLLDVFVLPMEQLRSLTIADRPEVSSSVYASIFNQAKNLIDLRFCDTPSRYALYPGFSETTSFVFPALRSLEISSREIVAHRLSFLQCLTAPCL # DQLTIRHSGYHLGHCCTDIKAFLQRSNTALSSLTLHQFSDEWGSEVSADLIAILRVLPTITSFRIDSCLFNLDELLEKMVYSSYQGSALLLPKLTHFE # ISYEKDIENWPWKLTEMIFSRADAAEKGEVAETPDWGSTEISRLQKVTLHGLNGPDKDIARISSLLGLGFIYKKKEQDSESKSLLGFADAPGEKKEEE # DEDKEEGDEEEDEDEDDDDDEENMFNDPYWSSDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g206 ### # start gene g207 6 AUGUSTUS gene 396699 397533 0.41 - . g207 6 AUGUSTUS transcript 396699 397533 0.41 - . g207.t1 6 AUGUSTUS stop_codon 396699 396701 . - 0 transcript_id "g207.t1"; gene_id "g207"; 6 AUGUSTUS CDS 396699 397105 0.84 - 2 transcript_id "g207.t1"; gene_id "g207"; 6 AUGUSTUS CDS 397174 397412 0.43 - 1 transcript_id "g207.t1"; gene_id "g207"; 6 AUGUSTUS CDS 397472 397533 0.9 - 0 transcript_id "g207.t1"; gene_id "g207"; 6 AUGUSTUS start_codon 397531 397533 . - 0 transcript_id "g207.t1"; gene_id "g207"; # protein sequence = [MAEIGAQESPVVGAHLKNAVKYQKDIDAFVHVIQGALQPVSIPVSDTHQSTLGGNSWTPPINSKQNQLVICGQNPQQS # REDNLGATAVTRAVGGMATHWTSTPHSEETTSSPIPRNELDSLLARARDFVKVDSTVFDKSIRHTTVKDILTTSFPNRNIRSIPLAVQPHSKAESGFV # TWSGSDTVLGDIINDPRFTIASEHRVTQLIVHPSFPGTVAGVLMRDLKTDRDVLVHARV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g207 ### # start gene g208 6 AUGUSTUS gene 407281 409407 0.77 + . g208 6 AUGUSTUS transcript 407281 409407 0.77 + . g208.t1 6 AUGUSTUS start_codon 407281 407283 . + 0 transcript_id "g208.t1"; gene_id "g208"; 6 AUGUSTUS CDS 407281 409407 0.77 + 0 transcript_id "g208.t1"; gene_id "g208"; 6 AUGUSTUS stop_codon 409405 409407 . + 0 transcript_id "g208.t1"; gene_id "g208"; # protein sequence = [MSFGNAKEKALIRQYRIAGFEKWQVPEIIGTLPLILHASLALFLIGLSLFAAELHTSLSWIVVTITVMAFTMYFGSIL # LPSIWLDCPYRIPLFFIAIGNVISTVKMGHWLFLWTGVKLLDFGKEHEQDEINSGSSVKQDSVGRKFPTFFKGPLKEVENQHLQDIKKQHRIAADIFF # WLQSFQSNLSIQRVVVQAIHGMFAENQEVELYIHQLKQYSVPITQLMWNTVWKLNKKDIDDYKLWPQVTLLWVDYMAKEMSWRKLPITLPDNAWTHAI # SSNKSMVVRIMIDIQQRCNLKVIQDNDWKDTALYQAAQKGHIDVVEVLVDKGAHVNAQGGKYGNALQVAASYKHMHIVKFLVQKGAKINAEGGMYGNA # LQAVSLWDELETVILLVKRGADVNAQGGRYGNALQAASAKGNLKIIKFLAEQGADANIQGGIYGNPLQAASLSGDFEVVKYFVEGGINVNIHGGQYGN # ALQAASLSGDLEIVKYLVKHGANVNAQGGQYGNALQAASFEGNSQVVKFLVENCADVNAQGGECGNALQAGAHNLEIVRFLVANGADVNAEGGTYGFA # LQAASYLSHLDVIEFLLGNGADIDAQGGRFGNALQAASHSDDLNIVKFLVEQGSNINAQGGQFGNALQAASYKGNLDNIKFLVEMGADVNAQGGQFGN # ALKAALHSEEPEIVEFLIEQGADVELQDREYGNTLASTAAQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g208 ### # start gene g209 6 AUGUSTUS gene 409967 412163 0.24 - . g209 6 AUGUSTUS transcript 409967 412163 0.24 - . g209.t1 6 AUGUSTUS stop_codon 409967 409969 . - 0 transcript_id "g209.t1"; gene_id "g209"; 6 AUGUSTUS CDS 409967 411578 0.85 - 1 transcript_id "g209.t1"; gene_id "g209"; 6 AUGUSTUS CDS 411634 411658 0.42 - 2 transcript_id "g209.t1"; gene_id "g209"; 6 AUGUSTUS CDS 411768 411803 0.4 - 2 transcript_id "g209.t1"; gene_id "g209"; 6 AUGUSTUS CDS 411959 412163 0.24 - 0 transcript_id "g209.t1"; gene_id "g209"; 6 AUGUSTUS start_codon 412161 412163 . - 0 transcript_id "g209.t1"; gene_id "g209"; # protein sequence = [MDVLIQQRGTIRSVSSPSGYNFTFGLGRPPNISPSPGIPDSNIATATIRRGATSSARARDVMLIITADRREDGDDASG # FDFNEARRHLDSMQADYGGTEIPNALDAVFASLPSRLTRPVSIFLLTDGGVWGSLLIQCVTRIESTIASRSSDKSFLRVYTIGIGDGVSTETCDRIAR # AGAGTSTYIVSDNEQYIGKCTRLVRAARTPPIVDVEVTWVTPKANASHDATGQVIDLFDAEVSYDDEECGGVGPLAPILQAPDPVPSFYRSTRTQVYA # IVPDSIAVTKEIKITGRIPVTGASVALTIPLQRFSPFAPFPASPGGIGTGTAFLHTLAAKALIQDREDWEDSGNGPAGKPSVASLKEDITRLGIDYKL # TSRYTSLIAVDRRNQNVLGMGYYSAPGAKKPKKNIVAEREGSFIPSFQARSLAHATFSSTPGGIGRAGADTATEALIILARLQNFDGSFDESSSKFDI # EGLYAELGVDLGTGTETETEIKSIVDKFVSGTESEKGQVVYITLLAWAFMAVQSKSNAKAGEAFYDVKDKADVWLKENLKGSGAAGSDVDVDELKRQF # LDKVASLGHGGETYGHGEFDEYVDSDEDDFDFDLSLDLEEGGFALGGEGVGLVEVVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g209 ### # start gene g210 6 AUGUSTUS gene 412406 412912 1 - . g210 6 AUGUSTUS transcript 412406 412912 1 - . g210.t1 6 AUGUSTUS stop_codon 412406 412408 . - 0 transcript_id "g210.t1"; gene_id "g210"; 6 AUGUSTUS CDS 412406 412912 1 - 0 transcript_id "g210.t1"; gene_id "g210"; 6 AUGUSTUS start_codon 412910 412912 . - 0 transcript_id "g210.t1"; gene_id "g210"; # protein sequence = [MTRCETRPPPPCAIPTPPPACPPVALPPVTSPPVARPPVTGPPAANPPGARPPVTNPPGSRPPTTSPPSSNLPLVLRE # CNIKVWIVDVHSWVTLSQQFQNPSSSVATHVTYTFSMLAGAAIYGFQIVRQDGTKVDGVVKQKDEAQKEMDIAVSEGLTAALGQEVTKDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g210 ### # start gene g211 6 AUGUSTUS gene 418730 419725 0.6 + . g211 6 AUGUSTUS transcript 418730 419725 0.6 + . g211.t1 6 AUGUSTUS start_codon 418730 418732 . + 0 transcript_id "g211.t1"; gene_id "g211"; 6 AUGUSTUS CDS 418730 419033 0.62 + 0 transcript_id "g211.t1"; gene_id "g211"; 6 AUGUSTUS CDS 419085 419725 0.95 + 2 transcript_id "g211.t1"; gene_id "g211"; 6 AUGUSTUS stop_codon 419723 419725 . + 0 transcript_id "g211.t1"; gene_id "g211"; # protein sequence = [MAHHPLAALKEGLAKLRKQYEERHNILKSKLAKKEKISNEDEQWLDKEGNLVEEEQLINDLENASDYERGLERLDEKK # QSILMHLTKLVISAPKVAGNKRKRPKPREPDPTATVKSQAQVLEKPVFTKKENATVAQRIEIINWYHANGKNQSKTARHFEPIYPNLKLNQPLVSSWV # KNEAKWREEYVKSGGVSRGAKRMRQTQHPEVTEMLSLWVLKAMGDGLLLTGEVLRQKWTQFADLVGIPEDERLNLSEGWLSRFKARNGLKEFKQHGEA # ASADPTVVDAERARLRELLKKYGYPLRDIFNMDETGLFYG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g211 ### # start gene g212 6 AUGUSTUS gene 420077 420877 0.82 + . g212 6 AUGUSTUS transcript 420077 420877 0.82 + . g212.t1 6 AUGUSTUS start_codon 420077 420079 . + 0 transcript_id "g212.t1"; gene_id "g212"; 6 AUGUSTUS CDS 420077 420877 0.82 + 0 transcript_id "g212.t1"; gene_id "g212"; 6 AUGUSTUS stop_codon 420875 420877 . + 0 transcript_id "g212.t1"; gene_id "g212"; # protein sequence = [MFLLKVQNIAVENFRANLTAHVQPMDSGIIRCFKAHYRQKYIERSIDRYDSGISPMNIYDINQLEAMRLAEAAWREVN # TTTIIHCWQKAGILPDSDSLPSSVPTNVSVPISSLITEDSSADDPIACAEKNVEDTLDLLEETGVLQRSNRMTIDSLLNPEREKIMVTADESTDKEIC # KAVLHARAAEEDTVINGGDDDVDDDGPVYKRPSRREALQAVTTLQQFIDGTDEQYARKLERILGSFGHQTRFEADRTLANTEITDYFHRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g212 ### # start gene g213 6 AUGUSTUS gene 421549 422178 0.97 + . g213 6 AUGUSTUS transcript 421549 422178 0.97 + . g213.t1 6 AUGUSTUS start_codon 421549 421551 . + 0 transcript_id "g213.t1"; gene_id "g213"; 6 AUGUSTUS CDS 421549 422178 0.97 + 0 transcript_id "g213.t1"; gene_id "g213"; 6 AUGUSTUS stop_codon 422176 422178 . + 0 transcript_id "g213.t1"; gene_id "g213"; # protein sequence = [MSPLASSRLSSICLVLIHLLSFCVIASPLASSSLAAANPSATSTPAHPLTVDPAFLSTPGPVLPAGASSNDINLWYDG # EDARLYIGSTFFSVNDQMECQVKVSMVPGTNEGIMRKVGTVVFPSADVKSQVFAILQTCGFKSMNPKKPQTARGHYFMSVIKKLVDTSKRNSIPVTGE # NGNDVKMVLESLLRDNEFLGKTRKKQGNRYTPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g213 ### # start gene g214 6 AUGUSTUS gene 434895 435200 0.75 + . g214 6 AUGUSTUS transcript 434895 435200 0.75 + . g214.t1 6 AUGUSTUS start_codon 434895 434897 . + 0 transcript_id "g214.t1"; gene_id "g214"; 6 AUGUSTUS CDS 434895 435200 0.75 + 0 transcript_id "g214.t1"; gene_id "g214"; 6 AUGUSTUS stop_codon 435198 435200 . + 0 transcript_id "g214.t1"; gene_id "g214"; # protein sequence = [MLQIPEQTSVATAIVTKYVPVLCFAEMLTGKYRLKENNGAPEVIQAIDFVDAHMLPYFSQQASIGEFCPSAPCVLARS # LKLFLPSRLANNSWPLVLDDLDW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g214 ### # start gene g215 6 AUGUSTUS gene 437404 437957 0.82 - . g215 6 AUGUSTUS transcript 437404 437957 0.82 - . g215.t1 6 AUGUSTUS stop_codon 437404 437406 . - 0 transcript_id "g215.t1"; gene_id "g215"; 6 AUGUSTUS CDS 437404 437561 0.96 - 2 transcript_id "g215.t1"; gene_id "g215"; 6 AUGUSTUS CDS 437618 437957 0.84 - 0 transcript_id "g215.t1"; gene_id "g215"; 6 AUGUSTUS start_codon 437955 437957 . - 0 transcript_id "g215.t1"; gene_id "g215"; # protein sequence = [MPVTLDEISKATQCLWRAATIYARENRTDPCSSLQEVKAQDEAAALDKKGKRKALLYSPSDLLDADMDDSNSVEAPRP # PYTQKHACNEVSDSESGSGNEKGIAKKKRASKYQKNECIEISDGNEDEDDQTSHPSSEDSEGHTSQPGTNEEEEEVEGKKLNAQVQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g215 ### # start gene g216 6 AUGUSTUS gene 443761 445057 0.27 - . g216 6 AUGUSTUS transcript 443761 445057 0.27 - . g216.t1 6 AUGUSTUS stop_codon 443761 443763 . - 0 transcript_id "g216.t1"; gene_id "g216"; 6 AUGUSTUS CDS 443761 444702 0.27 - 0 transcript_id "g216.t1"; gene_id "g216"; 6 AUGUSTUS CDS 445028 445057 0.33 - 0 transcript_id "g216.t1"; gene_id "g216"; 6 AUGUSTUS start_codon 445055 445057 . - 0 transcript_id "g216.t1"; gene_id "g216"; # protein sequence = [MGLVVGGLLYDNFSGNELPPSNSSTFEADDSNYLSNFTNYSLHKAAEDNSDYPDAVDTGEAEDADEDGEELWIADQVP # DFDIFYNLLQDCGTFHKKDMIHSQQNSDLDKLLLSLLEDEPAPTQNSFSALPASAFTTSSTQHPRSYFATSNSDPGSRKHRHSHVNHEEHIPRQRHSA # VNAHADPVEPRPDCNRNGGSASRKRLRVESQANRQDVEEEEEEEAPNGTQYLYEASQTPHAPPKEVTDVALAWMLRLTGGVRWGSDKWAKDIRSLVAA # VDWEEASEALSSDSLLHFTQRCRCTEKVNTGSTFIQMMYELFLAAKVNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g216 ### # start gene g217 6 AUGUSTUS gene 446685 448076 0.95 + . g217 6 AUGUSTUS transcript 446685 448076 0.95 + . g217.t1 6 AUGUSTUS start_codon 446685 446687 . + 0 transcript_id "g217.t1"; gene_id "g217"; 6 AUGUSTUS CDS 446685 448076 0.95 + 0 transcript_id "g217.t1"; gene_id "g217"; 6 AUGUSTUS stop_codon 448074 448076 . + 0 transcript_id "g217.t1"; gene_id "g217"; # protein sequence = [MTQAQSNQAASSTVITVAAGQHLMPIPEQLFRDELSSNVRTPEGRQPAVQEPPPVDPGMEPPQRRYTSMGYAQPASSP # MGGFAYSPTWGMGGPPPGPVLQLDMESALNAGGRVSGQVAAIERIQGENADPLMVRQQEKLPERRVSPAASEQSRASSSRLLTPPVQSLNLPPLRRGS # LLSSLLKSPAMNTPNWEHTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLWEVLESMGIKTLGDGLEFSDLWVQFLTVGTQLEKDLPEK # AQQWLMTPANRSDFLWLYNVLLNPERMLELLEAEARYGRLFRKSRGILPLLPHTHGREKELCSEAGLWILYRASNYRSGAVRFEPPPLRVNIPNYQAI # QILRNANLTAAAAKINEESNEDVNAIAAKNLRCRRYTMAHLLASVESMPNQDSPVWVCSGQTVYMYMPMRHMHQLLVRNKELEAMLCSQET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g217 ### # start gene g218 6 AUGUSTUS gene 448110 448751 0.51 + . g218 6 AUGUSTUS transcript 448110 448751 0.51 + . g218.t1 6 AUGUSTUS start_codon 448110 448112 . + 0 transcript_id "g218.t1"; gene_id "g218"; 6 AUGUSTUS CDS 448110 448751 0.51 + 0 transcript_id "g218.t1"; gene_id "g218"; 6 AUGUSTUS stop_codon 448749 448751 . + 0 transcript_id "g218.t1"; gene_id "g218"; # protein sequence = [MLSEELSGSNLERALEFCRRLVVDNRGTSYMVQCAPEGAGEVSLEQYDLKRQFCSSDGCFTACKHSLPRNNKVPGFNN # PGNMATRSPHLQSGTFPTAHALAHNPTPPPRVNLQTKPVTPVSTQRYQFGEQHSSQISRHNPTARLVPNPVHVPPRLSNPSVIPYQGSVLMQSQAVGV # ESRRGPNQQRMLAVHEEAIPPQGVPFRTPFVTRTQTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g218 ### # start gene g219 6 AUGUSTUS gene 452234 452950 1 + . g219 6 AUGUSTUS transcript 452234 452950 1 + . g219.t1 6 AUGUSTUS start_codon 452234 452236 . + 0 transcript_id "g219.t1"; gene_id "g219"; 6 AUGUSTUS CDS 452234 452950 1 + 0 transcript_id "g219.t1"; gene_id "g219"; 6 AUGUSTUS stop_codon 452948 452950 . + 0 transcript_id "g219.t1"; gene_id "g219"; # protein sequence = [MKVQLEEVKDEEYKARQQGPHGLFPSEKYLGPEDPILMGINKWLAFASESTEQEVEETLEARQSAREAGTPQPAKDSE # EAYQKWKSRDTEQSSSWPGAKQKVRWRKKRREHGPYPNLPTLDIKSLNIPKIPSRSGLTPKGSIRHNNFRRKQLIAGTHVVERKLDPTIQGKPISLIG # AAGMDCLLREGTPAYFLHISPTKEEPPTEEMLRVSDSSFPEEVQQPKDPESGNPSPEQGEVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g219 ### # start gene g220 6 AUGUSTUS gene 454368 455522 0.93 + . g220 6 AUGUSTUS transcript 454368 455522 0.93 + . g220.t1 6 AUGUSTUS start_codon 454368 454370 . + 0 transcript_id "g220.t1"; gene_id "g220"; 6 AUGUSTUS CDS 454368 455522 0.93 + 0 transcript_id "g220.t1"; gene_id "g220"; 6 AUGUSTUS stop_codon 455520 455522 . + 0 transcript_id "g220.t1"; gene_id "g220"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEEHSSSKSSMNKPKVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFRGNWDTFLKEFSQRFEPMDPGMEARSKIKNLRQSKGQTVAEFAQKFKDIGDRTESDIDLRECFFTAL # LPEIQQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLAHMRGRCFGCGAQGHVKQ # NCPHKETTCRYCGRREHLESVCQDKFMGLGCDRGRHQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRANA # MSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g220 ### # start gene g221 6 AUGUSTUS gene 457770 458411 0.37 + . g221 6 AUGUSTUS transcript 457770 458411 0.37 + . g221.t1 6 AUGUSTUS start_codon 457770 457772 . + 0 transcript_id "g221.t1"; gene_id "g221"; 6 AUGUSTUS CDS 457770 458411 0.37 + 0 transcript_id "g221.t1"; gene_id "g221"; 6 AUGUSTUS stop_codon 458409 458411 . + 0 transcript_id "g221.t1"; gene_id "g221"; # protein sequence = [MSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAED # INLQLSSEKLGDQQLGPYHILEKVGPLDYRLDLPLLLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVK # SKGYDAGHNSWEPAPNLSRAPKSVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g221 ### # start gene g222 6 AUGUSTUS gene 459122 459928 0.92 + . g222 6 AUGUSTUS transcript 459122 459928 0.92 + . g222.t1 6 AUGUSTUS start_codon 459122 459124 . + 0 transcript_id "g222.t1"; gene_id "g222"; 6 AUGUSTUS CDS 459122 459928 0.92 + 0 transcript_id "g222.t1"; gene_id "g222"; 6 AUGUSTUS stop_codon 459926 459928 . + 0 transcript_id "g222.t1"; gene_id "g222"; # protein sequence = [MKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNIRVAQGHGWKTAFQTWYGSFEYLVMPFGLTNAPSAFQFFMNEI # FHNMVDVCVVIYLDGILIYSDNEESHVEHVRKVLERLRPNHLHAKPEKCTFHVDTVEYLGVIISPRGVSMDPEKVKAVMDWPRPKTVKELQAFLGFTN # FYRRFIDNYLGITKVFTKLLRKDSMWNWTPQCSSAFELLKSAFLEAPVLGHYNPDLPVVLECDASDLVIAGILSQLDPEMGGYTLLPFMHAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g222 ### # start gene g223 6 AUGUSTUS gene 460859 461905 0.58 + . g223 6 AUGUSTUS transcript 460859 461905 0.58 + . g223.t1 6 AUGUSTUS start_codon 460859 460861 . + 0 transcript_id "g223.t1"; gene_id "g223"; 6 AUGUSTUS CDS 460859 461905 0.58 + 0 transcript_id "g223.t1"; gene_id "g223"; 6 AUGUSTUS stop_codon 461903 461905 . + 0 transcript_id "g223.t1"; gene_id "g223"; # protein sequence = [MPSDITSNQGSLFVSQFWRELCRVLGIKSRLSIVYHPQTDGQTEQVNQSVEAYLRIYCSYDQDDWDLLLPMAEFIYNN # SPNTAMGVLPFFANKGYHLKLSITLEQVQGAEVNEYTSNLKELHAYLQERIRVANETYAKYANQKRQEAPDWKEGDHGWLNMENVRTRRPMKKLDHKW # MGPYSILSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKWQNSPPFPVFIKGKTEHFFESILDSKPIKGRLEEIEYLVKWEGYGDKFNSWVEW # EGMAGSTELLRSWHNKHSRKRQPLQEHWDSLEREAREDEEDTLEDGRGMGAKRGRQEEGQRHDVDNNPMILTTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g223 ### # start gene g224 6 AUGUSTUS gene 471577 474210 0.17 + . g224 6 AUGUSTUS transcript 471577 474210 0.17 + . g224.t1 6 AUGUSTUS start_codon 471577 471579 . + 0 transcript_id "g224.t1"; gene_id "g224"; 6 AUGUSTUS CDS 471577 471783 0.46 + 0 transcript_id "g224.t1"; gene_id "g224"; 6 AUGUSTUS CDS 472036 472215 0.27 + 0 transcript_id "g224.t1"; gene_id "g224"; 6 AUGUSTUS CDS 472443 472617 0.32 + 0 transcript_id "g224.t1"; gene_id "g224"; 6 AUGUSTUS CDS 472676 474210 1 + 2 transcript_id "g224.t1"; gene_id "g224"; 6 AUGUSTUS stop_codon 474208 474210 . + 0 transcript_id "g224.t1"; gene_id "g224"; # protein sequence = [MQLTKDKKAWAVEKLSSFVDHQNRKVVADFWPPLRTAFFLRFPLVTEISTDVDAETREALGRHSDEKFKVDLEITNLG # KSISRSERMKICNKYINAGWEATQQDPVKMEAIEVLLKSEKEEVPPAAMPTSSYLWVGLLFIPSVPPGLIRLYRFHVGHDIHGQPFYRALPDYKTRVL # RPFLNFAEHALAGTVDWLKESAQSAPETGPALVSPVSENAAVPSTSTQPPPVTPSSVAPANSSTVVSPCPASVGSDSPSLPAVPTFSASPSAADAILA # VSGLSTSSPPPVVNAGAPTAALSQVNPSAGSSAVVSISAVTSSDVVNSALLPQPLPGPISLSNACTSSESIEARATSPLPVSSATSTAFGFSTEPTES # FLSTFPQSLLPQPEPIETFDPKRSILSNMTDLEFQELSDAALRNAKGFFNEDWAHLWDNNPETNCEHPANTGSPLPEVPTPKEHFDCSHLSAFPDEQC # GDFPFLPTFPKQPSNFSSSNMVTNSISNLPQVPKSSAVVHPSENGSTTSQITLVVITSLNALPTSLPSTASTLVSLLDPTGTILSNPLSGSLPCTPST # LASILDSNPVTGTISPDLRADSLPSTTSTPVSISDSMLATIDTTCVDRALPILQMVGSAEKGLPLPGMDNDLPPSSTKPVSNPQAASMTEPSREIPTS # DYMSNPAILSEPISDPIVSNLAGLSSITGAKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g224 ### # start gene g225 6 AUGUSTUS gene 481871 482767 0.79 + . g225 6 AUGUSTUS transcript 481871 482767 0.79 + . g225.t1 6 AUGUSTUS start_codon 481871 481873 . + 0 transcript_id "g225.t1"; gene_id "g225"; 6 AUGUSTUS CDS 481871 482767 0.79 + 0 transcript_id "g225.t1"; gene_id "g225"; 6 AUGUSTUS stop_codon 482765 482767 . + 0 transcript_id "g225.t1"; gene_id "g225"; # protein sequence = [MYDDKLTSCDRLKCFEPPALDDSSSESESPSRRPRKRKRSARKREEADAEEQSIGDVQMHEIDGRGDDDDDARSITST # RSQSRLKKKLKSVPTSPLASTSASVPISAPPTLTTKFTSASASKITSKPRKKRAKAKHDDKPFKPEASPFEDDDDEDMDVDDSASISTKRKAKRVSRT # TITGKGKAKASDSTSAVEFPTAGGATGSASPSSRSSPTRPDASASGDERRQRRRSQHSHSVSFAPTMEVALDSSTKTASGSVSKLGSKSVSSSSKQRS # TNPRPQAKKKSEEVLTSSVDGGET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g225 ### # start gene g226 6 AUGUSTUS gene 483947 484933 0.95 - . g226 6 AUGUSTUS transcript 483947 484933 0.95 - . g226.t1 6 AUGUSTUS stop_codon 483947 483949 . - 0 transcript_id "g226.t1"; gene_id "g226"; 6 AUGUSTUS CDS 483947 484933 0.95 - 0 transcript_id "g226.t1"; gene_id "g226"; 6 AUGUSTUS start_codon 484931 484933 . - 0 transcript_id "g226.t1"; gene_id "g226"; # protein sequence = [MATFHPQDYIPNHSLSGYWAGHILAHDSKGFYSVQGLIQIFIMDIDSDRKITGVAEAYRGLMNVSGSISLDNKPTLIL # TFENWEAAFTCEGQYDPKLHLQNLDIRLRAESRSQQIPVLKAPKATCSGCFHCWEVLSTAFGPLAENTGFADVETLSGKASSTDEETENSDGNDNGRE # QENSDAVDEDELEANKEGEHHTNQAGDRASEETNTFFFTRTPAFAWRFHSVLDQRSNSARERWVFAIGAVLDQVQRTQYSWNYLKSRNIERRRFLALV # LRREVAQSLSPANPLKKDERLEFRLLIAKLHPTDARFYYSLIPSLANVEFITHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g226 ### # start gene g227 6 AUGUSTUS gene 486518 488173 1 + . g227 6 AUGUSTUS transcript 486518 488173 1 + . g227.t1 6 AUGUSTUS start_codon 486518 486520 . + 0 transcript_id "g227.t1"; gene_id "g227"; 6 AUGUSTUS CDS 486518 488173 1 + 0 transcript_id "g227.t1"; gene_id "g227"; 6 AUGUSTUS stop_codon 488171 488173 . + 0 transcript_id "g227.t1"; gene_id "g227"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSESISAIGQPRHRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPG # DPSGPGGPGGPRSPISPDIPNEQQAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKV # NYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGIYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGL # AERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFIARNPKKGSLDFKTGSTNQQNNSQPPGSSAPFTPKPKPFSGGKPNNNGKPQN # SSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATAEVIEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g227 ### # start gene g228 6 AUGUSTUS gene 492351 493052 0.21 + . g228 6 AUGUSTUS transcript 492351 493052 0.21 + . g228.t1 6 AUGUSTUS start_codon 492351 492353 . + 0 transcript_id "g228.t1"; gene_id "g228"; 6 AUGUSTUS CDS 492351 492426 0.21 + 0 transcript_id "g228.t1"; gene_id "g228"; 6 AUGUSTUS CDS 492496 493052 0.33 + 2 transcript_id "g228.t1"; gene_id "g228"; 6 AUGUSTUS stop_codon 493050 493052 . + 0 transcript_id "g228.t1"; gene_id "g228"; # protein sequence = [MCSLDVDLAMDALNALHVATTSSTLNLTNSLRRTQELRTQLDRLGALFDQARQSFLRSFLDLQQAGQDPIVVLEALKA # AEPQRESISVEDWTLLATLFQWSSPFNLNGLKFDNRTPAEWIDLLRSIHSGATSATVTVDGHLVDTSQPPEADVEVSEALDPQGSLPNTVVEKVSGVE # DLASLSEGSPIQTELDLPQIESLTESTLAPEKGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g228 ### # start gene g229 6 AUGUSTUS gene 494824 495601 0.32 + . g229 6 AUGUSTUS transcript 494824 495601 0.32 + . g229.t1 6 AUGUSTUS start_codon 494824 494826 . + 0 transcript_id "g229.t1"; gene_id "g229"; 6 AUGUSTUS CDS 494824 494850 0.35 + 0 transcript_id "g229.t1"; gene_id "g229"; 6 AUGUSTUS CDS 494957 495092 0.91 + 0 transcript_id "g229.t1"; gene_id "g229"; 6 AUGUSTUS CDS 495174 495601 1 + 2 transcript_id "g229.t1"; gene_id "g229"; 6 AUGUSTUS stop_codon 495599 495601 . + 0 transcript_id "g229.t1"; gene_id "g229"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAANDVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSVSDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERA # TTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g229 ### # start gene g230 6 AUGUSTUS gene 495877 499881 0.27 - . g230 6 AUGUSTUS transcript 495877 499881 0.27 - . g230.t1 6 AUGUSTUS stop_codon 495877 495879 . - 0 transcript_id "g230.t1"; gene_id "g230"; 6 AUGUSTUS CDS 495877 499470 0.4 - 0 transcript_id "g230.t1"; gene_id "g230"; 6 AUGUSTUS CDS 499612 499881 0.38 - 0 transcript_id "g230.t1"; gene_id "g230"; 6 AUGUSTUS start_codon 499879 499881 . - 0 transcript_id "g230.t1"; gene_id "g230"; # protein sequence = [MGGSSLNPYERKFRRGDLSNLYFKIFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEIL # KEELNHFKDLNRQDRSPINLIDETNKQVDSEAIGVEKPIKLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRY # TEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEVGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNAS # YRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPI # FHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGS # MPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAV # GWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIH # VKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRN # HMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQ # PQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYII # HGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVS # KWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRH # TIKDWNFRPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVE # DEDEYWMAPENDYIFDAIPHLRLSDTDSDEELS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g230 ### # start gene g231 6 AUGUSTUS gene 500349 501990 0.34 - . g231 6 AUGUSTUS transcript 500349 501990 0.34 - . g231.t1 6 AUGUSTUS stop_codon 500349 500351 . - 0 transcript_id "g231.t1"; gene_id "g231"; 6 AUGUSTUS CDS 500349 501248 0.98 - 0 transcript_id "g231.t1"; gene_id "g231"; 6 AUGUSTUS CDS 501293 501557 0.61 - 1 transcript_id "g231.t1"; gene_id "g231"; 6 AUGUSTUS CDS 501704 501990 0.41 - 0 transcript_id "g231.t1"; gene_id "g231"; 6 AUGUSTUS start_codon 501988 501990 . - 0 transcript_id "g231.t1"; gene_id "g231"; # protein sequence = [MPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEE # LSDRLGNLEAHREDDVRVLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIEDVDEPDDEDTIKLIPSSRPTNQINNEHRPY # DHVQLGRITNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPS # RVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGAIVQKDIVESFLRDLSIDDERRSIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDE # EIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSE # ITISDPTHTRGLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g231 ### # start gene g232 6 AUGUSTUS gene 517699 518476 0.34 + . g232 6 AUGUSTUS transcript 517699 518476 0.34 + . g232.t1 6 AUGUSTUS start_codon 517699 517701 . + 0 transcript_id "g232.t1"; gene_id "g232"; 6 AUGUSTUS CDS 517699 517725 0.35 + 0 transcript_id "g232.t1"; gene_id "g232"; 6 AUGUSTUS CDS 517832 517967 0.85 + 0 transcript_id "g232.t1"; gene_id "g232"; 6 AUGUSTUS CDS 518049 518476 1 + 2 transcript_id "g232.t1"; gene_id "g232"; 6 AUGUSTUS stop_codon 518474 518476 . + 0 transcript_id "g232.t1"; gene_id "g232"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSVSDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERA # TTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g232 ### # start gene g233 6 AUGUSTUS gene 518752 521203 0.2 - . g233 6 AUGUSTUS transcript 518752 521203 0.2 - . g233.t1 6 AUGUSTUS stop_codon 518752 518754 . - 0 transcript_id "g233.t1"; gene_id "g233"; 6 AUGUSTUS CDS 518752 519575 0.29 - 2 transcript_id "g233.t1"; gene_id "g233"; 6 AUGUSTUS CDS 519970 521203 0.48 - 0 transcript_id "g233.t1"; gene_id "g233"; 6 AUGUSTUS start_codon 521201 521203 . - 0 transcript_id "g233.t1"; gene_id "g233"; # protein sequence = [MPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIK # KFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDSWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADR # VTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWNFRPGQLVQ # VRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMAPENDYI # FDAIPHLRLSDTDSDEELS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g233 ### # start gene g234 6 AUGUSTUS gene 521481 522002 0.61 - . g234 6 AUGUSTUS transcript 521481 522002 0.61 - . g234.t1 6 AUGUSTUS stop_codon 521481 521483 . - 0 transcript_id "g234.t1"; gene_id "g234"; 6 AUGUSTUS CDS 521481 522002 0.61 - 0 transcript_id "g234.t1"; gene_id "g234"; 6 AUGUSTUS start_codon 522000 522002 . - 0 transcript_id "g234.t1"; gene_id "g234"; # protein sequence = [MMCKQEVGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPYFTMM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g234 ### # start gene g235 6 AUGUSTUS gene 522197 522753 0.79 - . g235 6 AUGUSTUS transcript 522197 522753 0.79 - . g235.t1 6 AUGUSTUS stop_codon 522197 522199 . - 0 transcript_id "g235.t1"; gene_id "g235"; 6 AUGUSTUS CDS 522197 522674 0.92 - 1 transcript_id "g235.t1"; gene_id "g235"; 6 AUGUSTUS CDS 522731 522753 0.82 - 0 transcript_id "g235.t1"; gene_id "g235"; 6 AUGUSTUS start_codon 522751 522753 . - 0 transcript_id "g235.t1"; gene_id "g235"; # protein sequence = [MGGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY # ESRQRKKGKAQDSKDKKENVQADILNEPPTNKLEERIKLNQQDRSPINLIDETNKQVDSEAIGVEKPIKLNTEEVFTKYKPVDKRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g235 ### # start gene g236 6 AUGUSTUS gene 523077 524512 0.48 - . g236 6 AUGUSTUS transcript 523077 524512 0.48 - . g236.t1 6 AUGUSTUS stop_codon 523077 523079 . - 0 transcript_id "g236.t1"; gene_id "g236"; 6 AUGUSTUS CDS 523077 524053 0.53 - 2 transcript_id "g236.t1"; gene_id "g236"; 6 AUGUSTUS CDS 524164 524512 0.79 - 0 transcript_id "g236.t1"; gene_id "g236"; 6 AUGUSTUS start_codon 524510 524512 . - 0 transcript_id "g236.t1"; gene_id "g236"; # protein sequence = [MRTSRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVDEPDDEDTIKLIPSSRPTNQINNEHRPYDHVQPRTYRVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGE # TEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGAIVQKDIVESFLRDLSIDDERRSIAIVANQSVAYEDHSDHPVVVANQSNGLRAVT # PEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIK # TFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g236 ### # start gene g237 6 AUGUSTUS gene 524542 526068 0.26 - . g237 6 AUGUSTUS transcript 524542 526068 0.26 - . g237.t1 6 AUGUSTUS stop_codon 524542 524544 . - 0 transcript_id "g237.t1"; gene_id "g237"; 6 AUGUSTUS CDS 524542 526068 0.26 - 0 transcript_id "g237.t1"; gene_id "g237"; 6 AUGUSTUS start_codon 526066 526068 . - 0 transcript_id "g237.t1"; gene_id "g237"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNG # TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g237 ### # start gene g238 6 AUGUSTUS gene 528272 530761 0.73 + . g238 6 AUGUSTUS transcript 528272 530761 0.73 + . g238.t1 6 AUGUSTUS start_codon 528272 528274 . + 0 transcript_id "g238.t1"; gene_id "g238"; 6 AUGUSTUS CDS 528272 530761 0.73 + 0 transcript_id "g238.t1"; gene_id "g238"; 6 AUGUSTUS stop_codon 530759 530761 . + 0 transcript_id "g238.t1"; gene_id "g238"; # protein sequence = [MPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLQRLQKHRLYANPKKCEFNMDTVEYL # GYILSPDGLTMSKEKVQTVLEWPVLRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILVHWEPNRPLI # VETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWHHYLEGSGDPVDIVTDHKNLEYFSTTKVLTRRQVRWSEFLH # QFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTAFLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVVGLELA # KDPSNKRWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHWPYGLLKPLPV # PVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGY # HPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVINLDELHVFLREEILLA # QSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPI # EVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g238 ### # start gene g239 6 AUGUSTUS gene 532985 534511 0.53 + . g239 6 AUGUSTUS transcript 532985 534511 0.53 + . g239.t1 6 AUGUSTUS start_codon 532985 532987 . + 0 transcript_id "g239.t1"; gene_id "g239"; 6 AUGUSTUS CDS 532985 534511 0.53 + 0 transcript_id "g239.t1"; gene_id "g239"; 6 AUGUSTUS stop_codon 534509 534511 . + 0 transcript_id "g239.t1"; gene_id "g239"; # protein sequence = [MTTNNYGMSALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDKRGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVKR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNG # TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPQDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g239 ### # start gene g240 6 AUGUSTUS gene 534541 535371 0.99 + . g240 6 AUGUSTUS transcript 534541 535371 0.99 + . g240.t1 6 AUGUSTUS start_codon 534541 534543 . + 0 transcript_id "g240.t1"; gene_id "g240"; 6 AUGUSTUS CDS 534541 535371 0.99 + 0 transcript_id "g240.t1"; gene_id "g240"; 6 AUGUSTUS stop_codon 535369 535371 . + 0 transcript_id "g240.t1"; gene_id "g240"; # protein sequence = [MRTLRSNAVAPEESEKAKQNQFNDNTKRLVFDGVHISKKPGLIPGKLVETTNGNQKTVRFEAPKSINRPLKKPSVTIK # DVDESADEDTIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSKDGETEILDEPSRVQMIDTCIRIEDLWQDQTDMFEVLTESHNDIPVGSIVQKDIVESFLRDLSID # DE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g240 ### # start gene g241 6 AUGUSTUS gene 535600 540272 0.88 + . g241 6 AUGUSTUS transcript 535600 540272 0.88 + . g241.t1 6 AUGUSTUS start_codon 535600 535602 . + 0 transcript_id "g241.t1"; gene_id "g241"; 6 AUGUSTUS CDS 535600 535972 0.88 + 0 transcript_id "g241.t1"; gene_id "g241"; 6 AUGUSTUS CDS 536047 540272 1 + 2 transcript_id "g241.t1"; gene_id "g241"; 6 AUGUSTUS stop_codon 540270 540272 . + 0 transcript_id "g241.t1"; gene_id "g241"; # protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV # GTYPRGQKGRNIQINTSQYNEPKNVTPDKDKSTGENDSKGNFHSSMNGYKRCEQETFSKRELSEAYVLASREHLKSQDDQVEEIIDCYLNQKTIGDKQ # VFCVWRDGVLGEFDDQLNNDQFNLNPIKLFFLQNGRIKPKPVRKKVQKRRFVEPILQKFSLGESGDKSESTETTQNQCNNENTSETIRDDNWNKPKNS # QRTKKRMVRYEVLKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQPGLQDRSPIKLIEETNKQVVNEAIGVEKPINLNTEEVFTKYKPVD # KKVNPIKATLPDEFRIERHIHGDPLLELPELSKNPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPV # KVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPLNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGT # LDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVW # EHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCHDKTEVQAFLGTASQLRMFIANFAKKAAPLTKLTSNVP # FEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYG # CRRLTVETDASYIKGMLDNPSCGPNATINHWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQ # FDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKNATCEVFSRNLFPTFDEEFVQNNPYPEVHRSSEGNRLDELIPLIGKYL # SNPSDESLGGMPKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCK # ECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLA # WLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRIL # TRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDG # TVLKEKVGAFRVLPHFTRNESIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEEEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g241 ### # start gene g242 6 AUGUSTUS gene 540533 541991 0.42 - . g242 6 AUGUSTUS transcript 540533 541991 0.42 - . g242.t1 6 AUGUSTUS stop_codon 540533 540535 . - 0 transcript_id "g242.t1"; gene_id "g242"; 6 AUGUSTUS CDS 540533 540960 1 - 2 transcript_id "g242.t1"; gene_id "g242"; 6 AUGUSTUS CDS 541047 541182 0.84 - 0 transcript_id "g242.t1"; gene_id "g242"; 6 AUGUSTUS CDS 541824 541991 0.64 - 0 transcript_id "g242.t1"; gene_id "g242"; 6 AUGUSTUS start_codon 541989 541991 . - 0 transcript_id "g242.t1"; gene_id "g242"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALKQILASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKDEKS # AVNDVSPHLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRAHIAKVIADEACSILKS # RQDSGSDSFASDASFATAQSIPTTGSEDTVVTPTEITVPVLKTVERATTPFTRGVTPMMEDKEHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g242 ### # start gene g243 6 AUGUSTUS gene 543010 543674 0.51 - . g243 6 AUGUSTUS transcript 543010 543674 0.51 - . g243.t1 6 AUGUSTUS stop_codon 543010 543012 . - 0 transcript_id "g243.t1"; gene_id "g243"; 6 AUGUSTUS CDS 543010 543563 1 - 2 transcript_id "g243.t1"; gene_id "g243"; 6 AUGUSTUS CDS 543626 543674 0.51 - 0 transcript_id "g243.t1"; gene_id "g243"; 6 AUGUSTUS start_codon 543672 543674 . - 0 transcript_id "g243.t1"; gene_id "g243"; # protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQLGSLFNTTRDLFLRSILDLQNAGEDPVVVLEALKAAEPNRRAIN # LNEWTLLATLFRWPSLFNLSGLDFDNCTPGEWIELLRSIHSGESTASIDKHGHLVESSPPPDSATEALEGLKEVERGSADEGTSSQVGGSIPMELDLP # AIESLAEPALSPEKGAEPAQTLEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g243 ### # start gene g244 6 AUGUSTUS gene 544289 544986 0.46 - . g244 6 AUGUSTUS transcript 544289 544986 0.46 - . g244.t1 6 AUGUSTUS stop_codon 544289 544291 . - 0 transcript_id "g244.t1"; gene_id "g244"; 6 AUGUSTUS CDS 544289 544710 0.75 - 2 transcript_id "g244.t1"; gene_id "g244"; 6 AUGUSTUS CDS 544776 544986 0.63 - 0 transcript_id "g244.t1"; gene_id "g244"; 6 AUGUSTUS start_codon 544984 544986 . - 0 transcript_id "g244.t1"; gene_id "g244"; # protein sequence = [MMRSVPSKDLDAFASLRGKGSLAGASKRNPLAPPLEIKSSTSISKAPVAPPRLIRRNRELENLKADASLFLASPRSTR # SRDSDNELLSGFPLVDAAPRASSPTKVPVSRKEPKSKTAVKVVEDSKASDPPTSALVYKRVRLPPRSRKIAPAASKGKARQTIVTEADSASSEVESED # EDEEEDSAPPPKRLKTTSSISGKSLFFIYFVLFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g244 ### # start gene g245 6 AUGUSTUS gene 549136 549606 0.8 - . g245 6 AUGUSTUS transcript 549136 549606 0.8 - . g245.t1 6 AUGUSTUS stop_codon 549136 549138 . - 0 transcript_id "g245.t1"; gene_id "g245"; 6 AUGUSTUS CDS 549136 549606 0.8 - 0 transcript_id "g245.t1"; gene_id "g245"; 6 AUGUSTUS start_codon 549604 549606 . - 0 transcript_id "g245.t1"; gene_id "g245"; # protein sequence = [MSTSRTTTTTASSTAGPSRSRLVPPPPPTDPAVHEEEGLEDEDEDDIIRRVQERVERVRARKAAAAAKKAAEEKAAKA # AAVRERAAQEARERALRARQQEEEIVERRRLLAEAATARIQRGTSPSEMSASPRRPVIEIRRKLTNKGKGKAKAQVSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g245 ### # start gene g246 6 AUGUSTUS gene 551800 552378 0.82 - . g246 6 AUGUSTUS transcript 551800 552378 0.82 - . g246.t1 6 AUGUSTUS stop_codon 551800 551802 . - 0 transcript_id "g246.t1"; gene_id "g246"; 6 AUGUSTUS CDS 551800 552378 0.82 - 0 transcript_id "g246.t1"; gene_id "g246"; 6 AUGUSTUS start_codon 552376 552378 . - 0 transcript_id "g246.t1"; gene_id "g246"; # protein sequence = [MLAKTLKSSKYEARLAAYGDIFAEHHKKLKLALSFHTVLGVDSANTKLDTLSLQMEHVQVAMAALLQKLDTSREKDLK # DFIDMHGGPKACLQDDQLVQMLINISREGISAITSISTGDNAKNLEAARKKLSEDYHEDLDKCQVYAAGLHPAARYSEDLLLIVLSRYTYPFVLVPPY # CLLLYPAGTTRIAPSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g246 ### # start gene g247 6 AUGUSTUS gene 554125 556330 0.26 + . g247 6 AUGUSTUS transcript 554125 556330 0.26 + . g247.t1 6 AUGUSTUS start_codon 554125 554127 . + 0 transcript_id "g247.t1"; gene_id "g247"; 6 AUGUSTUS CDS 554125 554575 0.67 + 0 transcript_id "g247.t1"; gene_id "g247"; 6 AUGUSTUS CDS 554626 554734 0.36 + 2 transcript_id "g247.t1"; gene_id "g247"; 6 AUGUSTUS CDS 554782 556330 0.38 + 1 transcript_id "g247.t1"; gene_id "g247"; 6 AUGUSTUS stop_codon 556328 556330 . + 0 transcript_id "g247.t1"; gene_id "g247"; # protein sequence = [MHWLNTLYSTALLLSIAQHMQQSSAQLVQIPSIKSFSRSVSNFVVDTSIQIVVDVDFAHNFTGGFPTLVGFAQTFRED # LISVTGFSNISEVQTGKVSADTTTSTVFLTLGPSSSSNLTLFNGKSTGEGYEFEVAQKLYTIRGVEAIGAWWGTRTFLQQVVLSIVNGSNPAMIPTGF # GEDNPGWEIRGYLTITFRLLAVPGCLTILSADLCVYASFFKINEFHIHASDFFYDPSFLYGEDWRELYTGFRFQPSSDSPIFNLVPELNESWTQTQFS # TLQTTCSNHGVTLIPEIDTPAHSLVITKWKPELMISGTPDLLNLSYPETIPTLKSIWDEILPWFTSSEISIGADEYSASLADDYITFVNEMDEYISGS # SGKSIRIWGTSEPSTTESISTNVTIQHWWFPGGSIPVQLMDQGYSIINSDQVFLYLDGKFSDGGQFPWTLNITKMWSGAPDGEGWAPNIFSADDPTNN # TSIENPLLRGSIMALWNDWGNNATTPLEVYYQLAQSLAVFAEKTWSGSGVRASALTQDEFQEVYPVLNAAAPGQNLNRATGLEDGSVAFSYDRISQFP # LETSFESVGPPYTLSFSVKPPPTTNTSSTPLFLGLDSVLFLDSLSFKDPSTNLRYPLGVDLPPDVFTSLEIHATVNHTYALLNGSSSALYWTSNLDIW # GEYMQTVNMSFAAPSYIIGLDGFEGELVNVSLRLGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g247 ### # start gene g248 6 AUGUSTUS gene 559110 560843 0.69 + . g248 6 AUGUSTUS transcript 559110 560843 0.69 + . g248.t1 6 AUGUSTUS start_codon 559110 559112 . + 0 transcript_id "g248.t1"; gene_id "g248"; 6 AUGUSTUS CDS 559110 560843 0.69 + 0 transcript_id "g248.t1"; gene_id "g248"; 6 AUGUSTUS stop_codon 560841 560843 . + 0 transcript_id "g248.t1"; gene_id "g248"; # protein sequence = [MFAHSKRYLRRHSYDDSESSMGQTSRRQLRYCRAEHALLISFHSHLDTSPSDNTTNDSLQIQLRLLHQATAFLTTQAA # DARERLDALSNGVLKRSDIQPEKHRQALIERWREQRSLEKIESEVKQVEAVIANMNANRSIATVTDQNPESRAQKNLIRFLHTSSLRPNARRLRPRPR # STILLVDRTPRRMTLADVTPIRARPWSITEALIREHAQLKNATPLALIPAPHAKISNSPPGFQRHGKKQIMALSGSLGSISEVSSMFVALRNQADGGL # EGDSTPSSAFTSVFSHSEDTESVSEIDTPVPAIGDSGNEATSPCPSNTPLLPSRLDMPPTRATTNYTNGTATIYPHAHHHSNFDNIEVEVEIPIYAQE # LFAGFDRVGLDFGMDGALDLPSNTTTTSSAPETPNQIPKQSKHIALPSVFLTPPRRSPRSSGSLKGRAPNLKPSVSLGSLQPASHSQLRLERERASLL # SIPESSSMLSLSSSRNSFAPSRFGNGTFVKEDNTFPLSTVLSPPLEIRSNAPANVTPNEDSGNSNHTQSSPSSKVTRLKRKLSARLSLTVFGSPTKTL # KKKELDYMG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g248 ### # start gene g249 6 AUGUSTUS gene 565944 568545 0.34 - . g249 6 AUGUSTUS transcript 565944 568545 0.34 - . g249.t1 6 AUGUSTUS stop_codon 565944 565946 . - 0 transcript_id "g249.t1"; gene_id "g249"; 6 AUGUSTUS CDS 565944 567395 0.46 - 0 transcript_id "g249.t1"; gene_id "g249"; 6 AUGUSTUS CDS 567460 568545 0.38 - 0 transcript_id "g249.t1"; gene_id "g249"; 6 AUGUSTUS start_codon 568543 568545 . - 0 transcript_id "g249.t1"; gene_id "g249"; # protein sequence = [MSKTPMPRSPPRRVSVANTAHSNSDDLRKMALIGAHFHGNQRHHNHPAIETQLINNPQPLPSSSNSILQYPSTNRDLQ # NHPVAGPSGQANQFERNAGEQLRFFHPQGYGGPGSASDELENTINWGMMNKQLAEQMSVSNNDAWTNSQAVAAALASHQNSYSKSSPQAVLPSSQPHS # HAQQLGYHAPDAFGTTASQSPSTSSFPRVYGWMPRSEEDLKPIARIYSRYQPAHAVTPLVPSTPQQHSSTNTRRTSMTTRPTVPVTARSIAIPIHNTE # RHSGSIPVGSSQTLQTKGAGSSRRVFAPSPLDSSLSSPVPATPSTSTSPARHSRVSDKRWDQGQSTQKAHPSQGAAQSPPRIRNANLNASSHPQTQTS # LKDRDSLSPSVGKARSPQSRVQQNPVSFPRTSNTAPRSDTPSTPARLSPIPPSPHLFRFFAPGQKQYQQFQHQPIFSSSSHPPQSSNLGPSQPSLHLQ # PLLLQPAIELRKIAGRKRKAKREVQGEDLGSDWSSHDSPTPNLYQSPGDSAASPILIRSRSSSPVLPFETSVEYPLTYSSPSVSSSITIAASSSSVSP # ASSCSTAGAVASSASSSSPSPSKPPLKIVPHSTFPPNPPFASELASIVNSKTIDPHLLRCTGPPKRKKPRLNSHEPTPPAPTVQEMMLEVQKGWDEKE # RHEREAREKEQKELKELEETRENLMEALKDNEIKRNLVESLKQISNGAVDPRAQAAHIKLILAVLLAKPSTSPSPPPNTASAPWVPMMTESVLEFDIE # RDITRSSTFGRCSVTRRCQVPPSLLSNINHSKNSVCLCTRSSRSPFPFSSTPVSKPISSSASSPSSLYPIWKPVWVGGRKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g249 ### # start gene g250 6 AUGUSTUS gene 570976 571677 0.78 + . g250 6 AUGUSTUS transcript 570976 571677 0.78 + . g250.t1 6 AUGUSTUS start_codon 570976 570978 . + 0 transcript_id "g250.t1"; gene_id "g250"; 6 AUGUSTUS CDS 570976 571677 0.78 + 0 transcript_id "g250.t1"; gene_id "g250"; 6 AUGUSTUS stop_codon 571675 571677 . + 0 transcript_id "g250.t1"; gene_id "g250"; # protein sequence = [MICSTKSKTNNCPDCDFTTVDPGSLTRHRKRIHGYIPKSRRSRHPKPTTTISSDDGSSRISSNQNDGGEGSSSMQTTV # HEGQDSESYSGPYDTGHVQSSHQSQSLLLDESISRPNFNQAPISRFITTLSSSTSTSAPIPMTTKRISRARMEEAEAAEAAEKARAIEILSGLRHSIE # AGNFDTSDADAVSTASVRKVREGGLPTNEAMCQPADWDGIKGEDGKTGAISAPGSGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g250 ### # start gene g251 6 AUGUSTUS gene 572084 573136 0.81 - . g251 6 AUGUSTUS transcript 572084 573136 0.81 - . g251.t1 6 AUGUSTUS stop_codon 572084 572086 . - 0 transcript_id "g251.t1"; gene_id "g251"; 6 AUGUSTUS CDS 572084 573136 0.81 - 0 transcript_id "g251.t1"; gene_id "g251"; 6 AUGUSTUS start_codon 573134 573136 . - 0 transcript_id "g251.t1"; gene_id "g251"; # protein sequence = [MLCDFAQGVFVEPLNLRARPRNGRRPGGPGRRPGGPEGPHRPSDKTFPLPSNFHYESSYTQSLNVNSSALPSSGLDGA # IYSGSWHRYYPGDTRIQLDLTRLVSFYDTELVPSLVTERYGKERIKHRLLGISSEDLQTVVRKIEELTAVADLGSGIDWATLIRLIVKRYSERLEMVQ # YVLNSSNPNSVSENKALAENVQINLIAMLQPYMLYTIKPSPDLPTSTKWVSPMYELCATTYTKYIVTSSLHLRLTDSENLILNGIQETTKEICRVVTG # MWVDGVMAGLEPDFYRPSEEVDDAVQLELLIHSWKERIFGLMKWLDWSVWLKCRPACGFEVGVPNFQHRLYLSDGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g251 ### # start gene g252 6 AUGUSTUS gene 580145 581639 0.74 - . g252 6 AUGUSTUS transcript 580145 581639 0.74 - . g252.t1 6 AUGUSTUS stop_codon 580145 580147 . - 0 transcript_id "g252.t1"; gene_id "g252"; 6 AUGUSTUS CDS 580145 580647 0.98 - 2 transcript_id "g252.t1"; gene_id "g252"; 6 AUGUSTUS CDS 580715 581639 0.74 - 0 transcript_id "g252.t1"; gene_id "g252"; 6 AUGUSTUS start_codon 581637 581639 . - 0 transcript_id "g252.t1"; gene_id "g252"; # protein sequence = [MQPVWLELGERVYKLLDEMGVCWTSIDPLAFAEAGKKSFSPLLLWIGVVPGSLQYKLANTAAEAVTKLISEAGFGGVE # IGFRESIVTPSLAGPKMLSFDPFKDPISEFTKPFTPTLGLSIAPLKSPHYEGTGALYIREQGQDGRVLLLTCAHVARPPPDHCNTALLNKTSKNPREY # IIALGHSGYIGALQSMMGAIGDLDHLNKDWQDILDRLGEAQEGESETITQKREEHLNLAKKAWWKTEKINEFHTDISKLWNLPNDRIIGEVVHVEPIA # ASVGPQKLPEDWALIALHENKFEWDKFKGNLVYIGGNLCSAEYGKIMFPRDDERTNYAYPKDGLLQVRGVIQLDDIYNPKHLDVNGEQCLLVVKNGLT # TGTTIGRALGMESFTRVYKESKIEKTSIEFGVLSYGSTKGPFSAAGDSGSIVLDRNGDILGMLTGGAGTTDRTDVTYVTPYSYLDKAIKKHFPHSSLY # EVVGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g252 ### # start gene g253 6 AUGUSTUS gene 582447 583478 1 - . g253 6 AUGUSTUS transcript 582447 583478 1 - . g253.t1 6 AUGUSTUS stop_codon 582447 582449 . - 0 transcript_id "g253.t1"; gene_id "g253"; 6 AUGUSTUS CDS 582447 583478 1 - 0 transcript_id "g253.t1"; gene_id "g253"; 6 AUGUSTUS start_codon 583476 583478 . - 0 transcript_id "g253.t1"; gene_id "g253"; # protein sequence = [MNAPSNVTCLAGPSSTESGRGIILGARVTGDWTRALNNYADAEGKAIQAQNAIWVAEKKKAASNDEHSFLSDQSIPLP # EVPVQVMLDGPYGGCSLDLGQYETVLLIAGGSGATFTIGVLDDIVGRCARLGRPNNERTRRIEFVWCLRSYGGINWFTSVIMPIADLVAECPDLDLHV # SIYVTCLCNPEAVPPIPNSDVLMLAQRPDTSKILLDLTTPPLKKADCCCASGSDGEDVKCTCGSGCGGSADANKEKRAPSPSGSSVDDLEIEQVPRKN # LARDPEACAALAEASAKLQWVGLGGGVAVCASGPGSLTREASNAVAKLSLTRGVELGGVGLHTEVFSVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g253 ### # start gene g254 6 AUGUSTUS gene 587456 589030 0.76 - . g254 6 AUGUSTUS transcript 587456 589030 0.76 - . g254.t1 6 AUGUSTUS stop_codon 587456 587458 . - 0 transcript_id "g254.t1"; gene_id "g254"; 6 AUGUSTUS CDS 587456 588808 0.91 - 0 transcript_id "g254.t1"; gene_id "g254"; 6 AUGUSTUS CDS 588866 589030 0.76 - 0 transcript_id "g254.t1"; gene_id "g254"; 6 AUGUSTUS start_codon 589028 589030 . - 0 transcript_id "g254.t1"; gene_id "g254"; # protein sequence = [MWAETEEPPRLRVAADIMEILNARDLLIMMGSCGVSLRDDESDIPTDDDVNMEPELESSTTPFDYQNYPDPWPLVPFS # SNPTTLQSPIPFHLLPETLIVHDPFRLLHATTFRAKDVDWSSVDDITHKYSLNLTADSIKETIALERAKIQENMKNATPVVVATVFNRGDNPHSADSP # AHSVPGNAFKVTVPPPPPPPLSVPEAHLFLSPAHSVGVGNHSCVYRVEWDLPRSVFSKPKICITCVEEAARKIINETGTGTGDGSTTHSSGTLKLQEK # RTPSLAFAFSKFDFDYAELDKSRAQLDENLLHKLEDDNEITYIDYTGSVSTIHVDTVPWYDPASTMPPPCSHLAQSSVSGSLPGSPPPTAQVSVVAKL # SLPGDAHLEREAVNYQRFGTQFSQHWTGYTLARPIRNPTPMGAITPIFYGFYSKEGASDKYFSSILLLEDCGKPIEPLKLDIDDRYVNPEDVHPRRDD # EFLLQTRMCRPCSSFALPWVDAGLLLASKYSHATR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g254 ### # start gene g255 6 AUGUSTUS gene 590216 590735 0.91 - . g255 6 AUGUSTUS transcript 590216 590735 0.91 - . g255.t1 6 AUGUSTUS stop_codon 590216 590218 . - 0 transcript_id "g255.t1"; gene_id "g255"; 6 AUGUSTUS CDS 590216 590586 1 - 2 transcript_id "g255.t1"; gene_id "g255"; 6 AUGUSTUS CDS 590672 590735 0.91 - 0 transcript_id "g255.t1"; gene_id "g255"; 6 AUGUSTUS start_codon 590733 590735 . - 0 transcript_id "g255.t1"; gene_id "g255"; # protein sequence = [MYAEPFNDDGTLASNVFFETIEGKYIHPLNVSKINDFNIEGEGAKATAMENLVTDLKSRGIPIDGIGLESHFILGEIP # TTLQAQMEAFTALGVEVAVTELDIRMTLPETDALLAQQQTDYQTVVSACTAVADCVGVCIVFGYEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g255 ### # start gene g256 6 AUGUSTUS gene 594329 595506 0.68 - . g256 6 AUGUSTUS transcript 594329 595506 0.68 - . g256.t1 6 AUGUSTUS stop_codon 594329 594331 . - 0 transcript_id "g256.t1"; gene_id "g256"; 6 AUGUSTUS CDS 594329 595080 1 - 2 transcript_id "g256.t1"; gene_id "g256"; 6 AUGUSTUS CDS 595374 595506 0.68 - 0 transcript_id "g256.t1"; gene_id "g256"; 6 AUGUSTUS start_codon 595504 595506 . - 0 transcript_id "g256.t1"; gene_id "g256"; # protein sequence = [MSHDAKEQLFPAIGTIADRADQLPENEASANSDEDRPMQEIESLSRSDLNRQIVRSANASIVIPELQLTLPSSARGQL # TTVEGLIRDIVSDLSIDQPLRRVQDEDSYTKIQSLIDKLIEILGDDEVEDEAVDDQNNASARAASEKDLPMPAFTVKLDDPSGNSWIEFIGSMSDPKW # NMRNYPRTLQQNIELGLVAAPDESASASCFCFFRISKLIVPVAGVVQGAAKLSLNDDADEVVGGGAEGTDEEIYVFPGTCSSCGHPLDTMMKKVNIPY # FKVRNALCRHASVFHSPDRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g256 ### # start gene g257 6 AUGUSTUS gene 602735 602986 0.6 - . g257 6 AUGUSTUS transcript 602735 602986 0.6 - . g257.t1 6 AUGUSTUS stop_codon 602735 602737 . - 0 transcript_id "g257.t1"; gene_id "g257"; 6 AUGUSTUS CDS 602735 602986 0.6 - 0 transcript_id "g257.t1"; gene_id "g257"; 6 AUGUSTUS start_codon 602984 602986 . - 0 transcript_id "g257.t1"; gene_id "g257"; # protein sequence = [MSSDNKDQLPGEHFEPRQTATSDDYTPDQAKSLPLEPARQRLVDDILALYSCKPTVERVKRYSSDCVYDDQFVYANDR # YKMAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g257 ### # start gene g258 6 AUGUSTUS gene 610399 611328 0.31 - . g258 6 AUGUSTUS transcript 610399 611328 0.31 - . g258.t1 6 AUGUSTUS stop_codon 610399 610401 . - 0 transcript_id "g258.t1"; gene_id "g258"; 6 AUGUSTUS CDS 610399 610894 1 - 1 transcript_id "g258.t1"; gene_id "g258"; 6 AUGUSTUS CDS 610949 611328 0.31 - 0 transcript_id "g258.t1"; gene_id "g258"; 6 AUGUSTUS start_codon 611326 611328 . - 0 transcript_id "g258.t1"; gene_id "g258"; # protein sequence = [MTSRISTPLSSVRAAVPTPNSASLPSQALAKLTSISTKTLSLLLERQRSSTMSSSPSSNGLSNNTLHLEQIQTNLASL # RNGILELEAVSRTAAGSHSQVEAVKLLRKQYERMRGMLLADGQGVEVPSLDIIVAPTPKKPDPFSSLTSPSNASLAPLIGTPPPRSPSPSIPDYNGPF # TPYTDDPQRPPSPPSPNALLQTQKQLIDTQDTHLSALSDSISRHHNLSLQINSELDTHHGLLQELDTELDQTEGRLSGARRRLDRVGRGLKGNGSTVC # IGVLILVLLVLIIAFKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g258 ### # start gene g259 6 AUGUSTUS gene 611597 612118 0.39 + . g259 6 AUGUSTUS transcript 611597 612118 0.39 + . g259.t1 6 AUGUSTUS start_codon 611597 611599 . + 0 transcript_id "g259.t1"; gene_id "g259"; 6 AUGUSTUS CDS 611597 612118 0.39 + 0 transcript_id "g259.t1"; gene_id "g259"; 6 AUGUSTUS stop_codon 612116 612118 . + 0 transcript_id "g259.t1"; gene_id "g259"; # protein sequence = [MSSSSRRPKSPTRAQLSSKLAYEKKVPKFLQRLKNQVEGKLDTSSYDNDDEDYQDSTYRNPDRDEYRRDAGRNEYGGD # DNGRDEFGRERRIPNGGYNDEEFEYINDGSGRPPIPRRPRSSSPQRQGRPPIPTRPDDDPGSTDEDSNDEKPQVVVLKAGKHLSEREAENERRKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g259 ### # start gene g260 6 AUGUSTUS gene 618145 618954 1 - . g260 6 AUGUSTUS transcript 618145 618954 1 - . g260.t1 6 AUGUSTUS stop_codon 618145 618147 . - 0 transcript_id "g260.t1"; gene_id "g260"; 6 AUGUSTUS CDS 618145 618954 1 - 0 transcript_id "g260.t1"; gene_id "g260"; 6 AUGUSTUS start_codon 618952 618954 . - 0 transcript_id "g260.t1"; gene_id "g260"; # protein sequence = [MKSNKGDDFRAYASNSLFVAAQLQSRPLKQYGFKSVPDEVHREISLLPSDLPTRPNTPSGDDQPRPQAFGFGNSGHNP # FNMTLSSQSQHAQKYYSPGNSSWSMLDLSDESRTSQQKQKLEEQGQPMSCDSSFVLPTYNREENSFMDVDVLPGQQQNQSQFQSMYTPSQDFTHSTFS # QPHEASVEPVIMMLNSLEPQPSFWKAIEMDVRAFPRPNLRAGLVFPTKRDASANTPLGGSGNVYTSQGTRLNKPDITKASASKNERWRRLFQW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g260 ### # start gene g261 6 AUGUSTUS gene 620565 621194 0.93 + . g261 6 AUGUSTUS transcript 620565 621194 0.93 + . g261.t1 6 AUGUSTUS start_codon 620565 620567 . + 0 transcript_id "g261.t1"; gene_id "g261"; 6 AUGUSTUS CDS 620565 621194 0.93 + 0 transcript_id "g261.t1"; gene_id "g261"; 6 AUGUSTUS stop_codon 621192 621194 . + 0 transcript_id "g261.t1"; gene_id "g261"; # protein sequence = [MANREKTVFCLGSDGSQQEGNDAEAARLAVAQNLNIKLFIDDNDVTIAGHPSEYLKGFEVGKTLEGHGLKVVTVDGED # IDALWGGIASIVSYSGPAAVISKRKMAPGIAEIEGSPHGHDVIPVKAAIKYLEGRGYPNFGEILLNIKPVPQPYLYIGCTKEVGANRVVFGEAVNGVL # DRLGKEEAAKKVMVIDSTFSPILTNEYSWYLYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g261 ### # start gene g262 6 AUGUSTUS gene 622618 623115 1 - . g262 6 AUGUSTUS transcript 622618 623115 1 - . g262.t1 6 AUGUSTUS stop_codon 622618 622620 . - 0 transcript_id "g262.t1"; gene_id "g262"; 6 AUGUSTUS CDS 622618 623115 1 - 0 transcript_id "g262.t1"; gene_id "g262"; 6 AUGUSTUS start_codon 623113 623115 . - 0 transcript_id "g262.t1"; gene_id "g262"; # protein sequence = [MTQKSLKKETGLTNIIPDSFTWSDNGFDPVDDDEENIEEKDDEFDIPGPEQSMISASQRKKALAASTRNKATLYTPTP # GKLRTSADVMNRLLWDPVLGKKEYIVGYEDRFLGIQELKLRDWVMKEVEHESFVRIYLFVPEHLFSNCTIRSLSIESCISSTSQTEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g262 ### # start gene g263 6 AUGUSTUS gene 624217 625092 0.83 - . g263 6 AUGUSTUS transcript 624217 625092 0.83 - . g263.t1 6 AUGUSTUS stop_codon 624217 624219 . - 0 transcript_id "g263.t1"; gene_id "g263"; 6 AUGUSTUS CDS 624217 625092 0.83 - 0 transcript_id "g263.t1"; gene_id "g263"; 6 AUGUSTUS start_codon 625090 625092 . - 0 transcript_id "g263.t1"; gene_id "g263"; # protein sequence = [MEQKTAEMEALIKHLHGTHLDADWVIAGDINWPENFGATPAEELFEDCGLVIPHGPSFDPSTNPLAAATMQTSPHSQR # YDRVYVKRIGGWALQNTQLFGNGDSPPSDHYGLSVGFQCRVVPTKIAVESDVGLGAESHPITLLSPTGKLTTTELVELTRAQSWLPSAEQERKMSIVI # ETLRSFICPSSEFPTTSTGHVQIRIECVGSYALGVHTSASDVDCLAVGNVSSSTFWALMKHKLRRNAKALENGYGLDVRLRRFVKDAVVQMMNLEVEG # TKVDLQYCPARGLVGEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g263 ### # start gene g264 6 AUGUSTUS gene 627265 629560 0.21 - . g264 6 AUGUSTUS transcript 627265 629560 0.21 - . g264.t1 6 AUGUSTUS stop_codon 627265 627267 . - 0 transcript_id "g264.t1"; gene_id "g264"; 6 AUGUSTUS CDS 627265 628197 0.32 - 0 transcript_id "g264.t1"; gene_id "g264"; 6 AUGUSTUS CDS 628256 629560 0.38 - 0 transcript_id "g264.t1"; gene_id "g264"; 6 AUGUSTUS start_codon 629558 629560 . - 0 transcript_id "g264.t1"; gene_id "g264"; # protein sequence = [MEDVSLGIEDLPYDLAGEIFRHLPSSADLLHIAQASKSLYYVAIRILYRDIHYETLSDFYHNLPFWTHNVPQNIAQVP # RSVLIGRELGQSFCQNPHGLALPRSPRAILALSGVDGSKSEESFPPAFLPLRELLLSFPKLQRLTFRQARLTHEIHSFLGELPATIRSLAFEQCSFIS # KPILSSRSAPTTFTQLPVKELCITGTHTGRYQPLGNVLHNLPVNLLIPPVAGSTNALNERLVQLDMYHILTRSPKIQALCLDWNITCAGRFSRHPGLP # PPAFSCLDHLEVRHGMRSHAVWNGEANSTENKLLLMSAFAKLLAPCNSLTELVLFGYIPGLGDNGTAKPILPALMSYTGPTDFLKSSLRHCEMLQKLI # FPDAIKDIDTVMLEALPYNARESVRFLDITVGHWDIEVLYAISMELPRLEVLKIKYEVGYPDQDMLISFGPEFFSRIPHLTIFHLYRPEIEYDELRCL # GVHSHLSKFVVPSSQARKSVKPKLKLPSKSRAPSPRGSGPAVADHPNTDTDSDSDFTVGSTTSASNSMVSSTASISTSASSINSNQSITTGSASAGQS # SSTGTVGSVPDISQGPSIVTANSVAGTSQSSGIGTVTGTAYTSQGPVSTTANSAAGLHATVYHTVHPIHHPHHIGPQYTTGHRWRCICQNRPLPKIPV # PDLGPCGQPDAHEYMASWEKYAPGLREVRLVDAFVWRRAGVGDEWCRRDLKDPIDEEEQELGNDGYCRCNPDVDDESFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g264 ### # start gene g265 6 AUGUSTUS gene 637730 638185 0.34 - . g265 6 AUGUSTUS transcript 637730 638185 0.34 - . g265.t1 6 AUGUSTUS stop_codon 637730 637732 . - 0 transcript_id "g265.t1"; gene_id "g265"; 6 AUGUSTUS CDS 637730 638185 0.34 - 0 transcript_id "g265.t1"; gene_id "g265"; 6 AUGUSTUS start_codon 638183 638185 . - 0 transcript_id "g265.t1"; gene_id "g265"; # protein sequence = [MNVITHRRAYCLFARTTFKDRCTVVIDRGDRDNASGVEKYRGRGFEVVDVPNVDRIMNRHSDLTGVAARYMKDYRTWH # VAVENFGSESATHDFMEGNSFEMGYSEGKTGIIYVPIEEDTYSKNFIAAPGDLQHLREQFWRAEDVLAENFIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g265 ### # start gene g266 6 AUGUSTUS gene 640884 643454 0.99 - . g266 6 AUGUSTUS transcript 640884 643454 0.99 - . g266.t1 6 AUGUSTUS stop_codon 640884 640886 . - 0 transcript_id "g266.t1"; gene_id "g266"; 6 AUGUSTUS CDS 640884 643454 0.99 - 0 transcript_id "g266.t1"; gene_id "g266"; 6 AUGUSTUS start_codon 643452 643454 . - 0 transcript_id "g266.t1"; gene_id "g266"; # protein sequence = [MVAGQLGNRTQLGNRTQLDDYRDRGETLAHYNVKDFFAETYDKYEKAGETEVSTTNASSEDPWTRRGRAPGIRHVYLE # GTKPNRVRLIRQQGHETVPLYLGRWFPRNDRPEDRANYILLMLSLLKPWRKVTDITEGFQNLEDAWDAFVSSCAENVLDFINNVQYFYRCSDQSAARR # EREYKSYIAQEGSGTAGDVDQTLTLDIQDRAEGSVSDAEVYEAQQKEGMAQELYAYVAMECAFGAGVFDREYEIDDGVETAGRCSIDDKVDFQEWHQQ # LVDYTATGGLLVENEMVDIGRVTVNPPTVAGVSVVAHGEDDPTAGGVGGNLRKMLNEEQARAHDIVVDHVLRTVNGNPPPQLFMLLLGPGGTGKTVVI # NAINETMTKLGVGGWLAKTATTGVAASHFGGKTLHSWAGIKVAAKASDDLIGNASAAVQKRRTANIGLSRYLLCDECSMATKELVGRMSTICSHVATV # ENKNYSDSYFGGMNVVLCGDFHQFPPVGQPNGALYLPNAPGANSYAVLGRHLFSQFTTVVTLKKQIRVKDTRWMELLDRLRVGACNADDMEQLQKLRL # DVDTNPPVNFAQPGWNSCILITPRNSVRRKWNRAALRRHCKLHATRLYSCPAEDTIGGIPLSNEQLLRIARLDSKRTGNLEHRVEIVVGMRAMILANI # ATEADLANGTRGTVTDIVLDDREPVNHEVKDGATLLHYPPAIVYFKPDGNTSVRLEGFPVGLLPIVPQSNKFVAAVEDNKSRTILRRQLALTPGYAFT # DLKGQGQTIEYVIVDLGRPSYGSKLDAFGAYVALSRSRGRDTIRLLRGFDEALFVTHPSPDLEVEDARLVELEEETTIAWKTGKLWDRASRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g266 ### # start gene g267 6 AUGUSTUS gene 647093 648317 0.13 - . g267 6 AUGUSTUS transcript 647093 648317 0.13 - . g267.t1 6 AUGUSTUS stop_codon 647093 647095 . - 0 transcript_id "g267.t1"; gene_id "g267"; 6 AUGUSTUS CDS 647093 647967 0.39 - 2 transcript_id "g267.t1"; gene_id "g267"; 6 AUGUSTUS CDS 648131 648317 0.15 - 0 transcript_id "g267.t1"; gene_id "g267"; 6 AUGUSTUS start_codon 648315 648317 . - 0 transcript_id "g267.t1"; gene_id "g267"; # protein sequence = [MFQVFGVIQRREICAKASLRISRSQFSKYELEIQQLKPKDLLQASEEEKKKQPFSNPAIRALRENIDLDNFVATRGPT # STTRSINLASDPYAAAQFFHFVVKSTLESLYGFTKLPTGHPNRVRGIVGTVQAYVGMVESQGRGTLHLHMIMWLEGAPTPGEMQGALKSKEFRDKVAN # FISCTIRADVGKTMSELTQISTNPSIAYARPISTKDPEYERKRAAQEVHLARTLQLHECSPERCYRKGTVRCKRRAPWPTSQFDFIDEDGTWGMKRSV # GYLNGFNPTISEVQFCNNDQKLVTNGDETQDMTYYITTYSTKKRDHSTNESAILAQRLAYHREQERLNSDHVDVSRKLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g267 ### # start gene g268 6 AUGUSTUS gene 648774 649499 0.38 - . g268 6 AUGUSTUS transcript 648774 649499 0.38 - . g268.t1 6 AUGUSTUS stop_codon 648774 648776 . - 0 transcript_id "g268.t1"; gene_id "g268"; 6 AUGUSTUS CDS 648774 649499 0.38 - 0 transcript_id "g268.t1"; gene_id "g268"; 6 AUGUSTUS start_codon 649497 649499 . - 0 transcript_id "g268.t1"; gene_id "g268"; # protein sequence = [MCIQSLSGSPAKRPPLSLSNNLWIGDVPFELRILTLCERVLVSKFFSAAYIIKLYPKSRGARGWPKEMLTSAVKGNVS # SYFLNTEDIVGMIDPGFVPPRPGILAATIGVTFIGPQNIPLKFLPPYLRVRRKRVKDALEWLIRNNPLYLGLKLSAQHLALLPEDGVPPEVLDNMKWI # DDVRVLDRENGGYVPNLESPENDEDEVASGEGTVGDDVVEVFRPSYGTISDNAQCLLSILTDMRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g268 ### # start gene g269 6 AUGUSTUS gene 651939 652754 0.16 + . g269 6 AUGUSTUS transcript 651939 652754 0.16 + . g269.t1 6 AUGUSTUS start_codon 651939 651941 . + 0 transcript_id "g269.t1"; gene_id "g269"; 6 AUGUSTUS CDS 651939 652359 0.35 + 0 transcript_id "g269.t1"; gene_id "g269"; 6 AUGUSTUS CDS 652573 652754 0.69 + 2 transcript_id "g269.t1"; gene_id "g269"; 6 AUGUSTUS stop_codon 652752 652754 . + 0 transcript_id "g269.t1"; gene_id "g269"; # protein sequence = [MEFPRNVNSYAAPQTPPNKRAYMPITPQSVGTMVTTPSPVAGVEDSFASGNELQRQYNQYQNSPTALSERATSERRGG # SEAFQPQYAVPTGEPTSTWFNNHPYLGTLYGSLGPVQNAPLLGLQPAFNPEESPQLRDTRIVATAVSKEATVADVSSGNSNKSGGECVAKRKHVDDSG # GDAEQQHEPKRREIDNGMTAGLQE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g269 ### # start gene g270 6 AUGUSTUS gene 658578 659027 0.49 + . g270 6 AUGUSTUS transcript 658578 659027 0.49 + . g270.t1 6 AUGUSTUS start_codon 658578 658580 . + 0 transcript_id "g270.t1"; gene_id "g270"; 6 AUGUSTUS CDS 658578 659027 0.49 + 0 transcript_id "g270.t1"; gene_id "g270"; 6 AUGUSTUS stop_codon 659025 659027 . + 0 transcript_id "g270.t1"; gene_id "g270"; # protein sequence = [MRNHGTSPHAEPMDYLHMAADILQFIEKLGLSKISLLGHSMYVYTAPLAPISTENCVSSWRRGGKAAMTLALDKNLPS # GLLENLIVVDISPIKGKVSRTTISYIEAMRRIEALNLTGPNARKEADKLLVDVEKVVFSPQPRSFWSTQNC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g270 ### # start gene g271 6 AUGUSTUS gene 665488 665949 0.47 + . g271 6 AUGUSTUS transcript 665488 665949 0.47 + . g271.t1 6 AUGUSTUS start_codon 665488 665490 . + 0 transcript_id "g271.t1"; gene_id "g271"; 6 AUGUSTUS CDS 665488 665949 0.47 + 0 transcript_id "g271.t1"; gene_id "g271"; 6 AUGUSTUS stop_codon 665947 665949 . + 0 transcript_id "g271.t1"; gene_id "g271"; # protein sequence = [MNALCCSLVEYPHCLVITDDTTAAQQLSLSSKDYGHYLQEHLPVKVAEMSGLGKYKGYDRRNLIIKSFPSDKDVSALG # EIQALRLMGDLVDFGKDSEGKPIIIMKRQDGSLLEELEAYKTANDEQKRKIREETFKLACSKAASEAVHKGVWHK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g271 ### # start gene g272 6 AUGUSTUS gene 675306 675620 0.88 + . g272 6 AUGUSTUS transcript 675306 675620 0.88 + . g272.t1 6 AUGUSTUS start_codon 675306 675308 . + 0 transcript_id "g272.t1"; gene_id "g272"; 6 AUGUSTUS CDS 675306 675620 0.88 + 0 transcript_id "g272.t1"; gene_id "g272"; 6 AUGUSTUS stop_codon 675618 675620 . + 0 transcript_id "g272.t1"; gene_id "g272"; # protein sequence = [MDAESLNLTGDADDLVAQAVNSSSNVVVVIHATGAVNIEKWADNPNVTAIIAAYLPGQESGAGLVPVLYGDVSPSGKI # PWTWGKSLDDYPVTSYISTTFYCSTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g272 ### # start gene g273 6 AUGUSTUS gene 680961 681502 0.43 + . g273 6 AUGUSTUS transcript 680961 681502 0.43 + . g273.t1 6 AUGUSTUS start_codon 680961 680963 . + 0 transcript_id "g273.t1"; gene_id "g273"; 6 AUGUSTUS CDS 680961 681177 0.43 + 0 transcript_id "g273.t1"; gene_id "g273"; 6 AUGUSTUS CDS 681216 681502 0.85 + 2 transcript_id "g273.t1"; gene_id "g273"; 6 AUGUSTUS stop_codon 681500 681502 . + 0 transcript_id "g273.t1"; gene_id "g273"; # protein sequence = [MRRPNTSSPGDGSRTITITSTPTSEDEGSSNDAPRSAVGALKLRATTRKPRQKVVWREDVVDNEGAGKKSSKIDDFET # TVCCIYHKPKAYDESSDEDESDSDSSCDHNHAGHSRDHHHAHNSNDHRRDGEGLQNRDSGSSIQHLEHEEPSRNAYEIIPSKKGKHRAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g273 ### # start gene g274 6 AUGUSTUS gene 683582 684127 0.36 - . g274 6 AUGUSTUS transcript 683582 684127 0.36 - . g274.t1 6 AUGUSTUS stop_codon 683582 683584 . - 0 transcript_id "g274.t1"; gene_id "g274"; 6 AUGUSTUS CDS 683582 684127 0.36 - 0 transcript_id "g274.t1"; gene_id "g274"; 6 AUGUSTUS start_codon 684125 684127 . - 0 transcript_id "g274.t1"; gene_id "g274"; # protein sequence = [METRMGESDYEDIDWSKIPLHDGSRIRVDTHALEDIRSQTPSPTPEVIWALISDFEEASDRKNGPEREVLKRIVVLNR # ATIRKEEGNVFYKTGDYITALSKYLEAMNLILGRIATVSPLVIPSPHFFSQPYLDLSQGGESSFGAWVEYTDLVALAGNISQCYIKMQNDVMVYVTLV # MLLLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g274 ### # start gene g275 6 AUGUSTUS gene 688622 689111 0.28 - . g275 6 AUGUSTUS transcript 688622 689111 0.28 - . g275.t1 6 AUGUSTUS stop_codon 688622 688624 . - 0 transcript_id "g275.t1"; gene_id "g275"; 6 AUGUSTUS CDS 688622 688884 0.48 - 2 transcript_id "g275.t1"; gene_id "g275"; 6 AUGUSTUS CDS 689021 689111 0.41 - 0 transcript_id "g275.t1"; gene_id "g275"; 6 AUGUSTUS start_codon 689109 689111 . - 0 transcript_id "g275.t1"; gene_id "g275"; # protein sequence = [MGFFKGSLTPVRRNSQATTHAKEISANNIAVLVGGLLGFTLADRARTSLPTHSLIRTGSATKPTYGSPEDFGKAIEEL # KRTFPGEDIVSTDPEDVYNHGFSVNDYHPGALTLLISPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g275 ### # start gene g276 6 AUGUSTUS gene 694667 695493 0.86 - . g276 6 AUGUSTUS transcript 694667 695493 0.86 - . g276.t1 6 AUGUSTUS stop_codon 694667 694669 . - 0 transcript_id "g276.t1"; gene_id "g276"; 6 AUGUSTUS CDS 694667 695266 0.98 - 0 transcript_id "g276.t1"; gene_id "g276"; 6 AUGUSTUS CDS 695326 695493 0.87 - 0 transcript_id "g276.t1"; gene_id "g276"; 6 AUGUSTUS start_codon 695491 695493 . - 0 transcript_id "g276.t1"; gene_id "g276"; # protein sequence = [METEEAGGTTEIVKDEIAGDKSGTTDTNITGSTNDPTHDPLESQKNVIGNEPAIGSPQRSQSKPRPGSRRLKTRPHAP # TLSSMPALTDLSLHSPSNIVGTPFTVNSAPFEYPFPPNTTQSSEGLFPPLTPPSLLSASLSLSGPTVALSTSPPFGPDARSYSPTHPKMRTVDPPVPP # GLAKKRQRWSLTLARRESSFLSQTSEGSTSSGSGTRSHRAFSLDDPPPAVHQQVAPSSPEQDLSRKTSPEPGTTDDNGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g276 ### # start gene g277 6 AUGUSTUS gene 698009 698479 0.45 + . g277 6 AUGUSTUS transcript 698009 698479 0.45 + . g277.t1 6 AUGUSTUS start_codon 698009 698011 . + 0 transcript_id "g277.t1"; gene_id "g277"; 6 AUGUSTUS CDS 698009 698479 0.45 + 0 transcript_id "g277.t1"; gene_id "g277"; 6 AUGUSTUS stop_codon 698477 698479 . + 0 transcript_id "g277.t1"; gene_id "g277"; # protein sequence = [MTAVVFTSKTTSGSFQIDVVPVALHNIGANNQNIPVIDEGISIEDGHPRLNRNSVRVNVLGKDTAVILKKIDELVDSG # SWNDIPVMIMRGKGGKPLGMTAVYEQANKAQKKSLEELVKKMTCDKVVSVAKKHQILNRCVGRVILLFRLKLSKMHAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g277 ### # start gene g278 6 AUGUSTUS gene 701932 702411 0.31 + . g278 6 AUGUSTUS transcript 701932 702411 0.31 + . g278.t1 6 AUGUSTUS start_codon 701932 701934 . + 0 transcript_id "g278.t1"; gene_id "g278"; 6 AUGUSTUS CDS 701932 702411 0.31 + 0 transcript_id "g278.t1"; gene_id "g278"; 6 AUGUSTUS stop_codon 702409 702411 . + 0 transcript_id "g278.t1"; gene_id "g278"; # protein sequence = [MSSSSMPKSRPQSSSRPVWSASDGDVNPESVIRSSYGTGSTDEDVAMMLEDFAMGHRVNRSRAAQELDPGPSDLYTHR # QMTAYGSQNAPPRRESHENATRSLPLTPVSATDVFVPQLGLPDHHPLALLIDINTNVIGRLVSVLPAKSHCMTLVTFYVSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g278 ### # start gene g279 6 AUGUSTUS gene 706786 708733 0.09 - . g279 6 AUGUSTUS transcript 706786 708733 0.09 - . g279.t1 6 AUGUSTUS stop_codon 706786 706788 . - 0 transcript_id "g279.t1"; gene_id "g279"; 6 AUGUSTUS CDS 706786 707427 0.64 - 0 transcript_id "g279.t1"; gene_id "g279"; 6 AUGUSTUS CDS 707743 708138 0.51 - 0 transcript_id "g279.t1"; gene_id "g279"; 6 AUGUSTUS CDS 708191 708431 0.77 - 1 transcript_id "g279.t1"; gene_id "g279"; 6 AUGUSTUS CDS 708535 708576 0.29 - 1 transcript_id "g279.t1"; gene_id "g279"; 6 AUGUSTUS CDS 708687 708733 0.33 - 0 transcript_id "g279.t1"; gene_id "g279"; 6 AUGUSTUS start_codon 708731 708733 . - 0 transcript_id "g279.t1"; gene_id "g279"; # protein sequence = [MDNSIANLGRISSSKATVKISWVDAMYFPVVFLVTVHDPICTESGNLDNALYGSFLPVPAQSVFPNSTPDDYASEKAP # GAVVARKERIIINKGRERIKLRVTNNGDRPVQIGSHYHFIETNRLLSFDRAKAYGKRLDIPAGTAVRFEPGDVKTVTLCSIAGGKIISGGNGLASGVV # NPDRTEEIINSLMQKGFGHVPEPGALEVTDDTDIGREAYISMFGPTTGDRIRLGDTELWIEVEHDKADIGVKDGLIVGIGKAGNPDVMANVHPSLIIG # SSTEVIAGEKLIITAGAIDAHVHYICPQQVEEALAAGTTTMIGGGTGPSAGTNATTCTSSPFYMRHMLAATDGLAMNFAFTGKGNDAGRKALEDIVKA # GAAGLKLHEDWGSTPATIRNCLDVGDDYDVQVNFLASIVCHILRYSLNLLCRSISILIPLTKVVSLRVSHPLPTAPRLPIKTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g279 ### # start gene g280 6 AUGUSTUS gene 709113 709663 0.6 - . g280 6 AUGUSTUS transcript 709113 709663 0.6 - . g280.t1 6 AUGUSTUS stop_codon 709113 709115 . - 0 transcript_id "g280.t1"; gene_id "g280"; 6 AUGUSTUS CDS 709113 709559 0.8 - 0 transcript_id "g280.t1"; gene_id "g280"; 6 AUGUSTUS CDS 709658 709663 0.69 - 0 transcript_id "g280.t1"; gene_id "g280"; 6 AUGUSTUS start_codon 709661 709663 . - 0 transcript_id "g280.t1"; gene_id "g280"; # protein sequence = [MANKSLSDNEASDDILRLQGMGWVKRKIIGAGTLTLAIEHFKNAEGIECINIEQTLNPGGLKTNDERVLDWMEKPKED # SVFGATIGQNRRVKAEEIEDEYLSKGWTADTLEHGLIQSRVVSDTAKSGVSWTVNQVRPPILLPTSPIFIAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g280 ### # start gene g281 6 AUGUSTUS gene 712897 714320 0.79 + . g281 6 AUGUSTUS transcript 712897 714320 0.79 + . g281.t1 6 AUGUSTUS start_codon 712897 712899 . + 0 transcript_id "g281.t1"; gene_id "g281"; 6 AUGUSTUS CDS 712897 713739 0.82 + 0 transcript_id "g281.t1"; gene_id "g281"; 6 AUGUSTUS CDS 713859 714320 0.92 + 0 transcript_id "g281.t1"; gene_id "g281"; 6 AUGUSTUS stop_codon 714318 714320 . + 0 transcript_id "g281.t1"; gene_id "g281"; # protein sequence = [MALSATYTQASQNQAQAKLAERNRREAELKKRRLEQEKKDREREAQLRLKHFEQQKKEEEQKKKKEEERKAIEAAVER # RKAAEREALLHGPAKKTSSHRASQVRRKAPADNDDDNDGLKSEPLTREELRERKLQAELRRQFTSVKRSTTTGGYQRHGRHLPGGAVDVTTTGPPAPS # SSGQSVKARLAAMPNTLTKLNTVKRDTRTIDEILQDRAKAKEQKILDGHEALAFDDWFGTKKKEQTRPSSIGPASGENTPKSTASVARESIVSHDPNL # TDDGWAQSEKYSSSKLARPNASSSTSRPSTSISKKRARSSSRSESPRPKRRAISSEELDDVDNESLDVSGLIWGIMGKNRSHYVNMDVFSDDEDMEAD # ASALEREEKRRYILHHSLSLTCWFNDDFLAPVSLKKKNSLPWKKRGATKKIRDAVRCEFEPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g281 ### # start gene g282 6 AUGUSTUS gene 726577 727014 0.91 - . g282 6 AUGUSTUS transcript 726577 727014 0.91 - . g282.t1 6 AUGUSTUS stop_codon 726577 726579 . - 0 transcript_id "g282.t1"; gene_id "g282"; 6 AUGUSTUS CDS 726577 726847 0.98 - 1 transcript_id "g282.t1"; gene_id "g282"; 6 AUGUSTUS CDS 726986 727014 0.91 - 0 transcript_id "g282.t1"; gene_id "g282"; 6 AUGUSTUS start_codon 727012 727014 . - 0 transcript_id "g282.t1"; gene_id "g282"; # protein sequence = [MENSIQRLCLGYWTGDPGDDLYTATQSSYGCEDNGTPTDHQVPEEESLETQINDADDISYVRKTFQDMGFDVERDDGN # WGIEVYTEAVLRFKTFVEGQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g282 ### # start gene g283 6 AUGUSTUS gene 730350 730829 0.26 - . g283 6 AUGUSTUS transcript 730350 730829 0.26 - . g283.t1 6 AUGUSTUS stop_codon 730350 730352 . - 0 transcript_id "g283.t1"; gene_id "g283"; 6 AUGUSTUS CDS 730350 730651 0.56 - 2 transcript_id "g283.t1"; gene_id "g283"; 6 AUGUSTUS CDS 730826 730829 0.3 - 0 transcript_id "g283.t1"; gene_id "g283"; 6 AUGUSTUS start_codon 730827 730829 . - 0 transcript_id "g283.t1"; gene_id "g283"; # protein sequence = [MHSDSDSDSDSDSDSDSDLDSDLDSDSDLDSDLGNNATADPDYHDETENGVDKDFEYPAKHHYKGHQDMFSLYFNQCL # CWQTVLEDHLLKVTPLHFIWLFN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g283 ### # start gene g284 6 AUGUSTUS gene 733646 734611 0.24 - . g284 6 AUGUSTUS transcript 733646 734611 0.24 - . g284.t1 6 AUGUSTUS stop_codon 733646 733648 . - 0 transcript_id "g284.t1"; gene_id "g284"; 6 AUGUSTUS CDS 733646 734094 0.32 - 2 transcript_id "g284.t1"; gene_id "g284"; 6 AUGUSTUS CDS 734312 734342 0.46 - 0 transcript_id "g284.t1"; gene_id "g284"; 6 AUGUSTUS CDS 734429 734611 0.33 - 0 transcript_id "g284.t1"; gene_id "g284"; 6 AUGUSTUS start_codon 734609 734611 . - 0 transcript_id "g284.t1"; gene_id "g284"; # protein sequence = [MDTFTTTFALGPSGMDLLVTCLEKVYSKAEAAGPFFLTQLAKDFPNVHKGICELPNALLVLWRKTSGMHSLXFVEHVL # DKMSNGRQQYNKIYNLFATLCQALVHAIEAFLQNRSQLTSPNIPLSASTASPTPTTAHSSHSRIAAATKFADRALHLTWATFVHELMRDFPHPLLSKR # VQANALQGLPKRKQAIKLLKVTDSVWIRLFTYKHFLRHTTPIRM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g284 ### # start gene g285 6 AUGUSTUS gene 735737 736536 0.31 - . g285 6 AUGUSTUS transcript 735737 736536 0.31 - . g285.t1 6 AUGUSTUS stop_codon 735737 735739 . - 0 transcript_id "g285.t1"; gene_id "g285"; 6 AUGUSTUS CDS 735737 736190 0.53 - 1 transcript_id "g285.t1"; gene_id "g285"; 6 AUGUSTUS CDS 736239 736411 0.34 - 0 transcript_id "g285.t1"; gene_id "g285"; 6 AUGUSTUS CDS 736486 736536 0.35 - 0 transcript_id "g285.t1"; gene_id "g285"; 6 AUGUSTUS start_codon 736534 736536 . - 0 transcript_id "g285.t1"; gene_id "g285"; # protein sequence = [MPEPQNPCKRRFEPADAFENITGRPKKKKKTSASATFKTPAPGPPPAKPTEFHIGLYGKPSFVDHGTAKRPSLSEWQI # LWTADRIRKIFILPDATHADIMGAIEVAFGDFLPPVAEHTIRFRILQSVVVGRGQSAILKLLESDSLTVNDLLVYVFFIPLLLYNLLTPMPSASLTTR # PKGVPIKLASNLVYITLPAGAADIDEVVKSPKELIKSVSYFSIWPLHNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g285 ### # start gene g286 6 AUGUSTUS gene 745386 748261 0.92 - . g286 6 AUGUSTUS transcript 745386 748261 0.92 - . g286.t1 6 AUGUSTUS stop_codon 745386 745388 . - 0 transcript_id "g286.t1"; gene_id "g286"; 6 AUGUSTUS CDS 745386 748167 1 - 1 transcript_id "g286.t1"; gene_id "g286"; 6 AUGUSTUS CDS 748257 748261 0.92 - 0 transcript_id "g286.t1"; gene_id "g286"; 6 AUGUSTUS start_codon 748259 748261 . - 0 transcript_id "g286.t1"; gene_id "g286"; # protein sequence = [MSFVDDNSGPLQDIPTHIFGLDAQGRGQIYDQAEISTREEADSATVVKSAVDLVSNVKGTTGSDGSSNTTVAATDYIQ # HAMTVMDSLADLGKVVPFVAPAFAIIKAIIAVEQRARDVDVKCTDLVQRVTFMLSHLPALKKIDVTNSTRQVIDRMNDTLKKSAALIQTYRKQSTIAR # RLSVHNKDRFTSCASLLSQCTNDLMISLQIHQSTQLDILTRPVPFDLEDEAATKFVATHGGIDAVKGNEALVKQFASEMKLTVDENVMEQLNTNISVV # LQQNQDRLEQSLNESVSASVIEGIRGLAAQMNESAKEQTFVCVQCDKEYKESTSGEKSCSFHRTEYDSWSKSYRCCGSANPCQAGRHRSEHHDQYPYG # NFFVFARNITGYTDTTEKWTELEDSNLETSKKMTVSVARLLRWKSRGAQPELPTVLIRVGSVSISEPYLFRTYNTKDLEVITKVVDITHQTVIFRTSH # SEQEFAMAEWVLSVAGVIIGVKITAKAATSFDPFIQVCPIDITSCTLSGDVRSLSEGGLRSYKPSTPYVLPDIQRVSATIHEDAPREVRIDFKTCTTP # NLPIVMKPVSNPPLVANPQYANPETDYFAGTISVFNKHKVSSMEPISIASVAAFYRLVGEEKYQPVKSVELLDGITLPYSIDPRQTLTLQFGVVVPRS # EDDVKVGTRWWNRAFVARQRPLRIKLVLTDIDEEECSLVLDYVCPVSNLETADKEDLAYFYVDDPLTWKRYGVHIAKDSRMGPEAVKIGNESRGADWM # KSIVYKALKTGESEIALDVGADNDQGMPTAWSWKTWALVDLSCRRLYAFKILLTKSHGTAQSYACMGYVKCPVYGGFYEESRPIRYATEVTKFPELKP # YVPSRILLDDEFDTFVPSEALKPTVASSSTQLAIPDEVQQRLVSIENSLSRLAISIELLVEIMKTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g286 ### # start gene g287 6 AUGUSTUS gene 760583 762455 0.27 - . g287 6 AUGUSTUS transcript 760583 762455 0.27 - . g287.t1 6 AUGUSTUS stop_codon 760583 760585 . - 0 transcript_id "g287.t1"; gene_id "g287"; 6 AUGUSTUS CDS 760583 761893 0.42 - 0 transcript_id "g287.t1"; gene_id "g287"; 6 AUGUSTUS CDS 761967 762455 0.27 - 0 transcript_id "g287.t1"; gene_id "g287"; 6 AUGUSTUS start_codon 762453 762455 . - 0 transcript_id "g287.t1"; gene_id "g287"; # protein sequence = [MASLCKVLWIFQDRLVPPNVKLNKLNQKVKWKQWKLRVPTEIEPIEPRHPSGKLLISMNSSGIGGSNAHVLVESHELN # VALPNEIPSNYPVLLLAGALSDSSTSAVAKQLVALADGNKDIAALSLAFGRRSMQMNWRSFSVTLPGATPIFSSPRFIPRNRPALGPQHIAMGRQLFN # QFPVFRSSILELDSVYAAVVGQSMIARTGLFSNDVSAQKLPAVWPIEITLPAIAMVQLALIDLFQSVGIAPDAVVGHSAGETTMLYASGATSKALALE # IAIARGLAVAELEALEGSMVAFSCDPIVADDIINEVRASIDAPKMILDVACYNAETAVVLAGHVLLLEKAKEIAKARNIMVNQIATRVPFHSTMMEAC # KASYLKRVSEVFAKYRAEDCIPKIPAYSTMTGEIWNVAFTADYFWDNARSPVEFLSAINSILVDMPNATFLEISPHPVLSSYVSSIRGSADVVFCGMR # RKREYPQFGEYTQMMETIGGLAVTGYDSIDIRALTGVRSPPIPSPFKYPFSKKEVPVYSDVCRTSLDHMDATYRGPLCSSPLRINSSTHPDLTQHVIN # SQPIMAAAGFLEMVRLIYSFVSVSDSDITGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g287 ### # start gene g288 6 AUGUSTUS gene 772614 773291 0.4 - . g288 6 AUGUSTUS transcript 772614 773291 0.4 - . g288.t1 6 AUGUSTUS stop_codon 772614 772616 . - 0 transcript_id "g288.t1"; gene_id "g288"; 6 AUGUSTUS CDS 772614 773291 0.4 - 0 transcript_id "g288.t1"; gene_id "g288"; 6 AUGUSTUS start_codon 773289 773291 . - 0 transcript_id "g288.t1"; gene_id "g288"; # protein sequence = [MAVDTKLKFVQNYIKVTMTVTVHPTEYRNGHSFLSFKKNAGSSNFTLSLATSLGAGLQIQNSYFLILSTMKTHISQFP # LSLLKIRFLRTILTMLLLCSALLVTIASASPLPPFPEHSELVFSAADPNVSLTSIEGYEHAVNVEHGTYVVGSDSHQPAAVDDEYEDDLNAITTDQLQ # LYPRGVGKVLNKFNDGVKRVFNPLSSDWKLLGFAYTKPVSQLFAVPIFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g288 ### # start gene g289 6 AUGUSTUS gene 777497 778636 0.46 + . g289 6 AUGUSTUS transcript 777497 778636 0.46 + . g289.t1 6 AUGUSTUS start_codon 777497 777499 . + 0 transcript_id "g289.t1"; gene_id "g289"; 6 AUGUSTUS CDS 777497 778636 0.46 + 0 transcript_id "g289.t1"; gene_id "g289"; 6 AUGUSTUS stop_codon 778634 778636 . + 0 transcript_id "g289.t1"; gene_id "g289"; # protein sequence = [MAAQQPLTRFSGDPDDPVQPATFLQDFEVRMTELMTPRADLASRIKPYLERDSRAWEWYTEDLTATDRTGSWEGFEAK # FHLRFPSQKKEKKSAKSYLTSLEAERITHEQIMTTSDDTNQPYHQWWADRLLRLAKGAEVEKTKQSIGTVWRNLPYALKKAIDEEHNTWMEFTDAIKK # VKWSVLKVEAEHESSKVVPLVVPETPRTKLATSFAAARIARPPSPSPSRTRPTYGTNTGARRPRRLFTALDELQRSTLRRGIAAKIQHPNTPEGVAAW # KTELLEWASRHGVDGALSEITIVPLKPGTEAVCSGECFKCGGPRHGFETPCPKPGAIPPVESDWRAYCQRELGGRPARVNAVQLVGPEAIFEGMVDSG # NGEGLAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g289 ### # start gene g290 6 AUGUSTUS gene 778765 783408 0.58 + . g290 6 AUGUSTUS transcript 778765 783408 0.58 + . g290.t1 6 AUGUSTUS start_codon 778765 778767 . + 0 transcript_id "g290.t1"; gene_id "g290"; 6 AUGUSTUS CDS 778765 783408 0.58 + 0 transcript_id "g290.t1"; gene_id "g290"; 6 AUGUSTUS stop_codon 783406 783408 . + 0 transcript_id "g290.t1"; gene_id "g290"; # protein sequence = [MNIGLRDSEGKQAAVEAMVDDGAMVAAMDTRVYENLRSELGGWRPTKRKFRMANGTVVPGETSWVGRIDVQGVEVDGE # FEVFDSGGSWKFLFGKPLLERFSAVHDYGKESLVLHGKQGSWREVFNGGLGAVVAPEPTPVLEDRSQQGMPRPTAQAQVVLEESVGPAGGVIVKALTP # LDREVDNLCCDKQNSVANTARQRQPEATILSKHHAPQIEEVPDEDFAQTRSNLSAPEHPLGWEEDTDDEEWQMTEAELEGWYKELRRLHREESIKRQE # ELELRQQERRKIWEEEEERREADWVAWLRRQRAEPGLRKWFFWRNRLRDPSPPRRLRVDSLGGSNAPPSREVSADAGGTAAHHIDHMSAERQPHNATN # PTTETTSGASRREGTGDNTENMPDGSRVDSVGGFDVPPSREVLSEDSGANPQHADRSRTVPICVLQANEDYPSHSDVGLDFFPDALDQSEDVHLFTRN # DGEKGAFRPERVREILRKVKIGPNLSAVQRSRVEQLLSDYADCFALSVGEVRPVKDAVHRLNIPEGATFPKKVRQKSLTPPQREYLHAKVDELLEAGV # IERCNPEEVKCVSPLTLAQKAHEGKGLTVEELMYKLNDECVAAGLPASFDLPTRPVQPSEPTERTESIKPAKWRICQNFMAVNKLTEIAPMPQGNIRS # KQQSLSGHNYICLFDFASGFYACEVERESRPYTAFYVEGKGYFWCAKLPFGLTGAPSTFANMTALHLDDLIADGTIELFVDDGGSADDDFDTMFTKLT # RILDRVRSRNLSLSAAKSEFFMSEGIFAGGKVSKDGVTVDPAKLTAVVEWKQPEDALNLASFVGLTGHFRDLIRNYARIEGPLRNLLKSVPLPQNYTK # STYRKAMESFKLADKWTLDHTKAFLALKKALVSEPVLKAPRWDGSSFIVTTDGCKEGFAAVVAQRFEVVHPNGTTTYKTHPVGFASKRTSTSEQNYKP # FLLEFAALKFGLDKFSDMIWGFPVEIETDCQALRDVIANDKLNAAHSRWRDGVLAHHIVDVRHIPGKLNVVADGLSRMWEGHDRKVGDGSEWTVSEDW # EAVTGLVNDVFGVRMAEGLMESGDVTDWEALLRRFEGEPVFREVLNALRVLEGPADEKEKQKAKHKAARYMVEDNRLWKVGGNDGIRERARVECVTRK # EAMELARVQHGDAGHWGRDSVKLALMDRIWSPKLDESVLEAITSCPECKNFGAAHIHALLNPITRRHPFELLVGDYLSMSKGKGGYKTVGLYLDTYSQ # RVWAFKFKVAGSGATTTSSLTSLFNGYLPPETFMTDNGSHFANKEVETLCAKWGTKQHLTPAYSPWVNGLVEGTNKILLHVLKRLCAPKLGEDSEEFQ # GMNWETLPEKWPEHLDEAVRIINNRILPSVKFSPNELLLGAVVNTRRTPVTDATSVLPQRQVEIQTAYVAQQQLDGYSAFVQHAVKRKRVFDRRVLKK # EGKEVVFRKGDLVQVYRSDLDYTFKTIKKIIPKWSRPYRVVERNVNSYTLQTTDGQLIEGKQFAARRLREFKPRAGTKLALEQQEVVRRREKSEVST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g290 ### # start gene g291 6 AUGUSTUS gene 793125 794519 0.66 + . g291 6 AUGUSTUS transcript 793125 794519 0.66 + . g291.t1 6 AUGUSTUS start_codon 793125 793127 . + 0 transcript_id "g291.t1"; gene_id "g291"; 6 AUGUSTUS CDS 793125 794519 0.66 + 0 transcript_id "g291.t1"; gene_id "g291"; 6 AUGUSTUS stop_codon 794517 794519 . + 0 transcript_id "g291.t1"; gene_id "g291"; # protein sequence = [MNAIEQPPEKRSNVFSGSPPRNNPNPNVNVNTNPPPTTNSAKPPSSGTHSQPQPKPLNAPTQPPAGQPAQPVPPSNLA # NLPPPNSTQKIPWPGIGNLTPNELFQRLRHFEDMRRRTDAVLTQAINSGDSSKVEMVKQQTAQWEPMFFKVRNMVSHYITALRRAGMAGPGAPGGAPG # QVQASTSTGVGAPTNNLNPNPGNTDISSQPPTTQSNPHPNPPSSSNVASSPATKPNDSLMPVNSSITSATSPGLSAPALSSSTPSKSPSKPSPKPSAI # KPSPKPKPKGSPIKNAASTVSTAPSIGASSTAGSSTSTNPAVDGSGPNLASGLPIPSSLPPEAALQMQKLMEQGGRGHPRDMAMGSMGQVSPNVTAAG # VAPQPSPQGMQGMMPGQGQSGQQPQVGGVVGPAGVGAMSSGSVSNTPSTSAGGQNGGIPAWTGGLFYPGEPNGTRKDFRISVMAMSANHLEW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g291 ### # start gene g292 6 AUGUSTUS gene 795020 795796 0.81 + . g292 6 AUGUSTUS transcript 795020 795796 0.81 + . g292.t1 6 AUGUSTUS start_codon 795020 795022 . + 0 transcript_id "g292.t1"; gene_id "g292"; 6 AUGUSTUS CDS 795020 795796 0.81 + 0 transcript_id "g292.t1"; gene_id "g292"; 6 AUGUSTUS stop_codon 795794 795796 . + 0 transcript_id "g292.t1"; gene_id "g292"; # protein sequence = [MPGGLLGRLPGGVSGESIGAPPAGGAGGGGPTPGTNIGPPNILAILQSFRVPPDLTARILQMPPERQIMALKSLAQTK # AQLRGQGPGQGGAASGSGQAGIAGMHKSGGSNVNITAAAAAMALRMQQSGGIGIPQGMQGGMQGTSGLNMAGIQRQLSGQDGNKPNPQGAANIAALIN # GMRGNMGGMGGMNAANMGGTAAGNMFQQQMAQMQQMQQNRSIFGGPAGTGAGGVGGKNLSLDMIQSFMHRNGQEGQGGGQGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g292 ### # start gene g293 6 AUGUSTUS gene 796789 797385 0.65 + . g293 6 AUGUSTUS transcript 796789 797385 0.65 + . g293.t1 6 AUGUSTUS start_codon 796789 796791 . + 0 transcript_id "g293.t1"; gene_id "g293"; 6 AUGUSTUS CDS 796789 797385 0.65 + 0 transcript_id "g293.t1"; gene_id "g293"; 6 AUGUSTUS stop_codon 797383 797385 . + 0 transcript_id "g293.t1"; gene_id "g293"; # protein sequence = [MSSQTSEPQISGFQETQISRSFFHSFALDPRITFPIEAGMGIPQPLVNESNIASHELSPNANKRHRTCSIPPESSPPI # NPTLSPDSGNDTLSISSALSSDDISTLQAELDEEDLDHETHSIRRALQEAMQASNSKKDNYSRHVSRYVSFIEVERERRSQEHPNRKSNLTTEPITVA # KVALFLNFETTRPKVFTDLLFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g293 ### # start gene g294 6 AUGUSTUS gene 799003 799782 0.7 + . g294 6 AUGUSTUS transcript 799003 799782 0.7 + . g294.t1 6 AUGUSTUS start_codon 799003 799005 . + 0 transcript_id "g294.t1"; gene_id "g294"; 6 AUGUSTUS CDS 799003 799782 0.7 + 0 transcript_id "g294.t1"; gene_id "g294"; 6 AUGUSTUS stop_codon 799780 799782 . + 0 transcript_id "g294.t1"; gene_id "g294"; # protein sequence = [MEARISINDRWYVHSELLLYLQLTNVYPEAILLSANTNSPNFRTLGAASLSYPLLGPAPSSLSALQHHPTLTSIIQPT # STAASFAPLNPGVLIQPNSPNDSLNSNEQRSWTELIQRYGEAKLHKHKPWEWNSECKEHLPSYRYQKPSTLREYWGELTIGLNGYISIQELNNWWEAH # WRQNISGLKTDKCWYDRVEQLINTLRSRDNWTINLVWHFLDDQFPIPTEEVPHLKTTRSFITYIQKKDSSGMNDVLTAANSYP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g294 ### # start gene g295 6 AUGUSTUS gene 802832 803998 0.89 + . g295 6 AUGUSTUS transcript 802832 803998 0.89 + . g295.t1 6 AUGUSTUS start_codon 802832 802834 . + 0 transcript_id "g295.t1"; gene_id "g295"; 6 AUGUSTUS CDS 802832 803998 0.89 + 0 transcript_id "g295.t1"; gene_id "g295"; 6 AUGUSTUS stop_codon 803996 803998 . + 0 transcript_id "g295.t1"; gene_id "g295"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPSQDFSNQIGQIRELLD # RANTMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g295 ### # start gene g296 6 AUGUSTUS gene 804049 805185 0.82 + . g296 6 AUGUSTUS transcript 804049 805185 0.82 + . g296.t1 6 AUGUSTUS start_codon 804049 804051 . + 0 transcript_id "g296.t1"; gene_id "g296"; 6 AUGUSTUS CDS 804049 805185 0.82 + 0 transcript_id "g296.t1"; gene_id "g296"; 6 AUGUSTUS stop_codon 805183 805185 . + 0 transcript_id "g296.t1"; gene_id "g296"; # protein sequence = [MFATSSYDSHLSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g296 ### # start gene g297 6 AUGUSTUS gene 808250 809390 0.42 - . g297 6 AUGUSTUS transcript 808250 809390 0.42 - . g297.t1 6 AUGUSTUS stop_codon 808250 808252 . - 0 transcript_id "g297.t1"; gene_id "g297"; 6 AUGUSTUS CDS 808250 808564 0.84 - 0 transcript_id "g297.t1"; gene_id "g297"; 6 AUGUSTUS CDS 808739 808842 0.42 - 2 transcript_id "g297.t1"; gene_id "g297"; 6 AUGUSTUS CDS 808937 809390 0.89 - 0 transcript_id "g297.t1"; gene_id "g297"; 6 AUGUSTUS start_codon 809388 809390 . - 0 transcript_id "g297.t1"; gene_id "g297"; # protein sequence = [MFTISHSSSIVQQITTSSSIRDSSFNPSQTLSKASDLKHVLIPPTPTSNIHLAQTLKHPDITQTPLTPYLRSMVTVSL # PNSGVCCDQCSSSVLPLQLKLLINNTWFQEQGLCHSQVITVPYVDEPKCGPKEYNVKFSDIYDSLQQMHTALDDYGQILMKGDFHAMVPSADVLIVPP # SKILKLNVTLTCTSSASIYMSQLLNDLNSKPLEIAESRNRRGPKSTMVNELVIQASQLPGYKTFKAGHDRVLQYEQVAAHWEFAATFSATHFHQVCPI # TVCYIVHICHEAAEAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g297 ### # start gene g298 6 AUGUSTUS gene 812488 813769 0.13 + . g298 6 AUGUSTUS transcript 812488 813769 0.13 + . g298.t1 6 AUGUSTUS start_codon 812488 812490 . + 0 transcript_id "g298.t1"; gene_id "g298"; 6 AUGUSTUS CDS 812488 812652 0.89 + 0 transcript_id "g298.t1"; gene_id "g298"; 6 AUGUSTUS CDS 812706 813108 0.51 + 0 transcript_id "g298.t1"; gene_id "g298"; 6 AUGUSTUS CDS 813205 813362 0.25 + 2 transcript_id "g298.t1"; gene_id "g298"; 6 AUGUSTUS CDS 813440 813769 0.56 + 0 transcript_id "g298.t1"; gene_id "g298"; 6 AUGUSTUS stop_codon 813767 813769 . + 0 transcript_id "g298.t1"; gene_id "g298"; # protein sequence = [MSFETASTFTCKSQVFCFTTKYSLSIFKVETIQTKYAIEAISINEDTDHDEIIWNVHDFTKRKSGSVRLFIVTPEQFF # RNSAGHYSRWGEYIRDPRFGTRINIMIVDEAHCVATQGIAQYGLPAFRPAYGRLNELHVILGPHFRTAALTATAPPHVHKVICDKILHHNYVLITASS # NRPNTIYATHTVVDATVDLASHLNKLLPLEFRDRGVVRHYHSNMSCDYLTKTHAAFVEDGGDCRVLGIDFMKVKIVCIAGLPKSSAMVLQMFGRVWRQ # MDSYGLAILFIDPWVHELAFSDFNGDIDDLDRPAGILKTTSSAYDRAPFSFVALVQTVLCLRLFFSTYLNDLSAQGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g298 ### # start gene g299 6 AUGUSTUS gene 814063 814416 0.28 + . g299 6 AUGUSTUS transcript 814063 814416 0.28 + . g299.t1 6 AUGUSTUS start_codon 814063 814065 . + 0 transcript_id "g299.t1"; gene_id "g299"; 6 AUGUSTUS CDS 814063 814416 0.28 + 0 transcript_id "g299.t1"; gene_id "g299"; 6 AUGUSTUS stop_codon 814414 814416 . + 0 transcript_id "g299.t1"; gene_id "g299"; # protein sequence = [MITSLVRLKAGEITNASQITSLLSQTAEWASKWERGIFEVITTFDQHVFSLATAKRTSKKAKTANSAYPSAEIIGDSD # IEDEGMEAFLHKEAETRKVAKARADTNSCQVLKNKVNLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g299 ### # start gene g300 6 AUGUSTUS gene 814468 816279 0.56 - . g300 6 AUGUSTUS transcript 814468 816279 0.56 - . g300.t1 6 AUGUSTUS stop_codon 814468 814470 . - 0 transcript_id "g300.t1"; gene_id "g300"; 6 AUGUSTUS CDS 814468 816279 0.56 - 0 transcript_id "g300.t1"; gene_id "g300"; 6 AUGUSTUS start_codon 816277 816279 . - 0 transcript_id "g300.t1"; gene_id "g300"; # protein sequence = [MHHASLTPSYPTIANTWKYIADSSIKEAKQVADEYPTGEAWDNVNLSSSEYITQRPGAMAKVQSGTLPLVYKLHNAKW # DDMLLKPMIDALKVSSELTLGDINPTDDALASYAHQACINIIQALTKYVNNFSVDRYTKHPLLQHKHRRSLPRDLKTEFWVLRLNTHEEASVQGNLKV # QDNIHEEQLKQDVGDSSKLALYAKPLFADLLTLIRTRGCMHVRRGDTNPWTRREVYQNGMGMLHFLMNLVWVVLHTYRGEVRQLGSLKNFFAKLEKKR # LDNDKPDYYTLLAAFNEILDGLLLYAWQKKCGFSSLKKFAQSNPLPEDLLRIAMNILGSFASAQNMDDEGDSDDVDSDESDESTSTNTPKPEIDLVFS # NTCLLIRDLLYVREIVQATSDGDFGRIEDLFPDMLRIFHGAGSNNYANEILHWIHRVKKMWTPAFANIMRDNMLIRVGGNYMGIDMNIEHLIKEIKRL # ATAKGIYSDWVRFGHLSACLKEIHCIKNNVATDFQLSYKNKTSKEVDTQMLVWRVVKHASANDLLTFNADREGNNTCKSFVDIHAKGHKLLETSSLKT # FNKKMHAYIDGMPFEEEEDDIPLAEYESNIGIDVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g300 ### # start gene g301 6 AUGUSTUS gene 816400 817403 0.52 - . g301 6 AUGUSTUS transcript 816400 817403 0.52 - . g301.t1 6 AUGUSTUS stop_codon 816400 816402 . - 0 transcript_id "g301.t1"; gene_id "g301"; 6 AUGUSTUS CDS 816400 816992 0.92 - 2 transcript_id "g301.t1"; gene_id "g301"; 6 AUGUSTUS CDS 817040 817403 0.53 - 0 transcript_id "g301.t1"; gene_id "g301"; 6 AUGUSTUS start_codon 817401 817403 . - 0 transcript_id "g301.t1"; gene_id "g301"; # protein sequence = [MSGKRQGRGPARALPGTGSFRLSENPGLSQNPIPANIPTITPVQRPQSPNPWDDRTSVFSVQPDITAATSTSRIPRVP # WPGELSTTQVSFSNQPTAAFTSDYDDLSAGDVNNDSLMGESIYYYSDNSPFTTTQSVPLSYSSSQHRSRTIPERIHEVLHALQKAHFSPTEFQALLYS # PETSEFASYRRKLFENGNSGHLESFLDGIWNDPQGQPVLEKWFNNHAANHIDSVAKLVAKEFEDVKPLLKMQSQQITSEYMANWSMSQTMEPLLSNHF # PVWSKILDSISESPRAKSEGGLRSEHRIKVGFLGFLIVLFTHIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g301 ### # start gene g302 6 AUGUSTUS gene 818242 818583 0.99 + . g302 6 AUGUSTUS transcript 818242 818583 0.99 + . g302.t1 6 AUGUSTUS start_codon 818242 818244 . + 0 transcript_id "g302.t1"; gene_id "g302"; 6 AUGUSTUS CDS 818242 818583 0.99 + 0 transcript_id "g302.t1"; gene_id "g302"; 6 AUGUSTUS stop_codon 818581 818583 . + 0 transcript_id "g302.t1"; gene_id "g302"; # protein sequence = [MNSNQQNEDEREQGGNHDRQTRAQVEQETHTRREAPLEPEQEEIRISRRARSGLEEHQDAEASDSQKKPKANVGKFKW # NDANSFLKSIFTLTPAHQMVWEQVRNYVADIKESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g302 ### # start gene g303 6 AUGUSTUS gene 820989 824669 0.98 - . g303 6 AUGUSTUS transcript 820989 824669 0.98 - . g303.t1 6 AUGUSTUS stop_codon 820989 820991 . - 0 transcript_id "g303.t1"; gene_id "g303"; 6 AUGUSTUS CDS 820989 824669 0.98 - 0 transcript_id "g303.t1"; gene_id "g303"; 6 AUGUSTUS start_codon 824667 824669 . - 0 transcript_id "g303.t1"; gene_id "g303"; # protein sequence = [MIDSGATGLFLHQKFVNKHHIYVRSLPRPIELYNIDGTTNLAGRITHSARLLARVDQNQPQILEFLVTNIGSEDVILG # LPWLRKINPDINWRDGQIQIPAKPKVQHHVAIEEIPEPKEPNVGGNTEQILEPNRAESNGLPHTVPRTELGPETAETGTSLEDELVFEESGSPLYRLT # GNRKRRRAWLRAGFIQEVTEELWCAAGYTYSQQLAEAANKDKPQKTFEEMVPEPYRRHAKVFSEKESERLPEHKPWDHAIDLKPDAPKTLRTKIYPMS # VNEQKELDRFLEDNLRKGYIRPSKSPLSSPVFFVKKKDGKLRFIQDYRRLNEYTVKNRYPLPLVADIINCLRQAKYFTKFDVRWGYNNVRIKEGHEWK # AAFSTNRGLFEPLVMFFGLTNSPATFQALMNSIFADLIAAGKVAVYLDDILIFSASLQEHRKIVHEVLERLAKNDLYLRPEKCEFEQTSIEYLGLIIS # EGEVRMDPVKVEAVKNWPAPTCLRDVRGFLGFANFYRRFIDGFAKKARALNDLTKKGVGWSWGTNEQVAFEALKEAFTTAPILVLWDPDKPTRIKVDA # SGFATGGALLQQQGDGLWHPVAFRSASMDPAERNYEIYNREMLAIIEALKDWRHFLEGLPNPFEIVTDHRNLEYWRTAQDLSRRQARWALWLSRFDFT # LTHRAGKANAQADALSRVSQLKVMDADDNQQQIVLRPEHFLRAATAVLFQNPLEERIRKASERESEVLEGLRKLKTHGPHKLVNGLAEWEEKEGIVYY # KGRVYVPPDPQLRRDVVAQCHDALTAGHPGKHRTLELVSRQFWWPTVRSFVDKYVEGCDNCQRRRVRPQPRSSLQPLPVPGGPWQDIGVDLIGELPMT # QDGHNAAITFTDHYSKMIHCFPTTTELTAEGVADFYYKEIFRLHGLPRRFISDRGPQFAADIMKALLKRLGIESALTTSYHPETNGQTERANQEIERY # IRMYVSRRQDDWDRLLPTAKFVINSRVHFAHDKAPFEVLYGYTPEFSIPIGSWKEYPSITDRLDALRHAREDAEAALRMSKQRIADTIAEHPNQPSFE # VGQPVWLSVNNLKIRRKSEKLGSRRLGPFEVIEKTGAHTYRLALPPWMKIHDNINVKRLAPWKGNEVNGILPAPPEPEVIDGEEFYDVDRILDSRIHG # RWKKLQYLVRWKGYDEGHDIWENEENVVGSSDEAINEFYAAHPNAPRKISATIFHSLPWQPMVNFTEVNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g303 ### # start gene g304 6 AUGUSTUS gene 825934 826365 0.85 - . g304 6 AUGUSTUS transcript 825934 826365 0.85 - . g304.t1 6 AUGUSTUS stop_codon 825934 825936 . - 0 transcript_id "g304.t1"; gene_id "g304"; 6 AUGUSTUS CDS 825934 826365 0.85 - 0 transcript_id "g304.t1"; gene_id "g304"; 6 AUGUSTUS start_codon 826363 826365 . - 0 transcript_id "g304.t1"; gene_id "g304"; # protein sequence = [MSSAQDVRDAITELTKNQAKLQDVVSELVSGLSTTKSVGKPQNYNGKRGEDARRFLAAFELWANSIPALSTDRKKKIT # SAITYLEGDAAIWATPISETINRSSITGSGVPFPYDTWEEFVTAFKTRFETTDASADAKQLLKRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g304 ### # start gene g305 6 AUGUSTUS gene 833723 834310 0.85 - . g305 6 AUGUSTUS transcript 833723 834310 0.85 - . g305.t1 6 AUGUSTUS stop_codon 833723 833725 . - 0 transcript_id "g305.t1"; gene_id "g305"; 6 AUGUSTUS CDS 833723 834310 0.85 - 0 transcript_id "g305.t1"; gene_id "g305"; 6 AUGUSTUS start_codon 834308 834310 . - 0 transcript_id "g305.t1"; gene_id "g305"; # protein sequence = [MNTNLAYGSNISSGTSPQARGTPIALELEGRQPGNDKPTAPMGAHSPSQTAQIRFVEKYGHTESGAPQGFKAGAPNCV # DELLKWMFENWQPNTQYALTYVNSFYEVLSDGFAQPPDIFEFYVSGFAECFAKTAFVQDPKNPRKSIPPPPSCRVVVKSNKLKGKITVYQEDMKKGTS # MLFSKELPENLWRPGKTIY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g305 ### # start gene g306 6 AUGUSTUS gene 844616 845374 0.49 - . g306 6 AUGUSTUS transcript 844616 845374 0.49 - . g306.t1 6 AUGUSTUS stop_codon 844616 844618 . - 0 transcript_id "g306.t1"; gene_id "g306"; 6 AUGUSTUS CDS 844616 845374 0.49 - 0 transcript_id "g306.t1"; gene_id "g306"; 6 AUGUSTUS start_codon 845372 845374 . - 0 transcript_id "g306.t1"; gene_id "g306"; # protein sequence = [MHGEWRDSTYAEYTKFPLENCIPLDEQRLLGPVEAGGLGYCVEDLMHISKLVVPYGGLNDIGLKPGETVIIAPATGPF # GSAAVRVALAMGAGRVIAMGRNETMLHKLSTLDTRIFTVRITGNEKTETDALKKLGPIDVFFDISPFMAANSTHFKSAIAALRHSGRISLMGGVYADM # SFPYLSFMHRNLTMKGTWMFSREQMFAFVKLLESGLLPLGEKNGLSVGGKFELEEWEEAFEKARVAGAGEVVVIVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g306 ### # start gene g307 6 AUGUSTUS gene 845851 846735 0.49 - . g307 6 AUGUSTUS transcript 845851 846735 0.49 - . g307.t1 6 AUGUSTUS stop_codon 845851 845853 . - 0 transcript_id "g307.t1"; gene_id "g307"; 6 AUGUSTUS CDS 845851 846735 0.49 - 0 transcript_id "g307.t1"; gene_id "g307"; 6 AUGUSTUS start_codon 846733 846735 . - 0 transcript_id "g307.t1"; gene_id "g307"; # protein sequence = [MTEMVLNFIDYQAVVEAKASEKDRQGSDVDTDVDMDDIPQPGPSSAPLFVQQTINDIRSTSSSFLVSTSPIKSSSKPP # IFHTNRISPKKADSRYKDLLMFPACTPYELRLQNALLESEARDSTRKDALMEAQAGLVLSNLYSVQVNRQLQAKEEKKSTKGKKRLMGDGKAKLFTGD # EFYQLCVDDEQQRQEDIENANKRRDARQAQAEKISEWKKDNEAIKERNKAKKEEFSVAVAAWEAEKEMAKAEKRKPKWNKPKWKDYNPEKMKPRPKKS # AEDDGDDGDENSGSDDDDSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g307 ### # start gene g308 6 AUGUSTUS gene 847284 848105 0.37 - . g308 6 AUGUSTUS transcript 847284 848105 0.37 - . g308.t1 6 AUGUSTUS stop_codon 847284 847286 . - 0 transcript_id "g308.t1"; gene_id "g308"; 6 AUGUSTUS CDS 847284 848105 0.37 - 0 transcript_id "g308.t1"; gene_id "g308"; 6 AUGUSTUS start_codon 848103 848105 . - 0 transcript_id "g308.t1"; gene_id "g308"; # protein sequence = [MVGRAHSERQKHRAHSALVEKYMLQAIDLYKTKHEKEHGMSLKNVCNFIAQQCYVDTKQIIKLSDSTLYRRVNNGHSH # KEAKEEQRWLNDEEEEVLIGEVIYWGDRGFPLDHRRLKEHADEIARARHGSSFPINGVGKCWTRRFISDHNERIGMYWTHSLDNSRARAVNPFNHEHY # FHLLGKVIEGEGGDDVIRKDLTYGADESGLQKGVGQKTRGLGGAKKKIQHQQRSGDRENITVLVTICGDGTSIAPAVIYKGEGFQARWKQDNPLNAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g308 ### # start gene g309 6 AUGUSTUS gene 852325 853242 0.81 + . g309 6 AUGUSTUS transcript 852325 853242 0.81 + . g309.t1 6 AUGUSTUS start_codon 852325 852327 . + 0 transcript_id "g309.t1"; gene_id "g309"; 6 AUGUSTUS CDS 852325 853242 0.81 + 0 transcript_id "g309.t1"; gene_id "g309"; 6 AUGUSTUS stop_codon 853240 853242 . + 0 transcript_id "g309.t1"; gene_id "g309"; # protein sequence = [MYRLGYQKKGYTDGEIGQAWIEDFDKQTRSKADGRYRLLLVDGHNSHYTLEFLQYARENKIHILCYPSHSTHIYQGLD # VVIFSLLKRAWSDERDHYERNYGKVTKTNFMATYAKAHVQAFTESNIKAAFRKTGIVPFNPDVISEQAMAPSLESSTSATRLMPLGVMSPVKEIAALI # SSHQQLKQKASEISGSPGGFDSQPHTPTRRARITAVVDSVSRLSSTSAAFLVSSSPIRSTSHLPQLATTLISPPQNRNAELLARKPMTEYEAQLQAAL # LRSNNQLNLQNEWMMSMQAQNVLQDWYAREV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g309 ### # start gene g310 6 AUGUSTUS gene 853444 853809 0.84 + . g310 6 AUGUSTUS transcript 853444 853809 0.84 + . g310.t1 6 AUGUSTUS start_codon 853444 853446 . + 0 transcript_id "g310.t1"; gene_id "g310"; 6 AUGUSTUS CDS 853444 853809 0.84 + 0 transcript_id "g310.t1"; gene_id "g310"; 6 AUGUSTUS stop_codon 853807 853809 . + 0 transcript_id "g310.t1"; gene_id "g310"; # protein sequence = [MIRYDAEVKGIEEKNEQTLKEWEASVQEWEKERDIARTERRKPAWTKPSKPTYTSGALVKPPAKPKLADFLPAQRIAP # SGNQRNAIRYTEDGCGSESDKGSDSEDDDDEDEGEDEGGGSDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g310 ### # start gene g311 6 AUGUSTUS gene 856243 856518 0.86 - . g311 6 AUGUSTUS transcript 856243 856518 0.86 - . g311.t1 6 AUGUSTUS stop_codon 856243 856245 . - 0 transcript_id "g311.t1"; gene_id "g311"; 6 AUGUSTUS CDS 856243 856518 0.86 - 0 transcript_id "g311.t1"; gene_id "g311"; 6 AUGUSTUS start_codon 856516 856518 . - 0 transcript_id "g311.t1"; gene_id "g311"; # protein sequence = [MHLPPTKGERYEFHFPGIDITGNEYSLLGASNFEKNFLGEGMDFASDDGMDSDWVPTLDNDTSSSESDLEANSEISDD # ELEEYKSLPSWFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g311 ### # start gene g312 6 AUGUSTUS gene 862614 863993 0.61 + . g312 6 AUGUSTUS transcript 862614 863993 0.61 + . g312.t1 6 AUGUSTUS start_codon 862614 862616 . + 0 transcript_id "g312.t1"; gene_id "g312"; 6 AUGUSTUS CDS 862614 863993 0.61 + 0 transcript_id "g312.t1"; gene_id "g312"; 6 AUGUSTUS stop_codon 863991 863993 . + 0 transcript_id "g312.t1"; gene_id "g312"; # protein sequence = [MHRLLTFKGYRFRDFARPSQSQPTAANANLKSAVELEEEDRAAQSAKLQELIRRGTPRDLAAAQELMKSLAGADPEAK # PDYKTQALHEINKLESKVVLMNEMLDNVDMERGEKFVEGDAYDQVAEILRVARPKLQKWASEVDVESHDSESLGGWYLIYLCKAMFLIVTITDTFLQM # NDQINTVLNRYEAFKKGDYSFAANPIPAELSNAGSASAGTGLSLIDFDDSTNGTSATISTPTNTTTATSNSGGDLMGLFGAPAPAATRPSPLSSLSSL # SHPMSNAMPVMESRIGLGLPGMHVGTPTPPIPSTFTPPNYSSPSSAPVVASTPPIGVMHGTGGAGMGMGMNSALGYGSPFGPSGNVGPRNSSPAPAAP # HTPNYFSGPAGSGTVGVNMGMGMGVARIGTPSTPQTMQPMNAMGSMQSSQSSQLMQTQLPAQNGSSMSSQPPATQAKDPFADLAGLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g312 ### # start gene g313 6 AUGUSTUS gene 876580 877497 0.99 + . g313 6 AUGUSTUS transcript 876580 877497 0.99 + . g313.t1 6 AUGUSTUS start_codon 876580 876582 . + 0 transcript_id "g313.t1"; gene_id "g313"; 6 AUGUSTUS CDS 876580 877497 0.99 + 0 transcript_id "g313.t1"; gene_id "g313"; 6 AUGUSTUS stop_codon 877495 877497 . + 0 transcript_id "g313.t1"; gene_id "g313"; # protein sequence = [MYGGVGCVGTPIVRTDAAALWATGKTWWQVPRMIRVELKGRLRAGVTGKDVIVALCGAFGKDEVLNGAVEFCGEGVES # LTVEERLTIANMTTEWGALSGVFSVDRTLVDYYDGVVDKLERRTFGGEGIPPPPEHPRLNRTRVDSLRQTHSTSFVSDPAATYALRLSFDLSSLVPHV # SGPNSVKIATPLPKLEDKSVQVNKAYLVSCTNSRVGDLKSAADVFRGYETPSSSASPVSASASPDVSTIKYHVHPSVQFYIAAASSVVQAESEARGDW # DVLVRAGAKVLPAGCGPCIGLGVGLLEEGEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g313 ### # start gene g314 6 AUGUSTUS gene 879555 879905 0.63 + . g314 6 AUGUSTUS transcript 879555 879905 0.63 + . g314.t1 6 AUGUSTUS start_codon 879555 879557 . + 0 transcript_id "g314.t1"; gene_id "g314"; 6 AUGUSTUS CDS 879555 879905 0.63 + 0 transcript_id "g314.t1"; gene_id "g314"; 6 AUGUSTUS stop_codon 879903 879905 . + 0 transcript_id "g314.t1"; gene_id "g314"; # protein sequence = [MVVKSLNHLPIPTSANNGPRSVSTRRYVAGVVFGIFFFLQLGRYAFDLGKNLDITVDDVTSWTHNVNAAHFCPQVTAL # YPQSSVNAETWTEFGELLETEKFKTLAIEKLSGLIQIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g314 ### # start gene g315 6 AUGUSTUS gene 881245 881778 0.59 + . g315 6 AUGUSTUS transcript 881245 881778 0.59 + . g315.t1 6 AUGUSTUS start_codon 881245 881247 . + 0 transcript_id "g315.t1"; gene_id "g315"; 6 AUGUSTUS CDS 881245 881778 0.59 + 0 transcript_id "g315.t1"; gene_id "g315"; 6 AUGUSTUS stop_codon 881776 881778 . + 0 transcript_id "g315.t1"; gene_id "g315"; # protein sequence = [MSIVRNSSVNETAAHDTQTIAGLARSFNLTLKAFGEDIIPASAYSSSESKGHIELSQAFNHELEPAPRTPTSGKGSEP # WDFLSGTIKATYAAHRNLGGVDGSNIVVSPGMSTGNTGTWCFIIIASILTDRVVHNADTKYYWNLTRHIFRYNHKNGAYGGEIATGVHTVNESVFLQS # L] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g315 ### # start gene g316 6 AUGUSTUS gene 883811 885433 0.52 - . g316 6 AUGUSTUS transcript 883811 885433 0.52 - . g316.t1 6 AUGUSTUS stop_codon 883811 883813 . - 0 transcript_id "g316.t1"; gene_id "g316"; 6 AUGUSTUS CDS 883811 885433 0.52 - 0 transcript_id "g316.t1"; gene_id "g316"; 6 AUGUSTUS start_codon 885431 885433 . - 0 transcript_id "g316.t1"; gene_id "g316"; # protein sequence = [MSDPVGQVRVCYTPLASAIVDTPEASLIACTGGKTSPFTQAIYKDFGDGKLHPPRLATATLEAIDSIQARNIFPQDLP # AYQRASVTARTNGVVSPFWRDWPLAEPCEFLTPEPLHHWHKMFWDHDAKWAIQAVGASHIDFRFSIHQPIVGYRSFKEGISSLKQVTGRAQRDVQRYL # IPLISDAVIPKFITALRALMDFRYAGQAPRFNQASTLRVQTALNEFHENKDIIQDLKARVNPKGVPIIHWEIPKLEFMQSVAPSISASGPIMQWTADT # TEHAHITLVKDPARSGNNHDFEVQICRHLDRQSRVRRFDLVTAMVDAGVDFRLDDIEGDEGRGDIGHDREERDEEDEEVDAKISSSEELMTRLHPVSQ # KLFGSFRPKQNFFLKARLLKQDASALLPLRIFTDNISGEISAFKVNRDPDLKTLTIEQVSNLYSLPDFSGACLDFLERIQAKTQTFVIGGRRSLNQSI # SLPFTRVKVWSRIRIQTKTYFNTDLLADSHTIFAAPPSPGWEFGRQNAAVVNINSSFEWPRSSLEGGLNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g316 ### # start gene g317 6 AUGUSTUS gene 887021 888328 0.44 - . g317 6 AUGUSTUS transcript 887021 888328 0.44 - . g317.t1 6 AUGUSTUS stop_codon 887021 887023 . - 0 transcript_id "g317.t1"; gene_id "g317"; 6 AUGUSTUS CDS 887021 888169 0.94 - 0 transcript_id "g317.t1"; gene_id "g317"; 6 AUGUSTUS CDS 888269 888328 0.44 - 0 transcript_id "g317.t1"; gene_id "g317"; 6 AUGUSTUS start_codon 888326 888328 . - 0 transcript_id "g317.t1"; gene_id "g317"; # protein sequence = [MISKLHIITKLQPYFEQHPNCRSKSGRRLIRGAYSGLPFTASTATTTTTTASSKTTASTTTTTASTTASTPASTAFTT # ASTASTASTTTKTAASTTKTTASTTTSTTASTASTTASTTKTTTSTTTTTASTTTSTTASTTASTTASTASTAETTTKTTASTTASTTASTASTTAST # TKTTTTTASTTAASTTASTASTATTTTAASTASTTAASITTTTASTTTTTATTTATTTATTTATTTASTTASTTASTASTTAASTTTTTASTATTTAS # TTASTTAASTTASTASTTASTTSTATTTTRCLYHHNDRLYHQNHRLVEIKDAVRNSSEDDWSSAEDGVISVEEVEDTEADNEDGDDGDDEHGDDEDDE # DEDDKAFISAQHPSNYGGVVAAYILVIDRC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g317 ### # start gene g318 6 AUGUSTUS gene 888725 889471 0.9 - . g318 6 AUGUSTUS transcript 888725 889471 0.9 - . g318.t1 6 AUGUSTUS stop_codon 888725 888727 . - 0 transcript_id "g318.t1"; gene_id "g318"; 6 AUGUSTUS CDS 888725 889471 0.9 - 0 transcript_id "g318.t1"; gene_id "g318"; 6 AUGUSTUS start_codon 889469 889471 . - 0 transcript_id "g318.t1"; gene_id "g318"; # protein sequence = [MDARADWMANPNADPNANPKVKPGPNVSLRVDVDARADWMARVDANGKANANGKANANGKANANGKANANVDANPNSN # VDPSANPNVDANANPKVKPGPNVSLRVDVDARADWMARVDANGKANANANVDANPNPNVDANANPNVDANANLNVDANVNPNPNVDAKANPNVEANPN # VDANPNPNVDGNTNPNANLNANLNANANLNANANLNANTTPNLNPKVDVDARVNMKQTGQGTGRNESLKMES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g318 ### # start gene g319 6 AUGUSTUS gene 894429 896300 0.18 + . g319 6 AUGUSTUS transcript 894429 896300 0.18 + . g319.t1 6 AUGUSTUS start_codon 894429 894431 . + 0 transcript_id "g319.t1"; gene_id "g319"; 6 AUGUSTUS CDS 894429 894578 0.22 + 0 transcript_id "g319.t1"; gene_id "g319"; 6 AUGUSTUS CDS 894842 895098 0.97 + 0 transcript_id "g319.t1"; gene_id "g319"; 6 AUGUSTUS CDS 895877 896300 0.68 + 1 transcript_id "g319.t1"; gene_id "g319"; 6 AUGUSTUS stop_codon 896298 896300 . + 0 transcript_id "g319.t1"; gene_id "g319"; # protein sequence = [MEMDTEVNMEEDMEVDMEVDTEANMEVDTEVDTEVDMNIGRIVPPFLMQMVEGETEVLKKRKRNLLKPPNPAILKIHS # KSHVPTTEEDFINKELAEFKHDRYADDEDDENADAEDEDANDNGEDVTLTSREYKRRXREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFT # PKPKPFSGGKPNNNGKPQNSLNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKAQESKGRAAEVEETPEATIEVVEEES # EN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g319 ### # start gene g320 6 AUGUSTUS gene 896943 897533 0.6 + . g320 6 AUGUSTUS transcript 896943 897533 0.6 + . g320.t1 6 AUGUSTUS start_codon 896943 896945 . + 0 transcript_id "g320.t1"; gene_id "g320"; 6 AUGUSTUS CDS 896943 897533 0.6 + 0 transcript_id "g320.t1"; gene_id "g320"; 6 AUGUSTUS stop_codon 897531 897533 . + 0 transcript_id "g320.t1"; gene_id "g320"; # protein sequence = [MLRAKPLLSKFPFEPIYSYPTVSQFAAQLETPEVNIALVSAAVFNRACKDAGMEPILLRAIHSEVVARAAALPPLHYS # IPEEYAELADVFDQIAADSLPEHKPYDLKIGLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSLPHGAPVTSLPRFCVKEKGRNLMGTPT # NQSNTQYASSLLSNLFNSKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g320 ### # start gene g321 6 AUGUSTUS gene 901361 902425 0.59 + . g321 6 AUGUSTUS transcript 901361 902425 0.59 + . g321.t1 6 AUGUSTUS start_codon 901361 901363 . + 0 transcript_id "g321.t1"; gene_id "g321"; 6 AUGUSTUS CDS 901361 902425 0.59 + 0 transcript_id "g321.t1"; gene_id "g321"; 6 AUGUSTUS stop_codon 902423 902425 . + 0 transcript_id "g321.t1"; gene_id "g321"; # protein sequence = [MDSTQHSSRISGQDLTAKLVPNPVHVPPRLSNPSVIPYQGLVSMQSQAVGAENQRGPNQRRMLAVHKEVVPPQEAPFG # TPFVMGAQTNQPGMAVDLAHSQELVVMIQQQAQVIETLQEQLCEVRKGFAAGGIPTGGPPSKTGNTAGLFGQAPMVMIENTRGGPSPVVPQPRSWQAT # EPIPFTRQTPMGVREGNPQEEPSAPLPATPSVDRRRIQEWGARRQRAELGEYVRPEGGRYALEDGGIAASGGDRGGFKPPNRAPPPHLSNHSRDRERP # PSQGGQDHRGQVGRSGGGTPPPSPLGGPGDNDSEGSYKGEHTRSSREGGRNDNNRGKLPTGAPEVPPTCYDPDQPWYYDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g321 ### # start gene g322 6 AUGUSTUS gene 906462 907178 0.98 - . g322 6 AUGUSTUS transcript 906462 907178 0.98 - . g322.t1 6 AUGUSTUS stop_codon 906462 906464 . - 0 transcript_id "g322.t1"; gene_id "g322"; 6 AUGUSTUS CDS 906462 907178 0.98 - 0 transcript_id "g322.t1"; gene_id "g322"; 6 AUGUSTUS start_codon 907176 907178 . - 0 transcript_id "g322.t1"; gene_id "g322"; # protein sequence = [MQHSTPAQLFPTSSQIEYKQTSLDSLIPLLMNEYERQDSFSNSLIPPNCLEQAPLAALGMSWQYLPVDFGLAANGTRA # LLELTSHTQGLEDISLLQGINALIRGFDKQQRHINPPGVVLEDHLSVSNFWRFTSSQGDVAIALLEVVIWQHIVIFPYHGSSETMIKQAPKSLHLWAL # ISKEDIWGDTHNLVSGWEHFVTRNHSLDSSIFNSSTTFWEVAKITYDPSAGMQQKFAMQFAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g322 ### # start gene g323 6 AUGUSTUS gene 910398 910946 0.95 + . g323 6 AUGUSTUS transcript 910398 910946 0.95 + . g323.t1 6 AUGUSTUS start_codon 910398 910400 . + 0 transcript_id "g323.t1"; gene_id "g323"; 6 AUGUSTUS CDS 910398 910946 0.95 + 0 transcript_id "g323.t1"; gene_id "g323"; 6 AUGUSTUS stop_codon 910944 910946 . + 0 transcript_id "g323.t1"; gene_id "g323"; # protein sequence = [MSTPVLPAPNTSAEDLMAQLIRQVANLATAMEEHSSSKSSMNKPEVFNGKDGAEACRFMAQFQNWVSEQPDLAKRQVK # LIKSALGFFTESAGDWTTPHLLHFKAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAKFTQKFKDIGDRTEMSDIDLREHFFTA # LLPDIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g323 ### # start gene g324 6 AUGUSTUS gene 915568 916821 0.47 + . g324 6 AUGUSTUS transcript 915568 916821 0.47 + . g324.t1 6 AUGUSTUS start_codon 915568 915570 . + 0 transcript_id "g324.t1"; gene_id "g324"; 6 AUGUSTUS CDS 915568 915687 0.49 + 0 transcript_id "g324.t1"; gene_id "g324"; 6 AUGUSTUS CDS 916221 916348 0.81 + 0 transcript_id "g324.t1"; gene_id "g324"; 6 AUGUSTUS CDS 916404 916821 0.82 + 1 transcript_id "g324.t1"; gene_id "g324"; 6 AUGUSTUS stop_codon 916819 916821 . + 0 transcript_id "g324.t1"; gene_id "g324"; # protein sequence = [MIIPREDDKIRLYIQLDGKDVIDASGRVDKSKAGPEMILDYEFERRQYAQDLIDFDKKFSKLFSGKPYSELNLDGVSH # VEFLKAFQTFGGFTSGLGVQYTDSMIIDSNHQNLAQNIFIGRRLPPRPLLRAADCRSIDLHDLLISDARFKLLVFTGDTHDPAQMAIFQEFAKQFSAS # GSFFAEFSLPDSMRKVFDIIPISSEKKETIMYNALPRILWSHWSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g324 ### # start gene g325 6 AUGUSTUS gene 916859 917830 0.2 - . g325 6 AUGUSTUS transcript 916859 917830 0.2 - . g325.t1 6 AUGUSTUS stop_codon 916859 916861 . - 0 transcript_id "g325.t1"; gene_id "g325"; 6 AUGUSTUS CDS 916859 917419 0.56 - 0 transcript_id "g325.t1"; gene_id "g325"; 6 AUGUSTUS CDS 917555 917830 0.21 - 0 transcript_id "g325.t1"; gene_id "g325"; 6 AUGUSTUS start_codon 917828 917830 . - 0 transcript_id "g325.t1"; gene_id "g325"; # protein sequence = [MLGNSPGSPSNIALDPDSSSRGLETLMETDELENDLPGDGLLKTGLFPSTPQSRASSDDEGGLTLAQQLGVSESPPES # RILLTLYDPQGYIPFMRPDFLLREKKVQSNVVRRSCSSKSITNKARISSSKPTFGISKPCNSSTVEKGSGMKVKAKSMGTQPVTKNTARMSDRLTSVR # IGGNKKENSSYASGSASSNLNNDKGFAERSNTKSIDANLRKVDLVGESVDQGEFLLGAMAATYPSGRTTITAPAALIPSDLYTFPLPVTPLMSISSTR # TLKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g325 ### # start gene g326 6 AUGUSTUS gene 919095 919424 0.54 - . g326 6 AUGUSTUS transcript 919095 919424 0.54 - . g326.t1 6 AUGUSTUS stop_codon 919095 919097 . - 0 transcript_id "g326.t1"; gene_id "g326"; 6 AUGUSTUS CDS 919095 919424 0.54 - 0 transcript_id "g326.t1"; gene_id "g326"; 6 AUGUSTUS start_codon 919422 919424 . - 0 transcript_id "g326.t1"; gene_id "g326"; # protein sequence = [MERWHRISDAQAKLGATASGKHFIGSVKTAVEPVVPIVGRGKRYLEITLEEAEKAREQLGKDNLSLKKMLLKADNEIR # NIAFELTPSLQEPTNEIEIVHSCNTSFFIPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g326 ### # start gene g327 6 AUGUSTUS gene 926017 926931 0.68 - . g327 6 AUGUSTUS transcript 926017 926931 0.68 - . g327.t1 6 AUGUSTUS stop_codon 926017 926019 . - 0 transcript_id "g327.t1"; gene_id "g327"; 6 AUGUSTUS CDS 926017 926931 0.68 - 0 transcript_id "g327.t1"; gene_id "g327"; 6 AUGUSTUS start_codon 926929 926931 . - 0 transcript_id "g327.t1"; gene_id "g327"; # protein sequence = [MFTATHAVFDEKLFPCCKSSECHRSMCLPDCNPDPKDPIPPPGDDDVPIFHQPTTPQRRQDPEQNVALPVPAEQPARD # PMPPPQPRNEQPPAEEQLRCSGRVQRPPTHLTGNPRSSSKLPMEQQVERPKRDIQRRTKAPQPGSSLAEQEHPEPEQVPGPSTEHLTPEKGEQPPGDK # ANTLIRLCCEGGAELIYFLMAKAVPFEGKLKSSENVHEWTYKDITHLSKAECEEWLKACQEELEALKRRGTFELMDHPADQKVIKNCWVFDVKSDGRK # KACLVVKGFSQIEGLDYDQVFSPVVWFETV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g327 ### # start gene g328 6 AUGUSTUS gene 928542 929198 0.76 - . g328 6 AUGUSTUS transcript 928542 929198 0.76 - . g328.t1 6 AUGUSTUS stop_codon 928542 928544 . - 0 transcript_id "g328.t1"; gene_id "g328"; 6 AUGUSTUS CDS 928542 929198 0.76 - 0 transcript_id "g328.t1"; gene_id "g328"; 6 AUGUSTUS start_codon 929196 929198 . - 0 transcript_id "g328.t1"; gene_id "g328"; # protein sequence = [MAINCACNIGVRATAEVIRTLEPTGHISELDSDDELDPLTKHTRAMSPVDDVENGSKAQIAPVFYMKELSHCLIAQGH # FLQDGKTVRGNADKVDFWDKDSLFLSFEPRTHSDTIYILRDYSPQPMAVNLVIHSVDYTTMHRRMGHPSRKALTQLRKHAEGVPTFSIPHEEDLCEGC # AKGKMTLRPFPGITSLPDYSLRPQRMAYHFVPQVQVYDLLHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g328 ### # start gene g329 6 AUGUSTUS gene 929233 929862 0.64 - . g329 6 AUGUSTUS transcript 929233 929862 0.64 - . g329.t1 6 AUGUSTUS stop_codon 929233 929235 . - 0 transcript_id "g329.t1"; gene_id "g329"; 6 AUGUSTUS CDS 929233 929862 0.64 - 0 transcript_id "g329.t1"; gene_id "g329"; 6 AUGUSTUS start_codon 929860 929862 . - 0 transcript_id "g329.t1"; gene_id "g329"; # protein sequence = [MLTFSVDFTQITISSALFTTVTTTLKDDNYDTWTPEMEAFLQATGLGSAITSDPPAEPSPLDTEDLNSVKAWKEYDNL # LKSWKEIDSKAVGNIRLRLSLSIRILPKDEGDMAKKLWEFLQKTYKVKGLGAVFDNFAAAMAVKVPYKGNPLTAMTDIGMFFSHMNDADIGIPAHLEA # LILLSKLPSHYSVIVQTMSELGTGCAQALHPSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g329 ### # start gene g330 6 AUGUSTUS gene 935875 936727 0.31 - . g330 6 AUGUSTUS transcript 935875 936727 0.31 - . g330.t1 6 AUGUSTUS stop_codon 935875 935877 . - 0 transcript_id "g330.t1"; gene_id "g330"; 6 AUGUSTUS CDS 935875 936475 0.8 - 1 transcript_id "g330.t1"; gene_id "g330"; 6 AUGUSTUS CDS 936597 936727 0.32 - 0 transcript_id "g330.t1"; gene_id "g330"; 6 AUGUSTUS start_codon 936725 936727 . - 0 transcript_id "g330.t1"; gene_id "g330"; # protein sequence = [MQKNEKIDGLASIVGTLVQHLPTLLSAPFTTSGLHSMSLLGELLDPQTLMFSLESNSRGNNNGIITETAIDQEPVAGK # NGRSLVEAGNGITKGKDGEETDEPMQETCGFYVGMKDNVVIADAEDLAGHRRSLASTQAEVVNVVSHPKVSAEDSPVEKGITTIKIAHGRSLNFKSAD # IRDPCPISFATNIPHLECAWDDEGPNWDPADCGVNLFSINGTPIALRYWPEVSFLLSLFLIWALVCC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g330 ### # start gene g331 6 AUGUSTUS gene 941495 942625 0.35 + . g331 6 AUGUSTUS transcript 941495 942625 0.35 + . g331.t1 6 AUGUSTUS start_codon 941495 941497 . + 0 transcript_id "g331.t1"; gene_id "g331"; 6 AUGUSTUS CDS 941495 941716 0.93 + 0 transcript_id "g331.t1"; gene_id "g331"; 6 AUGUSTUS CDS 941814 942080 0.76 + 0 transcript_id "g331.t1"; gene_id "g331"; 6 AUGUSTUS CDS 942233 942625 0.39 + 0 transcript_id "g331.t1"; gene_id "g331"; 6 AUGUSTUS stop_codon 942623 942625 . + 0 transcript_id "g331.t1"; gene_id "g331"; # protein sequence = [MGKPKKDQVDWKNSPGDVEALVRFLHSQRSRVGQGGNFDSTVYNKAAKHLEARGPPSHGVAKTAVSIKKYYSSTKTYT # GASGWTYSHEGGFNVVSATEDAWRNFVSVHKQFKPFKTSGWPLWELMHEIVPTQARGVHVFNAASQDTAQETGDSLSEPELDPCCTSVTSSQLQKTPA # PKRASSDIADTLTPWSSKRVRLTGPEAIHSLGQSVHGISDTLCVIFGTTSKSTALSPSKKLAIARQRIKEDVQGFYISDDQATDLKILFARDNAAADA # YGAEEDPVDRAKIAAKLLY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g331 ### # start gene g332 6 AUGUSTUS gene 942675 943010 0.99 - . g332 6 AUGUSTUS transcript 942675 943010 0.99 - . g332.t1 6 AUGUSTUS stop_codon 942675 942677 . - 0 transcript_id "g332.t1"; gene_id "g332"; 6 AUGUSTUS CDS 942675 943010 0.99 - 0 transcript_id "g332.t1"; gene_id "g332"; 6 AUGUSTUS start_codon 943008 943010 . - 0 transcript_id "g332.t1"; gene_id "g332"; # protein sequence = [MDIQARIPSALIAIHNFILEHDQADLDRWILDEQAEDPLPGQRRQQEIDFGSLATSEKISRAEKRRAEIARDRLANEM # WENYLSILEEYHKQGGVDAMDVDEDEMGIAPLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g332 ### # start gene g333 6 AUGUSTUS gene 945625 947277 0.55 + . g333 6 AUGUSTUS transcript 945625 947277 0.55 + . g333.t1 6 AUGUSTUS start_codon 945625 945627 . + 0 transcript_id "g333.t1"; gene_id "g333"; 6 AUGUSTUS CDS 945625 947277 0.55 + 0 transcript_id "g333.t1"; gene_id "g333"; 6 AUGUSTUS stop_codon 947275 947277 . + 0 transcript_id "g333.t1"; gene_id "g333"; # protein sequence = [MSLLMPPKTQAQSRANSEENTFFTTAQSFAPFSKSISAIGQPRHRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTS # DGQPVQVLTPRRGQPPVVAPARGRSTTQIDSPILQAIARHTGKQPQRRAASESPCDPPPHSDLDAGDHDDQDPPVDPDDPGADNNNDNLDDDSGGLPR # GEPGDPSGPGAPGGPHSPISPDIPNKQCAMLELLSGFKGSIETLGTVLATLSRSSDSSESKSKVKEPEVFDGSDPRKLKMFFVNLALVFNDHPKYFTD # QRKVNYTLSYLSGSAKEWFVPDILDPDLDSLLAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRFNTLAASTNWDSAALKWAYGRGVA # ECIKDKMARLPEPVSLADYRQEVPRTDNHYWKRKETRKCEAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNS # SNSGHSGGQRPVFNHLGADGKVLPSERERRMKNNLCLFCSGKHQIADCNKQKAQESKGRAAEVEETPEATIEVVEEESEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g333 ### # start gene g334 6 AUGUSTUS gene 951109 951786 0.63 - . g334 6 AUGUSTUS transcript 951109 951786 0.63 - . g334.t1 6 AUGUSTUS stop_codon 951109 951111 . - 0 transcript_id "g334.t1"; gene_id "g334"; 6 AUGUSTUS CDS 951109 951786 0.63 - 0 transcript_id "g334.t1"; gene_id "g334"; 6 AUGUSTUS start_codon 951784 951786 . - 0 transcript_id "g334.t1"; gene_id "g334"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAVDLIPGTPATMCTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNQYPLPLVADIISQLQGARYFTKFDVCWGYNNIRIKKGHEWKGAFATNRGLFEPKVMFFGLTNSPATFQAL # MNTIFADLIAASKVAVYLDDILIFSDDLEEHRQVVWEVLTRLEKHDLYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g334 ### # start gene g335 6 AUGUSTUS gene 955630 956208 0.7 - . g335 6 AUGUSTUS transcript 955630 956208 0.7 - . g335.t1 6 AUGUSTUS stop_codon 955630 955632 . - 0 transcript_id "g335.t1"; gene_id "g335"; 6 AUGUSTUS CDS 955630 956208 0.7 - 0 transcript_id "g335.t1"; gene_id "g335"; 6 AUGUSTUS start_codon 956206 956208 . - 0 transcript_id "g335.t1"; gene_id "g335"; # protein sequence = [MQLLEAVDLRHAPQEYDLAIRNATDDEPYLIALHSTATVLEIARRKWGPGTVDIIKCLIKEGLSFNTLVASYPPRICK # VIPRRQPAVLSFRPARFLPNSQDYRAYEVVRDEFLRSARGRAALLSGGIVARLAREIVNEDDVCDGPTVHALQEGEHALCVWEVGRGRAFWDEQLTTE # EIDLICGTYEVATGMC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g335 ### # start gene g336 6 AUGUSTUS gene 958325 958987 0.97 - . g336 6 AUGUSTUS transcript 958325 958987 0.97 - . g336.t1 6 AUGUSTUS stop_codon 958325 958327 . - 0 transcript_id "g336.t1"; gene_id "g336"; 6 AUGUSTUS CDS 958325 958987 0.97 - 0 transcript_id "g336.t1"; gene_id "g336"; 6 AUGUSTUS start_codon 958985 958987 . - 0 transcript_id "g336.t1"; gene_id "g336"; # protein sequence = [MLYHLENKWVNLVALHTPPNEDDSFLGKRQKEYVELRRGPVPAKWEWQELLRRETSISYDWLAYLDQIMDIPPVGTFV # DVHNSGCLPWLPVFLDSKMPLMLYWGQTHDWSIPKFFNFVIPFPNPVTFPIPNTTTIDNLSATQTSYPPPLSEGHFFNSTEVSTHKPKLWYPRITGGS # FPHHNEDIFTFIQCREAHRLKIIISEAASERQSRLQREENARRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g336 ### # start gene g337 6 AUGUSTUS gene 966736 967199 0.33 + . g337 6 AUGUSTUS transcript 966736 967199 0.33 + . g337.t1 6 AUGUSTUS start_codon 966736 966738 . + 0 transcript_id "g337.t1"; gene_id "g337"; 6 AUGUSTUS CDS 966736 966907 0.33 + 0 transcript_id "g337.t1"; gene_id "g337"; 6 AUGUSTUS CDS 966961 967199 0.66 + 2 transcript_id "g337.t1"; gene_id "g337"; 6 AUGUSTUS stop_codon 967197 967199 . + 0 transcript_id "g337.t1"; gene_id "g337"; # protein sequence = [MSGCNGIPMISAVSLQLKFEDLTGVDAPEWMKTEKQKKKRKNGTVPSSLNLSSKRPKSSAAPLTSNWVPQLPKGTTKI # ELQFAHMYTDSNTGDDSISYPAPEGNTVPGYICDSEFDNGVTKMVYKVVHQRLSITLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g337 ### # start gene g338 6 AUGUSTUS gene 970149 970694 0.91 + . g338 6 AUGUSTUS transcript 970149 970694 0.91 + . g338.t1 6 AUGUSTUS start_codon 970149 970151 . + 0 transcript_id "g338.t1"; gene_id "g338"; 6 AUGUSTUS CDS 970149 970694 0.91 + 0 transcript_id "g338.t1"; gene_id "g338"; 6 AUGUSTUS stop_codon 970692 970694 . + 0 transcript_id "g338.t1"; gene_id "g338"; # protein sequence = [MSLALDVTVDHTVHLEGFPINAKDVQDMIEYDMQSATTPRFYNQLSMLSQFRLCLDNLSLKILPYKGLLTRTSNSPKA # SNSLVTFVKKGDDAAAAITGDGEGNGATGGDDLKKYAENFSNVASDHKGDDHNDKAKINPITGRTTCPILRTDTNCEAFDTGTSVLREQQLTSFGMIY # QSLGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g338 ### # start gene g339 6 AUGUSTUS gene 977057 977596 0.91 + . g339 6 AUGUSTUS transcript 977057 977596 0.91 + . g339.t1 6 AUGUSTUS start_codon 977057 977059 . + 0 transcript_id "g339.t1"; gene_id "g339"; 6 AUGUSTUS CDS 977057 977596 0.91 + 0 transcript_id "g339.t1"; gene_id "g339"; 6 AUGUSTUS stop_codon 977594 977596 . + 0 transcript_id "g339.t1"; gene_id "g339"; # protein sequence = [MLLPVVSGNTVKSGNAEDTSDSESSAMDIQSMDENMEPGPSTASQDASQTPSQILTHTPSQSTSQEPLFTVQIPQSPF # TVRVSQSASTIQWTTGQPPTPNPPTSNPLTPDPPTSNPLNPNPPTPNPPAPTHPTSHPPQMPGNSDTTMADPDATPTAAQFGSTVSLQVCNVTSECIG # RSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g339 ### # start gene g340 6 AUGUSTUS gene 978471 979637 0.75 + . g340 6 AUGUSTUS transcript 978471 979637 0.75 + . g340.t1 6 AUGUSTUS start_codon 978471 978473 . + 0 transcript_id "g340.t1"; gene_id "g340"; 6 AUGUSTUS CDS 978471 979637 0.75 + 0 transcript_id "g340.t1"; gene_id "g340"; 6 AUGUSTUS stop_codon 979635 979637 . + 0 transcript_id "g340.t1"; gene_id "g340"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEEHSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLDKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCSAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g340 ### # start gene g341 6 AUGUSTUS gene 979688 983404 0.96 + . g341 6 AUGUSTUS transcript 979688 983404 0.96 + . g341.t1 6 AUGUSTUS start_codon 979688 979690 . + 0 transcript_id "g341.t1"; gene_id "g341"; 6 AUGUSTUS CDS 979688 983404 0.96 + 0 transcript_id "g341.t1"; gene_id "g341"; 6 AUGUSTUS stop_codon 983402 983404 . + 0 transcript_id "g341.t1"; gene_id "g341"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFQIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLAFTVDNQERWMDFLITNLGGEDIIFGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEQSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQMEEVWCAAGFTYSQQLAEEANRDKPSKTFEEMVPEQYHDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLSL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDLVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHLVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQAQWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVQIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCACK # KIQRHPWAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYICLYVGQRQDDWAEHLPMAEFVINSWTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLAWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDELEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPMAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g341 ### # start gene g342 6 AUGUSTUS gene 983971 984432 0.82 + . g342 6 AUGUSTUS transcript 983971 984432 0.82 + . g342.t1 6 AUGUSTUS start_codon 983971 983973 . + 0 transcript_id "g342.t1"; gene_id "g342"; 6 AUGUSTUS CDS 983971 984432 0.82 + 0 transcript_id "g342.t1"; gene_id "g342"; 6 AUGUSTUS stop_codon 984430 984432 . + 0 transcript_id "g342.t1"; gene_id "g342"; # protein sequence = [MMNQLYNGIRTSNAEVVNKQDVKIDKLTNSVQHNSTILDHVLEALDIQSVKNKGKQRQEEMDIDEEARRQGDSGTATN # AENKSDGNHVDAEDSGDLTQETPFSYTTKKKASPHSGAVKHRPQQELKNKVRVYRYDLFSTDMMSTLAGDHSSMV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g342 ### # start gene g343 6 AUGUSTUS gene 987669 988309 0.26 + . g343 6 AUGUSTUS transcript 987669 988309 0.26 + . g343.t1 6 AUGUSTUS start_codon 987669 987671 . + 0 transcript_id "g343.t1"; gene_id "g343"; 6 AUGUSTUS CDS 987669 987767 0.49 + 0 transcript_id "g343.t1"; gene_id "g343"; 6 AUGUSTUS CDS 987905 988309 0.36 + 0 transcript_id "g343.t1"; gene_id "g343"; 6 AUGUSTUS stop_codon 988307 988309 . + 0 transcript_id "g343.t1"; gene_id "g343"; # protein sequence = [MAGDDDHNPLTQYEDLSIIKEAEIAKKQTVCCYNVDNDLWEANRMLTVGVATRKTTDLDFEDESESTLLVMVHDLKPP # FLDGRTVYTKQLDPMNPIRDPTSDMPIFSKKGSALVKEKREQAERAKAAAKLAALGGTSLGNIMGAKDEEAEVEGMAISFVIFGVAHSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g343 ### # start gene g344 6 AUGUSTUS gene 1006357 1007385 0.97 + . g344 6 AUGUSTUS transcript 1006357 1007385 0.97 + . g344.t1 6 AUGUSTUS start_codon 1006357 1006359 . + 0 transcript_id "g344.t1"; gene_id "g344"; 6 AUGUSTUS CDS 1006357 1007385 0.97 + 0 transcript_id "g344.t1"; gene_id "g344"; 6 AUGUSTUS stop_codon 1007383 1007385 . + 0 transcript_id "g344.t1"; gene_id "g344"; # protein sequence = [MSTPVLTAQTTSADELMTQLIKQVANLATAMEECSSSKSSMNKPEVFKGKDSNEARCFRAQFQNWASEQPDLANSQVK # LIKSALGFFTEGAGDWATPHLLHFNAENPLFEGSWEKFLLEFGQRFESIDPGMEARNAIQSLKQGKGQTVAEFAQKFQDIGSWTGMSDIDLREHFYSA # LLPKIQQNLIMVNIGQGVARTLKEAITQAVSVDVYLHDPTLTGQNLGPTRSHATLLTPILWISMPPTPVMGILGRRSWPACEDDVLAVVPKVMSSKTA # HIEKPPAVTVDVEDIWKQSARTSSWDSDETKANASNRGASRYQLRALRHFLYSQMNPSRSLPRPQHLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g344 ### # start gene g345 6 AUGUSTUS gene 1022371 1022616 0.4 + . g345 6 AUGUSTUS transcript 1022371 1022616 0.4 + . g345.t1 6 AUGUSTUS start_codon 1022371 1022373 . + 0 transcript_id "g345.t1"; gene_id "g345"; 6 AUGUSTUS CDS 1022371 1022616 0.4 + 0 transcript_id "g345.t1"; gene_id "g345"; 6 AUGUSTUS stop_codon 1022614 1022616 . + 0 transcript_id "g345.t1"; gene_id "g345"; # protein sequence = [MTSCTIITTTPSASTSSQPTNPPNPGKNNEDEEESIMQKAQEKIRRVKAKKAEKEAKKRAAEVEVAKKAAEEEQKRKQ # VTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g345 ### # start gene g346 6 AUGUSTUS gene 1029958 1030374 0.5 + . g346 6 AUGUSTUS transcript 1029958 1030374 0.5 + . g346.t1 6 AUGUSTUS start_codon 1029958 1029960 . + 0 transcript_id "g346.t1"; gene_id "g346"; 6 AUGUSTUS CDS 1029958 1030374 0.5 + 0 transcript_id "g346.t1"; gene_id "g346"; 6 AUGUSTUS stop_codon 1030372 1030374 . + 0 transcript_id "g346.t1"; gene_id "g346"; # protein sequence = [MQVGKRWEGTSNPSGERLAILESKTAQSLANDWQMWDALTQGDAYQCQITKKLNWLMIEVRVGRGSTGGPTIGGLSRL # LRNRHRVIQESKEGEKEDQEGVEKNGGDEEVEKEGEEEEEVNKEPVPKKAWFEKGKEREE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g346 ### # start gene g347 6 AUGUSTUS gene 1037129 1037353 0.84 + . g347 6 AUGUSTUS transcript 1037129 1037353 0.84 + . g347.t1 6 AUGUSTUS start_codon 1037129 1037131 . + 0 transcript_id "g347.t1"; gene_id "g347"; 6 AUGUSTUS CDS 1037129 1037353 0.84 + 0 transcript_id "g347.t1"; gene_id "g347"; 6 AUGUSTUS stop_codon 1037351 1037353 . + 0 transcript_id "g347.t1"; gene_id "g347"; # protein sequence = [MDAARRRRSPPELQEAGPSGTSKKRRRVVDSDEEEEKEIEGEMEKVREEVEEEEEENELAPKKAWSEKGKEREE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g347 ### # start gene g348 6 AUGUSTUS gene 1037626 1039190 0.27 - . g348 6 AUGUSTUS transcript 1037626 1039190 0.27 - . g348.t1 6 AUGUSTUS stop_codon 1037626 1037628 . - 0 transcript_id "g348.t1"; gene_id "g348"; 6 AUGUSTUS CDS 1037626 1038633 0.52 - 0 transcript_id "g348.t1"; gene_id "g348"; 6 AUGUSTUS CDS 1038732 1039190 0.28 - 0 transcript_id "g348.t1"; gene_id "g348"; 6 AUGUSTUS start_codon 1039188 1039190 . - 0 transcript_id "g348.t1"; gene_id "g348"; # protein sequence = [MDIEALHQAIILALPKDLSSVVGLELAKDPSNERWSLGSDGLLCLDDRIYVPNHGDFCLQVLHYFHDHPLSGHFGQNR # TLEAVHCQYTWPKVRDFVRDYVTSCTTCGCNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTPILVVHGVPNHVTSDRGSEFVSAFFRAL # GKVLSMELHYTSGYHLEADGQTERINQTLEQYIRIYCSYQQDDRSHLLLIAEFAYNNTPNASIGITPFFANKGYHPNITVRPEVDMKSDLARDFVINL # DELHGFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIHSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTP # NPFPNHTQSPPPSIEVDGEEEYNVAKILDSKLDRRYKRCPLRYYIRWASYKDTDNDSLGLLLMNFMPTNWYPLSTLDTLRNLDLDHKKSFYSASRNSA # LRRRFLRCIEKVNTMIAN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g348 ### # start gene g349 6 AUGUSTUS gene 1039740 1040132 0.71 - . g349 6 AUGUSTUS transcript 1039740 1040132 0.71 - . g349.t1 6 AUGUSTUS stop_codon 1039740 1039742 . - 0 transcript_id "g349.t1"; gene_id "g349"; 6 AUGUSTUS CDS 1039740 1040132 0.71 - 0 transcript_id "g349.t1"; gene_id "g349"; 6 AUGUSTUS start_codon 1040130 1040132 . - 0 transcript_id "g349.t1"; gene_id "g349"; # protein sequence = [MPFGLINAPAAFQCFVNDIFSDMLDICVIGYLNDILIYSDTPEEHREHIKEVLWRLRKHWLYANPDKCEFNMDTIEYL # GYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFSLDLGQQLSRGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g349 ### # start gene g350 6 AUGUSTUS gene 1040514 1041110 1 - . g350 6 AUGUSTUS transcript 1040514 1041110 1 - . g350.t1 6 AUGUSTUS stop_codon 1040514 1040516 . - 0 transcript_id "g350.t1"; gene_id "g350"; 6 AUGUSTUS CDS 1040514 1041110 1 - 0 transcript_id "g350.t1"; gene_id "g350"; 6 AUGUSTUS start_codon 1041108 1041110 . - 0 transcript_id "g350.t1"; gene_id "g350"; # protein sequence = [MANIAIRFPSGELLLLPFYVTHLDSSCKAELGYSFLSRYNPLIDWASATNTVDAKVAVPLPEPLPSVLPTILETPPGD # SSRSRSRTLRAKPLSSKFPFELIYSYPMVSQFAAQLETPKVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAARAADRSSTAPTVPPLHHSIPKEYA # EFADVFNDITADSLPEHRPYNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g350 ### # start gene g351 6 AUGUSTUS gene 1042055 1043722 0.5 - . g351 6 AUGUSTUS transcript 1042055 1043722 0.5 - . g351.t1 6 AUGUSTUS stop_codon 1042055 1042057 . - 0 transcript_id "g351.t1"; gene_id "g351"; 6 AUGUSTUS CDS 1042055 1043346 0.91 - 2 transcript_id "g351.t1"; gene_id "g351"; 6 AUGUSTUS CDS 1043503 1043722 0.52 - 0 transcript_id "g351.t1"; gene_id "g351"; 6 AUGUSTUS start_codon 1043720 1043722 . - 0 transcript_id "g351.t1"; gene_id "g351"; # protein sequence = [MPPKTRAQSRANSKENTFFTTAQSFAPFSDSISAIGQPHCHNRGFGPATVPTMSTLPEAMEEDQQFEYSTLFTESPRD # LPPHFDLDAGDHDEQDPPVDPSNLGADNDNVDLDDDSGSLPRGELGDPSGPGGPGGPGGPGGPAGPCSPIPSDIPNEQRAMLELLSGFKGSIEALGTV # LAALGHPTDSSEYKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQQKVNYTLSYLSGSAKEWFIPDILDPDLDLLPAWTSSFNALVKELQD # NFGVYDTQGEAKDSLGNLKMTGTENIQKYNIRFNTLAASTNWNSAALKWAYGRGLAECIKDEMARLPELATLANYCQEVLCIDNRYWKREAGKHFIAQ # NPKKGSSDFKAGSSNQQNNSQPSGSSAPFTPKSKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIANC # NKQKAQVSQSDEGGLTKQNREAERLSRTMERSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g351 ### # start gene g352 6 AUGUSTUS gene 1052457 1056173 0.87 - . g352 6 AUGUSTUS transcript 1052457 1056173 0.87 - . g352.t1 6 AUGUSTUS stop_codon 1052457 1052459 . - 0 transcript_id "g352.t1"; gene_id "g352"; 6 AUGUSTUS CDS 1052457 1056173 0.87 - 0 transcript_id "g352.t1"; gene_id "g352"; 6 AUGUSTUS start_codon 1056171 1056173 . - 0 transcript_id "g352.t1"; gene_id "g352"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNRSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHVEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQMEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREVRQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g352 ### # start gene g353 6 AUGUSTUS gene 1056224 1057390 0.87 - . g353 6 AUGUSTUS transcript 1056224 1057390 0.87 - . g353.t1 6 AUGUSTUS stop_codon 1056224 1056226 . - 0 transcript_id "g353.t1"; gene_id "g353"; 6 AUGUSTUS CDS 1056224 1057390 0.87 - 0 transcript_id "g353.t1"; gene_id "g353"; 6 AUGUSTUS start_codon 1057388 1057390 . - 0 transcript_id "g353.t1"; gene_id "g353"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g353 ### # start gene g354 6 AUGUSTUS gene 1058196 1058825 0.58 - . g354 6 AUGUSTUS transcript 1058196 1058825 0.58 - . g354.t1 6 AUGUSTUS stop_codon 1058196 1058198 . - 0 transcript_id "g354.t1"; gene_id "g354"; 6 AUGUSTUS CDS 1058196 1058825 0.58 - 0 transcript_id "g354.t1"; gene_id "g354"; 6 AUGUSTUS start_codon 1058823 1058825 . - 0 transcript_id "g354.t1"; gene_id "g354"; # protein sequence = [MHTLYNGIWTSNAEVVNKQDAKINKLTNSVQQNSTILDYLLEALDIQSVKSKDMDIDREERHQGDSDTTGTTNAKNKP # DGNHTDADDPGDSTQETPFSYASKKKGSPCSGAVKHRPQQELKNKVRVYCYDLFSTDMMSYSGRRQFVNGSTRLWREKTSTKMRFSMRKPRNLLKNSS # WIYSHAHALLIIFDIGSQVFLNQRGTRAHHMFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g354 ### # start gene g355 6 AUGUSTUS gene 1066341 1067453 0.54 + . g355 6 AUGUSTUS transcript 1066341 1067453 0.54 + . g355.t1 6 AUGUSTUS start_codon 1066341 1066343 . + 0 transcript_id "g355.t1"; gene_id "g355"; 6 AUGUSTUS CDS 1066341 1067453 0.54 + 0 transcript_id "g355.t1"; gene_id "g355"; 6 AUGUSTUS stop_codon 1067451 1067453 . + 0 transcript_id "g355.t1"; gene_id "g355"; # protein sequence = [MSLQEDWDLLERNMHAFQRACMKINRLAIPDNFHLWPLPNFYGYCAHWRTEAEARSAGMRSRQAFIPLIPCISFFLQM # LYQLENKWVDIVALHIPPNGPDSFLGKRQKEYAELRRGPVPAKWEWQELLRREMSISSGWLVYFHHMYFHHMYFHHMYFHQIMNIPRVSAFVDVHNSG # FLPWLPVFLDSKMPVMLYWGQIHNWSVPKISNFVIPFPNPITFPIPDSTTVDMLSATQTPYPPPSEDHSFNKTEGSTHKPKLRYPRITGGSLPRNNED # PFAFIQRREAHRLKVIASEATSEHQSRLQQEENARRDRPPGRKGARVYYWDLVEGIRVWTAVGRRNYEDIWERYGLILLLMNGRFARTWILTAVVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g355 ### # start gene g356 6 AUGUSTUS gene 1072035 1073267 1 - . g356 6 AUGUSTUS transcript 1072035 1073267 1 - . g356.t1 6 AUGUSTUS stop_codon 1072035 1072037 . - 0 transcript_id "g356.t1"; gene_id "g356"; 6 AUGUSTUS CDS 1072035 1073267 1 - 0 transcript_id "g356.t1"; gene_id "g356"; 6 AUGUSTUS start_codon 1073265 1073267 . - 0 transcript_id "g356.t1"; gene_id "g356"; # protein sequence = [MFATSSYDSHPSCTILLTRELNSTSPHFQIHARLRGRNHSITTAAMVDCGATALFLNQDFATRNCIRCAPLHKPIDVF # NIDGTPNRAGRITHFAHLALTVDSQERWMDFLITNLGGEDIILGLPWLQKVNPEIDWEKGRLSVKPPRVAIEEVQDEEISYPHLAAANTESPIPELPK # PLAEPPHIEAPQEATLEESESAAEESPIHRIRANHKTCRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVETFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLIPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGAQYFTKFDVRWGYNNVRIKESHEWKGAFATT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g356 ### # start gene g357 6 AUGUSTUS gene 1073318 1074475 0.95 - . g357 6 AUGUSTUS transcript 1073318 1074475 0.95 - . g357.t1 6 AUGUSTUS stop_codon 1073318 1073320 . - 0 transcript_id "g357.t1"; gene_id "g357"; 6 AUGUSTUS CDS 1073318 1074475 0.95 - 0 transcript_id "g357.t1"; gene_id "g357"; 6 AUGUSTUS start_codon 1074473 1074475 . - 0 transcript_id "g357.t1"; gene_id "g357"; # protein sequence = [MSTPVLTAQTTSADELMTQLIKQVANLATAMEECSSSKSSMNKPEVFKGKDSNEARCFRAQFQNWASEQPDLANSQVK # LIKSALGFFTEGAGDWATPHLLHFNAENPLFEGSWEKFLLEFGQRFESIDPGMEARNAIQSLKQGKGQTVAEFAQKFQDIGSWTGMSDIDLREHFYSA # LLPKIQQNLIMVNIGQGVARTLKEAITQAVSVDVYLHDPTLTGQNLGPTRSHATPADPHSMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNC # PHRETTCHYCGRRGHLEAVCQDKFMGLGRDQGQRQQPRRQQISATSTAPFSLFPNESVQIATSTPTSALATVPATPSPPNQDFSNQIGQIRELLDRAN # AMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g357 ### # start gene g358 6 AUGUSTUS gene 1088332 1088676 0.66 + . g358 6 AUGUSTUS transcript 1088332 1088676 0.66 + . g358.t1 6 AUGUSTUS start_codon 1088332 1088334 . + 0 transcript_id "g358.t1"; gene_id "g358"; 6 AUGUSTUS CDS 1088332 1088676 0.66 + 0 transcript_id "g358.t1"; gene_id "g358"; 6 AUGUSTUS stop_codon 1088674 1088676 . + 0 transcript_id "g358.t1"; gene_id "g358"; # protein sequence = [MKYTFHPSRVFGFLNCEQVLSRKEGPETTNEFSDTEAAASVKVSRSCLAQSMTCTASLSKTKPNVMRDVVVPLKAISR # PLEDPRADVRIPDSQMISAMTDNGEPLSKLFKLPED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g358 ### # start gene g359 6 AUGUSTUS gene 1089080 1089634 0.96 + . g359 6 AUGUSTUS transcript 1089080 1089634 0.96 + . g359.t1 6 AUGUSTUS start_codon 1089080 1089082 . + 0 transcript_id "g359.t1"; gene_id "g359"; 6 AUGUSTUS CDS 1089080 1089634 0.96 + 0 transcript_id "g359.t1"; gene_id "g359"; 6 AUGUSTUS stop_codon 1089632 1089634 . + 0 transcript_id "g359.t1"; gene_id "g359"; # protein sequence = [MTARVFIVPHLIDSDTSVLRRLEHALAALSKPPPALKPTCPNSCTSFNRDDLSLEVPIGGSGREGKDRGSGNGLMTNR # YPLALSQSMSTLPNTTAMELTAGHLPLISPRPVGFRSSSSSSPSSSNDSQSRASPTLVPELTVLEGCKVFVDVWMSDGQDTSLLYIDIAKNLGAQVCG # FEKSMQIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g359 ### # start gene g360 6 AUGUSTUS gene 1095950 1096402 0.4 - . g360 6 AUGUSTUS transcript 1095950 1096402 0.4 - . g360.t1 6 AUGUSTUS stop_codon 1095950 1095952 . - 0 transcript_id "g360.t1"; gene_id "g360"; 6 AUGUSTUS CDS 1095950 1096402 0.4 - 0 transcript_id "g360.t1"; gene_id "g360"; 6 AUGUSTUS start_codon 1096400 1096402 . - 0 transcript_id "g360.t1"; gene_id "g360"; # protein sequence = [MILSVVNVLSTAIKANAAVVLQMLDKLPALGVEQRAIVEAVLELEDSAATGVAGGDMMNTRGTTEMGKSTKFMMNMDV # VRLSLSSKISSLIADYSIGSSSLPASQIVGGGITAPGIVGSDGDDELRLQDAFSRPQRSIRLQEVRSIVGSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g360 ### # start gene g361 6 AUGUSTUS gene 1101243 1101701 0.96 - . g361 6 AUGUSTUS transcript 1101243 1101701 0.96 - . g361.t1 6 AUGUSTUS stop_codon 1101243 1101245 . - 0 transcript_id "g361.t1"; gene_id "g361"; 6 AUGUSTUS CDS 1101243 1101701 0.96 - 0 transcript_id "g361.t1"; gene_id "g361"; 6 AUGUSTUS start_codon 1101699 1101701 . - 0 transcript_id "g361.t1"; gene_id "g361"; # protein sequence = [MVFTPEELQVIHPMSRAGTRQIRNSDIVEIDFKILIDGGKRLHSSLLNAITAQIQSEAEVAGESPEFCVFSSWLGPLI # DGTHKENALTGTVDMHIAQAVSYKNISTSYPMKLMGMKGTRRKYGYDSSKNKMGYSLVRYENATLGTDLDRLQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g361 ### # start gene g362 6 AUGUSTUS gene 1105326 1106420 0.97 - . g362 6 AUGUSTUS transcript 1105326 1106420 0.97 - . g362.t1 6 AUGUSTUS stop_codon 1105326 1105328 . - 0 transcript_id "g362.t1"; gene_id "g362"; 6 AUGUSTUS CDS 1105326 1106420 0.97 - 0 transcript_id "g362.t1"; gene_id "g362"; 6 AUGUSTUS start_codon 1106418 1106420 . - 0 transcript_id "g362.t1"; gene_id "g362"; # protein sequence = [MTHPSVKNQIKTVLASQELLKCIQDWISYNAVLEAKRVQPAQLLRSQWRLRIHQKIPSPITVPEDNFLKSVLKGLSKT # HINWQASSQADSLAHMKRVLRELVIELCLWEGYRDQFLEAQEGFKCLLMEVVQLIQGSPNWRAWKPWLNLTFGKDDDDVALQCYKELFKDDQAGTLLS # VTHSQLHQKQKEKLFKLFKNLHNGLKEAGLDVKLGNTSKGLHPAISSPLEELIQTCIKAQEDLNHAVEQEPSIPLIAPEDISMPAENSLQLHYANEDN # LLELYSQSNGIEEDQGIFHSKHNAKGKKKVKQTEEMNFEEEEQENREEQEQEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEQEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g362 ### # start gene g363 6 AUGUSTUS gene 1106523 1107383 0.77 - . g363 6 AUGUSTUS transcript 1106523 1107383 0.77 - . g363.t1 6 AUGUSTUS stop_codon 1106523 1106525 . - 0 transcript_id "g363.t1"; gene_id "g363"; 6 AUGUSTUS CDS 1106523 1106750 0.96 - 0 transcript_id "g363.t1"; gene_id "g363"; 6 AUGUSTUS CDS 1106853 1107383 0.78 - 0 transcript_id "g363.t1"; gene_id "g363"; 6 AUGUSTUS start_codon 1107381 1107383 . - 0 transcript_id "g363.t1"; gene_id "g363"; # protein sequence = [MQFLKPILDGNWLQLLYLCSLVQLPGQFNNSVSTSEELHQHAITTFLQETPSFSADVASWITKLSEDCFLKYLAPISS # HWGLNTEEYRTGHNLYWKGLIEGVETRELDTLSSSETWTEEQHSILRELPKKMMLIRSVRPFHGSLGIPPGLEETVILCPSYCQAMMDIFSNMSQDLE # LRQGKKQKQQDVDILGNHPSTSEVLKDYLIYWTFSKHAEWRNLSGKEFMKLVPGATKELGSIWNEVSGYLTPDLDY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g363 ### # start gene g364 6 AUGUSTUS gene 1107721 1108700 0.43 - . g364 6 AUGUSTUS transcript 1107721 1108700 0.43 - . g364.t1 6 AUGUSTUS stop_codon 1107721 1107723 . - 0 transcript_id "g364.t1"; gene_id "g364"; 6 AUGUSTUS CDS 1107721 1108455 0.92 - 0 transcript_id "g364.t1"; gene_id "g364"; 6 AUGUSTUS CDS 1108612 1108632 0.43 - 0 transcript_id "g364.t1"; gene_id "g364"; 6 AUGUSTUS CDS 1108683 1108700 0.54 - 0 transcript_id "g364.t1"; gene_id "g364"; 6 AUGUSTUS start_codon 1108698 1108700 . - 0 transcript_id "g364.t1"; gene_id "g364"; # protein sequence = [MSNHSYASEDIEQIVLIGNTGGKKRAQTRGKNREKSSQAKGHSECGQQVQNMCNSQPQQFAAESSVNHSIDDTPYVLG # YGFMNVVGLGPNITPYKHLRGVKNRGVSRIVKLAGPNMAGLQKSAVEHCLIVGVRRAEVDVSTLATDITKPFQAVKAGGGGVKFPVILFNGQHRLSAV # SMVLKPALKALHEIGQQLKRSPDNRDLQEQEQKAHQYCYNHGSWLVKVYDLGNLISLSFVLELNCYHRHFAWITQLYQCYH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g364 ### # start gene g365 6 AUGUSTUS gene 1112361 1114337 0.69 + . g365 6 AUGUSTUS transcript 1112361 1114337 0.69 + . g365.t1 6 AUGUSTUS start_codon 1112361 1112363 . + 0 transcript_id "g365.t1"; gene_id "g365"; 6 AUGUSTUS CDS 1112361 1114337 0.69 + 0 transcript_id "g365.t1"; gene_id "g365"; 6 AUGUSTUS stop_codon 1114335 1114337 . + 0 transcript_id "g365.t1"; gene_id "g365"; # protein sequence = [MDPKLSALHHVLKALWLCRWYDPVDKPNGFPDPTMCFMALIHIRPEGEFSDPKDVPQPIAKLSWAIRLVVLRQVHLAV # ADGDYQTQLDAMKDLQQWIIEKEQTTFSSLRAITHYASAIAYSTISPPKIWWDDQECYTSLRYKGRSITETHIHTLFERLQDKIIRLWEDKILGGLSH # RVTYGSLADNLTNCEPGYSFLDDVENRFSDHFHDLLRLFFADPQLRKQFFHVPGGSQKWEFNSLRWRVWLADLADLEKHLILAVDMMGGAPARGTEIT # SVLIRNTPFRVRNMRGLGKFVAMVREYSKTTNIMQADKVIPHAMDAFCADIFIQVHVLARPIAQVGVICWDYSWLLIYNAQYLASKLYPNDPGVAVLY # GEMAFMDAGKEFSSESLSTTMANSSLPILGWGLKISAWRDVTVAFKRKRCNKTMALLNDDETFELHMQQNGHSIDVNKQHYGTTPFSFLGYPEDVIFA # YLMVSTEWQRLFHIVPGGIHLPYSQTSTRNYKHLYDTGFLRTKLFPGPMLSLSETSEKSHDWQIHDTLLEFTRQQQSRDEAHMQEIENLKATITSLQR # SNADTQKQNKELHTLLSVALPLLGSLVSNNTVTSQSLSHSVNTITTLAHISNDNLSFIPLVADQQCSPRSCIRVIHVKGERYSFKSVCRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g365 ### # start gene g366 6 AUGUSTUS gene 1114901 1116951 0.22 + . g366 6 AUGUSTUS transcript 1114901 1116951 0.22 + . g366.t1 6 AUGUSTUS start_codon 1114901 1114903 . + 0 transcript_id "g366.t1"; gene_id "g366"; 6 AUGUSTUS CDS 1114901 1116122 0.27 + 0 transcript_id "g366.t1"; gene_id "g366"; 6 AUGUSTUS CDS 1116233 1116951 0.44 + 2 transcript_id "g366.t1"; gene_id "g366"; 6 AUGUSTUS stop_codon 1116949 1116951 . + 0 transcript_id "g366.t1"; gene_id "g366"; # protein sequence = [MICLLKGMYGPSIQWRCQEQRDAVEALLALRTDVVIALGCGVGKTAVILLASLVENGHTIVVTPLVSLLQDWQRRLRT # LNIAFEHYAGAQTKTLSGHANIILASADTARGKHWEACLNMLSRPVYRIVVEEVHNHATEASFRRKAFANPYQLRNAGPVQLVLMSASVPVPLLNTLS # KSFELRPGFKVFRTPAVKDNVIFIRHKPLGNDSIIAETVTSYIQSWKQAGFHNTDDRYIVYVYSTKQGEALAKCLGCDFYHSASQTYPITDQERRTML # DRWITGDNSTLVSTTALSAGLDCHGIVMAFNIGVPPELITYYQQTHRLVRGEGGVGVCILIPWPKKPVSDRGDKDILALCGREELLDLAYFDISAENF # PMRCLRYRITKFLNGRGQTCAAIDATLDPCTGCLPETLNQDSSVEYQIGEDFAIAYEDPITATCPQLCLTPVRASSSAFPIPTILKQQSTKRALEEAF # GEVHSAARKRTTESMVMQKDRYLDAHRLLDLIGTHCGVCLLKNIQGNTTHIMKDCPAFQTSQHAQLASIRRSVDLKKMENHVCYHCLLPSGSHNELHP # EFIRGTITCTHPNLAWPIAALIWYTPELRIQAAGAFAVPGGVWHDIGSYMDWYFRDDIEYFSRSLHLSIWLAKSRGLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g366 ### # start gene g367 6 AUGUSTUS gene 1121480 1121746 0.7 - . g367 6 AUGUSTUS transcript 1121480 1121746 0.7 - . g367.t1 6 AUGUSTUS stop_codon 1121480 1121482 . - 0 transcript_id "g367.t1"; gene_id "g367"; 6 AUGUSTUS CDS 1121480 1121746 0.7 - 0 transcript_id "g367.t1"; gene_id "g367"; 6 AUGUSTUS start_codon 1121744 1121746 . - 0 transcript_id "g367.t1"; gene_id "g367"; # protein sequence = [MFETSKKNKQQRDCHIMHSQSGYDKISILKPQQKPSARAATVISVLTTFTMVGHAQPKLKKPVEDDGDNGDVNSGSDN # DFESMLSLID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g367 ### # start gene g368 6 AUGUSTUS gene 1124446 1125531 0.94 - . g368 6 AUGUSTUS transcript 1124446 1125531 0.94 - . g368.t1 6 AUGUSTUS stop_codon 1124446 1124448 . - 0 transcript_id "g368.t1"; gene_id "g368"; 6 AUGUSTUS CDS 1124446 1125531 0.94 - 0 transcript_id "g368.t1"; gene_id "g368"; 6 AUGUSTUS start_codon 1125529 1125531 . - 0 transcript_id "g368.t1"; gene_id "g368"; # protein sequence = [MDFLITNLGGEDVILGLPWLRKVNPEIDWEKGWLSVKPPRVAIEEVPNKEISYPHLAAANTESPIPELLNLEPPAEPP # HIEVPPEATLEESESAVVEEPPIHQNQANHKTHWAWVRAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVRTFEEIVPEQYRDFKKVFSESASERLP # AHQPWDHAIDLIPGAPATMCTKIYPMSLNEQEELDRFLEENLQKGYIVPSKSPILSPVFFVKKKDGKLCFIQDYQKLNEYTVKKRHPLPLVADIISQL # QGARYFTKFNVCWGYNNVRIKEGHEWKGAFATTRGLFEPKVMFFGLTNSPAMFQALMNAIFADLIAAGKVAVYLDDILIFSSDLQEH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g368 ### # start gene g369 6 AUGUSTUS gene 1126126 1127049 0.97 - . g369 6 AUGUSTUS transcript 1126126 1127049 0.97 - . g369.t1 6 AUGUSTUS stop_codon 1126126 1126128 . - 0 transcript_id "g369.t1"; gene_id "g369"; 6 AUGUSTUS CDS 1126126 1127049 0.97 - 0 transcript_id "g369.t1"; gene_id "g369"; 6 AUGUSTUS start_codon 1127047 1127049 . - 0 transcript_id "g369.t1"; gene_id "g369"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEECSSSKSSMNKPGVFRGKDGSEAHRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGRNWDRFLKEFGQRFEPMDPGMEAHSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRECFFTA # LLPEIQQHLIIVNIAQEIALTLKEAFKWAISMDVYLHDPTMTGRNSGHAPTHTAHTAPADPHAMDIDATHTSNGHTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGCRGHLEAVCQDKFMGLVQD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g369 ### # start gene g370 6 AUGUSTUS gene 1135261 1135653 0.47 - . g370 6 AUGUSTUS transcript 1135261 1135653 0.47 - . g370.t1 6 AUGUSTUS stop_codon 1135261 1135263 . - 0 transcript_id "g370.t1"; gene_id "g370"; 6 AUGUSTUS CDS 1135261 1135653 0.47 - 0 transcript_id "g370.t1"; gene_id "g370"; 6 AUGUSTUS start_codon 1135651 1135653 . - 0 transcript_id "g370.t1"; gene_id "g370"; # protein sequence = [MAGPVSWCSKRQATVALSTTESEYIGLSRATQQAVWLASFLAEVNLAQAGAIELLSNNFGSVCLTENSKRHALVKHIE # MRHHYIREKVSSGEVKVQRIQSGENVVDLFTKALNGTIHSKMVSILGLDGME] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g370 ### # start gene g371 6 AUGUSTUS gene 1135901 1136560 0.58 - . g371 6 AUGUSTUS transcript 1135901 1136560 0.58 - . g371.t1 6 AUGUSTUS stop_codon 1135901 1135903 . - 0 transcript_id "g371.t1"; gene_id "g371"; 6 AUGUSTUS CDS 1135901 1136560 0.58 - 0 transcript_id "g371.t1"; gene_id "g371"; 6 AUGUSTUS start_codon 1136558 1136560 . - 0 transcript_id "g371.t1"; gene_id "g371"; # protein sequence = [MESIRLVLAIVAVLQLSIFQVNFAAAFLNSPITHNVYMKQPEGFLKPGSEHLVCKLRKSIYGTMQGSHDWQETLATGY # AQDGYTASRADPCIQYQRVGGEYTITSTYGDDVCGGSPMAGGRNKTVADLGGEQSQKRGSTSMNITQNPESKAITISQKTYFKRMLANFGLEHVRCRN # TPLPPNVRLTESLSLLPDEEAELMRDKPYGSIMGCILWGEVCT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g371 ### # start gene g372 6 AUGUSTUS gene 1151413 1151799 0.95 + . g372 6 AUGUSTUS transcript 1151413 1151799 0.95 + . g372.t1 6 AUGUSTUS start_codon 1151413 1151415 . + 0 transcript_id "g372.t1"; gene_id "g372"; 6 AUGUSTUS CDS 1151413 1151799 0.95 + 0 transcript_id "g372.t1"; gene_id "g372"; 6 AUGUSTUS stop_codon 1151797 1151799 . + 0 transcript_id "g372.t1"; gene_id "g372"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGLHTPLPGEREDLPLDRYRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g372 ### # start gene g373 6 AUGUSTUS gene 1155911 1160149 0.76 + . g373 6 AUGUSTUS transcript 1155911 1160149 0.76 + . g373.t1 6 AUGUSTUS start_codon 1155911 1155913 . + 0 transcript_id "g373.t1"; gene_id "g373"; 6 AUGUSTUS CDS 1155911 1160149 0.76 + 0 transcript_id "g373.t1"; gene_id "g373"; 6 AUGUSTUS stop_codon 1160147 1160149 . + 0 transcript_id "g373.t1"; gene_id "g373"; # protein sequence = [MRHPENLVDLTDSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRTHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNSEEIHAGTLQSPPEAPQRPPEAPQPPPEASQQPPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAIERVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASDSSA # TEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKE # YIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGS # FEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEESHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEK # VKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILS # QLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLG # AKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALKRIARNEEESFVWEDELIKRGGRIYVPDVGTLR # REVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPATAGPEKYDAILVV # VCRLTKQAIYVPCHTTDKAEDFANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQD # DWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQEAEVNEYASNLKELHAYLQERIEVANKVYAKYANQKRQEAPDWKEGDQVWLNME # NVRTRRPMKKLDHKWTGPYTVLSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGKTEHFVEDILDSKPKKGRPEEVEYLV # KWEGYNDEFNSWVGWEGMVGSIELLRSWHKHHPRKRQPSRLQWASLEREAREDEEEGSGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g373 ### # start gene g374 6 AUGUSTUS gene 1160389 1162996 0.51 - . g374 6 AUGUSTUS transcript 1160389 1162996 0.51 - . g374.t1 6 AUGUSTUS stop_codon 1160389 1160391 . - 0 transcript_id "g374.t1"; gene_id "g374"; 6 AUGUSTUS CDS 1160389 1161520 0.58 - 1 transcript_id "g374.t1"; gene_id "g374"; 6 AUGUSTUS CDS 1161684 1162996 0.51 - 0 transcript_id "g374.t1"; gene_id "g374"; 6 AUGUSTUS start_codon 1162994 1162996 . - 0 transcript_id "g374.t1"; gene_id "g374"; # protein sequence = [MSAPLRRSSSRTRSPQLPILTTIGEVPSPDLESDGEAEQDQLAFTIEFPSRPQLQLFETVFNTGKPLSGYCQDDPLWP # LLAEVASPCSNCSKSPAKCKVLPNSPRCTNCSVKKTCSLGKILRYRYFARRCNQDLAYSRRFLELHGTPAHQSTWGIPMVTWRQYDAALHERTSSTST # LLELNMLDDQDAADVDQQELRDFLALQQEEAAVAAKRKRDLSPLPVAGPSSKKVRSNASKKRPRRRSPVQETAEESPRRVRLVVPPVRSLPVTTSTPL # PPRAFPSSMEVPDADLSVQGHSNLVRLAAVAGAQSGLVQQPAVSSSIKGTGQDLLSSNMPPVPRPTLVPRALATHPYRAENQRLAARVRLLESQLSDS # QRENSSLTSALRDTSHALESRQREVEQLRSSSREVREQQVEYRRVLDQFRALDEALPGPPDRVRILLLYQQGVVDESNALATRQRRLVEELQEEVHRA # RGRAAFVEQMIKEYPDEGYYEVVLPPLSQLEGDLHKAREDLRRVATFAHRLYRSEPATVLHHHYRYLGAIIEAVVAFLRRGLDSDDLDTVVHNFQLGL # DYMQAARGVHGDMYMRSLSSIQWFFNNAVDEDEGLYRMVLEHSRFDNDGPFLTAAQHAGFAPPPDSSLEPPLHRRMFALSTALPHSDGAGRWDDIVPA # LPSIDQLTADWEQLMLQYIHHITDTPLPVPDPPVPMSSMGPVPESSGEANVEQSLEAPIVQVSSPSAGSHPPVPLFLSEQESPTSPSPPPCSPVPPLL # FGSVASLSIDLTGDDDELYETEESYAGRIAVAREGTELAVGQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g374 ### # start gene g375 6 AUGUSTUS gene 1164388 1165030 0.89 - . g375 6 AUGUSTUS transcript 1164388 1165030 0.89 - . g375.t1 6 AUGUSTUS stop_codon 1164388 1164390 . - 0 transcript_id "g375.t1"; gene_id "g375"; 6 AUGUSTUS CDS 1164388 1164597 1 - 0 transcript_id "g375.t1"; gene_id "g375"; 6 AUGUSTUS CDS 1164637 1164804 0.98 - 0 transcript_id "g375.t1"; gene_id "g375"; 6 AUGUSTUS CDS 1164863 1165030 0.91 - 0 transcript_id "g375.t1"; gene_id "g375"; 6 AUGUSTUS start_codon 1165028 1165030 . - 0 transcript_id "g375.t1"; gene_id "g375"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLEKPVTLRSHVRQVSNLTARQSI # IDTLCLGHKLFPDIVSDSHFEQHLKFMAFANDAHSFQNTFIRNRLLNRARSVHSDHEASTRADNSRFIRKSKKKATRFASSRDVKREPRSVRFDSDVE # VNSQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g375 ### # start gene g376 6 AUGUSTUS gene 1166046 1166704 0.81 - . g376 6 AUGUSTUS transcript 1166046 1166704 0.81 - . g376.t1 6 AUGUSTUS stop_codon 1166046 1166048 . - 0 transcript_id "g376.t1"; gene_id "g376"; 6 AUGUSTUS CDS 1166046 1166593 0.92 - 2 transcript_id "g376.t1"; gene_id "g376"; 6 AUGUSTUS CDS 1166656 1166704 0.81 - 0 transcript_id "g376.t1"; gene_id "g376"; 6 AUGUSTUS start_codon 1166702 1166704 . - 0 transcript_id "g376.t1"; gene_id "g376"; # protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTARELFLRSILDLQNAGEDPIVVLEALKTAEPNRRAIT # LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIQSGESTVHIDEHGHLVEASPPPDSATEALEGLKEVERGSADEGTSSPVGGSVPMELDLP # TIESLAERALSPEKGAESAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g376 ### # start gene g377 6 AUGUSTUS gene 1287505 1288344 0.29 - . g377 6 AUGUSTUS transcript 1287505 1288344 0.29 - . g377.t1 6 AUGUSTUS stop_codon 1287505 1287507 . - 0 transcript_id "g377.t1"; gene_id "g377"; 6 AUGUSTUS CDS 1287505 1288344 0.29 - 0 transcript_id "g377.t1"; gene_id "g377"; 6 AUGUSTUS start_codon 1288342 1288344 . - 0 transcript_id "g377.t1"; gene_id "g377"; # protein sequence = [MHQPWPHRMVDIDHLLASAHIISEIQSAPAMMSEFPQGHLQSFHEHHNMPPQWTQPPSLLSLQAPTNHYYPVYYTLYP # VYQNFQPPPETPHSVTPKIKIKYSSIHATFLATIKDANALKDRKSWVKWNEGVWQVVADGFVLGHICDEPSLGTPLTEWNTPLPRPAISSQPMRKEIE # NRLKWDKNDGWTSSILTARLSDEACNHLPPMIDDQGEHRTARQIYLRLKAAYQAAPNRKACLCIQMNYLTLKSMAWTSKSLTSSGVQLLPLYATTATI # FPGIH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g377 ### # start gene g378 6 AUGUSTUS gene 1290269 1290778 0.75 - . g378 6 AUGUSTUS transcript 1290269 1290778 0.75 - . g378.t1 6 AUGUSTUS stop_codon 1290269 1290271 . - 0 transcript_id "g378.t1"; gene_id "g378"; 6 AUGUSTUS CDS 1290269 1290778 0.75 - 0 transcript_id "g378.t1"; gene_id "g378"; 6 AUGUSTUS start_codon 1290776 1290778 . - 0 transcript_id "g378.t1"; gene_id "g378"; # protein sequence = [MIVGSSSKISRTINQIFLGRFKNLPIRLLRKSKTGSIITNPDTTRVESDEDWAIFIGTDGFQVHPGPAGTLTAVRVPE # PRTNGGTLIKLQDLHEKASFTSSTEKAKVFQGLLTDVPALHKGNNVPKTNLAYLNGVFAYLASVKAVSAPQPPEAWVTIYNEMHDAKGDAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g378 ### # start gene g379 6 AUGUSTUS gene 1292630 1293049 0.51 + . g379 6 AUGUSTUS transcript 1292630 1293049 0.51 + . g379.t1 6 AUGUSTUS start_codon 1292630 1292632 . + 0 transcript_id "g379.t1"; gene_id "g379"; 6 AUGUSTUS CDS 1292630 1293049 0.51 + 0 transcript_id "g379.t1"; gene_id "g379"; 6 AUGUSTUS stop_codon 1293047 1293049 . + 0 transcript_id "g379.t1"; gene_id "g379"; # protein sequence = [MRKTKEGVLITKPDTKVTADEQWILFIGPDGFHAHPGSGKSLIAEHVPAPRTALGYMPTMQDLGEKATFPTAEERDEV # FKKLLTDVPALHGGAGVSQTDLSYLNGIFAYLASVKAVSSSRPPEEWMKLYNEMHAVKGYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g379 ### # start gene g380 6 AUGUSTUS gene 1299944 1300612 0.47 - . g380 6 AUGUSTUS transcript 1299944 1300612 0.47 - . g380.t1 6 AUGUSTUS stop_codon 1299944 1299946 . - 0 transcript_id "g380.t1"; gene_id "g380"; 6 AUGUSTUS CDS 1299944 1300164 0.47 - 2 transcript_id "g380.t1"; gene_id "g380"; 6 AUGUSTUS CDS 1300216 1300612 0.97 - 0 transcript_id "g380.t1"; gene_id "g380"; 6 AUGUSTUS start_codon 1300610 1300612 . - 0 transcript_id "g380.t1"; gene_id "g380"; # protein sequence = [MKLKALGIECWLSSSNTDEHPIGNTETSFSATTGTTTVKTSVFPSEEPDSEVRKTDKGFDKKLIHWKVDYYLSWSTSS # NEPMSLWCIVFSRKPTGRLEIVESKVWMCSSKQNTQQRSSEHFHDDPPRRFRPHSIKSSDNMGTLRLEIERLDGTVNAVCLLGVDDLDIDVLDEKYPW # IVFEFNFKRKNNDGEWNSICNQTYLKILS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g380 ### # start gene g381 6 AUGUSTUS gene 1305221 1306465 0.51 + . g381 6 AUGUSTUS transcript 1305221 1306465 0.51 + . g381.t1 6 AUGUSTUS start_codon 1305221 1305223 . + 0 transcript_id "g381.t1"; gene_id "g381"; 6 AUGUSTUS CDS 1305221 1306465 0.51 + 0 transcript_id "g381.t1"; gene_id "g381"; 6 AUGUSTUS stop_codon 1306463 1306465 . + 0 transcript_id "g381.t1"; gene_id "g381"; # protein sequence = [MLHEHTYPSPLSSRSKKFTKDKQIFSMTRGSALPLDESSDVPGPSEQPSNSQARASFSTGPLVDTPVAGKLATATPHP # SSAPESFSPVTQPTASSDLDNTMNPTIKSPVPARNKRSRPNSSNDTSDDVGSVASRLKRRKASLAASSDPAPQGNTPTAAPPPVSTSPVIPSVPSNPV # DRAISSAQPVQRSDGPFNLWGPMPVHMHRVPATRQTASSSAHVAASSNNPLITASGLPRIEESYNLWTAKFPIPFERRRNLSPDPADSSQPATDSNQP # NVGNLLNAPSSSSVTSSSLPIASSSRPTTTSSQPIASSSQPTASFSQPTERRRPAPLKRANERLMMNSDGTLELIDIDTPERIAASEELVRDAQRKGH # YFTLTTIAEQCAPRYPFLFAGKKEDDYHSICPPSPRAGWGYK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g381 ### # start gene g382 6 AUGUSTUS gene 1310040 1310945 0.8 + . g382 6 AUGUSTUS transcript 1310040 1310945 0.8 + . g382.t1 6 AUGUSTUS start_codon 1310040 1310042 . + 0 transcript_id "g382.t1"; gene_id "g382"; 6 AUGUSTUS CDS 1310040 1310945 0.8 + 0 transcript_id "g382.t1"; gene_id "g382"; 6 AUGUSTUS stop_codon 1310943 1310945 . + 0 transcript_id "g382.t1"; gene_id "g382"; # protein sequence = [MWDPLWNLFKLALKIKDVNAGKPTVTVGVMSQYRIEKNYGNVRRYKVPDTVVLGLDDTPQKVLLFWAEIKPLDYYDWF # TPEAYDAARVQIANTVNQVNTQAQYICEEFQIDRTRPFTIYAFIIAGPYWVLVDYTNNSLSPDFFTTAHSRRNGPYTRSQVPVPVAEDAGIEIDVGVE # VPAEEEDAEDVVTTPGFPYGTEPRCSFKMRRLGDDDRDDDSEGDELGEDNDDELDDLNEDEGDEEEEAKSEGGMFNGEFSLDLPLRWYHINPILLMAL # RRIMGNNHDAFRRRMQNVSWFDCNYGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g382 ### # start gene g383 6 AUGUSTUS gene 1311678 1313947 0.18 - . g383 6 AUGUSTUS transcript 1311678 1313947 0.18 - . g383.t1 6 AUGUSTUS stop_codon 1311678 1311680 . - 0 transcript_id "g383.t1"; gene_id "g383"; 6 AUGUSTUS CDS 1311678 1313102 0.64 - 0 transcript_id "g383.t1"; gene_id "g383"; 6 AUGUSTUS CDS 1313198 1313746 0.37 - 0 transcript_id "g383.t1"; gene_id "g383"; 6 AUGUSTUS CDS 1313798 1313947 0.38 - 0 transcript_id "g383.t1"; gene_id "g383"; 6 AUGUSTUS start_codon 1313945 1313947 . - 0 transcript_id "g383.t1"; gene_id "g383"; # protein sequence = [MCAISSHGGRRRFQVLAIVFLMALSSFLLASSKKQTTVDTELDALFQSTAKEFEVSSSTLRSGKLKRKHQDVGSAPSE # LAIKKAKAKESKSSLKQKKILLPDTGTTKLNNPTKTSNAIVEKSSDGDEEEREESKSDGDDENDSELENAYLSRANGKGNFSASHRAGKHEEQSEGAD # DDVEEASSGADDDDEGRPPPDHESLTKRQRSKKPPKSIIKYVPPDENQDQRNARTIFSLLKSLQRHILSLILTPSGSSNMTPRIESTRFRSVPFAVPT # SRLEKEGDQSSTNNSNPKSSTKSRQHDIDRTKSWKKSSGDKDDEDAVKGEKQFLTPAQKKKVAFINQEIHASGSSVNAYIVFAHPTPASASDEVPKRK # SNLPPLPDVMNPYDAARLAKEYCDGSEFMERTLRVDVVAHTTDLSVAEAGRVLRTGSDVDPKRCVFVGNLDFESKEEDVRTYFEGIISAEKGLRPGEG # TEEKDVWSDDEGNEKKKGSAKARARSEGWVIRVRIIRDKDTQLGKGFAYVQFADRDCVDEILAAALEPGKLKFAKRKLRVERCKTIPGGSFKVKVKST # PITSSSRPNNPNHPSNFKTKRSTPSTSLASISIPKGDPTLGAKLAHLSKEDRKSAKAGDADRMARRLAKKKSRMAMAVGGRAGTGGVKLQGKERDRER # KLRSGGDAHGKKGKGHGAGSGTKNKGKAISTRALEQRNAKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g383 ### # start gene g384 6 AUGUSTUS gene 1322881 1324593 0.81 - . g384 6 AUGUSTUS transcript 1322881 1324593 0.81 - . g384.t1 6 AUGUSTUS stop_codon 1322881 1322883 . - 0 transcript_id "g384.t1"; gene_id "g384"; 6 AUGUSTUS CDS 1322881 1324593 0.81 - 0 transcript_id "g384.t1"; gene_id "g384"; 6 AUGUSTUS start_codon 1324591 1324593 . - 0 transcript_id "g384.t1"; gene_id "g384"; # protein sequence = [MSRPTLWSTADMDDDLADAVDAELSIYAQQGQNPAIYDQLGAQIEQLEPLLAIQQHMAALAAVPDVVKSVSGAEPFDE # LNSILPQFIVSFHQAILNRDLPSITMFYTTTFPKLTDRFYSRAEWPEPEIIAPLLSSNNATEDQVHIFLVLYRDLYYRHVYSRLQPNIDDRFHSYENS # CELFNYLLNSPSSANDESDEPAPVDLVLPEQWLWDIIDEFIYQFQVFCSWRSKVKSKTDDELMMLADGTGVWSSYSVLNVLYSLIQKSKINEYIVALK # EEQGKENPRPAEEVAQSISPYTALPLYRTLGYFSVLGLLRVHVLLGDFTLGLKVMDQVGEFLLGGSSFGAKTNKSSFTALPTLPATHISTHYYVGFCY # MMLCRYPDAIRTFVTVLNFFQRMQRMRNYSGYERKDQYDQIAKTADRTLALYAMCHSLVLPGSPFTRLDDNITNSAKERYGDQMGRMSRGGSDALVAF # EELFLYACPKFINANSPPYDDPEAIALLLNADPADAAEGLFFYISNLSLSLLIYSFFPRILPHTDRPYASSPSSLPGFSRRTVTSTYPALFPSLVHLS # DH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g384 ### # start gene g385 6 AUGUSTUS gene 1325198 1327666 0.79 - . g385 6 AUGUSTUS transcript 1325198 1327666 0.79 - . g385.t1 6 AUGUSTUS stop_codon 1325198 1325200 . - 0 transcript_id "g385.t1"; gene_id "g385"; 6 AUGUSTUS CDS 1325198 1327666 0.79 - 0 transcript_id "g385.t1"; gene_id "g385"; 6 AUGUSTUS start_codon 1327664 1327666 . - 0 transcript_id "g385.t1"; gene_id "g385"; # protein sequence = [MASVHDLIPAQQFGGRTGLSTTDATLSFVNDVQAAWNRDMVTSALTFDIKGFFDFVNHERLLSELRRKGIPLQMVKFI # KNFLTDRKAAVCVDGIISTLEDVTNGTPQGSPLSPILSAFYAAELLETLKCKSQELQKAPGSDGEKTPPPNLFMFVDDGKLHVCSKSLELNTAILRAI # WIEVIVPWGKKVGLSFDFVKRELMHYTRWKRDNNISPSITFHDDDGQTRVVAPQAVVRWLGVYFDWKLLFNHHVKTLAGSAGKVLGSLVMLANTVKGL # SPNHMRMMYKSCVVPVMTYASAAWWTGKKSHERLLEKIQHRGLRLICAVFRTTPIEAMEIEASIPPIQVELNRLNRNCALRFNKLSTSNPIIQRLDDK # WRAGLPPSRPPAIHYKLNRKGKKDESRTTQLQNIARLTSPSNERILPFSTPPWRRVGSDFGPRLRFIPPPPKCKDEDKKKRMRKLVEDHNSKLSTLQS # QSHNLCIYTDGSLKPIHRVRKTGAGLVAYQNNEEIFSRSIGLGVHAEAYDGEIVALSYAAGMAANLSSQNNMITHWQFFTDSASSIDTIFDTLPKPGQ # GYCSNFYRKIVEFLDMDITHTVEVAWVPSHTGIRGNEQADFLAKAGTELVNEAIWGRSLSNAKRINQVRAEREWRKIWESRSTYGRFAVANRIVPSLK # PSERLKETTRELFSRLTQCRTGHAFIGEYYLQFVPGENVDCPCGVELQTREHILRACPKYEEYRYILKRISDDICLTDILGTKEGIEALTEFISESGA # FTKSGTHWPAPTEPNYTPLGIWDELEITYHNLAGEGITPEADWREETVDSDDPGPETT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g385 ### # start gene g386 6 AUGUSTUS gene 1331768 1335331 0.48 - . g386 6 AUGUSTUS transcript 1331768 1335331 0.48 - . g386.t1 6 AUGUSTUS stop_codon 1331768 1331770 . - 0 transcript_id "g386.t1"; gene_id "g386"; 6 AUGUSTUS CDS 1331768 1332239 0.48 - 1 transcript_id "g386.t1"; gene_id "g386"; 6 AUGUSTUS CDS 1332351 1335331 0.49 - 0 transcript_id "g386.t1"; gene_id "g386"; 6 AUGUSTUS start_codon 1335329 1335331 . - 0 transcript_id "g386.t1"; gene_id "g386"; # protein sequence = [MANIAVWFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWACRNITFRNTSHFDSPQTSVPSAINPVVAKVAV # PLPEPSPSVLPTILETPPGDSPRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTAPTVPPLHHSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLSHIYPLSEKELVALKDFIDKQLATGAITPSSSPHGTPVLF # VPKKDGKLRLCVNFRGLNCITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDMPEEHQEHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYHRFIYSYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLSASLRATFLEGLVLRALIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLCLDDRIYVPNHGDLCLQVLCYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDQSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSKFVLVFFRALGKALSMELHYTSGYHPEADGQTEHVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHSNITVRPEVDMKISHPEFPIGSEVFVLAKHIRSTCPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRWIHPVFHV # SQLEPVTPNPFPNHTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYKGTNDEFSWVAADELHADELVPAFHAQYPQKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g386 ### # start gene g387 6 AUGUSTUS gene 1335664 1336920 0.92 - . g387 6 AUGUSTUS transcript 1335664 1336920 0.92 - . g387.t1 6 AUGUSTUS stop_codon 1335664 1335666 . - 0 transcript_id "g387.t1"; gene_id "g387"; 6 AUGUSTUS CDS 1335664 1336920 0.92 - 0 transcript_id "g387.t1"; gene_id "g387"; 6 AUGUSTUS start_codon 1336918 1336920 . - 0 transcript_id "g387.t1"; gene_id "g387"; # protein sequence = [MATCGGYWDWSGCSQGMTDDDSSGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPHSPISPDIPNEQHAMLELLLGFKG # SIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPQKLKTFFVNLALVFNDCPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSFFK # ALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGQGLAERIKDEMARLPKPATLADYRQEVRRIDNRYWKRE # ETRKREAGKPFVARNPKKGSSDFKTGSSNQHNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNN # LCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g387 ### # start gene g388 6 AUGUSTUS gene 1341904 1342982 0.24 - . g388 6 AUGUSTUS transcript 1341904 1342982 0.24 - . g388.t1 6 AUGUSTUS stop_codon 1341904 1341906 . - 0 transcript_id "g388.t1"; gene_id "g388"; 6 AUGUSTUS CDS 1341904 1342300 0.73 - 1 transcript_id "g388.t1"; gene_id "g388"; 6 AUGUSTUS CDS 1342801 1342982 0.43 - 0 transcript_id "g388.t1"; gene_id "g388"; 6 AUGUSTUS start_codon 1342980 1342982 . - 0 transcript_id "g388.t1"; gene_id "g388"; # protein sequence = [MVPKSLSGGVTTASDVDSAGDSFEAHAYKDSPAIAGEDGDESHIEWSVSPPPRAPLPLESLRAGKILAVPNSSPPTAR # SVGIDAAPPQDLASIVINGCTYYASDDPLFKKIVLPPTLGHEDSADESISGSLDLCYPPEGVPDPVTAPPRLLHDTSEDYDDMDIDLPEDSAAYLPCT # RPLLICLLILWMVGRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g388 ### # start gene g389 6 AUGUSTUS gene 1354417 1355951 0.27 - . g389 6 AUGUSTUS transcript 1354417 1355951 0.27 - . g389.t1 6 AUGUSTUS stop_codon 1354417 1354419 . - 0 transcript_id "g389.t1"; gene_id "g389"; 6 AUGUSTUS CDS 1354417 1355317 0.68 - 1 transcript_id "g389.t1"; gene_id "g389"; 6 AUGUSTUS CDS 1355399 1355406 0.69 - 0 transcript_id "g389.t1"; gene_id "g389"; 6 AUGUSTUS CDS 1355757 1355951 0.47 - 0 transcript_id "g389.t1"; gene_id "g389"; 6 AUGUSTUS start_codon 1355949 1355951 . - 0 transcript_id "g389.t1"; gene_id "g389"; # protein sequence = [MSHRVDLMQLVEDAVDGCWIGHCARTAIMEDTGTGIGSVYSPPKEDEGQTRKHVEAVIDIGPRLERGSIVTSDSVGGK # VDVWSEENVGTEIKITFPVEVVEADEVVEMGHLRLDDVNPSPTVSLVGFEDPHKGIRLMRSVLKTYITKWWGLEILENHDGELGNIVILNEDVSVVVK # ATQRHDTSRPFVVLSALRGNPTMMSAASDHELIGGFCRIIYKPGGPSRIRSVLRLCLHAMKIGSKSSHASLFEERQVSNQSFVHNGALSAANTIVPRR # YSEDSHLLTPRPSMSPRSTTAHPNGSSSWKMPTSTVVEEKTDLSDPDTNEPTITLDSGGTLLKSSIRSIDTQLQKIRVLLIEDNSVLRGLLCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g389 ### # start gene g390 6 AUGUSTUS gene 1356531 1359407 0.27 - . g390 6 AUGUSTUS transcript 1356531 1359407 0.27 - . g390.t1 6 AUGUSTUS stop_codon 1356531 1356533 . - 0 transcript_id "g390.t1"; gene_id "g390"; 6 AUGUSTUS CDS 1356531 1357104 0.43 - 1 transcript_id "g390.t1"; gene_id "g390"; 6 AUGUSTUS CDS 1357250 1357358 0.46 - 2 transcript_id "g390.t1"; gene_id "g390"; 6 AUGUSTUS CDS 1357850 1357980 0.97 - 1 transcript_id "g390.t1"; gene_id "g390"; 6 AUGUSTUS CDS 1358089 1359407 0.84 - 0 transcript_id "g390.t1"; gene_id "g390"; 6 AUGUSTUS start_codon 1359405 1359407 . - 0 transcript_id "g390.t1"; gene_id "g390"; # protein sequence = [MRAAGAPGRNILVTVPGTVPEDTDSALASSEDGSPSDRVLVDNDPVDASSSGKELFRTHSRNSSTDVKKFADGGDGRE # GGRWLDNSESTGSLVITPGGTTRRIRISQEQKKFWKGTRDVDRPLGTYGQFSASDSHSIGSPLAKGKGKTVKIHSPGLNNGDDDYFTRGREFSAASSS # QDGGQRTPKINVGIADLEVVHLSSRSPSAELDSVDDGLDKLHPLTIFDDRELTTSPPLNLSSNFGQSDDSNAIPTYISKPSLSAYSFPYLHDRAQMVP # HPSGTMSVPVPAITNGTSHTDAITAISNPTDSDSSIDGQLVRRMTLVRQSSAPLPVGSGSNSLLKGSMAVGMPIPPRILSSLNEAEKSELVPVTEDSF # SSPEASESNNNHRYSAAPSEKPKISNIAVGHGALSSNASIEAMGALINAGQSPSMRAVKEEQMFRELGFNIWNTGSDLNFDRIAHLAKLVFNTKGVFI # SLLDGNEQWFKSEFIDDAPREEFTPRHRHTLKEFAAIAMREMELWRDKVGRECLEIDMEQQDPQSPQGSPASAYEEQSSNPSLSMSGSSMERVYDRAA # KLVQRTLDVEGVIVMDVSHCEVLENMSGESTVNVVMHHGDPDVTETTTKSLTADEYAKLNVFFAKNPDGKISEGIVPQSFRLFLPTTRIQYALSEYCV # RSIASSSNWIFTAVPIYNIDKRPFALLCAYNASEHTKRFVSFRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g390 ### # start gene g391 6 AUGUSTUS gene 1359780 1360865 0.94 - . g391 6 AUGUSTUS transcript 1359780 1360865 0.94 - . g391.t1 6 AUGUSTUS stop_codon 1359780 1359782 . - 0 transcript_id "g391.t1"; gene_id "g391"; 6 AUGUSTUS CDS 1359780 1360865 0.94 - 0 transcript_id "g391.t1"; gene_id "g391"; 6 AUGUSTUS start_codon 1360863 1360865 . - 0 transcript_id "g391.t1"; gene_id "g391"; # protein sequence = [MQYSSHSFNGTSSGKAATLASISTSDAPLPSSTLPMLPKRAKKSSRPATAPAKEDVALLPSLQPSGKIRQPDIVYANL # QALHEDDSSSDHTNSRPESVPTTPSEPASSSTMQTSSSTMIMMQEPHSMLRDSTSHPESSLTSSQQSVGMFRNYTNTYDWAVFISAYASGRWDPHRTP # NPPDGLGHSMSPMRKLGSGRKPEDDENDEVEQNRTPTANTPSVTSSENVSPVSNRLRERNDLSVHAHHQTNSDLVPQLHRSPSSFPSPSGASRASHLV # SIPLGSSRSADSPAENSQYPPQKAKAGLFLNLPNLLSMSSSSGTSPGLEPSPASPSPLNVALQSNALHSNMHHSPLDDSSPLSKQTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g391 ### # start gene g392 6 AUGUSTUS gene 1362326 1363239 0.52 - . g392 6 AUGUSTUS transcript 1362326 1363239 0.52 - . g392.t1 6 AUGUSTUS stop_codon 1362326 1362328 . - 0 transcript_id "g392.t1"; gene_id "g392"; 6 AUGUSTUS CDS 1362326 1362678 0.87 - 2 transcript_id "g392.t1"; gene_id "g392"; 6 AUGUSTUS CDS 1362733 1362954 0.97 - 2 transcript_id "g392.t1"; gene_id "g392"; 6 AUGUSTUS CDS 1363008 1363239 0.61 - 0 transcript_id "g392.t1"; gene_id "g392"; 6 AUGUSTUS start_codon 1363237 1363239 . - 0 transcript_id "g392.t1"; gene_id "g392"; # protein sequence = [MCHHANGDSQSQDVSQMVEVPLTNGATNGNVNGKRGTSRNPHITNPIENQRRNPYAPRASDFLSNISNFNIIESTLRE # GEQFANAFFDTKTKIAIAKALDAFGVEYIELTSPAASEQSRADCEAICKLGLKAKILTHIRCHMDDARIAVETGVDGVDVVIGTSSFLREFSHGKDMA # YITKTAIEVINYVKSKGIEVRFSSEDSFRSDLVDLLSIYQTVDKIGVNRVGIADTVGCANPRQVYDLVRTLRGVVTCDIEIHLHNDTGMGMR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g392 ### # start gene g393 6 AUGUSTUS gene 1363416 1363817 0.74 + . g393 6 AUGUSTUS transcript 1363416 1363817 0.74 + . g393.t1 6 AUGUSTUS start_codon 1363416 1363418 . + 0 transcript_id "g393.t1"; gene_id "g393"; 6 AUGUSTUS CDS 1363416 1363817 0.74 + 0 transcript_id "g393.t1"; gene_id "g393"; 6 AUGUSTUS stop_codon 1363815 1363817 . + 0 transcript_id "g393.t1"; gene_id "g393"; # protein sequence = [MIPDGGSDKTPPQIWSIAIGKFGQKTAIGGSQKEKFGQNTLKFTINCTRKFNEPNLQPVALCRCRKIWALIPWPEGNS # DKSPSQNSTFGSDKIPQDQAKFSYGIIGYNQGSLLHSAQLRFAEDPMGARRGANW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g393 ### # start gene g394 6 AUGUSTUS gene 1367448 1367891 0.5 + . g394 6 AUGUSTUS transcript 1367448 1367891 0.5 + . g394.t1 6 AUGUSTUS start_codon 1367448 1367450 . + 0 transcript_id "g394.t1"; gene_id "g394"; 6 AUGUSTUS CDS 1367448 1367891 0.5 + 0 transcript_id "g394.t1"; gene_id "g394"; 6 AUGUSTUS stop_codon 1367889 1367891 . + 0 transcript_id "g394.t1"; gene_id "g394"; # protein sequence = [MSTEEEVVYFEDVDRRSNVAVSRSVAVDKTEVAIQVTASKPAATAVKRQRTLVDMFSTSNSQPNSKRLKTSVSSSVES # SSPSRSSASVFGIQKLNSIPFSLKAFQDSLNEEQARLLRLECAVMGKSWYDNHIMPKSSVDITLDMLSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g394 ### # start gene g395 6 AUGUSTUS gene 1369616 1370296 0.74 - . g395 6 AUGUSTUS transcript 1369616 1370296 0.74 - . g395.t1 6 AUGUSTUS stop_codon 1369616 1369618 . - 0 transcript_id "g395.t1"; gene_id "g395"; 6 AUGUSTUS CDS 1369616 1370296 0.74 - 0 transcript_id "g395.t1"; gene_id "g395"; 6 AUGUSTUS start_codon 1370294 1370296 . - 0 transcript_id "g395.t1"; gene_id "g395"; # protein sequence = [MSMHSRDFSDSPPSTRMSSHSPESAIVRLDDPAWDQTIVMSDTQSDLPNSSASSSYPLPPMSAPPSSKSMQYNPYPST # SRSSSGSGSAYMNSQSNYSQSGDRSLNNINYSIPLVRLDVREEPRTHYPYSPSPYDSNVQNTPPPSAPPHLHSQRDSSISYSIRRPIIEPYTLESGFP # QLPHHVSHHGMHVSSPSPRLQENGVGPELPAPRHIYNTTPEAINRTPSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g395 ### # start gene g396 6 AUGUSTUS gene 1375302 1376880 0.21 + . g396 6 AUGUSTUS transcript 1375302 1376880 0.21 + . g396.t1 6 AUGUSTUS start_codon 1375302 1375304 . + 0 transcript_id "g396.t1"; gene_id "g396"; 6 AUGUSTUS CDS 1375302 1375387 0.47 + 0 transcript_id "g396.t1"; gene_id "g396"; 6 AUGUSTUS CDS 1375451 1375745 0.52 + 1 transcript_id "g396.t1"; gene_id "g396"; 6 AUGUSTUS CDS 1376614 1376880 0.89 + 0 transcript_id "g396.t1"; gene_id "g396"; 6 AUGUSTUS stop_codon 1376878 1376880 . + 0 transcript_id "g396.t1"; gene_id "g396"; # protein sequence = [MVVVPKLTLDFQNRNDPDAATKFQEMAAAYEILSDPNTRVLYDEGGMEGLQGGRSGGPNMDDLFTQFFTGGGSGFSFG # FDMGPGPSRFSRQNDSVLPHEVTLEDLYNGKTVKMNMEKQVLCSSCKGCALAKLLPPKKPEMQPQPEIVDEVNFEEIDVRSQSFPASQDFFDHGYANQ # RDDIHDEDGWEDEDDDDEGAGDMFDDYMGGPAEPECRQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g396 ### # start gene g397 6 AUGUSTUS gene 1380250 1381848 0.28 + . g397 6 AUGUSTUS transcript 1380250 1381848 0.28 + . g397.t1 6 AUGUSTUS start_codon 1380250 1380252 . + 0 transcript_id "g397.t1"; gene_id "g397"; 6 AUGUSTUS CDS 1380250 1380461 0.52 + 0 transcript_id "g397.t1"; gene_id "g397"; 6 AUGUSTUS CDS 1380520 1380664 0.9 + 1 transcript_id "g397.t1"; gene_id "g397"; 6 AUGUSTUS CDS 1380720 1380848 0.81 + 0 transcript_id "g397.t1"; gene_id "g397"; 6 AUGUSTUS CDS 1380899 1381129 0.74 + 0 transcript_id "g397.t1"; gene_id "g397"; 6 AUGUSTUS CDS 1381185 1381315 0.99 + 0 transcript_id "g397.t1"; gene_id "g397"; 6 AUGUSTUS CDS 1381362 1381848 0.96 + 1 transcript_id "g397.t1"; gene_id "g397"; 6 AUGUSTUS stop_codon 1381846 1381848 . + 0 transcript_id "g397.t1"; gene_id "g397"; # protein sequence = [MKGREVPSDHQLRQNIERRMLALEEDPLSKRFNRQGVKKNARSTNRIGLAGAAHTSRSLQLKKKKGGNAGGQTASAAT # ATGDNGTAGTGSEIEANGVPSGVEAANAPTASNSLGLNIECDVGYLATIQMGTPPQDFLILMDSGSADLWVGSESCTSTAGGGCGSHTFLGTASSSTF # QDSGKQFAVTYGTGNVAGTIITDNIAVAGLNLTGHQFGVADSESDDFADNSVPFDGLMGLAQSSLSEQGVPTPPESLASAGLISDAITSFKISREADD # LNDGEITFGGLDATKFDSSTLTTFDNVNADGFWEGAMDSVTVDGTDTQLTGRTAILDTGTTLIVAPPADATAVHQLIQGSASDGQGGFTVPCTTNASV # ALSFGNTAFAIDPRDIAFQPVDANDPTGDCISGISSGEIGAATEWLVGDVFLKNAYFSVDVGKNAISLAKLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g397 ### # start gene g398 6 AUGUSTUS gene 1390837 1391118 0.53 - . g398 6 AUGUSTUS transcript 1390837 1391118 0.53 - . g398.t1 6 AUGUSTUS stop_codon 1390837 1390839 . - 0 transcript_id "g398.t1"; gene_id "g398"; 6 AUGUSTUS CDS 1390837 1391118 0.53 - 0 transcript_id "g398.t1"; gene_id "g398"; 6 AUGUSTUS start_codon 1391116 1391118 . - 0 transcript_id "g398.t1"; gene_id "g398"; # protein sequence = [MQSKVEKIVPREDDPSLAGSVVVNGETLLADFVIMGVGVAPATEFLKSSGIELEKGGGIEVDEYLRVVKLPAANIENV # FAIGRRFPLLSVRTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g398 ### # start gene g399 6 AUGUSTUS gene 1395441 1395815 0.76 + . g399 6 AUGUSTUS transcript 1395441 1395815 0.76 + . g399.t1 6 AUGUSTUS start_codon 1395441 1395443 . + 0 transcript_id "g399.t1"; gene_id "g399"; 6 AUGUSTUS CDS 1395441 1395815 0.76 + 0 transcript_id "g399.t1"; gene_id "g399"; 6 AUGUSTUS stop_codon 1395813 1395815 . + 0 transcript_id "g399.t1"; gene_id "g399"; # protein sequence = [MTATHKLMISMLTEKASIDEAFIDFTKPVRQVLLQRFPYLSQIPADAPNGVDTPLPPPPPIDWGTDSHLIPIYSNANS # ESTDEETSQSAPLTWHDIALRLAAEMMHKVRVDIAAQLGYTTSAVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g399 ### # start gene g400 6 AUGUSTUS gene 1396565 1397368 0.97 + . g400 6 AUGUSTUS transcript 1396565 1397368 0.97 + . g400.t1 6 AUGUSTUS start_codon 1396565 1396567 . + 0 transcript_id "g400.t1"; gene_id "g400"; 6 AUGUSTUS CDS 1396565 1397368 0.97 + 0 transcript_id "g400.t1"; gene_id "g400"; 6 AUGUSTUS stop_codon 1397366 1397368 . + 0 transcript_id "g400.t1"; gene_id "g400"; # protein sequence = [MLAAKALQKPITKIDDGPHWIRVLAAELSLRLNDARKERPNLWPKTLALHAGHGKVNCFRTLVVLKVRIGYGTARSKQ # APFPFTKEVTVNVIAAAGGKLWKELVGNVTGTIRITYISLGFTGIEATDASQQSIASFLDSHAVTGVKRPNEEKNGNPSKSRHRNTQRVRSRPSSPSA # DQNTTSFTCLECHKTLSLSPKLLSTSDVLGRAYALAALKDEHSDFHFAESVAREMEPEVKEVRGPHKKVKTPMIQEKEIGPRGIEKFFNRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g400 ### # start gene g401 6 AUGUSTUS gene 1401965 1403248 0.84 - . g401 6 AUGUSTUS transcript 1401965 1403248 0.84 - . g401.t1 6 AUGUSTUS stop_codon 1401965 1401967 . - 0 transcript_id "g401.t1"; gene_id "g401"; 6 AUGUSTUS CDS 1401965 1403248 0.84 - 0 transcript_id "g401.t1"; gene_id "g401"; 6 AUGUSTUS start_codon 1403246 1403248 . - 0 transcript_id "g401.t1"; gene_id "g401"; # protein sequence = [MREAHAFLIFATLITFSYVCADGIPQSPFTHEQQQQPSCMNRIVPPRTTTTITNVSVFDGYNFLPPQIVTIEGDAITD # FAFNVENIVDGTDKFLIPGLMDSHTHPDTCDDLKSFASYGITTAFQMACYDYAQCDILRNQEGVTDIMRAGIPAVGRHSAHSRQAKLFTSQSLYLGSD # ITAAVNNAFSNGSDFYKIVAEKNGPTLEQQKELVERVHALGRQTVTHASHLEYYLQAIESGTDSIQHVFADGEIDASMIAKIKARENMFVTPTMEMFR # IAYAYPRLAFILRGWKGFGKTSFADIQKNVHKMFMAGIPLLAGTDSIGNALRFLTGASLPFGPTLHCELENFVDIGMTPAEAIRSATAVPAAWHRVSD # RGVILPGMRADLVLLNSNPLLNISNARDIARVWIAGVEYLDVADGAKFSCSSLID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g401 ### # start gene g402 6 AUGUSTUS gene 1409541 1411133 0.28 + . g402 6 AUGUSTUS transcript 1409541 1411133 0.28 + . g402.t1 6 AUGUSTUS start_codon 1409541 1409543 . + 0 transcript_id "g402.t1"; gene_id "g402"; 6 AUGUSTUS CDS 1409541 1411133 0.28 + 0 transcript_id "g402.t1"; gene_id "g402"; 6 AUGUSTUS stop_codon 1411131 1411133 . + 0 transcript_id "g402.t1"; gene_id "g402"; # protein sequence = [MNQQRSRRFRAAKEARELRQKAEAKGEKLPEEKAFDSNCITPGTPFMARLSEQLKYFVNKKISEDSNWRDVQVVLSGH # EVPGEGEHKIMEYIRLSRSQPDYDPNLRHCLYGLDADLIMLGLLSHDPHFCLLREEVKFGPTRKSRGNSSLDSINFYLLHLSLFREYLHLEFNSLATE # LPFEYSLERIIDDFVLLAVFVGNDFLPNLPDLHIHENGLEKLFEVYKKVLPTMEGYINDAGTINLPRLQFILDEMAQWEVDVFEKENSDTNWYKGKQA # KYKNGATPKTNELVITKPQHDIFRAVRDWLMAKPTKALTMPNDFPAKDRLFILTIARDLNLSLAWDEYDEEGRNILSFSPAYPEDAFDDEEQEAQVAV # LRVLRKYEKAPIDGGEEDFDTRATNALSHKMDEWKRGYYSGKLEFSYDDPEQMQKLVYRYVEGLQWVMYYYFTGVKSWAWFYDYHYAPRISDLSSKAR # WGGEGGIGRRGIAQLSFDFKLGQPFRPYEQLMGVLPAASKDHIPTAYHVRQKTIIPPFLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g402 ### # start gene g403 6 AUGUSTUS gene 1412726 1413790 0.93 + . g403 6 AUGUSTUS transcript 1412726 1413790 0.93 + . g403.t1 6 AUGUSTUS start_codon 1412726 1412728 . + 0 transcript_id "g403.t1"; gene_id "g403"; 6 AUGUSTUS CDS 1412726 1413790 0.93 + 0 transcript_id "g403.t1"; gene_id "g403"; 6 AUGUSTUS stop_codon 1413788 1413790 . + 0 transcript_id "g403.t1"; gene_id "g403"; # protein sequence = [MLRAVDVLPGANPDARVKDIRSWLKSKGVQDFEAVTLFCDQLGKETITQIEKLADDFNGNRSTTGIKKAIVKGIPRQA # VLKPAHAIYRLQGQRFALSDRVIMVQDSGGVPLGAKGVVVGLNTKTMDVVWDMPFMSGTTLGDRCASVSLFISWSRFICFLRCSQYRGLAVEFNSCLN # LSDPQFVTSTNPKDQKQPLPVNHAAPFKPRSGPYPLVRPGPGQHPAAGFRPAPQQPSSSPPKPVHIMTNPQHQHPRAAGIVARGGITRSTDHTRGLSH # DHLANAPNSNARPSAPVANEGGYTPRGRGFHRGGGGFNSGLGYRGRGGFGPSMNERGRGGRGGGFRGRGRGYVPAPPLPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g403 ### # start gene g404 6 AUGUSTUS gene 1417726 1418892 0.9 + . g404 6 AUGUSTUS transcript 1417726 1418892 0.9 + . g404.t1 6 AUGUSTUS start_codon 1417726 1417728 . + 0 transcript_id "g404.t1"; gene_id "g404"; 6 AUGUSTUS CDS 1417726 1418892 0.9 + 0 transcript_id "g404.t1"; gene_id "g404"; 6 AUGUSTUS stop_codon 1418890 1418892 . + 0 transcript_id "g404.t1"; gene_id "g404"; # protein sequence = [MSTPIPPAPNTSADDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPMHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSASAPVAVTPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g404 ### # start gene g405 6 AUGUSTUS gene 1418943 1421837 0.33 + . g405 6 AUGUSTUS transcript 1418943 1421837 0.33 + . g405.t1 6 AUGUSTUS start_codon 1418943 1418945 . + 0 transcript_id "g405.t1"; gene_id "g405"; 6 AUGUSTUS CDS 1418943 1420323 0.43 + 0 transcript_id "g405.t1"; gene_id "g405"; 6 AUGUSTUS CDS 1420405 1421837 0.36 + 2 transcript_id "g405.t1"; gene_id "g405"; 6 AUGUSTUS stop_codon 1421835 1421837 . + 0 transcript_id "g405.t1"; gene_id "g405"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFKKCEFEQQQI # EYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDR # PTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWAL # YLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSNDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEE # DNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDL # ITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYQRSSVSMVFLFTLNPTVDPSLQLNSCDPFSLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g405 ### # start gene g406 6 AUGUSTUS gene 1422017 1422658 0.44 + . g406 6 AUGUSTUS transcript 1422017 1422658 0.44 + . g406.t1 6 AUGUSTUS start_codon 1422017 1422019 . + 0 transcript_id "g406.t1"; gene_id "g406"; 6 AUGUSTUS CDS 1422017 1422658 0.44 + 0 transcript_id "g406.t1"; gene_id "g406"; 6 AUGUSTUS stop_codon 1422656 1422658 . + 0 transcript_id "g406.t1"; gene_id "g406"; # protein sequence = [MSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAED # INLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVK # WKGYDTGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g406 ### # start gene g407 6 AUGUSTUS gene 1428367 1428984 0.83 + . g407 6 AUGUSTUS transcript 1428367 1428984 0.83 + . g407.t1 6 AUGUSTUS start_codon 1428367 1428369 . + 0 transcript_id "g407.t1"; gene_id "g407"; 6 AUGUSTUS CDS 1428367 1428984 0.83 + 0 transcript_id "g407.t1"; gene_id "g407"; 6 AUGUSTUS stop_codon 1428982 1428984 . + 0 transcript_id "g407.t1"; gene_id "g407"; # protein sequence = [MPEIPNPSHSILTNHPGACPLPGELGTPKSPAVRIRAILNALKYCPDPINNLEVKLVRQRAGKVLWSNNVGLGEDWTI # FIGHAGLQLKSDNIANPKTLLEAERVAFQPQFSEPSGRKPTRSLLTKTSFDSAEEKELFLHMLLNDLPLLLNEHKTTECFYNGHYDPALAYLDGVVSM # VLSMGSEKSEVWKSLVRDREKLYVQPRRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g407 ### # start gene g408 6 AUGUSTUS gene 1429782 1431182 0.34 + . g408 6 AUGUSTUS transcript 1429782 1431182 0.34 + . g408.t1 6 AUGUSTUS start_codon 1429782 1429784 . + 0 transcript_id "g408.t1"; gene_id "g408"; 6 AUGUSTUS CDS 1429782 1430011 0.45 + 0 transcript_id "g408.t1"; gene_id "g408"; 6 AUGUSTUS CDS 1430098 1430348 0.42 + 1 transcript_id "g408.t1"; gene_id "g408"; 6 AUGUSTUS CDS 1430446 1431182 1 + 2 transcript_id "g408.t1"; gene_id "g408"; 6 AUGUSTUS stop_codon 1431180 1431182 . + 0 transcript_id "g408.t1"; gene_id "g408"; # protein sequence = [MQRLLNTFQIPPDIKPIKVESSLQGLRVVWPAHEHTEHGEHESVYSWKWLKENSYDPRIEPEDKGTKKILWNARISHK # LAQSIISSMFIFLPSFQDIFGFSFITDVPPNAVSTESLVRRISFIRETHYGGFWEFTSNLAKGDTAYTNIALGAHTDNTYFVTSESSSSTTYTSTTYP # NTKFPNLYASSASPTSNDTQITSNANSANASSSPSAFTPSSLSSSATQGPDATVSSSYTASSAPNSSLGGQTLLIDGFYVASILRSLYPSAYRLLSEI # RIPAHAAGERDSAGIFSTGEGYTVLSHNASGELTQVRWNNDDRSVLSSISPSLVEEFYTALRTFHSLLTTPDSEFLIQLTPGTAVIVDNHRVLHGRTA # FVGNRRMCGAYIGKDEWKAKLRGLREKYEGKRM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g408 ### # start gene g409 6 AUGUSTUS gene 1433103 1434179 0.95 + . g409 6 AUGUSTUS transcript 1433103 1434179 0.95 + . g409.t1 6 AUGUSTUS start_codon 1433103 1433105 . + 0 transcript_id "g409.t1"; gene_id "g409"; 6 AUGUSTUS CDS 1433103 1434179 0.95 + 0 transcript_id "g409.t1"; gene_id "g409"; 6 AUGUSTUS stop_codon 1434177 1434179 . + 0 transcript_id "g409.t1"; gene_id "g409"; # protein sequence = [MDTTPQTELPHARTSAEIGSTSKTSPIEQNMTTGPLKAKLKAQEHQHRHYNHNHKPAGLERFRNFAKLTSHSRGSEAG # QPLSDCSSNNVQVLVGLSGEDSDAVENCPAIDTNSYTDDTENPNLLAERIRQLIISLPAIVVPPDNESSSDTVHTMPNFNLHLTHDLDASSCPPLPPP # PPSAILINDKHLINVLSNPLIMNGGKEEKQPTVWSVLLSLAPPSCHQRDESGNMGNTSISCNPPDTSVMLYLPLQPKTQDEVELAESQHIQVVVLPTL # AFLADDNGSARAEHVVTAGWRWWPFHSKKKDQIPGIPKTSSQTPSTPTPGVPKSTKSSLPPILPKVVKKIWLPSRTKFSIEATW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g409 ### # start gene g410 6 AUGUSTUS gene 1434724 1435143 0.96 + . g410 6 AUGUSTUS transcript 1434724 1435143 0.96 + . g410.t1 6 AUGUSTUS start_codon 1434724 1434726 . + 0 transcript_id "g410.t1"; gene_id "g410"; 6 AUGUSTUS CDS 1434724 1435143 0.96 + 0 transcript_id "g410.t1"; gene_id "g410"; 6 AUGUSTUS stop_codon 1435141 1435143 . + 0 transcript_id "g410.t1"; gene_id "g410"; # protein sequence = [MSLPGVTPTTRTDAHTTLDVADVSTPLAMKHSSPEETSTSSSSFVADDVFTVKGDVVQTPYVAQTPLSPSIGGTKFVE # ALEENEMLIAGSGLNSPVVGAAQPLGVAIDSLVIVTANKLEPVVEEGVEDWEEDVRSFSGC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g410 ### # start gene g411 6 AUGUSTUS gene 1442444 1442818 0.56 + . g411 6 AUGUSTUS transcript 1442444 1442818 0.56 + . g411.t1 6 AUGUSTUS start_codon 1442444 1442446 . + 0 transcript_id "g411.t1"; gene_id "g411"; 6 AUGUSTUS CDS 1442444 1442818 0.56 + 0 transcript_id "g411.t1"; gene_id "g411"; 6 AUGUSTUS stop_codon 1442816 1442818 . + 0 transcript_id "g411.t1"; gene_id "g411"; # protein sequence = [MREFNVRLSSERIKVEHAFGKLKGRFLSLKEMGWHKNLQEMYKVIEALLILHNMCIDYGDIPEHILDFDPSDNTIPVE # VAAGDIHFGLVDVTQEANIPQYETDQWIKEEGRRKRDLIFNDLFPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g411 ### # start gene g412 6 AUGUSTUS gene 1442834 1443610 0.91 - . g412 6 AUGUSTUS transcript 1442834 1443610 0.91 - . g412.t1 6 AUGUSTUS stop_codon 1442834 1442836 . - 0 transcript_id "g412.t1"; gene_id "g412"; 6 AUGUSTUS CDS 1442834 1443344 0.97 - 1 transcript_id "g412.t1"; gene_id "g412"; 6 AUGUSTUS CDS 1443429 1443610 0.91 - 0 transcript_id "g412.t1"; gene_id "g412"; 6 AUGUSTUS start_codon 1443608 1443610 . - 0 transcript_id "g412.t1"; gene_id "g412"; # protein sequence = [MYSYIREYEEFTGGGGDADLQSMVPESDEWHKQRLILSKRGGKSIGSLTVKKYRDWKDNGWFGKSSKVDRPTVRNSVA # PISPIIDDDDDIDNIHWPPTPGRESPAESIHSDSEIERSVALTTPTPKAGTSRSTPASQVVSEPRYQALATTKSSAKKKSSLASVDTFGAINTFFESK # AKLTQEQLRRSKTESATSVQSQQLQELRTILNSNIDELTREIVNEKIRKIISNY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g412 ### # start gene g413 6 AUGUSTUS gene 1447232 1449595 0.95 + . g413 6 AUGUSTUS transcript 1447232 1449595 0.95 + . g413.t1 6 AUGUSTUS start_codon 1447232 1447234 . + 0 transcript_id "g413.t1"; gene_id "g413"; 6 AUGUSTUS CDS 1447232 1449595 0.95 + 0 transcript_id "g413.t1"; gene_id "g413"; 6 AUGUSTUS stop_codon 1449593 1449595 . + 0 transcript_id "g413.t1"; gene_id "g413"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFRDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEI # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYMPMR # HMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKH # SSPRNIEVPELLNPGNTATRSPQLRSGTSPTVHALAQNSTPPPRANLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSN # PSVIPYQGSVSMQSQAVGTESQRGPNQRRTLTVHEEAVPPQGAPFGTPFVTGAQTNRPGMAFESAHSQESVAMIQQQARVIETLQEQLREVKEGFTAG # EVPTGGPLSKQETRRDYPGEHLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g413 ### # start gene g414 6 AUGUSTUS gene 1519309 1520810 0.3 + . g414 6 AUGUSTUS transcript 1519309 1520810 0.3 + . g414.t1 6 AUGUSTUS start_codon 1519309 1519311 . + 0 transcript_id "g414.t1"; gene_id "g414"; 6 AUGUSTUS CDS 1519309 1519508 0.37 + 0 transcript_id "g414.t1"; gene_id "g414"; 6 AUGUSTUS CDS 1520126 1520810 0.71 + 1 transcript_id "g414.t1"; gene_id "g414"; 6 AUGUSTUS stop_codon 1520808 1520810 . + 0 transcript_id "g414.t1"; gene_id "g414"; # protein sequence = [MPVLSAEAKAEIDKASAKLPRKYKTAPLFDITDPKSNDTWFEATESIFEHGGITSDEAKVRLALEWTKFDPRELTEEQ # QQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNEC # PHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNL # EAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g414 ### # start gene g415 6 AUGUSTUS gene 1520840 1523097 0.34 + . g415 6 AUGUSTUS transcript 1520840 1523097 0.34 + . g415.t1 6 AUGUSTUS start_codon 1520840 1520842 . + 0 transcript_id "g415.t1"; gene_id "g415"; 6 AUGUSTUS CDS 1520840 1521934 0.63 + 0 transcript_id "g415.t1"; gene_id "g415"; 6 AUGUSTUS CDS 1522328 1522584 0.43 + 0 transcript_id "g415.t1"; gene_id "g415"; 6 AUGUSTUS CDS 1522677 1523097 0.99 + 1 transcript_id "g415.t1"; gene_id "g415"; 6 AUGUSTUS stop_codon 1523095 1523097 . + 0 transcript_id "g415.t1"; gene_id "g415"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVDESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLQNIVLDG # YKRCEQETFSKKELSEAYVLASREHLKSQDDQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNEQFNLNPIKSLGENCDKSESTETTQNQCN # NENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPI # NLIDETNKQVDNEAIGVEKPIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g415 ### # start gene g416 6 AUGUSTUS gene 1523347 1524351 0.78 + . g416 6 AUGUSTUS transcript 1523347 1524351 0.78 + . g416.t1 6 AUGUSTUS start_codon 1523347 1523349 . + 0 transcript_id "g416.t1"; gene_id "g416"; 6 AUGUSTUS CDS 1523347 1524351 0.78 + 0 transcript_id "g416.t1"; gene_id "g416"; 6 AUGUSTUS stop_codon 1524349 1524351 . + 0 transcript_id "g416.t1"; gene_id "g416"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY # ILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIA # QVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLQVMFHLNGMKNVTKQWTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g416 ### # start gene g417 6 AUGUSTUS gene 1524863 1525255 0.46 + . g417 6 AUGUSTUS transcript 1524863 1525255 0.46 + . g417.t1 6 AUGUSTUS start_codon 1524863 1524865 . + 0 transcript_id "g417.t1"; gene_id "g417"; 6 AUGUSTUS CDS 1524863 1525255 0.46 + 0 transcript_id "g417.t1"; gene_id "g417"; 6 AUGUSTUS stop_codon 1525253 1525255 . + 0 transcript_id "g417.t1"; gene_id "g417"; # protein sequence = [MGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDE # EFVQNNPYPEAHRSSEGNRLDELIPLIGSTCRTHQMNPWVKCQKMNGLNLLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g417 ### # start gene g418 6 AUGUSTUS gene 1525578 1526615 0.4 + . g418 6 AUGUSTUS transcript 1525578 1526615 0.4 + . g418.t1 6 AUGUSTUS start_codon 1525578 1525580 . + 0 transcript_id "g418.t1"; gene_id "g418"; 6 AUGUSTUS CDS 1525578 1526615 0.4 + 0 transcript_id "g418.t1"; gene_id "g418"; 6 AUGUSTUS stop_codon 1526613 1526615 . + 0 transcript_id "g418.t1"; gene_id "g418"; # protein sequence = [MSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIR # ISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQA # LSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRV # LPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDENSVRERINN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g418 ### # start gene g419 6 AUGUSTUS gene 1526872 1528314 0.24 - . g419 6 AUGUSTUS transcript 1526872 1528314 0.24 - . g419.t1 6 AUGUSTUS stop_codon 1526872 1526874 . - 0 transcript_id "g419.t1"; gene_id "g419"; 6 AUGUSTUS CDS 1526872 1527296 1 - 2 transcript_id "g419.t1"; gene_id "g419"; 6 AUGUSTUS CDS 1527378 1527510 0.84 - 0 transcript_id "g419.t1"; gene_id "g419"; 6 AUGUSTUS CDS 1528147 1528314 0.7 - 0 transcript_id "g419.t1"; gene_id "g419"; 6 AUGUSTUS start_codon 1528312 1528314 . - 0 transcript_id "g419.t1"; gene_id "g419"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTGPNKGSNKDEKSA # VNEVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSR # QDLVRLFCSDASFATAQSIPTTGSEDTVVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g419 ### # start gene g420 6 AUGUSTUS gene 1534338 1534880 0.98 + . g420 6 AUGUSTUS transcript 1534338 1534880 0.98 + . g420.t1 6 AUGUSTUS start_codon 1534338 1534340 . + 0 transcript_id "g420.t1"; gene_id "g420"; 6 AUGUSTUS CDS 1534338 1534880 0.98 + 0 transcript_id "g420.t1"; gene_id "g420"; 6 AUGUSTUS stop_codon 1534878 1534880 . + 0 transcript_id "g420.t1"; gene_id "g420"; # protein sequence = [MSTPDPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPQVCKGKDGAEARRFMAQFQNWASEQPDLTKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAAFAQKFKDIGDQTEMSDIDLRERDKTV # PTGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g420 ### # start gene g421 6 AUGUSTUS gene 1536033 1538282 0.97 + . g421 6 AUGUSTUS transcript 1536033 1538282 0.97 + . g421.t1 6 AUGUSTUS start_codon 1536033 1536035 . + 0 transcript_id "g421.t1"; gene_id "g421"; 6 AUGUSTUS CDS 1536033 1538282 0.97 + 0 transcript_id "g421.t1"; gene_id "g421"; 6 AUGUSTUS stop_codon 1538280 1538282 . + 0 transcript_id "g421.t1"; gene_id "g421"; # protein sequence = [MFTTSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTWNHVRCAPLHKPIDVF # NINGTPNRAGRITHFAHLPLTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGQLSVKPPRVTIEEIPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEQSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQMEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLHFVQDYWKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGTFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAASKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPKKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLWELRGFLGFANFYRCFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIIMDHSNLEFWRTAQDLTRRQARWALYLSQFDFHMIHRPGRVNTQADALSRMAVHHVLDSDDNRQQTVLKPGHFQLRSYGTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g421 ### # start gene g422 6 AUGUSTUS gene 1539098 1539739 0.92 + . g422 6 AUGUSTUS transcript 1539098 1539739 0.92 + . g422.t1 6 AUGUSTUS start_codon 1539098 1539100 . + 0 transcript_id "g422.t1"; gene_id "g422"; 6 AUGUSTUS CDS 1539098 1539739 0.92 + 0 transcript_id "g422.t1"; gene_id "g422"; 6 AUGUSTUS stop_codon 1539737 1539739 . + 0 transcript_id "g422.t1"; gene_id "g422"; # protein sequence = [MSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYECGKRKAHQFKVGDLVWLSAED # INLQLSSEKLGDRQLGPYHILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSWVRWKKLEYLVK # WKGYDTGHNSWEPAANLSRAPKIVQAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g422 ### # start gene g423 6 AUGUSTUS gene 1544374 1544823 0.54 + . g423 6 AUGUSTUS transcript 1544374 1544823 0.54 + . g423.t1 6 AUGUSTUS start_codon 1544374 1544376 . + 0 transcript_id "g423.t1"; gene_id "g423"; 6 AUGUSTUS CDS 1544374 1544823 0.54 + 0 transcript_id "g423.t1"; gene_id "g423"; 6 AUGUSTUS stop_codon 1544821 1544823 . + 0 transcript_id "g423.t1"; gene_id "g423"; # protein sequence = [MAALDVILRLLRPGDEIIAGDDLYGGTNRLLTFIRTHVGVTVHHVDTTDPNAVIPFIHPTKTAMVLLESPTNPLLKIA # DLALISKEVKERAPNAIVVVDNTMMSPYLQRPLEHGADIVYDSATKYLSGHHDLMAGMITCNRDDLAKVLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g423 ### # start gene g424 6 AUGUSTUS gene 1546916 1547456 0.54 + . g424 6 AUGUSTUS transcript 1546916 1547456 0.54 + . g424.t1 6 AUGUSTUS start_codon 1546916 1546918 . + 0 transcript_id "g424.t1"; gene_id "g424"; 6 AUGUSTUS CDS 1546916 1547087 0.54 + 0 transcript_id "g424.t1"; gene_id "g424"; 6 AUGUSTUS CDS 1547242 1547456 0.83 + 2 transcript_id "g424.t1"; gene_id "g424"; 6 AUGUSTUS stop_codon 1547454 1547456 . + 0 transcript_id "g424.t1"; gene_id "g424"; # protein sequence = [MISENHKHLVSLGVSHPSLEIIREKTAAPPYNLSTKLTGAGGGGCAVTLIPDGKHLPLGGSGLGILSPYPEHRNTSAK # DIHPGQVTPPETPDEANTSDPGDSIKASFETKSLLELTGWAQNLGKWLYV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g424 ### # start gene g425 6 AUGUSTUS gene 1548152 1548857 0.41 - . g425 6 AUGUSTUS transcript 1548152 1548857 0.41 - . g425.t1 6 AUGUSTUS stop_codon 1548152 1548154 . - 0 transcript_id "g425.t1"; gene_id "g425"; 6 AUGUSTUS CDS 1548152 1548400 0.64 - 0 transcript_id "g425.t1"; gene_id "g425"; 6 AUGUSTUS CDS 1548459 1548857 0.41 - 0 transcript_id "g425.t1"; gene_id "g425"; 6 AUGUSTUS start_codon 1548855 1548857 . - 0 transcript_id "g425.t1"; gene_id "g425"; # protein sequence = [MQDPDFDDGSTLCKITKEYVFTLVMCMEYGSNVTFFSFRKRYMSSAGPNTARRFLKHCDDYIECVSREAELREQGEVL # DLASFVDLRRENSAIRLCFGLFEYVLGLDLPQEVFDDPTFMEAYWAAADMVCWANDVYSYDMEQRKGLSGNNIVTVLMKDRNIELQAASDYIGLYFKV # LMDRYLDARKRIPSWGPEVDAAVARYMDATAHWVRGNLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g425 ### # start gene g426 6 AUGUSTUS gene 1557565 1559184 0.28 - . g426 6 AUGUSTUS transcript 1557565 1559184 0.28 - . g426.t1 6 AUGUSTUS stop_codon 1557565 1557567 . - 0 transcript_id "g426.t1"; gene_id "g426"; 6 AUGUSTUS CDS 1557565 1558432 0.82 - 1 transcript_id "g426.t1"; gene_id "g426"; 6 AUGUSTUS CDS 1558476 1559101 0.39 - 0 transcript_id "g426.t1"; gene_id "g426"; 6 AUGUSTUS CDS 1559182 1559184 0.41 - 0 transcript_id "g426.t1"; gene_id "g426"; 6 AUGUSTUS start_codon 1559182 1559184 . - 0 transcript_id "g426.t1"; gene_id "g426"; # protein sequence = [MNGQPAQQPKESYLAYGVPSASQVKRKHIADGVLNQTNNKRRRDVEDAADSFDDPGGQGAKHWTDEEKSKLFKWLMGP # GQDDHWNSLRATKNSCLREVIESPSHILAVANVSQCAHEVFGSKKTYQALKGCYERNFNLFKQIHIFENFLGATGSLELSPDLSETDSLREYERRLAS # ARKAGCDVGNITARTIDQWHRNGWYSLFYSRFSPWNGDPATTRSTNSRLIHGQSNGGSGVPHDDDDNDDHGLDFSHPLTQAVNSVSGLSHDRSSSLAM # SFMNPSEMQHAPPISPHTNVHMSTQPSHTSPILSSSAPSSGSLANNLLGSSNSLSNSSSLLNSSLNPALLQTGSPSFSSTSTLSSTNTASSTLTSSSS # SSGSNPPSSTPSSSSSLVSSSDQAVVNLTITQSMVSSYLQFLQAQTHASKMKLEYMRKREEREERDSQQRRELERLKMERERAEFDHKQSSANTKQKA # DRAIVGYFFLFFSGCHLLTIRPGAPGKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g426 ### # start gene g427 6 AUGUSTUS gene 1559687 1561594 0.67 - . g427 6 AUGUSTUS transcript 1559687 1561594 0.67 - . g427.t1 6 AUGUSTUS stop_codon 1559687 1559689 . - 0 transcript_id "g427.t1"; gene_id "g427"; 6 AUGUSTUS CDS 1559687 1561594 0.67 - 0 transcript_id "g427.t1"; gene_id "g427"; 6 AUGUSTUS start_codon 1561592 1561594 . - 0 transcript_id "g427.t1"; gene_id "g427"; # protein sequence = [MISSRPVTPPSIRPSPGQSIKYVKGRRGGSVARRNLQRTLTNTTERSQTDDNKNSNDNHHHVPIGPFIAPKEYEITWD # PEVVRNYMQNWEAKGYLKLRAEKLKWSPFLLVRAGAEGEFGVVKKTEAKEAVGTGPFISDNRLTALTTNGLSIEEGSASRGTDTPLSLFDDDNVVNAA # EMEASNLSKSSAQSPQPTLSNKPPLNGRRRMLSKRNSTPERELSPSPRHRRKRANVSTATCGTGDVIADENSSVDILVPQLVPTRNLEPSSTLKALDV # SNKIHQEDVLDDPSEIDNLAGADMPVGPSTLQRISKMSKQNENHTKDEIENGSEKKEGNVRLDEKSVEAEESAVEAGHWDTQRKCSPADHMDIEEAVE # AEVVLGRRSISRSSRQVSTLVKRVTRQSSKHSSVASPPPIISVDDELMQLEGTELVPATRPRQLRNFAVAVASDDSGDFLAGPVSDELQVNGRKPGKP # QQRKQVESVPEHNVHSESPVSVSNPSITDSMEDLFGDGDASLKGSESVEATAATSLLSLLHSKPVVFAALNGDATVDMKHASQSKELQDYDVKVEDID # AGSRHSIPSDITVFGSDTQSVRVVTKDDEGVDVEMVDAQGGEDGDLDADGSVDDGEYDIDDNVDADS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g427 ### # start gene g428 6 AUGUSTUS gene 1562716 1563423 0.91 - . g428 6 AUGUSTUS transcript 1562716 1563423 0.91 - . g428.t1 6 AUGUSTUS stop_codon 1562716 1562718 . - 0 transcript_id "g428.t1"; gene_id "g428"; 6 AUGUSTUS CDS 1562716 1563423 0.91 - 0 transcript_id "g428.t1"; gene_id "g428"; 6 AUGUSTUS start_codon 1563421 1563423 . - 0 transcript_id "g428.t1"; gene_id "g428"; # protein sequence = [MVELGWHGSCFDPPVETPEGDWFCSECSDNPHLHTDLNVTCDPSNNDQPTLDEYSEIPMRAVSIASSSRSQPAQAKSR # MGASRKRGQAPKAIQFPVGVTDNEELEMEVETRATPLRRTRTKSMQSLKKGKGPALDHSDDDLVTPNARQPKRMRLRLQSPAQPSNNINIPKVRLRIT # QKGKGKAKEREEEESKGLFDDVLGGDERDTSKTVILPSDKQRFERSRAIAEVNSFVSST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g428 ### # start gene g429 6 AUGUSTUS gene 1568332 1569708 0.3 + . g429 6 AUGUSTUS transcript 1568332 1569708 0.3 + . g429.t1 6 AUGUSTUS start_codon 1568332 1568334 . + 0 transcript_id "g429.t1"; gene_id "g429"; 6 AUGUSTUS CDS 1568332 1568588 0.41 + 0 transcript_id "g429.t1"; gene_id "g429"; 6 AUGUSTUS CDS 1569456 1569708 0.62 + 1 transcript_id "g429.t1"; gene_id "g429"; 6 AUGUSTUS stop_codon 1569706 1569708 . + 0 transcript_id "g429.t1"; gene_id "g429"; # protein sequence = [MYVLLNVPSSQGAPGFNNTDFLAAFQAAFMSFVISQDPNDKLRPTITPSWNIYSQGNTEMIFNKTVDGQPDVDVDSTD # NDLLERCNKVSTFLEILFQLILFQLWSGFMVEGEFGAHTNLSILTNVHSYVMGGADEYPGSDLMREANNGIVLVIIQYRLGIFGERMIYLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g429 ### # start gene g430 6 AUGUSTUS gene 1579426 1580311 0.85 - . g430 6 AUGUSTUS transcript 1579426 1580311 0.85 - . g430.t1 6 AUGUSTUS stop_codon 1579426 1579428 . - 0 transcript_id "g430.t1"; gene_id "g430"; 6 AUGUSTUS CDS 1579426 1579604 0.85 - 2 transcript_id "g430.t1"; gene_id "g430"; 6 AUGUSTUS CDS 1579666 1580311 0.93 - 0 transcript_id "g430.t1"; gene_id "g430"; 6 AUGUSTUS start_codon 1580309 1580311 . - 0 transcript_id "g430.t1"; gene_id "g430"; # protein sequence = [MDTAAAAAAGPKVIIKSSSIKTEEYNHKILQAVQGKTKAKQRYLKRKKERRKLNNKNNKNNQKKTSVSQSQVGEEEEG # TETEDEEVEVEMQEVDEEVTVPEEKEKRPKKRRKFSIELEDVEMHSESLAPPPAPSIQRSPTPQAALPTFPLPALPNPPSKATLALQGLDKALVDADI # ISPSKTLHIPPDGNIDGGTGLSEKMRKRLVDLGITELFAVQTSLLPFLLPSDPMHRALYQPYNPPRDVCVSAPTGSGKTLAYVVPIVEASGIPNSAMG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g430 ### # start gene g431 6 AUGUSTUS gene 1581194 1582734 0.45 + . g431 6 AUGUSTUS transcript 1581194 1582734 0.45 + . g431.t1 6 AUGUSTUS start_codon 1581194 1581196 . + 0 transcript_id "g431.t1"; gene_id "g431"; 6 AUGUSTUS CDS 1581194 1581437 0.45 + 0 transcript_id "g431.t1"; gene_id "g431"; 6 AUGUSTUS CDS 1581515 1582734 0.75 + 2 transcript_id "g431.t1"; gene_id "g431"; 6 AUGUSTUS stop_codon 1582732 1582734 . + 0 transcript_id "g431.t1"; gene_id "g431"; # protein sequence = [MSPADRLYRPTSSVNLHASAQQQQQQPGPRTPPKEGSLPIPGSYPPTTAVSNIIPAAVPHALKSGPAAVPSTLKPGPV # AVPTAAPASYRPPGTGRAPQSTPPAVPSILRPGNPQSDPHPSRRSSASPPRQSHLGNSATGSVPYVATHTPNPYTSSSPTPSNYNHNGALFYSPSTPV # PVSGGGPIPYASPSTPVPPSNRNSSLSYSSNVPSIQPHTHRQSSNPSSILDWNSTSQPEGPLSFPVPNFPGAPSIAVDPTVNGYGNSFYNSQPYQSPV # HVHQRTASFSHIQQQPARTSSSGSTDLPDPYLIARYQTPLPLPTETQGASSSSFSSHHRRTASAEPTLYRPAPPVPAKHPSYNTSTSPPPHNLSIPLS # PPPSEPTRSRTPVDESRLQALRQAEQEAARRREQEERDAELARILDQEEAEREEKERTLEQERQRQRELEKVRAPPVPLRKPDSPPPYAKAEEVRKAQ # EEKDAELARQLDRELNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g431 ### # start gene g432 6 AUGUSTUS gene 1583569 1583870 0.79 - . g432 6 AUGUSTUS transcript 1583569 1583870 0.79 - . g432.t1 6 AUGUSTUS stop_codon 1583569 1583571 . - 0 transcript_id "g432.t1"; gene_id "g432"; 6 AUGUSTUS CDS 1583569 1583667 0.91 - 0 transcript_id "g432.t1"; gene_id "g432"; 6 AUGUSTUS CDS 1583742 1583870 0.79 - 0 transcript_id "g432.t1"; gene_id "g432"; 6 AUGUSTUS start_codon 1583868 1583870 . - 0 transcript_id "g432.t1"; gene_id "g432"; # protein sequence = [MNTNRNESWRVLCLLVSNIESRMRPAPPITEPKIASELKTRSLDVPTGMPEIPFDNEIENEAYCSYGTRCDEQWL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g432 ### # start gene g433 6 AUGUSTUS gene 1588864 1589528 0.26 + . g433 6 AUGUSTUS transcript 1588864 1589528 0.26 + . g433.t1 6 AUGUSTUS start_codon 1588864 1588866 . + 0 transcript_id "g433.t1"; gene_id "g433"; 6 AUGUSTUS CDS 1588864 1589127 0.28 + 0 transcript_id "g433.t1"; gene_id "g433"; 6 AUGUSTUS CDS 1589292 1589528 0.35 + 0 transcript_id "g433.t1"; gene_id "g433"; 6 AUGUSTUS stop_codon 1589526 1589528 . + 0 transcript_id "g433.t1"; gene_id "g433"; # protein sequence = [MSKILRASRVWSKTIKYPKATRSFHSPFAVLGTTHSTPSSTASSVNVYEKQVDFSPEPVPYNGGQRTYVVSEPDPANT # HYQVPAGAYPAAAHNQSGVGESSAVRHATAPGSMGQRGGSHGGLGLSDQPSTHAGQGSLADRNPPPIESDVVEKFSKMSVKDAWKARK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g433 ### # start gene g434 6 AUGUSTUS gene 1600137 1600676 0.31 + . g434 6 AUGUSTUS transcript 1600137 1600676 0.31 + . g434.t1 6 AUGUSTUS start_codon 1600137 1600139 . + 0 transcript_id "g434.t1"; gene_id "g434"; 6 AUGUSTUS CDS 1600137 1600676 0.31 + 0 transcript_id "g434.t1"; gene_id "g434"; 6 AUGUSTUS stop_codon 1600674 1600676 . + 0 transcript_id "g434.t1"; gene_id "g434"; # protein sequence = [MAKHYRDPKTKIHIPYRERKSLSGTARYMSINTHLGREQSRRDDLESLGHVFMYFLRGGLPWQGLRAATNKQKYEKIG # EKKQTTAISELCEGFPGGCLSLYNVFQATEVSSEEFAIYMNYVRKLGFEETPDYDFLRELFTKVLKTLDEPDDGVYDWMLLNGGKGWEATNVNSKSSV # HIY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g434 ### # start gene g435 6 AUGUSTUS gene 1602893 1603294 0.47 - . g435 6 AUGUSTUS transcript 1602893 1603294 0.47 - . g435.t1 6 AUGUSTUS stop_codon 1602893 1602895 . - 0 transcript_id "g435.t1"; gene_id "g435"; 6 AUGUSTUS CDS 1602893 1603294 0.47 - 0 transcript_id "g435.t1"; gene_id "g435"; 6 AUGUSTUS start_codon 1603292 1603294 . - 0 transcript_id "g435.t1"; gene_id "g435"; # protein sequence = [MNSVERVIYYAEEIEQEAAHELPDKRPPSPWPSQGHVEFKDVILKYRPELPPVLKGISMNVKGGEKIGIVGRTGAGKS # SLMSAIYRLVELASGSIRIDGVNIANVGLTDLRTGLSIIPQDAVRFHSLPVIIRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g435 ### # start gene g436 6 AUGUSTUS gene 1605275 1605817 0.64 - . g436 6 AUGUSTUS transcript 1605275 1605817 0.64 - . g436.t1 6 AUGUSTUS stop_codon 1605275 1605277 . - 0 transcript_id "g436.t1"; gene_id "g436"; 6 AUGUSTUS CDS 1605275 1605817 0.64 - 0 transcript_id "g436.t1"; gene_id "g436"; 6 AUGUSTUS start_codon 1605815 1605817 . - 0 transcript_id "g436.t1"; gene_id "g436"; # protein sequence = [MDAAVEVKGASFSWDAPPPEREEKKMRRKNKTITNAQPAATAESPQEPFKLRDITITIPRGQLVAVVGQVGCGKTSLL # QGIIGEMRRTGGSVKFGGSVGYCPQSAWIQVGTDYVSAAFLTFSQNATIRENICFGRAFDEGRYWTAIKNSCLEPDLEMLPHGDMTEVGEKVGLFFLQ # RGSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g436 ### # start gene g437 6 AUGUSTUS gene 1610590 1612668 0.2 + . g437 6 AUGUSTUS transcript 1610590 1612668 0.2 + . g437.t1 6 AUGUSTUS start_codon 1610590 1610592 . + 0 transcript_id "g437.t1"; gene_id "g437"; 6 AUGUSTUS CDS 1610590 1610884 0.36 + 0 transcript_id "g437.t1"; gene_id "g437"; 6 AUGUSTUS CDS 1610941 1611418 0.5 + 2 transcript_id "g437.t1"; gene_id "g437"; 6 AUGUSTUS CDS 1611474 1612668 1 + 1 transcript_id "g437.t1"; gene_id "g437"; 6 AUGUSTUS stop_codon 1612666 1612668 . + 0 transcript_id "g437.t1"; gene_id "g437"; # protein sequence = [MAMESSSLTEMSLLGKRSRQPDELEQLQTPGPTPNPKRTKGTTTPVFDGNGNKENIPPLNLTPVNSNNASTPMSSRAV # RALRRSATSESFVTPSPARTAVKRTASFSTSFANLTLATPPSTPLTLLPLHARARALLRATSNNSNFFMPARDSEREIITRSIATFLSPSGADASHNL # YISGAPGCGKTALINSILDSLELDDTRIVNVNCMALKNIAALWDLLVDEFDGLLQKKRKSGMKRGNGREAVEALLYGMSTRCILVLDELDHIASNPQS # ISSLLSLARSDGLYVIGIANTHTLTSSPSSFTDDIRTLHFSPYTSAQLLQILQSRLSILTSQSNSKSAPDETLKQLLPLSTLTLLTKKIAALTGDVRT # LFEVLRRAIDLAVTSSATARIDDDNFFAEAGPVCSVTPTHVLAAITQSTADQTPVQTASTSTASNSEIVRRVASIGFQARLVLLSVLVAVQRIEAGLT # IDLSSSRNSSHGSLQNGPEFLATDKDIVVDGSHLHAYYSHILRRGGDASISSPVSRTDFSDLLGMLEGAGLIVLGPSQLSPKKKRVCFGPSASFGRSS # AWSSVRNGGTLTEEVRLAPGVWVDEVLRGLGAGFSSNIKASRDVNEEELNTLWMKEDTIIRKELKAIENKRNAQEGSQMFIDASLDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g437 ### # start gene g438 6 AUGUSTUS gene 1614996 1615478 0.89 + . g438 6 AUGUSTUS transcript 1614996 1615478 0.89 + . g438.t1 6 AUGUSTUS start_codon 1614996 1614998 . + 0 transcript_id "g438.t1"; gene_id "g438"; 6 AUGUSTUS CDS 1614996 1615478 0.89 + 0 transcript_id "g438.t1"; gene_id "g438"; 6 AUGUSTUS stop_codon 1615476 1615478 . + 0 transcript_id "g438.t1"; gene_id "g438"; # protein sequence = [MLPLSFKPPKSWSIRSKHVILPNSFSDDVRPHPVFVPPEENAFGKLSHPVVSIARIETPNKWFGRSSQGSLKPNLQRR # GVKVEEVEDENDLPRRSQSASRSGPRKSEPSSNLEDRIRSMYLNESTPPSTPPTKRNKKPRKSEPTLSSTSFGKCVFLFPFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g438 ### # start gene g439 6 AUGUSTUS gene 1618677 1620311 0.36 - . g439 6 AUGUSTUS transcript 1618677 1620311 0.36 - . g439.t1 6 AUGUSTUS stop_codon 1618677 1618679 . - 0 transcript_id "g439.t1"; gene_id "g439"; 6 AUGUSTUS CDS 1618677 1619915 0.78 - 0 transcript_id "g439.t1"; gene_id "g439"; 6 AUGUSTUS CDS 1620024 1620311 0.37 - 0 transcript_id "g439.t1"; gene_id "g439"; 6 AUGUSTUS start_codon 1620309 1620311 . - 0 transcript_id "g439.t1"; gene_id "g439"; # protein sequence = [MPRLALGSDERKKDAKGYQKVSWEDHRAALKKHKFYSNGLLEVNPNGQHPIFDLIEQSEAAWKAKLKSASRSLHEAVI # EYERRYGRKPPLGFDKWSIDKDLEAYWGIKPQDLQTIEFAHEVLPECDTYTLGKLNFKDSIALLNYSLPHNASVDYDMAEGGKMIMEMLREAGVDKYI # PPFRATFNPHDSPEMLTNRNLWLKAVAHAQERKSKTPSFWIYIELCLISSFLPAFSILDAPPLDDPYHGWLTACDPTSPASTTPIDFNAPYPTHLWPN # GDPMSPSHTRTFIYDHRAAMDPCNNPHLLRQHGQFVKFGKGVEPRNSLIPIFSFSPSVLHHDIISANPMNWFRDLPLGANPAWEDKVDERLHWRGANT # GIHYSKSIPWRLSHRIKMMEWAHHNLYSDLRILGLGVKKGERIGEGTVVEKARWVPAMLDISFTGKPIGCEEEDGSCGQLRDMFEWRKRANFVDAGKF # KYILDIDGNAWSSRFKRLITTSSCIFKATIYPEWYVSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g439 ### # start gene g440 6 AUGUSTUS gene 1631184 1632887 0.64 - . g440 6 AUGUSTUS transcript 1631184 1632887 0.64 - . g440.t1 6 AUGUSTUS stop_codon 1631184 1631186 . - 0 transcript_id "g440.t1"; gene_id "g440"; 6 AUGUSTUS CDS 1631184 1632887 0.64 - 0 transcript_id "g440.t1"; gene_id "g440"; 6 AUGUSTUS start_codon 1632885 1632887 . - 0 transcript_id "g440.t1"; gene_id "g440"; # protein sequence = [MIARLSDLSKAAEPTAFHHLLKTLDFNGRLLRVYTQNIDAIESKSGLSFGVPEFEGKRSKPRIATFQEVGDPGPSSTS # NRTPRCIPLHGTLQRVHCQICTHSFPLSDYLSSLTAGVPPECPECTSMERTRQLIGKRARGVGKLRPSVVLYNETHKDGEGVGEAVQKDLIGGKGRSG # ADLLLVVGTSLRVPGTKRMVREFSKAVHSRGSTSKESTPGSDEPVSQQQQQPLKSVYLNLDFPVPTREWEGVFDVWVQGDAQTFAHMLQEELKKELHA # KEVAVEKRRKKEEELALAILSGLPSVKQKPKAKTKTKEESHDKKRKGFVGEEHEIKRKKLVVEVPTYSQIFSQSHPKKYPLHSPSRISLLPPSPVSPI # CAPSRISQSPSSPVSPLRHLTIRIPPRSQIVKPPSQSLIQSYLSPSPLTPAKTSPTLGRPPPTPDHTPPRIGSLNFPTNKQDHNSYSIPQFKHHRIPP # SESASPSLLSEDESRYDPHVQALGGKHSRRDGTRSSGEGTWQGSYYLQFQSPRNSIRRSLGDSDIDMDMSTHNMDDFRDRMGTSCLRTTQVEVGDGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g440 ### # start gene g441 6 AUGUSTUS gene 1638344 1642777 0.99 - . g441 6 AUGUSTUS transcript 1638344 1642777 0.99 - . g441.t1 6 AUGUSTUS stop_codon 1638344 1638346 . - 0 transcript_id "g441.t1"; gene_id "g441"; 6 AUGUSTUS CDS 1638344 1642777 0.99 - 0 transcript_id "g441.t1"; gene_id "g441"; 6 AUGUSTUS start_codon 1642775 1642777 . - 0 transcript_id "g441.t1"; gene_id "g441"; # protein sequence = [MSFGNSPNIPRLPDEKQLVGEDNWRPFKREVTFAVQSKGLSGYLDGTIARPNSYPATIYPPTQTSTPLFSPTPCPEEW # EARDRLVAGAIVSNITDPVGLGIDETKRASEIWKELIRRFEKRDEQRIHLADTNLRQEKYDPETTMEDHEKRMRNLLKKVHDLGGTATDAQFRRIVIS # SMPPGWRQDVRSVPGTSSADAFTYLHTLWYEKEEERKEEERDTKRVKALMAAHTHTTTPNPFSAQANQPRSGNRASITCHNCGKPGHIARKCWAKGGG # MEGQGPKQGQPSKPKTGASANATQTDDTDTATPMATYVLSADSGTSTSTSAQIHKSTTDTTTRQNNSVLKGVCQWETIGRDVDRHLTTVPKAECTVCH # SRTSLYSTPAPVIRTFLDSGASEHCWVRRSDFIEYHEVQGQGGSSAISGAAGRFQILGTGTIQFVTRVQDEERTVRLQGVKHTPSFGHNLISLSTLDN # RGMRGEWGLGVLTVKAPNGNTILQGFGRNKMYEVEVLESGETSVNYSRARDRPADILTWHRRLGHIAIRRILRMSNRNLVDGLNITKRQVHGMCEDCL # YGKATKRPFDEILTHETEVLERVHMDLFGPSWTQSRGGATYLMLCTDGRSSFRVPYYLSNKRKETGLKALHEYRVMAEKQTGKRLKIIRIDGGGELNN # GAVDEYCKEHSILIEKVPHDSSAANGVAERSFRTVMEGTRTLLEESNLLYSFWGEASSTFIYVNNFVPSARFPDIVPVEAWTQKRHDISHLRPFGCEC # WATLPRRRTDGKLGRQAVKGKLLGYMGRRGYRIWIPELKRVEESHDVTFEEGTPHRTRKTEEVNEEEGASEETTRIPMPETDMLDARPNTPANTTETT # GSGDQPPARRENTQIPEGTHMEIDAPIIAPEPPRRSERGQIPSRRQLESDEYKEREQMAQERGESWTADTPLALIAQHPYAFAATSGDLWVPQSYKQA # MRRPDLWTGPMEQEFRTLEGKECWELVPLPPGANLTGGRWTYAIKFDAMGNLLKRKARYVAQGYTQIQGLDYDKTYGGVARMESVRLVLAITAILRLS # IFQVDFTAAFLNSPITHNVYMKQPEGFIKPGSEHLVCKLKKSIYGTMQGSHDWQTTLAAGYKEDGYITSRADPCIRYKRVGGEYTITSTYGDDICGGS # STMAGRHRAVADLGRRWEANEVTSEVLLGMTIRQNPETKAITISQKTYFQRMLAHFGLDHVRRRNTPLPPNVKLRQSPDPLPEDERHFMADKQYRAVV # GSVLWGQVCTRPDLAFAGSLLARYQLNPGRVHWECVEWVAGYILNTLDYSITYRAPPAKPGPGDGLKPYAYVDSDHAGCQDTYRSTSGHVFFMAGAPV # SWSSKRQATVALSTTESEYIGLSRAAQQAVWLTSFLQEVDLRQEGPINLLGDNFGSVSLTENSKRHALVKHIEMQHHYIREKVTSGEVDITRIRSGEN # IADILTKALNGTIHSKMVSMLGIDRTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g441 ### # start gene g442 6 AUGUSTUS gene 1644372 1644742 0.87 + . g442 6 AUGUSTUS transcript 1644372 1644742 0.87 + . g442.t1 6 AUGUSTUS start_codon 1644372 1644374 . + 0 transcript_id "g442.t1"; gene_id "g442"; 6 AUGUSTUS CDS 1644372 1644510 0.89 + 0 transcript_id "g442.t1"; gene_id "g442"; 6 AUGUSTUS CDS 1644603 1644742 0.98 + 2 transcript_id "g442.t1"; gene_id "g442"; 6 AUGUSTUS stop_codon 1644740 1644742 . + 0 transcript_id "g442.t1"; gene_id "g442"; # protein sequence = [MSTASSSNPKTQDKSGQDADDKKKQEARPHLGVLEEDDEFEEFAAADWDDSQTDLAHLGGVAPGAAKSGGDKLWEDNW # DDDDIEDEFSVQLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g442 ### # start gene g443 6 AUGUSTUS gene 1646403 1646717 0.95 + . g443 6 AUGUSTUS transcript 1646403 1646717 0.95 + . g443.t1 6 AUGUSTUS start_codon 1646403 1646405 . + 0 transcript_id "g443.t1"; gene_id "g443"; 6 AUGUSTUS CDS 1646403 1646717 0.95 + 0 transcript_id "g443.t1"; gene_id "g443"; 6 AUGUSTUS stop_codon 1646715 1646717 . + 0 transcript_id "g443.t1"; gene_id "g443"; # protein sequence = [MSSTSVEIPVQVASSVASSSHISQPNAVSHTIEGSHLPLDSTIVIHDLPATMDAVDNIFGRHCQEQEALPPYIEEPPA # YTPSGSNEPITLAMYLFKFGFREYSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g443 ### # start gene g444 6 AUGUSTUS gene 1655391 1656338 0.86 - . g444 6 AUGUSTUS transcript 1655391 1656338 0.86 - . g444.t1 6 AUGUSTUS stop_codon 1655391 1655393 . - 0 transcript_id "g444.t1"; gene_id "g444"; 6 AUGUSTUS CDS 1655391 1656338 0.86 - 0 transcript_id "g444.t1"; gene_id "g444"; 6 AUGUSTUS start_codon 1656336 1656338 . - 0 transcript_id "g444.t1"; gene_id "g444"; # protein sequence = [MYPAVPTFYTTGIPSSSSSSGALPSPPTMISQPQTFVVPMGSHAYYAPPPPGQYPTTSYYSYPYGHPGAYYTPAVAPV # VPPPAAPAAPPIVTMTNSGTGNSGAWSDEEIERLKIMAEEKKTGSGEIDWDDIISQWGSTRSRCVEFIGSTGSSLTSPIRHQILIKATQVGLKESSSV # RGVKRRRDVDGDPVSSAAPTPNATTVRNPSSTPSSTPVASPSLQNQHQPPSSNSKASTSVPVIPPGPAGQPWPMPVVAVSTSSPVNIGPSPPDHRVTS # YYRPRPTDPPSRPSSSSGASQLPTVHRYMYQPNGHHSESAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g444 ### # start gene g445 6 AUGUSTUS gene 1656552 1657102 0.65 - . g445 6 AUGUSTUS transcript 1656552 1657102 0.65 - . g445.t1 6 AUGUSTUS stop_codon 1656552 1656554 . - 0 transcript_id "g445.t1"; gene_id "g445"; 6 AUGUSTUS CDS 1656552 1656867 0.65 - 1 transcript_id "g445.t1"; gene_id "g445"; 6 AUGUSTUS CDS 1656906 1657102 0.88 - 0 transcript_id "g445.t1"; gene_id "g445"; 6 AUGUSTUS start_codon 1657100 1657102 . - 0 transcript_id "g445.t1"; gene_id "g445"; # protein sequence = [MDNPQYYQPLSHALNPPRSSSQPQFYKTASVEHQKTIESDDDDEGMVEEQLSRTSAPPSPKPPETARFRYSSEHQHEP # EPKRRGRPRGSKNRRGRVSSQAVKSSPPSHQPLHATGQGTNPPQLPEVTAQNQQYYEFQWRVLNLCAEFYGAAEELVVSVNLVRLVSTKIIH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g445 ### # start gene g446 6 AUGUSTUS gene 1661049 1662433 0.63 + . g446 6 AUGUSTUS transcript 1661049 1662433 0.63 + . g446.t1 6 AUGUSTUS start_codon 1661049 1661051 . + 0 transcript_id "g446.t1"; gene_id "g446"; 6 AUGUSTUS CDS 1661049 1661737 0.63 + 0 transcript_id "g446.t1"; gene_id "g446"; 6 AUGUSTUS CDS 1661785 1662433 1 + 1 transcript_id "g446.t1"; gene_id "g446"; 6 AUGUSTUS stop_codon 1662431 1662433 . + 0 transcript_id "g446.t1"; gene_id "g446"; # protein sequence = [MVYSRDSGFVLLNIPNVQIRSQQSSYSESGTLTIECIYVTPEGQAAIDRNIFLILRINSNEIPLDPRRMITFTAQVQG # IHAGQTYVLHGTDLDPEVLELYVPVFDSNDAKALQRQEDLDTLQGIFTEYAGLTELASAHVSHSMPISTNSPDLRGHLVLVNEDSGDIIGEVDQRVTV # HEDPDISHLEKGHEHGPVVIEINQDEEGQAIEVFARAIPTGQEDWMTKSARLVSQGISQTTNLLVNVVSSASSNYVNRSSPSTSTVPGAKSSPSSSKA # VAFISSSRTRTGLTHAHALTAQAVKVSGKTLSVIDDMIGKMIGTKSSCNTPKGMPVTLPSLNNVVNVPPPPPYSTSPNPLTDSVKPPLPPRKVPILSQ # SGSEKPPLPPRFISTPATAPPASSSALTAKAKLILSADLILSTLDQSVKQLIDVGGRSATRVVGHQLVAHLLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g446 ### # start gene g447 6 AUGUSTUS gene 1663746 1665052 0.29 + . g447 6 AUGUSTUS transcript 1663746 1665052 0.29 + . g447.t1 6 AUGUSTUS start_codon 1663746 1663748 . + 0 transcript_id "g447.t1"; gene_id "g447"; 6 AUGUSTUS CDS 1663746 1664035 0.69 + 0 transcript_id "g447.t1"; gene_id "g447"; 6 AUGUSTUS CDS 1664229 1664569 0.5 + 1 transcript_id "g447.t1"; gene_id "g447"; 6 AUGUSTUS CDS 1664613 1665052 0.87 + 2 transcript_id "g447.t1"; gene_id "g447"; 6 AUGUSTUS stop_codon 1665050 1665052 . + 0 transcript_id "g447.t1"; gene_id "g447"; # protein sequence = [MPLPLSAPSSTMGALTGFSGYMTLGLGAKSKPGIVKLNEAESLIIKDSALLCYVRLSRLDFTSIVDEGIIIGKDAKPS # RSETIGWQAAPEEIGSPRSEPSRPSSPAPAPQPSLLANATIRLMSPSLATNHSIFLVTTPTDRATATSEGSSIWQFEMKTWSEQIDELVLAGQYSDAL # KFLESIESKDLSDKVSPRCIPCISISDTFEGRPQGQFDKAIDTFTELNINPAKVVALYPESISGRLSVPRDKWIELYGGPPKQKDVVESPTEGSEADS # KGSETPKKSEHERSMTATDEMLDNLGLAGPGSIRGRLKGLGALMGAAAAVPTTQKDDDTASVKSQTSRPSKVDSDSGECGLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g447 ### # start gene g448 6 AUGUSTUS gene 1667091 1668113 0.72 + . g448 6 AUGUSTUS transcript 1667091 1668113 0.72 + . g448.t1 6 AUGUSTUS start_codon 1667091 1667093 . + 0 transcript_id "g448.t1"; gene_id "g448"; 6 AUGUSTUS CDS 1667091 1668113 0.72 + 0 transcript_id "g448.t1"; gene_id "g448"; 6 AUGUSTUS stop_codon 1668111 1668113 . + 0 transcript_id "g448.t1"; gene_id "g448"; # protein sequence = [MSLVARKKSMDPAKLWIKWLIYTLLCFTADLLDTLLSFVVPKSKPPLSLKPSDVDNLSDDEILNEFAKTRDGLDRQNL # EKGVEYDWTVLPRGTPGTVGKAVSVLSEEDESRTDSSEANALNLLWANTMIPVPRVRRVMKLEYLFFIVEDYIEGPTLAQVWSTYSLWQKIRVAFTLR # SYICQLQKLKAPRGAPPGPISNDGPRVCTSPLFGMLDLDQGPFASYADLASFFNEKAKLCYDYNNIPEDHPCRRQKFDDSEELVLSHQDLNPRNIIVG # LDGTIWMIDWGWAGYFPPWFEYVAMKEKSISEHYYQYWDLFIPFICGPYFEHEIWRLNMARGFSYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g448 ### # start gene g449 6 AUGUSTUS gene 1673352 1674155 0.78 + . g449 6 AUGUSTUS transcript 1673352 1674155 0.78 + . g449.t1 6 AUGUSTUS start_codon 1673352 1673354 . + 0 transcript_id "g449.t1"; gene_id "g449"; 6 AUGUSTUS CDS 1673352 1674155 0.78 + 0 transcript_id "g449.t1"; gene_id "g449"; 6 AUGUSTUS stop_codon 1674153 1674155 . + 0 transcript_id "g449.t1"; gene_id "g449"; # protein sequence = [MEPESIADRKHASRLPTSNHDIFGTATRLIDNLRISSPSIHHDFDIRHTEHLESLVIEMEQLQRTIIDHFQVRMQQVS # DVLKEMEDDAQETAILLESVAHSVDAKLQERGLQPWTRIRMSEDSEITCVSDRFSNSRGLKTKSSLSIPKSLESTASSANGSSTASAEKKAAPSTTSR # FVAWIKRKTSANALAKVSNPSPTLLQKDAPKQTFTDRGESDLDMMRTSIESALRTSVFPLRAAGRDLESLRESIASVSIQPFLFLLTKICK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g449 ### # start gene g450 6 AUGUSTUS gene 1678319 1679044 0.54 + . g450 6 AUGUSTUS transcript 1678319 1679044 0.54 + . g450.t1 6 AUGUSTUS start_codon 1678319 1678321 . + 0 transcript_id "g450.t1"; gene_id "g450"; 6 AUGUSTUS CDS 1678319 1679044 0.54 + 0 transcript_id "g450.t1"; gene_id "g450"; 6 AUGUSTUS stop_codon 1679042 1679044 . + 0 transcript_id "g450.t1"; gene_id "g450"; # protein sequence = [MEKLRSQAPKTGGVVISHLGNHEWMNAIGDWRYVYPSEIKTFGTVEARQRMISTGSIGRAWANNYTVASRLPLHPYLG # PPNTPYPPVRSRLYFEQDLDGTEKLETSHMHELDLESGPLSHAALSFVHGGLSPTYEALVPFPEKINELGTSLLRKLQRREQPPPHPPHPYPGLPPSA # TGEEHELYDANGPLWYRGWALEPEEKVCEDVEKVLKATGTRRMIMGHTPDFHVGRSFSRKSLCQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g450 ### # start gene g451 6 AUGUSTUS gene 1679651 1681030 1 - . g451 6 AUGUSTUS transcript 1679651 1681030 1 - . g451.t1 6 AUGUSTUS stop_codon 1679651 1679653 . - 0 transcript_id "g451.t1"; gene_id "g451"; 6 AUGUSTUS CDS 1679651 1681030 1 - 0 transcript_id "g451.t1"; gene_id "g451"; 6 AUGUSTUS start_codon 1681028 1681030 . - 0 transcript_id "g451.t1"; gene_id "g451"; # protein sequence = [MDLRRGSQAAVDRVVDYLASQTKTITTTAEIAQVATISANGDVHVGNLIAQAMEKVGKEGVITVKEGKTIEDEIEVTE # GMRFDRGFISPYFITDVKGQKVEFEKPLILLSEKKISALQDILPALELAAQSRRPLLIIAEDIDGEALAACIVNKLRGQLAVAAVKAPGFGDNRKSIL # GDLAILTGGTVFTDEIDIKLDKATPDMFGTTGSVTVTKEDTIFLNGEGSKDAIQARCEQLRALIADPTTSDYDGTRLQERLAKLSGGVAVIKVGGSSE # VEVGEKKDRYDDALNATRAAVEEGILPGGGVALLKASLMLSTTSPSPASSSTPVSPNANPIPTANFDQDLGVSIIRRAISGPSRAILNNAGEESSVIV # GTLLSTYGSPDKFAWGYDASKGEYVDMIKAGIVDPLKVVRTALVDAAGVASLLTTSECCVVDAPEEKPAAPMGGMGGMGGMGGMGGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g451 ### # start gene g452 6 AUGUSTUS gene 1683265 1683759 0.58 - . g452 6 AUGUSTUS transcript 1683265 1683759 0.58 - . g452.t1 6 AUGUSTUS stop_codon 1683265 1683267 . - 0 transcript_id "g452.t1"; gene_id "g452"; 6 AUGUSTUS CDS 1683265 1683589 0.69 - 1 transcript_id "g452.t1"; gene_id "g452"; 6 AUGUSTUS CDS 1683647 1683759 0.58 - 0 transcript_id "g452.t1"; gene_id "g452"; 6 AUGUSTUS start_codon 1683757 1683759 . - 0 transcript_id "g452.t1"; gene_id "g452"; # protein sequence = [MARTALELIGQSGFGYSFDNMVDDVPRHEYSIVIKDLAPALARLAFARFYLLPLALKILPTYALTFIMNITPWKSLHD # VRDMVNYMHELSVEVYEEKKCAFEEGDEAVVKQIGKGKDLLSIMSKLSSARSTRNAWITSPFASERE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g452 ### # start gene g453 6 AUGUSTUS gene 1689328 1691681 0.13 + . g453 6 AUGUSTUS transcript 1689328 1691681 0.13 + . g453.t1 6 AUGUSTUS start_codon 1689328 1689330 . + 0 transcript_id "g453.t1"; gene_id "g453"; 6 AUGUSTUS CDS 1689328 1689382 0.15 + 0 transcript_id "g453.t1"; gene_id "g453"; 6 AUGUSTUS CDS 1689507 1689683 0.56 + 2 transcript_id "g453.t1"; gene_id "g453"; 6 AUGUSTUS CDS 1689733 1691681 0.63 + 2 transcript_id "g453.t1"; gene_id "g453"; 6 AUGUSTUS stop_codon 1691679 1691681 . + 0 transcript_id "g453.t1"; gene_id "g453"; # protein sequence = [MDEVLSLSDLAGLSRRPGPLLFLTSSDESTFTSAEVSDLGLSRQESSSDFEEAVVESQFAFNIPDDGVLGKDDEQGHS # SDNNRFATWTVYPNRKTDSPEMVRHIGPADRSLPRLSEPKHLNVTLTSPSYHVASENPMEYPHISNLSSQTTPGSNIFDYEDPWMAIGVMLGVEKTPL # KPLKKRDFRKILAEIPTPVATPTSNVNIFATNHLVPDLIIAGSSSPSQLSDSKVRVSPSTHANTDAAQNPFRIFSPSVRKQPIFPNAFHSLVPYSSDE # AIFDHLSSSTHVNRSQLVSDFSIDQGRGIVNQTQSDMLTNIRPRSGSSKFSSPNYGREGKADSSYLVSEHQLPLLPNLRNDLDDVNTNDHRASNRAAD # LSSSPLFGRSLYSSSSHTRRGQALPLDLHRRQRHEPTHMHDLHHVQGGLSNFQEVAASQGGDPSSPLLTPIQFALSPRRLNFDPKCHVDFPFSAIAQA # GDEYLHTPEQRTRIGTYKNRTSHDDTDPPTIRLVNTTKQSTAASPSIVNSDVSSPNDLQLHASQSDQLRDNRRFAPASIPRLNPRTKLSTELDTSLHR # APARYRSPAVCPTNATENLPRTPQTRRSPLFSRFNASHAVPSSQSTLPTLFLNSPARRSARNHSHENTSKEIDIQDNRQSTREDNQKTEIPTPAHSIV # QDSTSKPEDEEVRERGLAESNVGEQPVPSAEAGSEKHSSRVALRFSLFADDEIESDSESE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g453 ### # start gene g454 6 AUGUSTUS gene 1691770 1692783 0.98 + . g454 6 AUGUSTUS transcript 1691770 1692783 0.98 + . g454.t1 6 AUGUSTUS start_codon 1691770 1691772 . + 0 transcript_id "g454.t1"; gene_id "g454"; 6 AUGUSTUS CDS 1691770 1692783 0.98 + 0 transcript_id "g454.t1"; gene_id "g454"; 6 AUGUSTUS stop_codon 1692781 1692783 . + 0 transcript_id "g454.t1"; gene_id "g454"; # protein sequence = [MSTNPSHILIARNSNNYYSVSRGPNNPSASLSSPTETHVHAAASASGAGISPYLLSESEPEEGAEETDGGEEDIEIHE # TFTKNAKFPGTVKIIVENTTFWTHKEVLVFASPFFEAALSGNWSETETEGKEGTDEEHSQRLSGRPPSIITISHSIGPDSETEMRVTFDPVKENDIDI # DRSRSDTLTKLQDSSPPPTAVIVLQEERPSTFHDFLQYIYPHLSCIITWNNVEPLIHISHKLLQPSLQRDCLTFLLTHAAGKPIKAMRIAELFEEEEL # YKESSRYEFPTFYTVTAIIPDIGLYWIIPVAGPKMKCAPLPKKPYSNSKSAETGFLNVFSKSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g454 ### # start gene g455 6 AUGUSTUS gene 1693392 1693853 1 - . g455 6 AUGUSTUS transcript 1693392 1693853 1 - . g455.t1 6 AUGUSTUS stop_codon 1693392 1693394 . - 0 transcript_id "g455.t1"; gene_id "g455"; 6 AUGUSTUS CDS 1693392 1693853 1 - 0 transcript_id "g455.t1"; gene_id "g455"; 6 AUGUSTUS start_codon 1693851 1693853 . - 0 transcript_id "g455.t1"; gene_id "g455"; # protein sequence = [MRPAAGIVGVVANPIQGAWKSAQTTFVKEQDEPHYQTRVEEGLQAVKFSTESERVKVVKRFKDLMQKEKVMDRKKNIA # KAAEEVMYESEKEEKLKVGKGMPSSSTSISTESPPSDLDLKESEDRTTRNTNTPQDEAMFERDLELAKRLSLYEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g455 ### # start gene g456 6 AUGUSTUS gene 1699201 1700841 0.69 + . g456 6 AUGUSTUS transcript 1699201 1700841 0.69 + . g456.t1 6 AUGUSTUS start_codon 1699201 1699203 . + 0 transcript_id "g456.t1"; gene_id "g456"; 6 AUGUSTUS CDS 1699201 1700841 0.69 + 0 transcript_id "g456.t1"; gene_id "g456"; 6 AUGUSTUS stop_codon 1700839 1700841 . + 0 transcript_id "g456.t1"; gene_id "g456"; # protein sequence = [MKTIQTLNILLTHLLSTSFKFLFPRTASFSEDAVVQQPGKKKRQGKKMQKKDKDPSDLRSDPTAGSSKPPLSLAEEFS # PEFWTSLERLFGILTTSILEPILKSFVSLSQHYLSMTFAPENQGIEKAGSSPFCKFSDIRPNLLSLVQSGCNQIFQAIVLFDSIDSLPRSRAQSTRDS # GYACYVSGVREYLSLVAVRELFKSFAVNYSGGLRNVNPTHKARSINAFLKSLPQDLSDPAISTCMKSRTSGVLPLPRSSGEISAFTTEQKPVPESSSA # DTQSKEFAAAPKPVSQHPRARTREARIRDLARKDAVWYLATVLHVLFEDGCFSDDVNDIGGIDTDEVGATITSVPSFEMNASSTNPGLNPNGDKSLDV # SVPSESNSLSTSSGSKELNHGIIPPVSVHLKVDNISQRHSSLNPNEAARSSLSLLRTGLLDSFDALLFLVTECRPAASFPVSEGCNGSLAMSDVNVAT # SNASANNVEDSMPVDTSGQAGGGIVNLHPTVTPSSGSCIRQLAFNLGSGIMDEVEYDIVLGVVERYWECTLGLKGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g456 ### # start gene g457 6 AUGUSTUS gene 1701647 1702400 0.73 - . g457 6 AUGUSTUS transcript 1701647 1702400 0.73 - . g457.t1 6 AUGUSTUS stop_codon 1701647 1701649 . - 0 transcript_id "g457.t1"; gene_id "g457"; 6 AUGUSTUS CDS 1701647 1702111 0.86 - 0 transcript_id "g457.t1"; gene_id "g457"; 6 AUGUSTUS CDS 1702176 1702400 0.73 - 0 transcript_id "g457.t1"; gene_id "g457"; 6 AUGUSTUS start_codon 1702398 1702400 . - 0 transcript_id "g457.t1"; gene_id "g457"; # protein sequence = [MFSFSLVAAVIALSAISTSARVTPRHRILPRVNTPSTYDTAILEDYFTYHARYLALGCQYNHGNDFFDACCHPLLQNE # TLSDLEARCTPDPSVLSSVSASLEGYTSTSSSWSSTADVTPTTDVAQVAAPTTTWSSSSSDTWTPDTWTSSSDTWTSSSDTWTSSSDTWTSSSDTWTS # SSDTWTSSSDTWTSTSSAVSASSTANVNTGGFGTFFYQNGVAGACGTVHSMSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g457 ### # start gene g458 6 AUGUSTUS gene 1703631 1703930 0.64 - . g458 6 AUGUSTUS transcript 1703631 1703930 0.64 - . g458.t1 6 AUGUSTUS stop_codon 1703631 1703633 . - 0 transcript_id "g458.t1"; gene_id "g458"; 6 AUGUSTUS CDS 1703631 1703930 0.64 - 0 transcript_id "g458.t1"; gene_id "g458"; 6 AUGUSTUS start_codon 1703928 1703930 . - 0 transcript_id "g458.t1"; gene_id "g458"; # protein sequence = [MKSKTVASILRHVASKIPSTDVEPKTVEAAPAPIDVGDKDSKKARRAARQAAHDEDGAEELPVSTGNEEDRLEMLYEQ # IAWPLGKTYGHPYDAFKLSLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g458 ### # start gene g459 6 AUGUSTUS gene 1704770 1708084 0.39 + . g459 6 AUGUSTUS transcript 1704770 1708084 0.39 + . g459.t1 6 AUGUSTUS start_codon 1704770 1704772 . + 0 transcript_id "g459.t1"; gene_id "g459"; 6 AUGUSTUS CDS 1704770 1705983 0.4 + 0 transcript_id "g459.t1"; gene_id "g459"; 6 AUGUSTUS CDS 1706710 1708084 0.5 + 1 transcript_id "g459.t1"; gene_id "g459"; 6 AUGUSTUS stop_codon 1708082 1708084 . + 0 transcript_id "g459.t1"; gene_id "g459"; # protein sequence = [MQITRQGPLPNDPSIISANRTRKTHKDAETITRISKLPIESKLRINFNKQTRNASRRERVFEGNDDVSDVSSYLSIPE # EEYDKMLKDQDYFDKVKAWLSAHTISWLVDRRKSLRSRTREGDDASAEASGTQPSKRFRSNDDLNEIDPTSPPNVFFDQAFLDLGLYGYHIPLALFTN # KNIEFLNNNSISFHRTKISHIEGKPQILDLADVIKKVKGSREGGPTQDLAMEHFEWLEATANFFVYQSLLYAEGDEANEPQFYRKHFGFFENQTDSVK # LFDLWKDIELELCQKHQNKKTHFDLFDYRTEWSRVKSRLDSLEASSSSNSSQPQSNRRSHIPNFRSTKIAAHDVPPSTSSNSFPLGNKEKASHEPCCI # ICGGVGHTFFTHTDSTHGPAKWALRDGKELLHPKSGKPRLFNNHSSFATFIRLFSGLTPSYSIRWSYCPLLITFAHLLPISLFALFILTQFAQVVSAP # PGTKVCTMDITKFHRTIPLRPQDKPYMVVRDPDGKFWVDHCYAFGAASASSNSGMVSSAGREIWQALGIAPIAKVEDDLAAFITPNTLSSLDLTNRED # LFALISDLGFPWHPEKGEHQFALTSTFIGFLWDLEHHRVSLPEDKRLKYLFRLQNFLETSHRRLTPRVKIESIHGTLCHIAFIYADGKTHLPPISNFM # SSYRNYEVEKGKYPDKIIPEIQWWIERLSVPHVYQQLRELGPVQDLGLFVDASTDWGIGIIIGGKWAAFHLANNWKIKGRDICWLETVAVEILLYFLE # SMDYKNTRLLIHSDNQGTIGAIRKSRSPNYWINMSIRRTCATIGPLFILPELTYIESANNPADPISRGILGLQDNHLPLQFQLPDELINILSYYVEVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g459 ### # start gene g460 6 AUGUSTUS gene 1708231 1709604 1 + . g460 6 AUGUSTUS transcript 1708231 1709604 1 + . g460.t1 6 AUGUSTUS start_codon 1708231 1708233 . + 0 transcript_id "g460.t1"; gene_id "g460"; 6 AUGUSTUS CDS 1708231 1709604 1 + 0 transcript_id "g460.t1"; gene_id "g460"; 6 AUGUSTUS stop_codon 1709602 1709604 . + 0 transcript_id "g460.t1"; gene_id "g460"; # protein sequence = [MHPYLAKSPKPLDVLPRKILPSLRCRFHSTPATPAPSSHSPAHLPPPPASRKPSPNNAIIPNTFRPNVRARDRLQAWD # TPFSINKRTLLSSIYPPEILELGKKATYAGLADSTKQSYGAGPLRWNQFCDEMSISENLRMPADDTLIIAFIGFHMGKVSASCIKNWLSGLRAWHELA # GASWPANSRLIRFARAGARIAGASQKRPQRNPITLAHLLALYSALDFSIPFHCAIWAVASTAFWGCRRLGELTIPSKNKFDPKYHVSRSAILKFAKNP # DHSRKSVSFKIPWTKTTKELGASVVGTAQHHSLQTLCPYHAIERHMAVNALVPQTYSLFAYLDDQGLPQHMVKTTFLSFCDHIWNAAGLEHVHGHSFR # IGGAVELLIAGVTPEVVAAIGGWTSLAFLLYWRRFEDILPTHVLKAYDSSQISRLKHSLDDFQKANGLSNSLIDACIMGIDVTEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g460 ### # start gene g461 6 AUGUSTUS gene 1712121 1716472 0.28 + . g461 6 AUGUSTUS transcript 1712121 1716472 0.28 + . g461.t1 6 AUGUSTUS start_codon 1712121 1712123 . + 0 transcript_id "g461.t1"; gene_id "g461"; 6 AUGUSTUS CDS 1712121 1712700 0.53 + 0 transcript_id "g461.t1"; gene_id "g461"; 6 AUGUSTUS CDS 1712859 1713221 0.28 + 2 transcript_id "g461.t1"; gene_id "g461"; 6 AUGUSTUS CDS 1713999 1716472 1 + 2 transcript_id "g461.t1"; gene_id "g461"; 6 AUGUSTUS stop_codon 1716470 1716472 . + 0 transcript_id "g461.t1"; gene_id "g461"; # protein sequence = [MPNVYSSMLDDTVTYAKWKPCGNGMPGTMSCGKITVETLEAAKRDLRIFLTNNRKLAASDYALRCLNVWEDPRVSNWI # DQNREKFSALSFNELFIAVRDRVLEPDWQDSTFRKMQAVCMPDDLSTSASDLAVQLMVLNNLLQGTARFQSEESLKMMLIDAIDSGLREAFNKELEDH # AANPVHGIHSNDFHTFTRSTTNTGRLPPLTTNERRLLSENEGCFKCRSFFVKCRTSSTEHEFPLPIGNGYKELTVADVTAARKLRGMNPDSNKKPRTA # AIASIGVTDDGDDDDVVASIMPSAVLGDGTDSEEEVSCPFPSRSYRCPRKFRAAWQTLIQKHLDSGKIRASDSPYASPSFVIPKSDPNALPRWVADYR # QLNDNTVVDAHPLPRIDDILSDCAKGRIWGKIDMTDSFFQTRMDEDSIKLTAITTLFGLYEWTVMPQGLKNSPAIHQRRVTSALRHLIGKICYVYVDD # IIIWSNSVEEHVTNVEKVLLALRIARLYCNPNKCDLFTLNVHFLGHTISADGIAADDKKVDRIMDWPTPKTLKELQAFLGLVRYVAAFLPRLAELTEI # LTALTANVVDKNHLPWEACHQNAFEAVKLLVSSRECLTVIDHDKLDTHKIFVTTDASDRCSGAVLSFGETWESAQPVSYDSSTFKHAELNYPVHEKEM # LAIIRALKKWRVDLLGVPFIIMTDHRTLENFHSQPDLSRRQARWMEFFSQFDCKIVYVKGERNTVADALSRRTDLLDPVKCHPYLDASADAIPTSRHP # YAYCADSDDDLDLPILCVLPDSCWSTARMLALRDPPDPPSPIATTLEISSDPTLLDDIHNGYTTDAWCKDLPSMASSMPLIRHDKTSKLWYIGDRLII # PRVGHIREELFRLAHDNLGHFGFDKSYAALRECYYWPHMCRDLSKAYIPACDECQRNKSTTQKKAGPLHPLPIPDRRFSSVAMDFIGPLPEDGGSNCI # LTITDRLGADIRILPCRTDLTASDCAQLFFDSWYCENGLPDDIVCDRDHLFVSKFWEALRSLAGVRLRMSTSYHPKSDGSSERSNKTVIQMLHYHVER # NQKGWKRALPRIRFEIMNTVNSSIGMSGFQLRCHASTIIHSPLNGDDQDSPSISQTLSPLSTDPRPYLPRSMPVPIQDSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g461 ### # start gene g462 6 AUGUSTUS gene 1717401 1718255 1 + . g462 6 AUGUSTUS transcript 1717401 1718255 1 + . g462.t1 6 AUGUSTUS start_codon 1717401 1717403 . + 0 transcript_id "g462.t1"; gene_id "g462"; 6 AUGUSTUS CDS 1717401 1718255 1 + 0 transcript_id "g462.t1"; gene_id "g462"; 6 AUGUSTUS stop_codon 1718253 1718255 . + 0 transcript_id "g462.t1"; gene_id "g462"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQLFGDETASNIRTPEGCQPEVQ # GPPPVEPGMGPPQRKFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPVPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLSVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPLPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMALRLEDVIRIQECIPEDVAMVLREVLESMGIEI # LGDGLEFSDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g462 ### # start gene g463 6 AUGUSTUS gene 1723555 1724073 0.34 + . g463 6 AUGUSTUS transcript 1723555 1724073 0.34 + . g463.t1 6 AUGUSTUS start_codon 1723555 1723557 . + 0 transcript_id "g463.t1"; gene_id "g463"; 6 AUGUSTUS CDS 1723555 1724073 0.34 + 0 transcript_id "g463.t1"; gene_id "g463"; 6 AUGUSTUS stop_codon 1724071 1724073 . + 0 transcript_id "g463.t1"; gene_id "g463"; # protein sequence = [MQLDGLGALFDQARQSFLRSFLDLQQAGQDPIVVLEALKAAEPQRESISVEDWTLLATLFQWSSPFNLNGLKFDNRTP # AEWIDLLRSIHSGATSATVTMDGHLVDASQPLEAAVEVSETLDPQGSPPITVVQKASGVGDLVSLSEGSPIQTELDLPQIESLTESTLAPEKGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g463 ### # start gene g464 6 AUGUSTUS gene 1725842 1726619 0.39 + . g464 6 AUGUSTUS transcript 1725842 1726619 0.39 + . g464.t1 6 AUGUSTUS start_codon 1725842 1725844 . + 0 transcript_id "g464.t1"; gene_id "g464"; 6 AUGUSTUS CDS 1725842 1725868 0.39 + 0 transcript_id "g464.t1"; gene_id "g464"; 6 AUGUSTUS CDS 1725975 1726110 0.93 + 0 transcript_id "g464.t1"; gene_id "g464"; 6 AUGUSTUS CDS 1726192 1726619 1 + 2 transcript_id "g464.t1"; gene_id "g464"; 6 AUGUSTUS stop_codon 1726617 1726619 . + 0 transcript_id "g464.t1"; gene_id "g464"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSTKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATCARIAKVIADEACSMLKSRQDSGSDSSVSDASFATAQSILTTGSEDTVVTPTEMAVPVPKTVERA # TTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g464 ### # start gene g465 6 AUGUSTUS gene 1726881 1727186 0.88 - . g465 6 AUGUSTUS transcript 1726881 1727186 0.88 - . g465.t1 6 AUGUSTUS stop_codon 1726881 1726883 . - 0 transcript_id "g465.t1"; gene_id "g465"; 6 AUGUSTUS CDS 1726881 1727186 0.88 - 0 transcript_id "g465.t1"; gene_id "g465"; 6 AUGUSTUS start_codon 1727184 1727186 . - 0 transcript_id "g465.t1"; gene_id "g465"; # protein sequence = [MVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIF # DAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g465 ### # start gene g466 6 AUGUSTUS gene 1728319 1731681 0.35 + . g466 6 AUGUSTUS transcript 1728319 1731681 0.35 + . g466.t1 6 AUGUSTUS start_codon 1728319 1728321 . + 0 transcript_id "g466.t1"; gene_id "g466"; 6 AUGUSTUS CDS 1728319 1731681 0.35 + 0 transcript_id "g466.t1"; gene_id "g466"; 6 AUGUSTUS stop_codon 1731679 1731681 . + 0 transcript_id "g466.t1"; gene_id "g466"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPLPRRGSSLASLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVTRIQECIPEDVAMVLREVLESMGIEV # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMR # HMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKH # SSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQHATPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSWISGQDLTARLAPNPVHVPPRLSN # PSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVYEEAVPPQGAPFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTAG # EVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEY # GRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPSDSNSEGSNEGEQNKSSRNGGRRE # EDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKTAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYA # REKDKCASAASHLTGAALSHFDTLNRQRLRGSTLVSKTGQNSNESSVPNSDPSTRRTRQGGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g466 ### # start gene g467 6 AUGUSTUS gene 1732832 1733661 0.26 + . g467 6 AUGUSTUS transcript 1732832 1733661 0.26 + . g467.t1 6 AUGUSTUS start_codon 1732832 1732834 . + 0 transcript_id "g467.t1"; gene_id "g467"; 6 AUGUSTUS CDS 1732832 1732852 0.54 + 0 transcript_id "g467.t1"; gene_id "g467"; 6 AUGUSTUS CDS 1732940 1733092 0.26 + 0 transcript_id "g467.t1"; gene_id "g467"; 6 AUGUSTUS CDS 1733167 1733661 0.57 + 0 transcript_id "g467.t1"; gene_id "g467"; 6 AUGUSTUS stop_codon 1733659 1733661 . + 0 transcript_id "g467.t1"; gene_id "g467"; # protein sequence = [MRHPENLISFAEGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKELCLTFQDRNGGNGEEIHAGTLQSPPEAPQ # RPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPGPHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKP # TKDSEEAYQSGRVGTQNDPPPGPELSKKSGGGRKGGCMDLIPTSPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g467 ### # start gene g468 6 AUGUSTUS gene 1733838 1734224 0.97 + . g468 6 AUGUSTUS transcript 1733838 1734224 0.97 + . g468.t1 6 AUGUSTUS start_codon 1733838 1733840 . + 0 transcript_id "g468.t1"; gene_id "g468"; 6 AUGUSTUS CDS 1733838 1734224 0.97 + 0 transcript_id "g468.t1"; gene_id "g468"; 6 AUGUSTUS stop_codon 1734222 1734224 . + 0 transcript_id "g468.t1"; gene_id "g468"; # protein sequence = [MDRLLREGTPAYFLHISPTKEGSPTEEILRASGSNDPERVQQPKDPENGNPGLEQGGVVKELDEEVSKRQETEELKKS # IPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGSFTTCLRRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g468 ### # start gene g469 6 AUGUSTUS gene 1734838 1735656 0.56 + . g469 6 AUGUSTUS transcript 1734838 1735656 0.56 + . g469.t1 6 AUGUSTUS start_codon 1734838 1734840 . + 0 transcript_id "g469.t1"; gene_id "g469"; 6 AUGUSTUS CDS 1734838 1735656 0.56 + 0 transcript_id "g469.t1"; gene_id "g469"; 6 AUGUSTUS stop_codon 1735654 1735656 . + 0 transcript_id "g469.t1"; gene_id "g469"; # protein sequence = [MDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCNSAFELLKSAFSEAPVLGHYNPDLPV # VLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAEL # LSGYDFVINYRPGRLGAKPDALTRRSDVPKEGSLKDQALAGRERILIPPERLNAIILMNEDLLVNRVREAPKDTTIIEALRRIARNEEESLVWRMG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g469 ### # start gene g470 6 AUGUSTUS gene 1749241 1751835 0.98 + . g470 6 AUGUSTUS transcript 1749241 1751835 0.98 + . g470.t1 6 AUGUSTUS start_codon 1749241 1749243 . + 0 transcript_id "g470.t1"; gene_id "g470"; 6 AUGUSTUS CDS 1749241 1751835 0.98 + 0 transcript_id "g470.t1"; gene_id "g470"; 6 AUGUSTUS stop_codon 1751833 1751835 . + 0 transcript_id "g470.t1"; gene_id "g470"; # protein sequence = [MSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKI # FTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEESHVEHVRKVLERLRANHLH # AKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWSWTPQCSSAFELLKSAF # SEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFT # TTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALRR # IARNEEESIVWEDGLIKRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPI # GQRPWSSISLDHITQLPATAGPEKYDAILVVVCRLTKQAIYVPCHTTDKAEDFANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLS # TAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIG # VANKAYAKYANQKHQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTILSKVGSRAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPQ # SS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g470 ### # start gene g471 6 AUGUSTUS gene 1752391 1753973 0.39 - . g471 6 AUGUSTUS transcript 1752391 1753973 0.39 - . g471.t1 6 AUGUSTUS stop_codon 1752391 1752393 . - 0 transcript_id "g471.t1"; gene_id "g471"; 6 AUGUSTUS CDS 1752391 1753293 0.52 - 0 transcript_id "g471.t1"; gene_id "g471"; 6 AUGUSTUS CDS 1753374 1753973 0.39 - 0 transcript_id "g471.t1"; gene_id "g471"; 6 AUGUSTUS start_codon 1753971 1753973 . - 0 transcript_id "g471.t1"; gene_id "g471"; # protein sequence = [MEGDLRDAVRERKVAEEKLSSSTRKSSQLTTTLLYQQGRVDESNALATRQRRLVEELQEEVHRARDRAAFVEQMVKEY # PDEGYYEVVLPPLSQLEGDLNKAREDLRRVATLAHRLHCSDPATVLHHHHRYIGAIIEAVVAFLRRGLESEDPDIATHNLHLALDYMQAARGVHGDLY # IRSISSIQWFFNNAVDEDEGLYRLLEGDLNKAREDLRRVATLAHRLHCSDPATVLHHHHRYIGAIIEAVVAFLRRGLESEDPDIATHNLHLALDYMQA # ARGVHGDLYIRSISSIQWFFNNAVDEDEGLYRLVLEHSRFDNDSPFLTAAQHAGFAPPPDNSLEPPLHRRMLALSTALPHSDGVGRWDDLVPALPSVD # QLTVDWEQLMLRYIHHITDVPLSGTDTQVPMSSVEPGTESLAEVTVEQLPEAPPLFLPEQESPTSPSPPPTSPTLPPPFASLANLTIDLTGDDDDLYE # TEESRMARVSMSREVVDSVAVQSVVKEEPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g471 ### # start gene g472 6 AUGUSTUS gene 1754041 1754811 0.78 - . g472 6 AUGUSTUS transcript 1754041 1754811 0.78 - . g472.t1 6 AUGUSTUS stop_codon 1754041 1754043 . - 0 transcript_id "g472.t1"; gene_id "g472"; 6 AUGUSTUS CDS 1754041 1754811 0.78 - 0 transcript_id "g472.t1"; gene_id "g472"; 6 AUGUSTUS start_codon 1754809 1754811 . - 0 transcript_id "g472.t1"; gene_id "g472"; # protein sequence = [MLDEQDAADADQQELQDFLALQQGEAVVAAKRKRDRSPMPVAGPSVKRVRQDASKKRSRRRSPEEEVVQEAPLRVRLV # VPPSRSVAASTSTPPPPRASPSLMEVSGGDLPVQGHSNLVRLAAVAEAQSGLVQQPVVPPSIKGAGPNLLSSNMPPASRPTLVPRALAAHPYRAENQR # LAARVRLLESQLADSQRENSSLTSALRDTSHALESRQREVEQLRSSRHEVLEHETEYRRVLDQFVALDGALPGTPGQVST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g472 ### # start gene g473 6 AUGUSTUS gene 1756593 1759417 0.97 - . g473 6 AUGUSTUS transcript 1756593 1759417 0.97 - . g473.t1 6 AUGUSTUS stop_codon 1756593 1756595 . - 0 transcript_id "g473.t1"; gene_id "g473"; 6 AUGUSTUS CDS 1756593 1757911 1 - 2 transcript_id "g473.t1"; gene_id "g473"; 6 AUGUSTUS CDS 1757986 1759417 0.97 - 0 transcript_id "g473.t1"; gene_id "g473"; 6 AUGUSTUS start_codon 1759415 1759417 . - 0 transcript_id "g473.t1"; gene_id "g473"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPMNQINSEHRPYDHVQPRMYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVRSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDDQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKP # KPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMARYEVLQRGTESFQRSQPSFEKVRYELRQRKK # GKDQDSKDKKENVQADLLNEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEKVFTKYKPVDKKVNPIKATLPDEFRIERHIHG # DPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHKMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIF # EDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g473 ### # start gene g474 6 AUGUSTUS gene 1759447 1762435 0.12 - . g474 6 AUGUSTUS transcript 1759447 1762435 0.12 - . g474.t1 6 AUGUSTUS stop_codon 1759447 1759449 . - 0 transcript_id "g474.t1"; gene_id "g474"; 6 AUGUSTUS CDS 1759447 1761416 0.42 - 2 transcript_id "g474.t1"; gene_id "g474"; 6 AUGUSTUS CDS 1762420 1762435 0.21 - 0 transcript_id "g474.t1"; gene_id "g474"; 6 AUGUSTUS start_codon 1762433 1762435 . - 0 transcript_id "g474.t1"; gene_id "g474"; # protein sequence = [MTNDRRKPCTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRESSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ # SHFKEGADIMTQLTTVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLR # DNARMPRDDPNVPCYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g474 ### # start gene g475 6 AUGUSTUS gene 1766874 1767437 0.58 + . g475 6 AUGUSTUS transcript 1766874 1767437 0.58 + . g475.t1 6 AUGUSTUS start_codon 1766874 1766876 . + 0 transcript_id "g475.t1"; gene_id "g475"; 6 AUGUSTUS CDS 1766874 1767437 0.58 + 0 transcript_id "g475.t1"; gene_id "g475"; 6 AUGUSTUS stop_codon 1767435 1767437 . + 0 transcript_id "g475.t1"; gene_id "g475"; # protein sequence = [MQQFSAAYDAYLEVKARVWKLVAQALGRDSPDWRIMHTCPCCQNGLKEDVTLDIQMMVAMDGNDSLKQVERRKEAADD # SPAEVAGSGVVERVDPRKAGGDYFLSRAAVDEWAEENWKNVAPWVPEGDFREWVWKTGRCEEKWHNVLRSCTPCNRAKVTRCLSAEDEWDSSEVINNT # AVTPLVPGERE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g475 ### # start gene g476 6 AUGUSTUS gene 1768165 1769259 0.73 + . g476 6 AUGUSTUS transcript 1768165 1769259 0.73 + . g476.t1 6 AUGUSTUS start_codon 1768165 1768167 . + 0 transcript_id "g476.t1"; gene_id "g476"; 6 AUGUSTUS CDS 1768165 1768626 0.73 + 0 transcript_id "g476.t1"; gene_id "g476"; 6 AUGUSTUS CDS 1768678 1769259 0.73 + 0 transcript_id "g476.t1"; gene_id "g476"; 6 AUGUSTUS stop_codon 1769257 1769259 . + 0 transcript_id "g476.t1"; gene_id "g476"; # protein sequence = [MSASRTITTTTSATAGPSRSRPVPPPPPPASDSAAQEEEGLEDEDEDDIIRKAQARVERVRARKAAEAARKKAEEEAA # RAAAEKKRKAQEAQERAERARQQEEEVVERRRLLAAAATARSQRGTSPSEVSASPRRPVVEIRRTKSKGKGKARAEPVGGDPDDGDEGDDDDDDDKEP # CERCRAKKISCQMQAGKRSSIICKPCHDAKVRCSYSGRPSTVKREGGSNPTGERLAVLESQVAQLLADNRQLRDGQVKANTYHRHMNRKLDWLVTDAA # RRRRTPPELPQAGPSELPKKRRRVMDSDEEEERGREQEMEEDGEGEEEEGGGMEVEGEVEAPAPTAKGKERAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g476 ### # start gene g477 6 AUGUSTUS gene 1769630 1773193 0.93 - . g477 6 AUGUSTUS transcript 1769630 1773193 0.93 - . g477.t1 6 AUGUSTUS stop_codon 1769630 1769632 . - 0 transcript_id "g477.t1"; gene_id "g477"; 6 AUGUSTUS CDS 1769630 1773193 0.93 - 0 transcript_id "g477.t1"; gene_id "g477"; 6 AUGUSTUS start_codon 1773191 1773193 . - 0 transcript_id "g477.t1"; gene_id "g477"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHPDSPQTSVPSAINPVAAKVAV # PLPEPSPSVSPTILETPPGDSLRPRSRSRSRTSRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHIKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLNAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYHVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g477 ### # start gene g478 6 AUGUSTUS gene 1773526 1775217 0.96 - . g478 6 AUGUSTUS transcript 1773526 1775217 0.96 - . g478.t1 6 AUGUSTUS stop_codon 1773526 1773528 . - 0 transcript_id "g478.t1"; gene_id "g478"; 6 AUGUSTUS CDS 1773526 1775217 0.96 - 0 transcript_id "g478.t1"; gene_id "g478"; 6 AUGUSTUS start_codon 1775215 1775217 . - 0 transcript_id "g478.t1"; gene_id "g478"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRATSESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSANQHNNSQPSGSTAPFTPKPKPFS # GGKPNNNGKPQNSSNSGQPGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g478 ### # start gene g479 6 AUGUSTUS gene 1777197 1778281 0.91 + . g479 6 AUGUSTUS transcript 1777197 1778281 0.91 + . g479.t1 6 AUGUSTUS start_codon 1777197 1777199 . + 0 transcript_id "g479.t1"; gene_id "g479"; 6 AUGUSTUS CDS 1777197 1777539 0.91 + 0 transcript_id "g479.t1"; gene_id "g479"; 6 AUGUSTUS CDS 1777596 1778281 0.99 + 2 transcript_id "g479.t1"; gene_id "g479"; 6 AUGUSTUS stop_codon 1778279 1778281 . + 0 transcript_id "g479.t1"; gene_id "g479"; # protein sequence = [MEYYGKLVALKECQAVLKEARHAWLSYRPGERDQTAALERTQRHAQENERKILADVHALESKLDVRVRWTEGSKEWDE # AGALVMGAKYRRALDKLEGLLVSRIFELSRLNISGTGYKMRKHLASALKKRSKSIQNAIAEYNAVATKMKPPRRQVDWEEVVEYAFLSEFDILRDTRE # DIRKRPWAVPANRVIMTQFFKVIGAEDELARVHQEIQRLITNMQQESKELILKEEYLMPTNPTLALQIRRFRQERGRFHKIHRKRLLSITKLPGFDWS # TNIKYFFPGTSVERTSNDRDPLTEELKADRGVEEDHGDDDDDDDDDDEEDLILRVDAFLSVAEDVLEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g479 ### # start gene g480 6 AUGUSTUS gene 1779119 1779910 0.54 - . g480 6 AUGUSTUS transcript 1779119 1779910 0.54 - . g480.t1 6 AUGUSTUS stop_codon 1779119 1779121 . - 0 transcript_id "g480.t1"; gene_id "g480"; 6 AUGUSTUS CDS 1779119 1779910 0.54 - 0 transcript_id "g480.t1"; gene_id "g480"; 6 AUGUSTUS start_codon 1779908 1779910 . - 0 transcript_id "g480.t1"; gene_id "g480"; # protein sequence = [MEIPFDRIIATEFNHTSPGIAHAVFTVSEPPHFYLEHRMTPRPDGRMKLSWRQCNDWTEGAQATHVLRHSLLGSAPQL # SHLVQRLKLYRSHRNISLLSTPYKGDDSLPSPLEIPAPPMAGLLRPHLSPYSDASPDTGINGDLDQVTCNSDGYNPQLRNAPVLTSAYSEEQYPRLFG # RYSTPDISSYHQSSAGATLVAPVSRLSTARPYTVTQETFPSMYSDDVSIAQSLQSARRHTWTNVQDHVSPSLPLLGTSFHPAADFIY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g480 ### # start gene g481 6 AUGUSTUS gene 1784928 1785809 0.65 + . g481 6 AUGUSTUS transcript 1784928 1785809 0.65 + . g481.t1 6 AUGUSTUS start_codon 1784928 1784930 . + 0 transcript_id "g481.t1"; gene_id "g481"; 6 AUGUSTUS CDS 1784928 1785809 0.65 + 0 transcript_id "g481.t1"; gene_id "g481"; 6 AUGUSTUS stop_codon 1785807 1785809 . + 0 transcript_id "g481.t1"; gene_id "g481"; # protein sequence = [MYHPPLPVTFNLMADVRALLKAKRQEARITHPLALYSQSGQLRCTACGTIVKHSSAWEGHLGSKAHRTNVARLKEQER # AKEEQRLREEREEQERLSKGKRKAEQEDIIMQDEETTSDTAMKKPRLNEGPNGFPVDFFSDPSRAIPLGGGSSDNEEEEDQPASAAEDAPVATAKAPL # DLEWERFQREVVNAPDFKETYENATVFAEPVLAPEVPEGFPVPETSSEPTEPSKTEEEEARRQKELDERELIMDRLLEEERAQEEADMKVVAMKNKLE # LLRKKREAAKVAKVSSSPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g481 ### # start gene g482 6 AUGUSTUS gene 1790770 1791360 0.83 - . g482 6 AUGUSTUS transcript 1790770 1791360 0.83 - . g482.t1 6 AUGUSTUS stop_codon 1790770 1790772 . - 0 transcript_id "g482.t1"; gene_id "g482"; 6 AUGUSTUS CDS 1790770 1791360 0.83 - 0 transcript_id "g482.t1"; gene_id "g482"; 6 AUGUSTUS start_codon 1791358 1791360 . - 0 transcript_id "g482.t1"; gene_id "g482"; # protein sequence = [MNAAPLPPLKPTPVSLPGIHEITGFFPGRLEFEHEIDHEAEDLVKDLEFGVVMQYGGDQIPEDENDLDVKARLRWEDE # RRNGGTSGKKGVFAGKSAGKGLSNGIVNGYHSSPPLVPKEVTAPSNSGNEEGNEEDVEELTQPPPIETEDSLAFKFTLMEMYFQRIEKRLESKSIIYD # RGLLEYKKVWPVTEVFLTHD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g482 ### # start gene g483 6 AUGUSTUS gene 1792671 1793682 0.64 - . g483 6 AUGUSTUS transcript 1792671 1793682 0.64 - . g483.t1 6 AUGUSTUS stop_codon 1792671 1792673 . - 0 transcript_id "g483.t1"; gene_id "g483"; 6 AUGUSTUS CDS 1792671 1793564 0.67 - 0 transcript_id "g483.t1"; gene_id "g483"; 6 AUGUSTUS CDS 1793620 1793682 0.64 - 0 transcript_id "g483.t1"; gene_id "g483"; 6 AUGUSTUS start_codon 1793680 1793682 . - 0 transcript_id "g483.t1"; gene_id "g483"; # protein sequence = [MEKDNKKAREDARRDFNDTVRSLAKFLKKRDPRYKKHIVRQAEATQMHASGSSTPNSRKIFTPDAAYIEQDWQKIDSR # VGEHDLEWAVAEGDDPEEWECVACNKSFRSEAAWDSHERSKKHLREVERLRREMLDEGEMLGLDQAPQLEVEETAPSIEDHLDSFLDEPPRSPSPPPS # EQEIHTYAATPEASREENGEEKNLRHLPKGKKGREKAQPLATSKEPRTKSEKKMQGLDHAFFEEAGSSNIGSIEQGKDSARPDSGEKLELSKREQRRA # RQAKKAELSGATHSVSKFFFRMRLYELLKHFTDTVQLGWLWKIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g483 ### # start gene g484 6 AUGUSTUS gene 1797146 1798166 0.58 + . g484 6 AUGUSTUS transcript 1797146 1798166 0.58 + . g484.t1 6 AUGUSTUS start_codon 1797146 1797148 . + 0 transcript_id "g484.t1"; gene_id "g484"; 6 AUGUSTUS CDS 1797146 1797173 0.61 + 0 transcript_id "g484.t1"; gene_id "g484"; 6 AUGUSTUS CDS 1797340 1798166 0.58 + 2 transcript_id "g484.t1"; gene_id "g484"; 6 AUGUSTUS stop_codon 1798164 1798166 . + 0 transcript_id "g484.t1"; gene_id "g484"; # protein sequence = [MTALPRQAKKHKLLLLNIKLYIMTDFTKRNGTGGESIYGGMFADEDLLRPLDSEALLCMANRGPDTNGSQFFITLRPC # PHLNGKHVVFGRVLRGYDEVVQKIAEVPVDGKDRPLSPVVIHNCGELELKKPPGMFLSVGRRYPQNLNNNILAKLVPSESEPEPLKEEKPRESRRRSR # HSRSISRSSDSESDSSNKRHRRKKSKRKHRNDKNADSIEKEAKLNFRGETEEEYDARLEREENERLAADRKIQLERMKGKYDAESQTQDGVRFKGQIS # LSSNPCRFRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g484 ### # start gene g485 6 AUGUSTUS gene 1798384 1799232 0.49 - . g485 6 AUGUSTUS transcript 1798384 1799232 0.49 - . g485.t1 6 AUGUSTUS stop_codon 1798384 1798386 . - 0 transcript_id "g485.t1"; gene_id "g485"; 6 AUGUSTUS CDS 1798384 1799232 0.49 - 0 transcript_id "g485.t1"; gene_id "g485"; 6 AUGUSTUS start_codon 1799230 1799232 . - 0 transcript_id "g485.t1"; gene_id "g485"; # protein sequence = [MRKKPIGFGSDNSGAADRDEVWSKGSKFKPAEERENAAPTNRFGSGRGRGDMGPPRDPVPEESDWRSSSRARPARDNT # SRELIFQLRREKESSVYLYTATGSTPPTPQMGRRKLELLPRSGNGSNVPSPLSSPKIGPTPPTSGSRSNPFGTAKYVQLYLQCVSLLNVRLRPVDVTA # KDIEITQKLEKDRELNRISMSRTSSRTSIERPISRNHTPPASAGSHSQPPSSPPAPTSKVIPQGMSANVRPAFSFANAAANKKKAEEAETIRKEETLA # EKLGEVTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g485 ### # start gene g486 6 AUGUSTUS gene 1801845 1803426 0.19 + . g486 6 AUGUSTUS transcript 1801845 1803426 0.19 + . g486.t1 6 AUGUSTUS start_codon 1801845 1801847 . + 0 transcript_id "g486.t1"; gene_id "g486"; 6 AUGUSTUS CDS 1801845 1802397 0.37 + 0 transcript_id "g486.t1"; gene_id "g486"; 6 AUGUSTUS CDS 1802553 1803048 0.38 + 2 transcript_id "g486.t1"; gene_id "g486"; 6 AUGUSTUS CDS 1803153 1803426 0.69 + 1 transcript_id "g486.t1"; gene_id "g486"; 6 AUGUSTUS stop_codon 1803424 1803426 . + 0 transcript_id "g486.t1"; gene_id "g486"; # protein sequence = [MMRSWRTVALERYDRDASRYHQGVYKRKRADLIVSLDATLSPLFLGQLKNLHKACLGAFKKDILEGMKGEEYNFADVV # SKAKAKCDNRFTTGARESVVDDSEEGKTEWNWEEELELLREEVQSVADQCRKDETKKMVNTIEVSLLFEAFAFFSTCSRFAAEFQEADFGTNRVGTQQ # RVAQYVGRAALRRRAWQALRSKIDEQTADSVFVGRLRAHFEERFRYDEQGVPRVWKPEDDIDGVYRKAKEQTLELIPLYSKIVPLDSSVAYVLPPDAI # SSSDSGSSLEEAFDFESSLVVFSETKALDLAAKFRKDADLAYVEAKRSTVSSVAQIPFWMYGVLLVLGWNEFMMVLYLIIQLGLAGPLLSITQTMGLE # VSFSTYVIIMVTDEPSLQIKRQATQKLREHFSEPMLAQAQAHNARSQSSSMIEEEDYELRKRQEGSPM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g486 ### # start gene g487 6 AUGUSTUS gene 1803434 1804178 0.43 - . g487 6 AUGUSTUS transcript 1803434 1804178 0.43 - . g487.t1 6 AUGUSTUS stop_codon 1803434 1803436 . - 0 transcript_id "g487.t1"; gene_id "g487"; 6 AUGUSTUS CDS 1803434 1803461 0.44 - 1 transcript_id "g487.t1"; gene_id "g487"; 6 AUGUSTUS CDS 1803544 1804178 0.43 - 0 transcript_id "g487.t1"; gene_id "g487"; 6 AUGUSTUS start_codon 1804176 1804178 . - 0 transcript_id "g487.t1"; gene_id "g487"; # protein sequence = [MSSAPSPSLVLFARGVIARLALWETLTLAVQESWGGPGAKEKRTWMAGVVVDMFEEKQSKTNSASSSNVDSRVEPEDI # EDTLLQIMADEFEVHVEDGSAETLGKDIVQLWDAIINSASPSSTTITHSEGEKKVQEWESRVESAKGRKIQAHYQEAVEEDGDWEDDDSEGDDEDGDH # PMDEDEVPHLIDSNRGQRKPEVDEDGFTLVSSRRKRAIIHHRGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g487 ### # start gene g488 6 AUGUSTUS gene 1805294 1805500 0.6 + . g488 6 AUGUSTUS transcript 1805294 1805500 0.6 + . g488.t1 6 AUGUSTUS start_codon 1805294 1805296 . + 0 transcript_id "g488.t1"; gene_id "g488"; 6 AUGUSTUS CDS 1805294 1805500 0.6 + 0 transcript_id "g488.t1"; gene_id "g488"; 6 AUGUSTUS stop_codon 1805498 1805500 . + 0 transcript_id "g488.t1"; gene_id "g488"; # protein sequence = [MGSSSKVHLHYGLAPLSDNTITPDFEWKEPDSTNHLPISTHLSNLDETPKDKPTSDTSNSGMFLPVTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g488 ### # start gene g489 6 AUGUSTUS gene 1810452 1812128 0.97 + . g489 6 AUGUSTUS transcript 1810452 1812128 0.97 + . g489.t1 6 AUGUSTUS start_codon 1810452 1810454 . + 0 transcript_id "g489.t1"; gene_id "g489"; 6 AUGUSTUS CDS 1810452 1812128 0.97 + 0 transcript_id "g489.t1"; gene_id "g489"; 6 AUGUSTUS stop_codon 1812126 1812128 . + 0 transcript_id "g489.t1"; gene_id "g489"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTARIDSPILQAIAHRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPHTPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGVYDAQGEAEDALGNLKMKETENIRFNTLAASTNWDSAALK # WAYGRGLAERIKDEMARLPEPATLAAYRLEVLRIDNRYWKREETKKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPLTPKPKPFSGGKPN # NNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g489 ### # start gene g490 6 AUGUSTUS gene 1812461 1816024 0.97 + . g490 6 AUGUSTUS transcript 1812461 1816024 0.97 + . g490.t1 6 AUGUSTUS start_codon 1812461 1812463 . + 0 transcript_id "g490.t1"; gene_id "g490"; 6 AUGUSTUS CDS 1812461 1816024 0.97 + 0 transcript_id "g490.t1"; gene_id "g490"; 6 AUGUSTUS stop_codon 1816022 1816024 . + 0 transcript_id "g490.t1"; gene_id "g490"; # protein sequence = [MANIAVRFPAGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHFDSPQTSVPSAINPVVAKVVV # PLPEPSPSVSPTILETPPGDSPRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSATPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKILTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHTRYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g490 ### # start gene g491 6 AUGUSTUS gene 1824038 1825006 0.57 + . g491 6 AUGUSTUS transcript 1824038 1825006 0.57 + . g491.t1 6 AUGUSTUS start_codon 1824038 1824040 . + 0 transcript_id "g491.t1"; gene_id "g491"; 6 AUGUSTUS CDS 1824038 1825006 0.57 + 0 transcript_id "g491.t1"; gene_id "g491"; 6 AUGUSTUS stop_codon 1825004 1825006 . + 0 transcript_id "g491.t1"; gene_id "g491"; # protein sequence = [MSILSFRSIVWAQSKKPYKRLQRVKHGSEGTPSESRPASNDWRQLQLDASDLAFGLRGIGWNWSQGLHIPPEKRSTSS # DRSFAFWTLASLVTHIPVFDLLHYSVQRFGPGTFATTSGGSIFDESVPPLIRYSRSTFLSLLSGLVVYCAIEIAYDFCTLIGIVVLRQSPTQWPPIFD # EPWRADSLSDFWAKRWHQLFRHFFIGLGWIPLYHVFGRIGGVFGAFLVSGILHYVGLWGLGSGSDVLGMIGFFMLMGVGVILEGFWKSFTGYKVKGWL # GRIWTTVWLLGWSNLLVDAWARKGLMGSLFIPDSRRLPVQLFGVIPTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g491 ### # start gene g492 6 AUGUSTUS gene 1826179 1827170 0.47 + . g492 6 AUGUSTUS transcript 1826179 1827170 0.47 + . g492.t1 6 AUGUSTUS start_codon 1826179 1826181 . + 0 transcript_id "g492.t1"; gene_id "g492"; 6 AUGUSTUS CDS 1826179 1826716 0.53 + 0 transcript_id "g492.t1"; gene_id "g492"; 6 AUGUSTUS CDS 1826839 1827170 0.7 + 2 transcript_id "g492.t1"; gene_id "g492"; 6 AUGUSTUS stop_codon 1827168 1827170 . + 0 transcript_id "g492.t1"; gene_id "g492"; # protein sequence = [MPSLTRFLAFSTVAVSLVGKYSCGPISKPAHLPTDCGLIYPAFQGVPASNADPYNFNGTSTDANSIASTAFRVNQKSG # ATTNAPPNLPAANTTVTAVDGDMVIPVSRRSLSSIRTIDNDMSRRTNSDYEQVFGGTGTESEDRDAAIIGTAYLTYTLVSNSTYNVGDCLAFCDATAG # CGEFYYEFNNEMLDHVYSQHSNLKCAAYGDVHSAEEKLNFGSQSLSGTPDGPLTYIQQSSGWTSKSFGDPSTPEGYDPLPDLGGANEAPGVRSHVLKF # TASPTASCSTWVSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g492 ### # start gene g493 6 AUGUSTUS gene 1830252 1830737 0.87 - . g493 6 AUGUSTUS transcript 1830252 1830737 0.87 - . g493.t1 6 AUGUSTUS stop_codon 1830252 1830254 . - 0 transcript_id "g493.t1"; gene_id "g493"; 6 AUGUSTUS CDS 1830252 1830737 0.87 - 0 transcript_id "g493.t1"; gene_id "g493"; 6 AUGUSTUS start_codon 1830735 1830737 . - 0 transcript_id "g493.t1"; gene_id "g493"; # protein sequence = [MGQTQDEDEDDGFTHIPPADSIPSNATTTAPAGSNPFSDSNRYSGAPSGTPAYSSYAAPSYIPPVSRPSMDAYGAFSD # PPPSGFGPTAAAPARPSPAVAAAPPSLPEPDLGPQVSRTMQYADPYAAVRASLAGQQSQQAAAGDTSPSYGAAPTYDAYTGYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g493 ### # start gene g494 6 AUGUSTUS gene 1832322 1833081 0.9 - . g494 6 AUGUSTUS transcript 1832322 1833081 0.9 - . g494.t1 6 AUGUSTUS stop_codon 1832322 1832324 . - 0 transcript_id "g494.t1"; gene_id "g494"; 6 AUGUSTUS CDS 1832322 1832428 0.99 - 2 transcript_id "g494.t1"; gene_id "g494"; 6 AUGUSTUS CDS 1832484 1833081 0.91 - 0 transcript_id "g494.t1"; gene_id "g494"; 6 AUGUSTUS start_codon 1833079 1833081 . - 0 transcript_id "g494.t1"; gene_id "g494"; # protein sequence = [MLYIVFGTLYNRYVLQLRGFDQIPQFSIEAMKYHGREALGWFRDIMGQLYEGGQGSGWGSNVPRTWGGRTNPNTGFGV # GSQLPPGRANPRANTRSGATTNSFSHQAQVDIGGGGESTNVVDVPGGGVGGFMRPNSGTNTTNKQNQTKSTQPPAPLPISPAPVMVKKYEPGSSTAEE # RTFMLGDDEEEEDVIATPMTAAAPPAHPSEDNTNPPAASESAAQPRGRDLGEEGTIRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g494 ### # start gene g495 6 AUGUSTUS gene 1834215 1835074 0.67 - . g495 6 AUGUSTUS transcript 1834215 1835074 0.67 - . g495.t1 6 AUGUSTUS stop_codon 1834215 1834217 . - 0 transcript_id "g495.t1"; gene_id "g495"; 6 AUGUSTUS CDS 1834215 1834684 0.67 - 2 transcript_id "g495.t1"; gene_id "g495"; 6 AUGUSTUS CDS 1834798 1835074 0.67 - 0 transcript_id "g495.t1"; gene_id "g495"; 6 AUGUSTUS start_codon 1835072 1835074 . - 0 transcript_id "g495.t1"; gene_id "g495"; # protein sequence = [MTATNFEADALLAHVVSQVQQNVEFLVSHDYLAQSDASAFLSKLGNVRAGAAPGPAMPTPTPSPFARRSPAVISPQPV # MAKAIWGYNEDGAVNWWTGKINERQALFPSSYVEKVVAHAPIAAAMPTPIPSTGGRSLPPAFNGAKEKPVYKPFGAAHQSANAPPPPDAGVNNVGLQE # DAGQEKKKSKFGKYGNTMAHSAAGGVGFGAGKLVISVTHFQSLDSSQVPLLVVVSSEQYFDLSVLFSSAPRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g495 ### # start gene g496 6 AUGUSTUS gene 1837734 1839119 1 - . g496 6 AUGUSTUS transcript 1837734 1839119 1 - . g496.t1 6 AUGUSTUS stop_codon 1837734 1837736 . - 0 transcript_id "g496.t1"; gene_id "g496"; 6 AUGUSTUS CDS 1837734 1839119 1 - 0 transcript_id "g496.t1"; gene_id "g496"; 6 AUGUSTUS start_codon 1839117 1839119 . - 0 transcript_id "g496.t1"; gene_id "g496"; # protein sequence = [MKYIELPSLTALASSLSHQGSECNVSVRLEAYSCKNIKRDKRLFRDLEKVYWDDMGVLETMKFDPGEEHSKSSPAEGS # SSHTLPHSYLAQAHSSLSTPFGPLGSPQSRKTLYLLISTLNVAFPDYIFDSVKPSSFVHLESGAQILNALSTTLLASQTSVRSHTSRHNSGYASMAYG # AYPAAQGLGFGVAQGSPGSPYEFVKESPCAPSSVISGTHPEVYALLDDVIGPLDECEVFEYVPEPEEDPNAGEGEEEGDEDFEDEFEGYSPDEVHVFT # LDEDINTQSYNQPHSTLSTPVTPRDAVLSTSANPISPFDESYRPLSPTRLTLRTPSRSSSSILPSSYPPMHPTSSSGGNTLLWSSHWFFLNRKQKRIL # YVTVWARKRSMDSMPETPVDEELFVYGSEPTHQLYASVARRNRRIRKFSESDESDVSPVSMRFPTAGKERFLGWEGAAGAGARALGLVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g496 ### # start gene g497 6 AUGUSTUS gene 1839786 1841288 0.72 + . g497 6 AUGUSTUS transcript 1839786 1841288 0.72 + . g497.t1 6 AUGUSTUS start_codon 1839786 1839788 . + 0 transcript_id "g497.t1"; gene_id "g497"; 6 AUGUSTUS CDS 1839786 1841288 0.72 + 0 transcript_id "g497.t1"; gene_id "g497"; 6 AUGUSTUS stop_codon 1841286 1841288 . + 0 transcript_id "g497.t1"; gene_id "g497"; # protein sequence = [MGDGLEPVLGLLRFLAKLIAAVDVELAKLLKCAAPLPYFALSHLLTMFAHDIPTLPVIQHVFDYLLARPPIALVYLTG # AVILARRDELLALEEDEDGDLGMLHSLLGTLPQVSDEAIPEEVAAEFRQEHQAEAGDAENCRGPSPDPSPSASGAEMEMEKSSCNSVVADDDDTDTIA # ESEYYEDTETVLNSDVDADEEPLKLLDFVASFSSSPGRSGILSLPPSSPRPASASDPLPLDSQSLPQSNPPLQSVSSSPSSSSFSIHTPSSSSHATTL # PTRDNLSGSPSFETQSHVDDFDSSKKAKKLPIPLSVLLRDADRLLAAYPPYQGYLQELTNMSSSVSLSNSPNVTPNNSSSPINSSDSSLAPVLSSIMG # PSSVVYTWSEDPAKLPSDTDAELMVRDTSRIVYPWDPSSNEDEDGEDDGEGEKDIPGDSTKRRTRFGDGRVLRRPELVLSAGAGAVLVIAIALAMYSN # RISRGERLSLDRLLGLLGVWGVWGWNWINR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g497 ### # start gene g498 6 AUGUSTUS gene 1843525 1844174 0.88 + . g498 6 AUGUSTUS transcript 1843525 1844174 0.88 + . g498.t1 6 AUGUSTUS start_codon 1843525 1843527 . + 0 transcript_id "g498.t1"; gene_id "g498"; 6 AUGUSTUS CDS 1843525 1843625 0.88 + 0 transcript_id "g498.t1"; gene_id "g498"; 6 AUGUSTUS CDS 1843676 1844174 0.9 + 1 transcript_id "g498.t1"; gene_id "g498"; 6 AUGUSTUS stop_codon 1844172 1844174 . + 0 transcript_id "g498.t1"; gene_id "g498"; # protein sequence = [MRSQTYHDRANVNIEVAIAAFSASERRKRGRGDKRILELSQTLKSTFEPVIQTSLYPRSQIDIYIQVLQQDGGLLQAC # VNATTLALANAGIPMYDFVCAVTGGVHSTSALLDLTLLEENDLPNVTVAVMPRSGKITLVSMETRLHVDRFEEIFRLAGEAGTVIHREMRRAVKDRTE # QLVASMQSVGRPSTGADVGDNEY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g498 ### # start gene g499 6 AUGUSTUS gene 1846115 1846719 0.92 + . g499 6 AUGUSTUS transcript 1846115 1846719 0.92 + . g499.t1 6 AUGUSTUS start_codon 1846115 1846117 . + 0 transcript_id "g499.t1"; gene_id "g499"; 6 AUGUSTUS CDS 1846115 1846117 0.92 + 0 transcript_id "g499.t1"; gene_id "g499"; 6 AUGUSTUS CDS 1846189 1846719 1 + 0 transcript_id "g499.t1"; gene_id "g499"; 6 AUGUSTUS stop_codon 1846717 1846719 . + 0 transcript_id "g499.t1"; gene_id "g499"; # protein sequence = [MGKLPAVDPSKDYSQNLATLLGFGDNENFVELLRLYITIHSDHEGGNVSAHTGKLVGSALSDPFLAFGASLNGLAGPL # HGLANQEVLLWLRKMQSKIGENASDEAVKEYVWSTLKGGQVVPGYGHAVLRKTDPRYTAQREFALKHLPEDPMFKLVGQIYNIVPGILLEVGDVCVFK # S] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g499 ### # start gene g500 6 AUGUSTUS gene 1847978 1849228 0.92 - . g500 6 AUGUSTUS transcript 1847978 1849228 0.92 - . g500.t1 6 AUGUSTUS stop_codon 1847978 1847980 . - 0 transcript_id "g500.t1"; gene_id "g500"; 6 AUGUSTUS CDS 1847978 1849228 0.92 - 0 transcript_id "g500.t1"; gene_id "g500"; 6 AUGUSTUS start_codon 1849226 1849228 . - 0 transcript_id "g500.t1"; gene_id "g500"; # protein sequence = [MNQYPGVRTDSEAEIYQYELEELWKDWIWKKKYPSGDEIQAYFRYVDEKLDLKRDIYFDTRVVSAKWDEPSRLWIVST # ANGISTHVQYLILCTGSLSKPLIPDIKNLSDFEGPCFHTSRWPREGLDLTGKRVAVIGTGSSGIQVIEHIASQVRHLTVFQRTPNLALPLSQSHFPEE # DQAEMKETGLYNRIFRRLSETFGGFLFDFQPIPFISATAEERRLLWESQWKTGGFHFWLENYPDIFSDEAANSEAYAFWRTKVTERVQDPALHEKLAP # SIPPHPFGIKRPGLEKAYFEVFDRENVSLVDVKETPIKRVTPDGLELHSGTTHIFDVLVLATGFEGLTGAILDLDIRGSNDISIREKWKSGVCTNIGM # MTSDFPNLFFVYGPQAPSPLANATSLIVSPPPLVHTVPFLNRTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g500 ### # start gene g501 6 AUGUSTUS gene 1850729 1851214 0.21 + . g501 6 AUGUSTUS transcript 1850729 1851214 0.21 + . g501.t1 6 AUGUSTUS start_codon 1850729 1850731 . + 0 transcript_id "g501.t1"; gene_id "g501"; 6 AUGUSTUS CDS 1850729 1851214 0.21 + 0 transcript_id "g501.t1"; gene_id "g501"; 6 AUGUSTUS stop_codon 1851212 1851214 . + 0 transcript_id "g501.t1"; gene_id "g501"; # protein sequence = [MGTGKVSVLLSGLVSYFVASRVKALQTLNISLLSPPPSTLPTSSIRRHPHSTTIISTVSSDGKINVYDLGHLHEFNAG # KISIQEIQPVATYDTKGTRLTCVTLGEGEIGTDNVTGKRNRDRQEVEEDDDDESAEDEEWGGVGADEDEEEEEGEEDEEEESD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g501 ### # start gene g502 6 AUGUSTUS gene 1852186 1852908 0.39 + . g502 6 AUGUSTUS transcript 1852186 1852908 0.39 + . g502.t1 6 AUGUSTUS start_codon 1852186 1852188 . + 0 transcript_id "g502.t1"; gene_id "g502"; 6 AUGUSTUS CDS 1852186 1852908 0.39 + 0 transcript_id "g502.t1"; gene_id "g502"; 6 AUGUSTUS stop_codon 1852906 1852908 . + 0 transcript_id "g502.t1"; gene_id "g502"; # protein sequence = [MAVLTHAMDVGALTPFLWGFEEREKLMEFYERVSGARLHSAYVRPGGVAFDLPHGLLDDIFQWATQYGSRIDEIEEVV # TGNRIWKERTVGVGVVTKEEALNFSFSGVMLRGSGVPWDLRRTQPYDMYDQAGLLDFLVRAKLTPKYCQVEFDIPIGVNGDCYDRYLCRVQEMRESLR # IISQVCVDFVIRNMGFHNNSTVQCLNKITPGAIKVDDHKLVPPPRASMKESMESLIHHFKVIFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g502 ### # start gene g503 6 AUGUSTUS gene 1857385 1859285 0.46 + . g503 6 AUGUSTUS transcript 1857385 1859285 0.46 + . g503.t1 6 AUGUSTUS start_codon 1857385 1857387 . + 0 transcript_id "g503.t1"; gene_id "g503"; 6 AUGUSTUS CDS 1857385 1857542 0.47 + 0 transcript_id "g503.t1"; gene_id "g503"; 6 AUGUSTUS CDS 1858055 1859285 0.99 + 1 transcript_id "g503.t1"; gene_id "g503"; 6 AUGUSTUS stop_codon 1859283 1859285 . + 0 transcript_id "g503.t1"; gene_id "g503"; # protein sequence = [MPPKTRAQSRANSKENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTTLYTGDGQPVQVLTPRRGQPPVVAP # ARGRSTTRIDSPILQAIARRTGKQPQYRAASESPCDPPPHFDLDAGDYNDQDPPVDPNDLGADNINDNLDDESGSLPCGEPGDPSGPGGPHSPISPDI # PNEQCAMLDFLSGFKGSIETLGTVLAALGHPSDSSESKSKVKEPEVFNGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDI # LNPDLDSLPAWMSSFKALVKELQDNFGVYDAQGKAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAEHIKDEMARLPEPATLAN # YRQEVLRIDNHYWKHEETRKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSLAPFTPKPKSFSGGKPQNSSNSGQSGDMTHFYLSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g503 ### # start gene g504 6 AUGUSTUS gene 1866960 1868285 0.29 - . g504 6 AUGUSTUS transcript 1866960 1868285 0.29 - . g504.t1 6 AUGUSTUS stop_codon 1866960 1866962 . - 0 transcript_id "g504.t1"; gene_id "g504"; 6 AUGUSTUS CDS 1866960 1867591 0.55 - 2 transcript_id "g504.t1"; gene_id "g504"; 6 AUGUSTUS CDS 1867673 1868285 0.29 - 0 transcript_id "g504.t1"; gene_id "g504"; 6 AUGUSTUS start_codon 1868283 1868285 . - 0 transcript_id "g504.t1"; gene_id "g504"; # protein sequence = [MEQERYGPVPSKWEWQKKLRERTSISAEWLSYFHEIMDIPMVGLFFDVHHSGCLSLLSVFLETKMPLVLYWGSTNDWR # VPLGLPPSIPVPSRALVNHLMSKQIPYSPPAPTTPPTSVAVSSTTNIIGKKLRISRFDGGTQPRKSEGVIEFLKRREIDRLRKIASEDMKDRQSRLQR # EKNASKDMPPGRKGARVYYWDMVEGIRVHEWDICTELDPNDEPSYPDDDDDDGDDYFILASSTMGEDTAHNIGPASSLAYLARLLPSSDSDERVVFDE # TVDDIVVHRFGFAPDGHSTNRQYSCPEKVWNSMLLLIGCGRPPRPPIRDERTASQLCTFLHDLMKAVKLHQAPQAFDLISIRPALPFEVDVLHAGTSS # YFLVLPPAASESEAFFLAFTNAATVMEIARRKWGSGTTDMQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g504 ### # start gene g505 6 AUGUSTUS gene 1872940 1876165 0.45 - . g505 6 AUGUSTUS transcript 1872940 1876165 0.45 - . g505.t1 6 AUGUSTUS stop_codon 1872940 1872942 . - 0 transcript_id "g505.t1"; gene_id "g505"; 6 AUGUSTUS CDS 1872940 1874727 0.8 - 0 transcript_id "g505.t1"; gene_id "g505"; 6 AUGUSTUS CDS 1874786 1876165 0.47 - 0 transcript_id "g505.t1"; gene_id "g505"; 6 AUGUSTUS start_codon 1876163 1876165 . - 0 transcript_id "g505.t1"; gene_id "g505"; # protein sequence = [MAPERSTSPDPLASYDISPSAPQIALDKAQIASDKPLQRSQRLPSTSSTQISLDKGKGRAQPAQSTSYIASRPSPELR # SVRIRPRTLQERLQVIPEAGTAPQVTGSEHREASIALSTHSHHSSHQIPSQDRISAAPTPPDALEQVRLTAEALGQVVEQYRNNELSPNDAFRALRSL # TDDPTVVRDFIGQIQEIQRDHLRASRERVAVAKAARVAAAAASKSRISDGPLVSTEKAVNEAAWALMERELAENALQLAAAEAEADQMEQDAHQDRSN # SLQQALLKLVGQTQSSSSPGTSSGLPPSLLEAAPHLSALTSSDILSPTVSETWKLRMLFTVDSHVDTTVSLLSAQPFTDPLPQSLLKLIVKDRYVDFE # KIHASITSYTSIFDDSTTFGSEYKLVKKEHSIRSLPVTSEAQWLRVFDAWLAPVLKIYPHRQSELSAYKASIMEFFRAAPSDPSIAFRKTSDFCCLRN # FSVLENVPAPLLALLLLQSARILLVSFGMKGNALPHVQIAASMASVVSVESPTKQLTPNPAMRSLSTVDQRVKTALAGPRSLAGTKRAVPESNSGSSN # SIPRFRRGYLWSTSSSSSEIIPPSIQSTYTAPPLPSPPEHLLNNPQIQSTLKTMAPYIKVETPFNVDRLESLLASHPNQPFVASVMRSLREGFWPFYE # AEWEVESKQKLDNYVSEPQDFAALRAHRDQEVAAGRWSEALPEDFVLLPGMKVSPMFVVWQKGKPRVIMDHTGSGLNDNIPKAEGKVKYDDMHTFGQV # LNDILKEHPDEELILFKSDVSKAFLNLPGHPLWQLCQVVEVDGRYHIVRRLVFGTRTSPHCWCSLSSLMCWFGSEKLGIIGLHVYMDDFYGWDFKRNL # LLFHDQLRPKRQVQLLVFWDMILCPYEDKKQEHGVTLKIIGFWVDIVKGSISLSYESIQGLVADITSFLSSPKRQAALRDWQHLAGSLNWSLNVLPWA # RPALTEMYRKMSGKTLQFRAIPINGEVYRDLTWFSDLLQTAIGIRFVDAQRWHDSEADFVGWTDASNIGLSYVYAGNGFCYQLHPTEGSPVVDIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g505 ### # start gene g506 6 AUGUSTUS gene 1878223 1879227 1 + . g506 6 AUGUSTUS transcript 1878223 1879227 1 + . g506.t1 6 AUGUSTUS start_codon 1878223 1878225 . + 0 transcript_id "g506.t1"; gene_id "g506"; 6 AUGUSTUS CDS 1878223 1879227 1 + 0 transcript_id "g506.t1"; gene_id "g506"; 6 AUGUSTUS stop_codon 1879225 1879227 . + 0 transcript_id "g506.t1"; gene_id "g506"; # protein sequence = [MAPERSTSPDPLASYDISPSAPQIALDKAQIASDKPLQRSQTLPSTSSTQISLDKGKGRAQPAQSTSYIASRPSPELR # SVRIRPRTLQERLQVIPEAGTAPQVTGSEHREASIALSTHSHHSSHQIPLQDRISAVPTPPDALEQVRLTAEALGQVVEQYRNNELSPNDAFRALRSL # TDDPTVVRDFIGQIQEIQRDHLRASRERVAAAKAARAAAAAASKSRISDGPLVSTEKAVNEAAWALMERELAENALQLAAAEAEADQMEQDAHQDRSN # SLQQALLKLVGQTQSSSSPGTVEHTVVIEHFLHTLHSASSLLVITVVTYLVYKVLTDFIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g506 ### # start gene g507 6 AUGUSTUS gene 1879727 1888043 0.55 + . g507 6 AUGUSTUS transcript 1879727 1888043 0.55 + . g507.t1 6 AUGUSTUS start_codon 1879727 1879729 . + 0 transcript_id "g507.t1"; gene_id "g507"; 6 AUGUSTUS CDS 1879727 1883922 0.56 + 0 transcript_id "g507.t1"; gene_id "g507"; 6 AUGUSTUS CDS 1884557 1888043 0.74 + 1 transcript_id "g507.t1"; gene_id "g507"; 6 AUGUSTUS stop_codon 1888041 1888043 . + 0 transcript_id "g507.t1"; gene_id "g507"; # protein sequence = [MSSTTISTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ # VPIKAHQEDPIRMWSILEKQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALI # RALPEEYRHLSSNLLMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPINPHNKRKG # IQANKAKVTEVDDDGVTESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRHWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDRKEAR # QVLFSRVLHVPSLNNNLLSVLYLTKHKGFTVQILKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYG # DVSKLSKNKMVEGFKLESSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFK # RFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQDEGIEVQRTARNRPQQNGVAERLNRTLAELLTAMLLESGLPKTFWVECLAALVYVLNRCPTSA # VPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVP # PETTPKQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDELPIAIRRPARNRKPPGEWWKTKPSSSRVPA # PNDDSDDSNDDYYGDAELAASTTPQVEPRNYREAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLPPGEKAIGSTWVFRIKHNADGSIERFKARLCAQ # GFSQRPGFDYLETYASTLRWSSLRLVLALAAIDDMELRSVDISHAFINSDIDTTIYMKQPEGFKQGGPEKVCRLNKSIYGLKQSPRLWSEKLCSVLVK # LGFKRLESDPCVYLFQRGNIKVIVPVWVDDITLACKDPGVLDKFVIELSKELKLRDLGETTFLLGIGIRRDRPNRKLYLNAKQYIIRKLEEFSMQDSK # PVKTPLNPTVSLSKEDSPKTPEDKEAMINIPYMSAVGSLLFLAMILRADIAFATGVLTRFNSNPGPAHWLAVKHLLRYLKGTIDYELELGPDPTAPDL # ITAISDADLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVASPTIIHVDNQSSIQVAKNPEHHG # RMKHLDRTFYWLREQVIHGKLAPSYLPTEDNPADLLTKALVKQKVENKKAVHWQEDCPINPHNKRKGIQANKAKVTEVDDDGVTESAGSATASSLSNV # LSASSFADTMEWNTDTGATSHMTPHRNWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEARQVLFSRVLHVPSLNNNLLSVLYLTKHKGFTV # QILKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYGDVSKLSKNKMVEGFKLESSAKPDPVCEPCLG # GKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFKRFKAWAEKVTGLKVKILRHDKGGEYISKEFE # KFLQDEGIEVQRTARNRPQQNGVAERLNRTLAELLTAMLLESGLPKTFWVECLAALVYVLNRCPTSAVPDVTPYEVFYKKKPNVENLRVWGCMAYVHV # QKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVPPETTPKQQPLKVTSSAPNELFTLPIPIDESE # SDSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDELPIAIRRPARNRKPPGEWWKTKPSSSRVPAPNDDSDDSNDDYYGDAELASISTQQVEPRNY # REAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLPPGEKAIGSTWVFRIKHNADGSIERFKARLCAQGFSQRPGFDYLETYASTLRWSSLRLVLALAA # IDDMELRSVDISHAFINSDIDTTIYMKQPEGFKQGGPEKVCRLNKSIYGLKQSPRLWSEKLCSVLVKLGFKRLESDPCVYLFQRGDIKVIVPVWVDDI # TLASKNSGVLNKFVIELSKELKLRDLGETTFLLGIGIRRDRPNRKLYLNAKQYIIRKLDEFGMQDSKPVKTPLNPNVTLSKEDSPQTPEDKEAMINVP # YMSAVGSLLFLSMIIRADTAYATGVLTRFNSNPGSAHWLAVKHLLRYLKGTIDYELELGPDPTAPDLITAISDSDLGGNKDNGKSTTGYIIKIGSGAV # SWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVASPTIIHVDNQSSIQVAKNPEHHGRMKHLDRTFYWLREQVIHGKLAPSYLPTEDN # PADLLTKALAIPKVDKFRTMIGLVKPITSDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g507 ### # start gene g508 6 AUGUSTUS gene 1889340 1889896 0.48 + . g508 6 AUGUSTUS transcript 1889340 1889896 0.48 + . g508.t1 6 AUGUSTUS start_codon 1889340 1889342 . + 0 transcript_id "g508.t1"; gene_id "g508"; 6 AUGUSTUS CDS 1889340 1889518 0.49 + 0 transcript_id "g508.t1"; gene_id "g508"; 6 AUGUSTUS CDS 1889760 1889784 0.62 + 1 transcript_id "g508.t1"; gene_id "g508"; 6 AUGUSTUS CDS 1889879 1889896 0.73 + 0 transcript_id "g508.t1"; gene_id "g508"; 6 AUGUSTUS stop_codon 1889894 1889896 . + 0 transcript_id "g508.t1"; gene_id "g508"; # protein sequence = [MASVVSVESPTKQLTPNPAMRSLSTVDQRVKTALAGPRSLAGTKRAAPESNSGSSNSIPRRNTGLFGLLSYEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g508 ### # start gene g509 6 AUGUSTUS gene 1890118 1894365 1 - . g509 6 AUGUSTUS transcript 1890118 1894365 1 - . g509.t1 6 AUGUSTUS stop_codon 1890118 1890120 . - 0 transcript_id "g509.t1"; gene_id "g509"; 6 AUGUSTUS CDS 1890118 1894365 1 - 0 transcript_id "g509.t1"; gene_id "g509"; 6 AUGUSTUS start_codon 1894363 1894365 . - 0 transcript_id "g509.t1"; gene_id "g509"; # protein sequence = [MSSTTISTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ # VPIKAHQEDPIRMWSILEKQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALI # RALPEEYRHLSSNLLMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPINPHNKRKG # IQANKAKVTEVDDDGVTESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRNWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEAR # QVLFSRVLHVPSLNNNLLSVLYLTKHKGFTVQILKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYG # DVSKLSKNKMVEGFKLESSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFK # RFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQDEGIEVQRTARNRPQQNGVAERLNRTLAELLTAMLLESGLPKTFWVECLAALVYVLNRCPTSA # VPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVP # PETTPKQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDEQPIAIRRPVRTRKPPGEWWKTKPSTSRVPA # NNDDSDDSNDDYYGDAELAASTTPQVEPRNYREAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLPPGAKAIGSTWVFRIKHNADGSIERFKARLCAQ # GFSQRPGFDYLETYASTLRWSSLRLVLALAAIDDMELRSVDISHAFINSDIDTTIYMKQPEGFKQGGPEKVCRLNKSIYGLKQSPRLWSEKLCSVLVK # LGFKRLESDPCVYLFQRGDIKVIVPVWVDDITLASKNSGVLNKFVIELSKELKLRDLGETTFLLGIGIRRDRPNRKLYLNAKQYIIRKLDEFGMQDSK # PVKTPLNPNVTLSKEDSPQTPEDKEAMINVPYMSAVGSLLFLSMIIRADTAYATGVLTRFNSNPGPAHWLAVKHLLRYLKGTIDYELELGPDPTAPDL # ITAISDSDLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVASPTIIHVDNQSSIQVAKNPEHHG # RMKHLDRTFYWLREQVTHGKLAPSYLPTEDNPADLLTKALAIPKVDKFRTMIGLVKPITSDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g509 ### # start gene g510 6 AUGUSTUS gene 1895425 1896758 0.38 + . g510 6 AUGUSTUS transcript 1895425 1896758 0.38 + . g510.t1 6 AUGUSTUS start_codon 1895425 1895427 . + 0 transcript_id "g510.t1"; gene_id "g510"; 6 AUGUSTUS CDS 1895425 1895428 0.39 + 0 transcript_id "g510.t1"; gene_id "g510"; 6 AUGUSTUS CDS 1895488 1895519 0.77 + 2 transcript_id "g510.t1"; gene_id "g510"; 6 AUGUSTUS CDS 1895613 1896758 0.93 + 0 transcript_id "g510.t1"; gene_id "g510"; 6 AUGUSTUS stop_codon 1896756 1896758 . + 0 transcript_id "g510.t1"; gene_id "g510"; # protein sequence = [MMITRSDEALCNSTYTAPPLPSPPEHLLNNPQIQSTLKAMAPYIKVETPFNVNRLESLLASHPNQPFVASVMRSLREG # FWPFYEAEWEVESKQKLDNYVSEPQDFAALRAHRDQEVAAGRWSEALPEDFVLLPGMKVSPMFVVWQKGKPRVVMDHTGSGLNDNIPKAEGKVKYDDM # HTFGQVLNDIMKEHPDEELILFKSDVSKAFLNLPGHPLWQLCQVVEVDGRYHIVRRLVFGTRTSPRCWCSLSSLMCWFGSEKLGIIGLHVYMDDFYGW # DFKRNLLLFHDQLRPKRQVQLLVFWDMILCPYEDKKQEHGVTLKIIGFWVDIVKGSISLSSESIQGLVADITSFLSSPKRQAALRDWQHLAGSLNWSL # NVLPWARPALTEMYRKMLSIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g510 ### # start gene g511 6 AUGUSTUS gene 1897362 1899131 1 + . g511 6 AUGUSTUS transcript 1897362 1899131 1 + . g511.t1 6 AUGUSTUS start_codon 1897362 1897364 . + 0 transcript_id "g511.t1"; gene_id "g511"; 6 AUGUSTUS CDS 1897362 1899131 1 + 0 transcript_id "g511.t1"; gene_id "g511"; 6 AUGUSTUS stop_codon 1899129 1899131 . + 0 transcript_id "g511.t1"; gene_id "g511"; # protein sequence = [MSSTTISTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ # VPIKAHQEDPIRMWSILEKQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALI # RALPEEYRHLSSNLLMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPINPHNKRKG # IQANKAKVTEVDDDGVTESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRHWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEAR # QVLFSRVLHVPSLNNNLLSVLYLTKHKGFTVQILKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYG # DVSKLSKNKMVEGFKLESSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVPMLVFTQGGVFSQN # LSPRAPKLRIMKRPTTRYMVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g511 ### # start gene g512 6 AUGUSTUS gene 1900016 1902748 0.91 + . g512 6 AUGUSTUS transcript 1900016 1902748 0.91 + . g512.t1 6 AUGUSTUS start_codon 1900016 1900018 . + 0 transcript_id "g512.t1"; gene_id "g512"; 6 AUGUSTUS CDS 1900016 1902748 0.91 + 0 transcript_id "g512.t1"; gene_id "g512"; 6 AUGUSTUS stop_codon 1902746 1902748 . + 0 transcript_id "g512.t1"; gene_id "g512"; # protein sequence = [MVGQVEQQQLDVFMCTIEVMNTDLIAVVYLLFAEASRNAPYPWNPPSCRIPMKKKSDAFAAFKRFKAWAEKVTGLKVK # ILRHDKGGEYISKEFEKFLQDEGIEVQRTARNRPQQNGVAERLNRTLAELLTAMLLESGLPKTFWVECLAALVYVLNRCPTSAVPDVTPYEVFYKKKP # NVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVPPETTPKQQPLKVTSS # APNELFTLPIPIDESESDSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDELPIAIRRPARNRKPPGEWWKTKPSSSRVPAPNDDSDDSNDDYYGD # AELASISTQQVEPRNYREAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLPPGEKAIGSTWVFRIKHNADGSIERFKARLCAQGFSQRPGFDYLETYA # STLRWSSLRLVLALAAIDDMELRSVDISHAFINSDIDTTIYMKQPEGFKQGGPEKVCRLNKSIYGLKQSPRLWSEKLCSVLVKLGFKRLESDPCVYLF # QRGNIKVIVPVWVDDITLACKDPGVLDKFVIELSKELKLRDLGETTFLLGIGIRRDRPNRKLYLNAKQYIIRKLEEFSMQDSKPVKTPLNPTVSLSKE # DSPKTPEDKEAMINVPYMSAVGSLLFLAMILRADIAFATGVLTRFNSNPGPAHWLAVKHLLRYLQGTIDYELELGPDPTAPDLITAISDADLGGNKDN # GKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVASPTIIHVDNQSSIQVAKNPEHHGRMKHLDRTFYWLREQ # VTHGKLAPSYLPTEDNPADLLTKALVKQKVEKFRTMIGLVKPSTSDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g512 ### # start gene g513 6 AUGUSTUS gene 1908863 1909797 0.9 + . g513 6 AUGUSTUS transcript 1908863 1909797 0.9 + . g513.t1 6 AUGUSTUS start_codon 1908863 1908865 . + 0 transcript_id "g513.t1"; gene_id "g513"; 6 AUGUSTUS CDS 1908863 1908882 0.9 + 0 transcript_id "g513.t1"; gene_id "g513"; 6 AUGUSTUS CDS 1908945 1909797 0.9 + 1 transcript_id "g513.t1"; gene_id "g513"; 6 AUGUSTUS stop_codon 1909795 1909797 . + 0 transcript_id "g513.t1"; gene_id "g513"; # protein sequence = [MSENRHRDYVRFCTSHNLPLDPTPSTLSRYIAFTSRHKASGPKYLTGARHYLKDVYPQFDESRSHPLVQATIRGSKKV # RADPVKRKPPLRTSHLQQFLELKTKSYNHLLFATLISCCFYGCHRVGELTFPNQKSLRDWRKVIKRSTLKFEAGRAGYHLPYHKGDPFYQGTDILFCS # QQVADPVTLLKEYATVRDKLHGARPALFILEDGNVPTRGWFDSMFFAVLSKEFGGHSGRAGGATFYAGLGLQEMIIMALGRWSSSAWKIYIRDNPAVR # AELELAAIRRHQSSFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g513 ### # start gene g514 6 AUGUSTUS gene 1910975 1915222 0.98 + . g514 6 AUGUSTUS transcript 1910975 1915222 0.98 + . g514.t1 6 AUGUSTUS start_codon 1910975 1910977 . + 0 transcript_id "g514.t1"; gene_id "g514"; 6 AUGUSTUS CDS 1910975 1915222 0.98 + 0 transcript_id "g514.t1"; gene_id "g514"; 6 AUGUSTUS stop_codon 1915220 1915222 . + 0 transcript_id "g514.t1"; gene_id "g514"; # protein sequence = [MSSTTISTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ # VPIKAHQEDPIRMWSILEKQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALI # RALPEEYRHLSSNLLMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPSNPHNKRKG # IQANKAKVTEVDDDGVTESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRHWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEAR # QVLFSRVLHVPSLNNNLLSVLYLTKHKGFTVQILKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYG # DVSKLSKNKMVEGFKLESSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFK # RFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQDEGIEVQRTARNRPQQNGVAERLNRTLAELLTAMLLESGLPKTFWVECLAALVYVLNRCPTSA # VPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVP # PETTPKQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDELPIAIRRPARNRKPPGEWWKTKPSSSRVPA # PNDDSDDSNDDYYGDAELASISTQQVEPRNYREAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLPPGEKAIGSTWVFRIKHNADGSIERFKARLCAQ # GFSQRPGFDYLETYASTLRWSSLRLVLALAAIDDMELRSVDISHAFINSDIDTTIYMKQPEGFKQGGPEKVCRLNKSIYGLKQSPRLWSEKLCSVLVK # LGFKRLESDPCVYLFQRGNIKVIVPVWVDDITLACKDPGVLDKFVIELSKELKLRDLGETTFLLGIGIRRDRPNRKLYLNAKQYIIRKLEEFSMQDSK # PVKTPLNPTVSLSKEDSPKTPEDKEAMINIPYMSAVGSLLFLAMILRADIAFATGVLTRFNSNPGPAHWLAVKHLLRYLKGTIDYELELGPDPTAPDL # ITAISDADLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVASPTIIHVDNQSSIQVAKNPEHHG # RMKHLDRTFYWLREQVIHGKLAPSYLPTEDNPADLLTKALVKQKVEKFRTMIGLVKPSTSDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g514 ### # start gene g515 6 AUGUSTUS gene 1929097 1930014 0.23 - . g515 6 AUGUSTUS transcript 1929097 1930014 0.23 - . g515.t1 6 AUGUSTUS stop_codon 1929097 1929099 . - 0 transcript_id "g515.t1"; gene_id "g515"; 6 AUGUSTUS CDS 1929097 1929609 0.72 - 0 transcript_id "g515.t1"; gene_id "g515"; 6 AUGUSTUS CDS 1929696 1929845 0.58 - 0 transcript_id "g515.t1"; gene_id "g515"; 6 AUGUSTUS CDS 1929898 1930014 0.51 - 0 transcript_id "g515.t1"; gene_id "g515"; 6 AUGUSTUS start_codon 1930012 1930014 . - 0 transcript_id "g515.t1"; gene_id "g515"; # protein sequence = [MDVPGDESSMDDEPRTPPAQSAASDPGATPTQQNPGEARTRKATQLQTAKSISKKTTRAASRAASKSQTPSIADDDDD # TGAPLKPVHVRANNDAIQKMAESNARMLAKFRASQTEAMEKTIQVAVVSGLSSLNQNVGRLAESLETISKNQAITSQLLSHLEGRLDGERPRSPTRSS # SHRRSISTNAGYADDTQAEGSNQNAASAKGKGRREVDEDDDNDNDNEEFEYADNENQAEKGIALKKKRKLTKTRKALDLQVRH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g515 ### # start gene g516 6 AUGUSTUS gene 1944713 1945345 0.99 + . g516 6 AUGUSTUS transcript 1944713 1945345 0.99 + . g516.t1 6 AUGUSTUS start_codon 1944713 1944715 . + 0 transcript_id "g516.t1"; gene_id "g516"; 6 AUGUSTUS CDS 1944713 1945345 0.99 + 0 transcript_id "g516.t1"; gene_id "g516"; 6 AUGUSTUS stop_codon 1945343 1945345 . + 0 transcript_id "g516.t1"; gene_id "g516"; # protein sequence = [MHETESDHNSDNNEEIPYQVSESHNLNARVKTTLMPVEQDNQQRADSINEPLNDVDSSIKYFMDTNSPVDQFEKNEKT # YAKQENERLHRELQGEPITTLGFFIDATNPIELKSQMSARIRRDIAEHTHLNVLNRLLIQTRSEYLQNKLSQSATSETFDNLSSQLQELADRCVEHTV # VIEHFLHTLHSASSLLVITVVTYLVYKVLTDFIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g516 ### # start gene g517 6 AUGUSTUS gene 1953084 1954739 0.99 - . g517 6 AUGUSTUS transcript 1953084 1954739 0.99 - . g517.t1 6 AUGUSTUS stop_codon 1953084 1953086 . - 0 transcript_id "g517.t1"; gene_id "g517"; 6 AUGUSTUS CDS 1953084 1954739 0.99 - 0 transcript_id "g517.t1"; gene_id "g517"; 6 AUGUSTUS start_codon 1954737 1954739 . - 0 transcript_id "g517.t1"; gene_id "g517"; # protein sequence = [MNSERNSKENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDGQPVQVLTP # RRGQPPVVAPARGWSTTRIESPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGTDSNHDNLDDDSGGLPRGEPGDPSGPG # GPGGPGGPGGPRSPLPPDIPNEQRAMLELLLGFKGSIETLGTILAALSRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKV # NYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIQKYNIRFNTLAASTNWDSAALKWAYGRGL # AERIKDEMAHLPEPATLADYRQEVLRIDNCYWKHEETRKREAGKPFIALNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQN # SSNSGQSGGQRPAFNHLGTDGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g517 ### # start gene g518 6 AUGUSTUS gene 1955367 1955891 1 - . g518 6 AUGUSTUS transcript 1955367 1955891 1 - . g518.t1 6 AUGUSTUS stop_codon 1955367 1955369 . - 0 transcript_id "g518.t1"; gene_id "g518"; 6 AUGUSTUS CDS 1955367 1955891 1 - 0 transcript_id "g518.t1"; gene_id "g518"; 6 AUGUSTUS start_codon 1955889 1955891 . - 0 transcript_id "g518.t1"; gene_id "g518"; # protein sequence = [MVKDLGWDGAESYFANMEDDKDDKVMDQQMNLNVNLAIWMTGTKELLDRLGNLEAHREDDVCVFNQDSLNGKKISTPM # KEQDWSKRTLRSNAVAPEESEKAKPNQTNENMRRLVFDGVHIPKKPGLIPGKLVKTTNENQKTVRFEASTSIDRPCQVHASGLHAAAWYSEDLPLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g518 ### # start gene g519 6 AUGUSTUS gene 1956797 1957627 1 - . g519 6 AUGUSTUS transcript 1956797 1957627 1 - . g519.t1 6 AUGUSTUS stop_codon 1956797 1956799 . - 0 transcript_id "g519.t1"; gene_id "g519"; 6 AUGUSTUS CDS 1956797 1957627 1 - 0 transcript_id "g519.t1"; gene_id "g519"; 6 AUGUSTUS start_codon 1957625 1957627 . - 0 transcript_id "g519.t1"; gene_id "g519"; # protein sequence = [MGENRHSSEATESIFEHGGITSDEAKVRLALEWISYKTRQALKVFDSVKKPNWDQFKKDLKNMFLQSVGDEQGSRLLL # EQLVHQFNPVDAGEQEKMRIFRLLFDAKMKKLMDEPKMIMNSDAVRLFLAPMTPKVRRGMLETVVKEVSVTSMSDQRKEDAFKIDEVMNAAEKYMIGS # LFDNYYQTLSSAFSSPPIDNPNSFSRGHINLLFAADVPKTDRNYLQALKPKIENKFKDLLGIKLESLIPRKLTEEQQQMVALNKDLMEVNMKEIRAVK # LL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g519 ### # start gene g520 6 AUGUSTUS gene 1972453 1973019 0.97 - . g520 6 AUGUSTUS transcript 1972453 1973019 0.97 - . g520.t1 6 AUGUSTUS stop_codon 1972453 1972455 . - 0 transcript_id "g520.t1"; gene_id "g520"; 6 AUGUSTUS CDS 1972453 1973019 0.97 - 0 transcript_id "g520.t1"; gene_id "g520"; 6 AUGUSTUS start_codon 1973017 1973019 . - 0 transcript_id "g520.t1"; gene_id "g520"; # protein sequence = [MQDSKPVKTPLNPTVSLSKEDSPQTPEDKEAMINVPYMSAVGSLLFLAMIIHADIAFATGVLTRFNSNPGLAHWLAVK # HLLRYLKGTIDYELELGPDPTAPDLITAISDADLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLNELGYK # VASPTIRTLKSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g520 ### # start gene g521 6 AUGUSTUS gene 1979741 1980001 0.57 + . g521 6 AUGUSTUS transcript 1979741 1980001 0.57 + . g521.t1 6 AUGUSTUS start_codon 1979741 1979743 . + 0 transcript_id "g521.t1"; gene_id "g521"; 6 AUGUSTUS CDS 1979741 1980001 0.57 + 0 transcript_id "g521.t1"; gene_id "g521"; 6 AUGUSTUS stop_codon 1979999 1980001 . + 0 transcript_id "g521.t1"; gene_id "g521"; # protein sequence = [MLNPFPNRTQSPPPPIEVDGEEEYNIAEILDSKLDRRYKHCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHA # RYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g521 ### # start gene g522 6 AUGUSTUS gene 1983084 1984184 0.95 - . g522 6 AUGUSTUS transcript 1983084 1984184 0.95 - . g522.t1 6 AUGUSTUS stop_codon 1983084 1983086 . - 0 transcript_id "g522.t1"; gene_id "g522"; 6 AUGUSTUS CDS 1983084 1984184 0.95 - 0 transcript_id "g522.t1"; gene_id "g522"; 6 AUGUSTUS start_codon 1984182 1984184 . - 0 transcript_id "g522.t1"; gene_id "g522"; # protein sequence = [MFGSPKILTLWPSLSQSPILRQFSHSPLILGAFERHRHLFGVIDTKPVRKPHLVQKLGTILLDSFYSRARSKNGKESR # TPISSISTPPSNSSLPLIDFDQLPQLYPHSPASPNINDTIPGLVVLHIRRGDFEQHCINLVEWGAAFNGFNSFEDIREQDGFDSAAAGAGTRPPGDEP # IAPEQESDFAAKLKDMSEEEKKQARKARKETLEAYAAAKKDYEHRKAKYDTAKTNYLERCFPEIDQIVRRVRQVREAASLDSSKSDTQSAPLTHLYVM # TNGRPPFLAELRAALELDAIANNPLDLPPWESIYTSRDLELGWEEAYVSQALDMYVAQRAEVFVGNGFSSLTSNILMLRKANGVDSIKTRLW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g522 ### # start gene g523 6 AUGUSTUS gene 1987416 1987702 0.8 + . g523 6 AUGUSTUS transcript 1987416 1987702 0.8 + . g523.t1 6 AUGUSTUS start_codon 1987416 1987418 . + 0 transcript_id "g523.t1"; gene_id "g523"; 6 AUGUSTUS CDS 1987416 1987445 0.8 + 0 transcript_id "g523.t1"; gene_id "g523"; 6 AUGUSTUS CDS 1987496 1987702 0.99 + 0 transcript_id "g523.t1"; gene_id "g523"; 6 AUGUSTUS stop_codon 1987700 1987702 . + 0 transcript_id "g523.t1"; gene_id "g523"; # protein sequence = [MWLMLQGQGLKPEEPPTDFVLATGETHPVREFVEKAFGVVGIKLAWSGSGLDEEARDVNTGKVVVKIDPQYFRPAEVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g523 ### # start gene g524 6 AUGUSTUS gene 1988115 1989236 0.9 - . g524 6 AUGUSTUS transcript 1988115 1989236 0.9 - . g524.t1 6 AUGUSTUS stop_codon 1988115 1988117 . - 0 transcript_id "g524.t1"; gene_id "g524"; 6 AUGUSTUS CDS 1988115 1989236 0.9 - 0 transcript_id "g524.t1"; gene_id "g524"; 6 AUGUSTUS start_codon 1989234 1989236 . - 0 transcript_id "g524.t1"; gene_id "g524"; # protein sequence = [MNSSYSKINPTSTFHSAYPFRPLPPTASGPPQSIVSQTSFEYPLEPVSSSVVPQGTDFSTRVRGSISTDSTSSSNANH # NLDKPDTFASSSTSAPADTPSLCSDNDAEMDAERPEHDNDSSTPPSTPPGTTARFTTPPKYTGEVIDLEVDLVDEDDQHDHDPSEDQKQSRRRSSPHP # SAYLTAKRIPVSPLPNMSPKRPKPPASSRRRIRTSTGRATTHPIPATPPSHANLYDLEHQDDEGDEDPLLLRLTADEDDFVSLSGLSQRQPQRRRSTL # DEEMRAAHRASLNVETQGGYSEDELENGVLVATGARSKNLGFLAHGGVWMGEGYDLGVGNAEEEQREDHRLSSKESGKEKSRTRIPIPKSKPPMVMRG # R] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g524 ### # start gene g525 6 AUGUSTUS gene 1989275 1990090 0.29 - . g525 6 AUGUSTUS transcript 1989275 1990090 0.29 - . g525.t1 6 AUGUSTUS stop_codon 1989275 1989277 . - 0 transcript_id "g525.t1"; gene_id "g525"; 6 AUGUSTUS CDS 1989275 1990090 0.29 - 0 transcript_id "g525.t1"; gene_id "g525"; 6 AUGUSTUS start_codon 1990088 1990090 . - 0 transcript_id "g525.t1"; gene_id "g525"; # protein sequence = [MKEKRWERDKESVTGDEENVIREKERDKEKIRKLEEEIERLKEELRRRPAPTPPFPIPPPPPPPPQPPLAISIAAPSA # LNNSNAPAPFAHARAALNHAPTPKEAPINPPRRGGQPTVGVTADKMAAFLTEMKTVRLRKVGSQSTLGKSTGNLSRRDSFGNDNSRRDSFDDLNIERS # RLSISDLRTTKEILDIRTQHGPSVGPSSAVARELSWPSTRSVSSNSEEDASGSLHRKRKRMESADEETNHNKSGDLSSQIRKYIHPFVLSILTSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g525 ### # start gene g526 6 AUGUSTUS gene 1992219 1993469 0.85 + . g526 6 AUGUSTUS transcript 1992219 1993469 0.85 + . g526.t1 6 AUGUSTUS start_codon 1992219 1992221 . + 0 transcript_id "g526.t1"; gene_id "g526"; 6 AUGUSTUS CDS 1992219 1993469 0.85 + 0 transcript_id "g526.t1"; gene_id "g526"; 6 AUGUSTUS stop_codon 1993467 1993469 . + 0 transcript_id "g526.t1"; gene_id "g526"; # protein sequence = [MLKIANATFCTAKRITMFATLRRCAQVVSTTSKPAPNPFFNKAATSKTSHRKSPLTRTSVDGLFQTYKPVTPGLRHLK # RPLNPHLYAGRPVRLLTYPLRKSGGRNNTGRITVRHRGGGHRQRIRIVDWKREEGGIWDVVRIEYDPGRSAHLALIKRRGTPESAEASLSVDSQGRPG # WAYILATEGMRAGDHVQSFRSGIPPDLVPGLNLELPSSKSKSQSDSSDNEDANTSSSLALGIFRALTLKSGNVLPLSLIPPGTVVHNITLTPTGPARL # VRSAGTSALVVAHETAEQSPSPTPTLYTQVRLASGEIRRILQSAFATIGTVSNPLWKNRSLGKAGRSRWLGWRPAVRGVAMNAKDHPHGGGRGKGKSN # KHPVSIWGWGTKGTRTRKPGPKGPKNSNKLVVKERPRGVDRRKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g526 ### # start gene g527 6 AUGUSTUS gene 1993806 1994225 0.35 - . g527 6 AUGUSTUS transcript 1993806 1994225 0.35 - . g527.t1 6 AUGUSTUS stop_codon 1993806 1993808 . - 0 transcript_id "g527.t1"; gene_id "g527"; 6 AUGUSTUS CDS 1993806 1994225 0.35 - 0 transcript_id "g527.t1"; gene_id "g527"; 6 AUGUSTUS start_codon 1994223 1994225 . - 0 transcript_id "g527.t1"; gene_id "g527"; # protein sequence = [MRGPHGLPPDLLDRLLIVATSKYVPDEVRQIIKIRCQEEDVEVGPDAEDLLVEIAGDAGMRYALGLIAVSQVVARKRV # KSSGGGSEAVEVEDLRRAYGCFMDPGRSVQWLKEQQGSLLVEEITGSENILQGQSDKMDVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g527 ### # start gene g528 6 AUGUSTUS gene 1994657 1995388 0.36 - . g528 6 AUGUSTUS transcript 1994657 1995388 0.36 - . g528.t1 6 AUGUSTUS stop_codon 1994657 1994659 . - 0 transcript_id "g528.t1"; gene_id "g528"; 6 AUGUSTUS CDS 1994657 1995388 0.36 - 0 transcript_id "g528.t1"; gene_id "g528"; 6 AUGUSTUS start_codon 1995386 1995388 . - 0 transcript_id "g528.t1"; gene_id "g528"; # protein sequence = [MDIGAGITTGTAELREATKMERIGVHSHITGLGLDDRLEPRPNSQGIPNYILSSIGLNLLNLILGMVGQLRARKAAGV # ILRLLSPSSFSSSTVSAAPGLSGRAILLAGPPSTGKTAIARGMAATLGPDVPFTSITASEVYSLSMSKTEALTQALRRSIGVRIREEEEIVEGEVVEI # VVERGITGSGKSGRVILKTTDMETVYEMGGKMIDEMTKEKVRVYEICAFSQHIIITTSRSLQATSSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g528 ### # start gene g529 6 AUGUSTUS gene 2002172 2004870 0.68 - . g529 6 AUGUSTUS transcript 2002172 2004870 0.68 - . g529.t1 6 AUGUSTUS stop_codon 2002172 2002174 . - 0 transcript_id "g529.t1"; gene_id "g529"; 6 AUGUSTUS CDS 2002172 2003785 1 - 0 transcript_id "g529.t1"; gene_id "g529"; 6 AUGUSTUS CDS 2003908 2004870 0.68 - 0 transcript_id "g529.t1"; gene_id "g529"; 6 AUGUSTUS start_codon 2004868 2004870 . - 0 transcript_id "g529.t1"; gene_id "g529"; # protein sequence = [MLSAIAARKAATAAAASGGVKGDSYSTSASTSTVSTSISTPITKSKPRPTPSKRKHSSTGAALDGSITAKKRKRRERD # VLEKPRAPRSRYFEQGRPAATEGEDGVGKGEDDEEEEEEDWDGSNSDVKVETTATRGYSPSRPISPDDSSDEEQVQNGSIQPEPQTQTQSQVLLTNFV # PIPGQNTFYLSPDELSLVLSAEKSTVPATLIALGPSENLTLLGTYRLAVIRGSIEIGGAILRSRVHPETHNVFAPRSSPVPSIRVVSSAPSSRSPALF # PLRIQHEIDALVGDPVLVLLQELRSGVEALGKVCRTFDGVFELHPRDITHQSKYVSPLVIPPSWEKALDEVSTQNLECHDDDDDSETERKHPPKIYLI # KGPKKVGKSSFARTLVNRLLSQHNTLAYLDLDPGQSEFTPAGLIALTLVSDPVLGPPWTHPSVPLRAHFIGAFSPKGCPSLYVEGVRDLVRFWGEEVC # WGGSKSAIPLVVNTMGWAKGLGVDLMKRIQDVLVVDGVEKVSYETCFGSRIGSESRAVMCVYEFGQSENEMGNGRQRGMDGVPLERSSFFGEGATSRV # DHLQHPPPGIQIHNLEPVPVSASNTLSLLFSAADQRTMNIMSYFHAVFPSSSSSSSSSYTAAPHWDASLPLLARPPYQVDVGRALDRVFLLGGGGEVI # KAEIENVLGGAVVALVRCEPGTLDDAIDDNDDDSTQGQNQLGEVGTKIPYFPSSNSASSYPSPLTSSAVGLALVRSVAPGGSHLHVLTPLPLSAILSS # SSISPGLSLSKSLDMGMGMGMGTGAAGARVLVKGEMEIPIWGMVDFRRLGGRGANGGEGDEQRDIPFLQWEKGVGVGAERRRVRRNLMRKGQGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g529 ### # start gene g530 6 AUGUSTUS gene 2012823 2014433 0.99 - . g530 6 AUGUSTUS transcript 2012823 2014433 0.99 - . g530.t1 6 AUGUSTUS stop_codon 2012823 2012825 . - 0 transcript_id "g530.t1"; gene_id "g530"; 6 AUGUSTUS CDS 2012823 2014433 0.99 - 0 transcript_id "g530.t1"; gene_id "g530"; 6 AUGUSTUS start_codon 2014431 2014433 . - 0 transcript_id "g530.t1"; gene_id "g530"; # protein sequence = [MLAASASLLNIPVVVLDVGVDAPAKQIIASSSHIDGSFRDKKKIAELAKRVDVLTVEIEHVDVEALETVQESHPNVSI # HPSPSTIRLIQDKFSQKKHLSSVGCPLGPFQAVDATPEAITQAAKELGLPLMLKSRTMAYDGRGNYLLRSLDSESIATAIKFLGSGSRKLYAEKWVPF # VKELAVMVVRGLDETVASYPAVETIHRDNICHLVWAPFRLSDIDQDPALPTKAERVAREAVEKAFKGAGVFGVEMFLLNNGEILINEIAPRPHNSGHY # TIEACESSQYDNHLRAILGLPLGSTRIKVGAAGMLNILGSSDGQSSKISESSSPSSSSFADDLLIDKLTHIALSTPGASPHLYGKAQSRKGRKMGHIT # IVGTSDAEVRERMAPLLSCLSEFEGDVQGDQASSPDPPHLLGYSHPHPVISIIMGSDSDLPVLLPAAQILTKHFPSIPFEVTLVSAHRTPLRLVNFAK # SAAGRGVKVIIAGAGGAAHLPGMVASLTGVPVVGVPVDSKSVSGSGGGLGGVDAMWSILQMPVSTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g530 ### # start gene g531 6 AUGUSTUS gene 2014633 2015142 1 + . g531 6 AUGUSTUS transcript 2014633 2015142 1 + . g531.t1 6 AUGUSTUS start_codon 2014633 2014635 . + 0 transcript_id "g531.t1"; gene_id "g531"; 6 AUGUSTUS CDS 2014633 2015142 1 + 0 transcript_id "g531.t1"; gene_id "g531"; 6 AUGUSTUS stop_codon 2015140 2015142 . + 0 transcript_id "g531.t1"; gene_id "g531"; # protein sequence = [MPAPRKRPNRKRKRRAVSVSSSSSDASSSSDNDSTVVTRTLPVVNAVKTKADEDGDSDSSSSSSSSSSSSSDSSSSSD # ESQSPPHGNGKSKSDHHHANSVEKGPRPRSPSPGPIAPSALRIPSFLPEKETRDAKESERVLQEKFTKFWMNNIVEGFKDDLEIIRKVGKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g531 ### # start gene g532 6 AUGUSTUS gene 2015850 2016971 0.51 + . g532 6 AUGUSTUS transcript 2015850 2016971 0.51 + . g532.t1 6 AUGUSTUS start_codon 2015850 2015852 . + 0 transcript_id "g532.t1"; gene_id "g532"; 6 AUGUSTUS CDS 2015850 2016971 0.51 + 0 transcript_id "g532.t1"; gene_id "g532"; 6 AUGUSTUS stop_codon 2016969 2016971 . + 0 transcript_id "g532.t1"; gene_id "g532"; # protein sequence = [MNFRHCARKAIGTQSSNIQHHCRKNSSRCNKDVPGPEGHVENDTGSNGRNLVRNVYKYILIFADFLNFVSMYRLTNDG # NAILREIDVAHPAAKNMIELSRTQDEECGDGTTSVIVLAASILASSLSQLERDIHPVVIISAYNKALREALAIIEKVAIPVNVEDEEQMLGIVKGALG # TKFVSRWSELMCKLALDAVHIVAQNVQSDKSDSQYASTFSSATPTVDIKRYARIEKIPGGAIEESRVIRGIMLNKDITHPGMRRRIQNPRIVLLDCPL # EYKKGESQTNMEFSKEGDWSRAQEVEEEVVKAMVEAVCQVGCDLVLTEKGVSGECAFNFSDLSTFWIYLHSQTLPSTISSNTMFLASDVSENQITIVL # H] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g532 ### # start gene g533 6 AUGUSTUS gene 2022281 2022850 0.36 - . g533 6 AUGUSTUS transcript 2022281 2022850 0.36 - . g533.t1 6 AUGUSTUS stop_codon 2022281 2022283 . - 0 transcript_id "g533.t1"; gene_id "g533"; 6 AUGUSTUS CDS 2022281 2022850 0.36 - 0 transcript_id "g533.t1"; gene_id "g533"; 6 AUGUSTUS start_codon 2022848 2022850 . - 0 transcript_id "g533.t1"; gene_id "g533"; # protein sequence = [MTDNWEKPHPMTRYCSMYRAATCSAIPFKLTSTQELLKTSSSDMNWGPLIAFVLSAFVSASNLTVTVSSPPTLPETAS # HTLHPSLASFSIETAFFIMYVGNTTSPNILTRDLLQNIKDRIGIPAEIRIGGITADSTFWDPSLEAAIFNFVDNTGALINTTIGWEFWDAARELLPEG # TQITVNLVCPIQF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g533 ### # start gene g534 6 AUGUSTUS gene 2026153 2028115 0.37 + . g534 6 AUGUSTUS transcript 2026153 2028115 0.37 + . g534.t1 6 AUGUSTUS start_codon 2026153 2026155 . + 0 transcript_id "g534.t1"; gene_id "g534"; 6 AUGUSTUS CDS 2026153 2026795 0.6 + 0 transcript_id "g534.t1"; gene_id "g534"; 6 AUGUSTUS CDS 2026852 2026974 0.98 + 2 transcript_id "g534.t1"; gene_id "g534"; 6 AUGUSTUS CDS 2027435 2027773 0.82 + 2 transcript_id "g534.t1"; gene_id "g534"; 6 AUGUSTUS CDS 2027829 2028115 0.75 + 2 transcript_id "g534.t1"; gene_id "g534"; 6 AUGUSTUS stop_codon 2028113 2028115 . + 0 transcript_id "g534.t1"; gene_id "g534"; # protein sequence = [MAKLAKLEEANKQKSSLHSAGLSESSSPPILSPSSTHDSAYFSSDLASATQVSPGANQDVEDWIAKARESLAEFGGFI # GIGGASMPKSYIVEQDPESLSDSGGDTDSSLDAPRSNGEYEFAVVDDEGEERSPQGSEIKRPMGKRLSNSSAGSISGFKKKESTGKSVTIPNEAVPFG # LMAELSYKNIRERGSNSEVETDEPGAETGVANANFFRPSPGPDPARTQTTNLPQLPHILARGIITPSDAEKLFKMFVRTXLNLHLPNTAKPQNEMHAR # EQLNRTRVWLNCFNLDRSTGSQNGKPPIISNNDYIANHSEDWWKLSPYNMKNFDIQLCCYNSELKVMSNFRSKIYNDPDHATGLNKVEILSSCISETD # EEFLALQTKWFPILDENVDKNDPPGHFRLGLLKLAFGYARLIVLSYGFQHAFGKNSSNDNPFLDRCMNAANDIVQTMVEDIGRPEQSKRFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g534 ### # start gene g535 6 AUGUSTUS gene 2028390 2028773 0.69 + . g535 6 AUGUSTUS transcript 2028390 2028773 0.69 + . g535.t1 6 AUGUSTUS start_codon 2028390 2028392 . + 0 transcript_id "g535.t1"; gene_id "g535"; 6 AUGUSTUS CDS 2028390 2028773 0.69 + 0 transcript_id "g535.t1"; gene_id "g535"; 6 AUGUSTUS stop_codon 2028771 2028773 . + 0 transcript_id "g535.t1"; gene_id "g535"; # protein sequence = [MVAELNSPGHNKFRRKSNRNKSSTPNAESESVDFTSNGINHTSAYASPATTTHSLSPPPSTAAMSFDQFAPSGGAIDP # FVPDNVALQGSAYDPNVMDYLGSMPSDDELMRFHSMNDQSIWQDVTVSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g535 ### # start gene g536 6 AUGUSTUS gene 2035320 2038741 0.59 + . g536 6 AUGUSTUS transcript 2035320 2038741 0.59 + . g536.t1 6 AUGUSTUS start_codon 2035320 2035322 . + 0 transcript_id "g536.t1"; gene_id "g536"; 6 AUGUSTUS CDS 2035320 2035601 0.59 + 0 transcript_id "g536.t1"; gene_id "g536"; 6 AUGUSTUS CDS 2035712 2038741 0.65 + 0 transcript_id "g536.t1"; gene_id "g536"; 6 AUGUSTUS stop_codon 2038739 2038741 . + 0 transcript_id "g536.t1"; gene_id "g536"; # protein sequence = [MSTSNGSGGGRTGIPTLRSLRTLFAPTSSQAKSVQVSPSRPSLNLPASRPSINLMPSRSSLNIHSGGSDTSPSTSSFD # IVRRSMTLGKKAGSRSILTDCTPGSPETIDGGGVDLSTIVEADTSGMSGISLAESLSKHLPALPTFDSPPPSVSHSTSPSPSFSPSPSPSPHPRSPSA # SASSLHLPRSPSSIQAQVHSALQVDSALAAFLSPNNLPPPSLSPSAGSASPSPGVNDFPLYPTTTGQTSSSSLPQHASTPHSSMRIKNVSHLGLMRPA # YIRSTGSDDSRSFAASISRPGSSVSAPRQETNMTASASASASVGRNTFSAARTRTRSMSVDEQSPRQASGAGLITSRRDSSFLIRRQNYKSHTRSLSQ # FGDHDKTQSEAGDVRPSSQRNVQQRPPITEWLGPRTAKAFKAAGLLASQSHDSDSISSQRSHPYLDSNSSPSLSVPSSPVRARFRPVSYASDISYSPN # SPNSHSPSPPYPSNIHTPHPRSASVAASAISARSGGSVRSASIRSGSVRSASTAPTSLSTSLGPSAPAQAAREYLMQSQNQQQKFSSSSSTLNLPTTT # SLAPSSSVNGAPPSEVQLLKDQHSIETSALLAALSDAQRTTRVLRVENAELRAALTLAENKQESWEQEKLQLKLQLEEVEDRLKEVRGRKREDLKFIE # EIKGLHKAKAGLISKLDEAEARLMQAEGKLCVLNEIKTSNYKLRQALHVAQRDKARVEAEAEMRAEEALRRIEQLEEALSEASGAIDATLGMAKMTDG # LKPNANGVYHNPLTTNISFLDSQIEFRKTSKINSRTSSESPPLSSASSSRPPSIFPLPPDNMSLLMHEEAEGTTRTGEQSASSELDDLSSFETNRVQY # NRKLKVRPSQESEDAENFELDASESKWRQSMQTPMMEAHPSTPFPKSIPDPRHNLYDASASISRSRLGSTSFSHLTHTYSSDDHDSLYPDPDLASSHV # KHPNSSHHSLHSEYEYEDEAVVGNTTFYDAGGPEEDSIISEDEDRLLDLDPDPTVRANLRPDNLSHVTSLSRSPSDSHHHPLKLETTKATASAEPGNE # DDGATTSFEGTGTPGSPGSLLWMHPLDERHLGDLNGSVDSLRLDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g536 ### # start gene g537 6 AUGUSTUS gene 2039863 2041233 1 - . g537 6 AUGUSTUS transcript 2039863 2041233 1 - . g537.t1 6 AUGUSTUS stop_codon 2039863 2039865 . - 0 transcript_id "g537.t1"; gene_id "g537"; 6 AUGUSTUS CDS 2039863 2041233 1 - 0 transcript_id "g537.t1"; gene_id "g537"; 6 AUGUSTUS start_codon 2041231 2041233 . - 0 transcript_id "g537.t1"; gene_id "g537"; # protein sequence = [MVHHPLIRQHRRSDIFASPTVSGITGALTAGAGATTATALAEAQNTASNGTPSLEGLATGVAGVSTTSSTSSSSSFKS # TASVSSSSSSASSSSSISMSTVIGACVGTLVGVLALVLLAIWLYKRSDPTKKRRPNTRAGPGLQPNWNKLGDDDDKWEGMDKKPETAEIAPMEKLTMF # KKSTPSIRTAYTSKTEELPAFDFGSHPFSQYHPNLAKELASADEPPVPPFRHRADSAAVSWDGDTIGGASFLSAPSKRMSGAMSPTVEIARPTPALTN # SEPHRWESAEVVNLEGHVAEVIDPQDSENPFEHPMERRKSQHNPFFGSSSSEVPIAKDYKGKGRARELTPLPPIPVSNPFVDDSENLDKTPTRPTFNH # QVIGSVSSISSNDRAIQSLIAALDTTPEEVHARLKVAEPSLASDTADSIYTSAEYNSEDEDAEEDVTNSFPLPPGSDHSGHSFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g537 ### # start gene g538 6 AUGUSTUS gene 2041697 2043587 0.74 + . g538 6 AUGUSTUS transcript 2041697 2043587 0.74 + . g538.t1 6 AUGUSTUS start_codon 2041697 2041699 . + 0 transcript_id "g538.t1"; gene_id "g538"; 6 AUGUSTUS CDS 2041697 2041787 0.74 + 0 transcript_id "g538.t1"; gene_id "g538"; 6 AUGUSTUS CDS 2042313 2042455 0.82 + 2 transcript_id "g538.t1"; gene_id "g538"; 6 AUGUSTUS CDS 2042547 2043587 0.84 + 0 transcript_id "g538.t1"; gene_id "g538"; 6 AUGUSTUS stop_codon 2043585 2043587 . + 0 transcript_id "g538.t1"; gene_id "g538"; # protein sequence = [MIELRSLPHYQTIVADISPYRQKRNSRSPASPTGINLNVKSTGSFESPCTPLDGGFDSGLVHTENSSTAARATLTLGT # SDPDWRCNSSKVFIFFSVLDFYPYIFPITGIVGALNPPVTGNLTFASFLANANATGPTTSRSATAATLDPSTVVPRTSSLSETHSAIATAPTASTSYP # PAITGHSVTAGAIVGGVLGGAIVVVVALLAVLFSLREREARRRTSVRRRSILAQDLEGNLKFDSLAGHTDDGTRRKSIPQLDHPELLTQMNLLDYDPC # TNVAHFPAVSIVLQRPKLSSTEFIAPASRNLSGSESNVEDPTEASRQRDTGNSLPSNTNPIFILKSAIENSPLIINRNVGEIRAQRLIEHVCIEAERA # IAEIRRAQTNANAVILNASSGENAIDDGNAHVLFSETPPPPYQLSDTLKRNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g538 ### # start gene g539 6 AUGUSTUS gene 2044178 2044591 0.55 + . g539 6 AUGUSTUS transcript 2044178 2044591 0.55 + . g539.t1 6 AUGUSTUS start_codon 2044178 2044180 . + 0 transcript_id "g539.t1"; gene_id "g539"; 6 AUGUSTUS CDS 2044178 2044591 0.55 + 0 transcript_id "g539.t1"; gene_id "g539"; 6 AUGUSTUS stop_codon 2044589 2044591 . + 0 transcript_id "g539.t1"; gene_id "g539"; # protein sequence = [MEGIPAPDVADYKRRKEIELGLAAGSISQPPAKRPKTENRPLSEDELKAALEAHRALMGGANDNAPPAASDQSAGGVY # GAPPQAYVAPPAPSGAMPGPPPPGMMPPGPPSFFPPLPGMVPGQPPFPPFPGMPGFPPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g539 ### # start gene g540 6 AUGUSTUS gene 2045815 2048373 0.25 - . g540 6 AUGUSTUS transcript 2045815 2048373 0.25 - . g540.t1 6 AUGUSTUS stop_codon 2045815 2045817 . - 0 transcript_id "g540.t1"; gene_id "g540"; 6 AUGUSTUS CDS 2045815 2046201 0.65 - 0 transcript_id "g540.t1"; gene_id "g540"; 6 AUGUSTUS CDS 2046283 2046562 0.62 - 1 transcript_id "g540.t1"; gene_id "g540"; 6 AUGUSTUS CDS 2046992 2048373 0.36 - 0 transcript_id "g540.t1"; gene_id "g540"; 6 AUGUSTUS start_codon 2048371 2048373 . - 0 transcript_id "g540.t1"; gene_id "g540"; # protein sequence = [MMSPRTHRTHRSARSHRLHQNSTHDPNEVQDEAQLHTAENLHQDNSTFNLDPDAPILGAGGESIQEAIRSEEQRNEMR # KEKNFVGGFVVGLKRVLKPTWNDNRQQSDPEAAYTGTPYGADNTYLPARGPADIEEQHPHSESSRSPSSESQFSPSSETMHGTQEFPDDGTTAIDHQS # MPMPVPIPGHYVSPILVEPQLAPDYAKMGSSASSTSEGSLNSYVSRIAHFFQHINELPWVADSRVTVDYYPGQSPRRARSRPPHRKVLSWYNRHAFPP # GQNAEPLDLDAGSSPSPVLGQVVQMIEAQPSVITKEPTKDAIQPLILPTVPVPESQIESGPTYFAELISPLPPRSDTQQSARTGRSIVYSVVNPSAPS # TSTTTTTSSSPLTEPPRHLGIDTMTALAQSITGYTPYQPVAPQYGRPIHEPLAQVPVASSVISTGDIREVPPAHTRTGTPAQSMYPYPLTELSPTPAE # ALENSEITSEDAWKNEYEEQVKTWRLQSAEAREKAERERAKWEALREAEKFAGVPPPPPLPVQQNSPSPLEMSDSPSPADARDLTSHSRQLTSEDSQK # WEHLPSEVTSSLPSMSFPEDSGHEETGVPPSQSPPTAPTSATLSVFDNTLSTSTRVKAFASALAINLLLPFVNGVMLGFGEIFAKNVVLRWFGWGTNV # PGSTAASLGLRGKSHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g540 ### # start gene g541 6 AUGUSTUS gene 2052343 2053449 0.75 - . g541 6 AUGUSTUS transcript 2052343 2053449 0.75 - . g541.t1 6 AUGUSTUS stop_codon 2052343 2052345 . - 0 transcript_id "g541.t1"; gene_id "g541"; 6 AUGUSTUS CDS 2052343 2053449 0.75 - 0 transcript_id "g541.t1"; gene_id "g541"; 6 AUGUSTUS start_codon 2053447 2053449 . - 0 transcript_id "g541.t1"; gene_id "g541"; # protein sequence = [MQGSHDWQATLSAGYKADGYSTSRADPCIRYKWIQDEYTITSTYGDDVCGGSSTRAGRDEAIANLGKRWEANEVTTGV # LLGMTIQQDPGTKAITISQKTYFQRMLNHFGLDCVRRRNTPLPLNVKLKESPTPLSDEENRYMADKQYRAVVGSILWGQVCTHPDLAFAGSLLARYQL # NLGRAHWECVEWVAGYILNTLDYAIAYKAGVEPGLKPYAYVDSDHAGCQDTYRSTSGYVFFMAGAPVSWSSKRQATVALSTTESEYIGLSRATQQAVW # ISSFLSEVDLAQEGPINMLGDNFGSVCLTENSKRHALVKHIEMRHHYVREKVQSGEVNIERIRSGENVADIFTKALNGTTHSKFVSMLGIDRTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g541 ### # start gene g542 6 AUGUSTUS gene 2059547 2060383 0.82 - . g542 6 AUGUSTUS transcript 2059547 2060383 0.82 - . g542.t1 6 AUGUSTUS stop_codon 2059547 2059549 . - 0 transcript_id "g542.t1"; gene_id "g542"; 6 AUGUSTUS CDS 2059547 2060383 0.82 - 0 transcript_id "g542.t1"; gene_id "g542"; 6 AUGUSTUS start_codon 2060381 2060383 . - 0 transcript_id "g542.t1"; gene_id "g542"; # protein sequence = [MPLRGKADENATSKHLRQLSGSALSGTSKTLQKEAVGVKNNIVRAALGEVTTTAVNRRVRWLSRLPCPRVAHNFSTQE # NNSKVLLGKEKDEVSLKRGRSNSTNNAVQRVPLGPGRSQVAPPVTSTAPIRAAPGRSSRPSTLNASRRSIRDTSRPIAIYEDVDMDVEDQLEPVVVLS # EENPSEAASEADANFLTSEPDGHDMVLVEAEDEDTETVAFQESKAPKVWPDLATQHRLDCERQVETIREVFDDDDDEFDPTMVSEYAEEIFEYMSGLE # VRSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g542 ### # start gene g543 6 AUGUSTUS gene 2060843 2061967 0.97 - . g543 6 AUGUSTUS transcript 2060843 2061967 0.97 - . g543.t1 6 AUGUSTUS stop_codon 2060843 2060845 . - 0 transcript_id "g543.t1"; gene_id "g543"; 6 AUGUSTUS CDS 2060843 2061967 0.97 - 0 transcript_id "g543.t1"; gene_id "g543"; 6 AUGUSTUS start_codon 2061965 2061967 . - 0 transcript_id "g543.t1"; gene_id "g543"; # protein sequence = [MEDGEITSRSPSNKRHWSVHVASECEPLSSNHAHEQCQGLTWGTASDEWDDPNRSQMPSKAGLRLVVLNSRTLPKFNV # AIIDGYPEVQLGRDNPVSDHIPRIRLKEMEVSKLHASIYWDQSWDGWGVVDMGSKHGTYLHSSALTIGNSQAVERKVRLSISKTASTPKRLHHLDHLT # LGTTVFIVHIHENQLPCEECSPGVGGEIPLFATSSSPKPSSNNNINVERSSGYEATRPLIHDSRKALSQLKRELMSRPRHVDTRHSSNMAGSVTVGRY # VDRSARRRAMYRASSSDAPGIPTSSQSSPQDFPKLTLQYKPEPISKPAVPIPASSIGYRLLIQQGWHPGTVLGPTERGLIEPLDIQLPCDRSGLGMRT # IK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g543 ### # start gene g544 6 AUGUSTUS gene 2073894 2075237 0.51 - . g544 6 AUGUSTUS transcript 2073894 2075237 0.51 - . g544.t1 6 AUGUSTUS stop_codon 2073894 2073896 . - 0 transcript_id "g544.t1"; gene_id "g544"; 6 AUGUSTUS CDS 2073894 2075237 0.51 - 0 transcript_id "g544.t1"; gene_id "g544"; 6 AUGUSTUS start_codon 2075235 2075237 . - 0 transcript_id "g544.t1"; gene_id "g544"; # protein sequence = [MPNLTVFGATEYMDGALTLPVLNELLLRGAPSRGRGRPSRGRAFINVSDAEEEDRERRRECVELEALDFTGCVSAVFV # NALTEFVTTNLLPPFEGISERDVLHRFATSSLDDMLFLPGLQRLGLRGVKSVLPHILTPFVLAFPSLTHLDLSGTRASSELLAALGQSPTVRLQSLAL # SRCIRLTSAGIRSFLIDSPVTSNLTELNLYGDMTFVSPLEEHDLKDILSLAPCFIRGNLVYLDLSSAPLTQDVLDMCQPLQKLRSLGMSHIPDLPLKV # VSTFILSKAPHVEVLALVGTTPELDCGLRPGNTGPVAQRGTVRQSCVALHSRLINPLCTPPFSFSILNPDSRKSQAPTSLRVVELSQVMLGGLGGGAG # SWRIVRSKGGRGWYVDTSSGWVSQPGEGTCLRRDLGLDHPLRRELQALADANGNVSSGVGWHARKMEVHYFQMYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g544 ### # start gene g545 6 AUGUSTUS gene 2083917 2085262 0.96 + . g545 6 AUGUSTUS transcript 2083917 2085262 0.96 + . g545.t1 6 AUGUSTUS start_codon 2083917 2083919 . + 0 transcript_id "g545.t1"; gene_id "g545"; 6 AUGUSTUS CDS 2083917 2084102 0.97 + 0 transcript_id "g545.t1"; gene_id "g545"; 6 AUGUSTUS CDS 2084234 2085262 0.97 + 0 transcript_id "g545.t1"; gene_id "g545"; 6 AUGUSTUS stop_codon 2085260 2085262 . + 0 transcript_id "g545.t1"; gene_id "g545"; # protein sequence = [MDDVEGLVDVCSKESTERASLTKRDLYDPFDQLDIDFPSFKRNPRLIQHPQHPTQDHKDLESYRKSRNSRVDIVTLEG # IEYVLQARRTPAGRFNSHSRTLFGSRINAIRQILESKEGTYCDPSLVTSPYFDGIHNSSSVSIASSETLNGLSSDHNRSSSDPILDSFEDDIEESDYQ # TGPNSDDFYWPEDDMDYEAPELSAVLDASFSDVNKSLAEVPTSREETPDHTAFANHPFYKEIMRNLQRVFRLKNFRQNQLEAILAAMAGRDVFVLMPT # GGGKSLCYQLPAVCNGGSTKGVTIVISPLLSLMTNQVDALKTKDVDVLVWNSETVDHGEIMRRLRGYPKPSLLYVSPEKVKDSGALKSIFADLYRAGD # LARFVVDEAHCISTWGHDFREAVSTFYLPCIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g545 ### # start gene g546 6 AUGUSTUS gene 2088428 2088811 0.87 - . g546 6 AUGUSTUS transcript 2088428 2088811 0.87 - . g546.t1 6 AUGUSTUS stop_codon 2088428 2088430 . - 0 transcript_id "g546.t1"; gene_id "g546"; 6 AUGUSTUS CDS 2088428 2088811 0.87 - 0 transcript_id "g546.t1"; gene_id "g546"; 6 AUGUSTUS start_codon 2088809 2088811 . - 0 transcript_id "g546.t1"; gene_id "g546"; # protein sequence = [MEDFPQVSAYLQSRSLQPPLPPSVSSSSIETMTSQYAQNAVSEQLTVSLLSSVQDLVDQGVDPESADAELRRRVEEAV # VNGLLNGYTLGTQISSESGQEPEGTHTRTLPVDDSGGEESENKRPRTER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g546 ### # start gene g547 6 AUGUSTUS gene 2091696 2092388 0.69 + . g547 6 AUGUSTUS transcript 2091696 2092388 0.69 + . g547.t1 6 AUGUSTUS start_codon 2091696 2091698 . + 0 transcript_id "g547.t1"; gene_id "g547"; 6 AUGUSTUS CDS 2091696 2092388 0.69 + 0 transcript_id "g547.t1"; gene_id "g547"; 6 AUGUSTUS stop_codon 2092386 2092388 . + 0 transcript_id "g547.t1"; gene_id "g547"; # protein sequence = [MSICSPDRCGLRYARSRAKKEGHVVSNSGRKRKDKIIKRESSTPPSATSATGSITNSYSSSAVIPYHSSSTPPFTSAG # SLRRSYVSTYDSIGSFSGNDIYGASRSVGTSSPSPPTGAATPAGGFSHYVNASSESAGHAHHPTAASRTSYYGSSVSSPLVANPPLLQTQSFERVRRD # REGYPPTPVSAEPRASYYEASYNRGERKDALCGYEKEYEREYDHEERGRSLVTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g547 ### # start gene g548 6 AUGUSTUS gene 2102184 2104211 0.79 + . g548 6 AUGUSTUS transcript 2102184 2104211 0.79 + . g548.t1 6 AUGUSTUS start_codon 2102184 2102186 . + 0 transcript_id "g548.t1"; gene_id "g548"; 6 AUGUSTUS CDS 2102184 2102195 0.98 + 0 transcript_id "g548.t1"; gene_id "g548"; 6 AUGUSTUS CDS 2102370 2102394 0.98 + 0 transcript_id "g548.t1"; gene_id "g548"; 6 AUGUSTUS CDS 2103370 2104211 0.79 + 2 transcript_id "g548.t1"; gene_id "g548"; 6 AUGUSTUS stop_codon 2104209 2104211 . + 0 transcript_id "g548.t1"; gene_id "g548"; # protein sequence = [MTIHSNRPIRLHGKLRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPPNESSRPSSSQIPTEESRGSSVS # RGTGSSISRGRFTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLNQTISQTSNTIEPVKMTTNNYGMPALSAEAK # AEIDKASAKLPRKYKTAPLFDITNPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKTPNWDQFKKDLKNMFPQLVGDERGS # RLLLEQLVHQFNPIDAGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g548 ### # start gene g549 6 AUGUSTUS gene 2105819 2106709 0.48 + . g549 6 AUGUSTUS transcript 2105819 2106709 0.48 + . g549.t1 6 AUGUSTUS start_codon 2105819 2105821 . + 0 transcript_id "g549.t1"; gene_id "g549"; 6 AUGUSTUS CDS 2105819 2106709 0.48 + 0 transcript_id "g549.t1"; gene_id "g549"; 6 AUGUSTUS stop_codon 2106707 2106709 . + 0 transcript_id "g549.t1"; gene_id "g549"; # protein sequence = [MAVHLNCHGFCVPCEKYMIGSSFDNYYQTLSIASLSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFK # DLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTSVMAQMAKENAKGMINSIPLSGPSNQSNRFERNMTPRSSN # GTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNTRMPQDDPNIPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNV # NLAVWMTRIEELSDRLGNLEAH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g549 ### # start gene g550 6 AUGUSTUS gene 2106769 2107586 0.6 + . g550 6 AUGUSTUS transcript 2106769 2107586 0.6 + . g550.t1 6 AUGUSTUS start_codon 2106769 2106771 . + 0 transcript_id "g550.t1"; gene_id "g550"; 6 AUGUSTUS CDS 2106769 2106785 0.6 + 0 transcript_id "g550.t1"; gene_id "g550"; 6 AUGUSTUS CDS 2106863 2107586 0.71 + 1 transcript_id "g550.t1"; gene_id "g550"; 6 AUGUSTUS stop_codon 2107584 2107586 . + 0 transcript_id "g550.t1"; gene_id "g550"; # protein sequence = [MKEQDRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKPIVRPLKKPSVTIEDVDALDDEDTIKLIPSSRPTNQ # INSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIESHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMCKIHNRRVRPR # TKMNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g550 ### # start gene g551 6 AUGUSTUS gene 2107839 2108216 0.76 + . g551 6 AUGUSTUS transcript 2107839 2108216 0.76 + . g551.t1 6 AUGUSTUS start_codon 2107839 2107841 . + 0 transcript_id "g551.t1"; gene_id "g551"; 6 AUGUSTUS CDS 2107839 2108216 0.76 + 0 transcript_id "g551.t1"; gene_id "g551"; 6 AUGUSTUS stop_codon 2108214 2108216 . + 0 transcript_id "g551.t1"; gene_id "g551"; # protein sequence = [MQDASEKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPLQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV # GTYPRGQKGRNNQINTSRYNEPKNVTPDNKKLTGENDSKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g551 ### # start gene g552 6 AUGUSTUS gene 2108312 2109007 0.85 + . g552 6 AUGUSTUS transcript 2108312 2109007 0.85 + . g552.t1 6 AUGUSTUS start_codon 2108312 2108314 . + 0 transcript_id "g552.t1"; gene_id "g552"; 6 AUGUSTUS CDS 2108312 2109007 0.85 + 0 transcript_id "g552.t1"; gene_id "g552"; 6 AUGUSTUS stop_codon 2109005 2109007 . + 0 transcript_id "g552.t1"; gene_id "g552"; # protein sequence = [MFSKKELSEAYVLASREHLKSQDDRAEEIIDCYLNQKTIGDKQVFCVWRDGVLGELDDQLNNDQFNLNPIKSFFLQNG # RIKPKPIRRKVQKRRFVEPVLQNFSLGENCNKSESTETTQNQCNNKNISETIRDDNWNKPKNSQRTRKRMVRYEVLKRGTESFQRSQPSFEKVRYESR # QRKKGKAQDSKDKKENVQPDLLNEPPTNKLEERIKLNQQDRSPINLIDEMCHEVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g552 ### # start gene g553 6 AUGUSTUS gene 2109553 2111286 0.88 + . g553 6 AUGUSTUS transcript 2109553 2111286 0.88 + . g553.t1 6 AUGUSTUS start_codon 2109553 2109555 . + 0 transcript_id "g553.t1"; gene_id "g553"; 6 AUGUSTUS CDS 2109553 2111286 0.88 + 0 transcript_id "g553.t1"; gene_id "g553"; 6 AUGUSTUS stop_codon 2111284 2111286 . + 0 transcript_id "g553.t1"; gene_id "g553"; # protein sequence = [MNKQVVNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDLLVELPELSKHPKPFVPTGRYTEE # RKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVLVIPHEPWVERNIPIPPSIFEDVCKIIKSKIDSGIYEPSNASYCS # KWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYIGYDERELDQLSRDMTSFQTPYGPHRLVKLPMGWTNSVPIFHD # DVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRQFVWEHFQNMNRVIQRMKYAGGTFSGTEAFLCCEETIVIEHRCTYEGSMPE # EHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWY # IYQIDPSEKKKFFNYFGSCHALPKTRPAPVPATRCHTLYTPPALPLHLPSHLPKYHHAPPSCTFPTQVPLYTYPNVLHRHTYIPRHAYRTPYSNSIKY # QSRLPPHVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g553 ### # start gene g554 6 AUGUSTUS gene 2112123 2114234 0.87 + . g554 6 AUGUSTUS transcript 2112123 2114234 0.87 + . g554.t1 6 AUGUSTUS start_codon 2112123 2112125 . + 0 transcript_id "g554.t1"; gene_id "g554"; 6 AUGUSTUS CDS 2112123 2114234 0.87 + 0 transcript_id "g554.t1"; gene_id "g554"; 6 AUGUSTUS stop_codon 2114232 2114234 . + 0 transcript_id "g554.t1"; gene_id "g554"; # protein sequence = [MTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHV # KGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNH # MLESKNATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDKLIPLIGKYLSNPSDEFLGKMSKDEWIKFIRLIKKFQVDDQGRLYHRNTDQPDQP # QLVVEKEKHMHMLNSGHDCLGHKGVFAMNDFLQKRFWWPDIYKDVEWYVRSCQECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIH # GRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTNNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSK # WFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFMEKVRHRVDANKVAELRRFERKYRHT # IKDWNFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMAVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVED # KDEYWMTPENDYIFNAIPHLRFSDTDSEEELSEEEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g554 ### # start gene g555 6 AUGUSTUS gene 2114495 2115947 0.09 - . g555 6 AUGUSTUS transcript 2114495 2115947 0.09 - . g555.t1 6 AUGUSTUS stop_codon 2114495 2114497 . - 0 transcript_id "g555.t1"; gene_id "g555"; 6 AUGUSTUS CDS 2114495 2114922 1 - 2 transcript_id "g555.t1"; gene_id "g555"; 6 AUGUSTUS CDS 2114995 2115128 0.63 - 1 transcript_id "g555.t1"; gene_id "g555"; 6 AUGUSTUS CDS 2115244 2115272 0.29 - 0 transcript_id "g555.t1"; gene_id "g555"; 6 AUGUSTUS CDS 2115780 2115947 0.84 - 0 transcript_id "g555.t1"; gene_id "g555"; 6 AUGUSTUS start_codon 2115945 2115947 . - 0 transcript_id "g555.t1"; gene_id "g555"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLMNSASEDELVTPYPTTGSNKGS # NKDEKSAVNDVSPRLSKVHGHSDSHVSFNCISLTHSKHINHALAQVVSSNLDTPPAPLESQSTRFIAATLNFQAAEFEFNANLVKTYATRARIAKVIA # DEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEIAVPVLKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g555 ### # start gene g556 6 AUGUSTUS gene 2116964 2117678 0.51 - . g556 6 AUGUSTUS transcript 2116964 2117678 0.51 - . g556.t1 6 AUGUSTUS stop_codon 2116964 2116966 . - 0 transcript_id "g556.t1"; gene_id "g556"; 6 AUGUSTUS CDS 2116964 2117511 0.82 - 2 transcript_id "g556.t1"; gene_id "g556"; 6 AUGUSTUS CDS 2117630 2117678 0.51 - 0 transcript_id "g556.t1"; gene_id "g556"; 6 AUGUSTUS start_codon 2117676 2117678 . - 0 transcript_id "g556.t1"; gene_id "g556"; # protein sequence = [MPSLLLSEPKVLGILGHLANSLRRATDLNDQLKQIGSLFDTTRELFLRSILDLQNAGEDPIVVLEALKTAEPNRRAIT # LNEWTLMATLFRWPSPFNLSGLDFDNWTPGEWIELLCSIHSGESTAHIDEHGHLVESSPPPDFATEALEGLKEVERGSADEGTSSQVGGSIPMELDLP # AVESLAEPAPSPEKGAEPAQIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g556 ### # start gene g557 6 AUGUSTUS gene 2120384 2120959 1 - . g557 6 AUGUSTUS transcript 2120384 2120959 1 - . g557.t1 6 AUGUSTUS stop_codon 2120384 2120386 . - 0 transcript_id "g557.t1"; gene_id "g557"; 6 AUGUSTUS CDS 2120384 2120959 1 - 0 transcript_id "g557.t1"; gene_id "g557"; 6 AUGUSTUS start_codon 2120957 2120959 . - 0 transcript_id "g557.t1"; gene_id "g557"; # protein sequence = [MSFGSDPGSFLEYALSLPDPVGPDPEASDSSNQSGSSEQHSEQESVQSGTNSDPDQSSYDSKFPGPFDYDYLHESSDF # DSDHPGPYDLHYLHSYPSSSASDSVESFHSFASDNAEAPELRPGDDRSGHPHLGPDGRLVDSERERRRVLGLCFYCGGEHMKVDCLKLQARTGQNYDA # DNSESDVLGSDDGSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g557 ### # start gene g558 6 AUGUSTUS gene 2122235 2123116 0.52 + . g558 6 AUGUSTUS transcript 2122235 2123116 0.52 + . g558.t1 6 AUGUSTUS start_codon 2122235 2122237 . + 0 transcript_id "g558.t1"; gene_id "g558"; 6 AUGUSTUS CDS 2122235 2122392 0.52 + 0 transcript_id "g558.t1"; gene_id "g558"; 6 AUGUSTUS CDS 2122441 2123116 0.52 + 1 transcript_id "g558.t1"; gene_id "g558"; 6 AUGUSTUS stop_codon 2123114 2123116 . + 0 transcript_id "g558.t1"; gene_id "g558"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSESISAIGQQRRRNCGFGPATVPTTTLYTGDGQPVQVLTPRHGQPPVVAP # ARGRSTTQIESPILQAIACRTGKQPQRRAASESPRDPPPHFDLDAGDHDDQDPPVDPDDPGADNNHDDLDDNSGGLPRGEPGDPSGPGGPGGPGGPSG # PRSPISPDIPNEQRTMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDHPKYFTDQRKVNYTLSYLSGS # AKE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g558 ### # start gene g559 6 AUGUSTUS gene 2123813 2124460 1 + . g559 6 AUGUSTUS transcript 2123813 2124460 1 + . g559.t1 6 AUGUSTUS start_codon 2123813 2123815 . + 0 transcript_id "g559.t1"; gene_id "g559"; 6 AUGUSTUS CDS 2123813 2124460 1 + 0 transcript_id "g559.t1"; gene_id "g559"; 6 AUGUSTUS stop_codon 2124458 2124460 . + 0 transcript_id "g559.t1"; gene_id "g559"; # protein sequence = [MKETESIWKYNIWFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIENCYWKREETRKREA # GKPFVARNLKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEWERRMKNNLCLFCSG # KHQIADCNKRKARESMGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g559 ### # start gene g560 6 AUGUSTUS gene 2129862 2133220 0.82 + . g560 6 AUGUSTUS transcript 2129862 2133220 0.82 + . g560.t1 6 AUGUSTUS start_codon 2129862 2129864 . + 0 transcript_id "g560.t1"; gene_id "g560"; 6 AUGUSTUS CDS 2129862 2130044 0.84 + 0 transcript_id "g560.t1"; gene_id "g560"; 6 AUGUSTUS CDS 2130335 2133220 0.9 + 0 transcript_id "g560.t1"; gene_id "g560"; 6 AUGUSTUS stop_codon 2133218 2133220 . + 0 transcript_id "g560.t1"; gene_id "g560"; # protein sequence = [MSATEVVDNGAAVFDEANHPPTSKPKVLSERTGDEDNHSLNDVEVERDPIIEFDTSEIPLEDDEIPLKDPTDPLATLE # ASDSPLQLFESPNTASHNEFEATEPKSQTEKSGDRGVDSTGTGTIASGIGRVHEGEEPQLEVEQVPLIREPVFRDADSALEAETLAQNLPEDTTKPIN # GNPVNLEPDGPLPGVAALQTSSSVDSAALVDAAEETVLGTGVAEERATKSSFAEGAEDPISNVHGSISVIPDTVSGEATGVSHVNVLAVSTSSEETPN # SVTPVLTDPIIGGEESTVGNIVTDGSSGEVQVHSTERIESEKHMHLDSNVREHDLTSPAEPAESHSNELGSSAAILVDEKPGADIVLGYPEDNAEGSH # AIPVEALTIVSAAALQHSVSSPLVEPTQIETGQLSLTLGNSEDIPTGQAASGNLHDESSLEEMPMNVSEALEPLMERSIGDAAIETENPSELEHESEL # IVTDEVADMNGQSKSEIVPALEESSVIPDKFSETAYEVAGESEAKLITESDVLGVILATGNVDTVSADPNAETTPPISGEEASSVELEKQLAENVGTP # NEVILSDGEKLAANNENTNTSSVEEVPFARDEDVGPLLEGHPSWINENLATKDESNKPESVLDTQQLDVKPDEKEPDIGIDHNLDVAETVVDSAASAT # QILETGTEQHLMTETGGIMLTNEDADSAAVADVVVAPASGGAGGEGAQVFSGLVEESSPSDTTVEGTIADDKALLKGESIANLPQDEPVDLFRENSSA # LVEESSNADPATSLTGSVVKDHSTDTVVQFLSSGEAVTDASINQSTEMEEQPVLEPQNQANQCSEVPQDEAADDSDDPTNEAVPAAAPEAPFAEDIVP # AITDTADSQDEFSSDTLGLEKPSLDQEIQLTELTTPSESAQIDVEKLVEVMPDSPNVGTTTEDSSDLRVDVAEVERLESPWTPSYSVSNQGPDVTREE # DISEIEQLPISDVATSAESSVPMVNIVPEESEPTAKIVPEESEPTAANVRLKPHDTVFFLRC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g560 ### # start gene g561 6 AUGUSTUS gene 2133860 2135265 0.39 + . g561 6 AUGUSTUS transcript 2133860 2135265 0.39 + . g561.t1 6 AUGUSTUS start_codon 2133860 2133862 . + 0 transcript_id "g561.t1"; gene_id "g561"; 6 AUGUSTUS CDS 2133860 2134519 0.8 + 0 transcript_id "g561.t1"; gene_id "g561"; 6 AUGUSTUS CDS 2134660 2135007 1 + 0 transcript_id "g561.t1"; gene_id "g561"; 6 AUGUSTUS CDS 2135059 2135265 1 + 0 transcript_id "g561.t1"; gene_id "g561"; 6 AUGUSTUS stop_codon 2135263 2135265 . + 0 transcript_id "g561.t1"; gene_id "g561"; # protein sequence = [MASEEDIPEIQQLPSSNVPAGQELPVPEVNIIPEVSEATVANVSSMVYGAAVLADTYNLQLEEPKESSRPSSPWVPSY # SVSVQGSPSVSAHSSPVLAATELSENVIPVIELTEESAEPASPVSAEVSALNNAAESIEEPGLEVDSLPSKPPVDSVIHDENSVIPSVNITETSSESS # LDIPLESTEVDIAQKPMQDQTVNTVSPVQQPLVVNEMLDQSGDEDTPVFKVPDEEAIVDLSAKPYKDVQIPGALSLSPSQSVVAAQIERPKSPWGSYE # VTNQSGHETSVAEMADPEAVEAVEDIPAPTSFIRDEPVVEPADEPTLKDVSTEDAPAAEVSKLTVDTTENDLPERPKSPWTPSYSVSRQGSQVFNEAR # NDAELDTLEQPPPHAESSTVSPHSIYVLIEMY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g561 ### # start gene g562 6 AUGUSTUS gene 2135431 2135742 0.91 + . g562 6 AUGUSTUS transcript 2135431 2135742 0.91 + . g562.t1 6 AUGUSTUS start_codon 2135431 2135433 . + 0 transcript_id "g562.t1"; gene_id "g562"; 6 AUGUSTUS CDS 2135431 2135742 0.91 + 0 transcript_id "g562.t1"; gene_id "g562"; 6 AUGUSTUS stop_codon 2135740 2135742 . + 0 transcript_id "g562.t1"; gene_id "g562"; # protein sequence = [MSFTSRDTVGDTLAAPKDRKRLESTTSSLFFPGGWFSKPPTGRTSLDNAQGVITSPKAVSPVEGRSSVELLGGSSAPV # SATADITNEGPDEDKEKKGKWCVIM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g562 ### # start gene g563 6 AUGUSTUS gene 2136000 2136825 0.67 - . g563 6 AUGUSTUS transcript 2136000 2136825 0.67 - . g563.t1 6 AUGUSTUS stop_codon 2136000 2136002 . - 0 transcript_id "g563.t1"; gene_id "g563"; 6 AUGUSTUS CDS 2136000 2136287 1 - 0 transcript_id "g563.t1"; gene_id "g563"; 6 AUGUSTUS CDS 2136336 2136466 1 - 2 transcript_id "g563.t1"; gene_id "g563"; 6 AUGUSTUS CDS 2136523 2136549 0.9 - 2 transcript_id "g563.t1"; gene_id "g563"; 6 AUGUSTUS CDS 2136693 2136825 0.68 - 0 transcript_id "g563.t1"; gene_id "g563"; 6 AUGUSTUS start_codon 2136823 2136825 . - 0 transcript_id "g563.t1"; gene_id "g563"; # protein sequence = [MPAKKNRDKGDKSAAIADPTPAASEPEGPPPPEPRPPVRVLYCGEAYSKYYSDEALQAKIGTLSLEAQSKLEQETAKK # EAKAEAKADAALKKKLASQVTIKRIERNKRKHVTSIHGLEAFNIDLKKAAKQFASKFATGASVTKNPQGLEEIVVQGDVSDEVLEMIEGEVGILKGIP # ADNVEIIEEKKKKGGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g563 ### # start gene g564 6 AUGUSTUS gene 2137990 2139003 0.3 - . g564 6 AUGUSTUS transcript 2137990 2139003 0.3 - . g564.t1 6 AUGUSTUS stop_codon 2137990 2137992 . - 0 transcript_id "g564.t1"; gene_id "g564"; 6 AUGUSTUS CDS 2137990 2139003 0.3 - 0 transcript_id "g564.t1"; gene_id "g564"; 6 AUGUSTUS start_codon 2139001 2139003 . - 0 transcript_id "g564.t1"; gene_id "g564"; # protein sequence = [MIVNISVCCTIHSLKYFPASPEHDTLPVPANPNRMRAQSSPGPPRIQTDVPRRSHSRTPSPTPGSNSPMPHFSQMPSF # SLVGALEFRQVVASLRNEASSSSLNIFDSPVTPYAGGHYHSRPRSRPRTPVTHDHDRDPWDAALALDERSPHVRVIPAPNDSHPGSPDLNGSSYFDDP # PTSMSSSIPTISHTPASPTGTESDAEYPHLPLSKWQRSKYTFGACYHTLFPTLHRFRSQSVLGQIASIFAAPAVMLLTLTLPVVVTPYISTHHAREKL # DSSHNLIDFEEEGIERVLIAEEEVEDEMHGVGFNKWLTSVQVFLGPLFCIAVLFSVLFSIPPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g564 ### # start gene g565 6 AUGUSTUS gene 2144057 2145142 0.89 + . g565 6 AUGUSTUS transcript 2144057 2145142 0.89 + . g565.t1 6 AUGUSTUS start_codon 2144057 2144059 . + 0 transcript_id "g565.t1"; gene_id "g565"; 6 AUGUSTUS CDS 2144057 2145142 0.89 + 0 transcript_id "g565.t1"; gene_id "g565"; 6 AUGUSTUS stop_codon 2145140 2145142 . + 0 transcript_id "g565.t1"; gene_id "g565"; # protein sequence = [MEYCRKLKPLLDDADGKLEERRVVVSCDSGRREWNTVMGPLLDPTPRGSLWMYSPISGETTHLTLENFPAEHTFHPLG # VEIYPSYSGNASYMYVVNHAANKTVIEQFRVSPSESVAKHIRTLSHPFFVASNALALTSPTSFYVTNDHVFTKRLPYVGAVLPMVETVLGIPLSFAGH # VIINPDETDETAVLSHTVVAPFVAFSNGLSISPSGLELAIASTSIGTVYFYSRNTSTNALTFSTSVQLPFPPDNVKYDHYGNLVVSGHPHFPTLLQLV # AGKVDIAPSWVVSISRIQGAVTAEYDLNAPLSTSTIVPSPANHTVQTLFQSNGKIFTSSTSGLIDTLSGNLYVTGLYAEDGAIICHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g565 ### # start gene g566 6 AUGUSTUS gene 2145531 2146424 1 - . g566 6 AUGUSTUS transcript 2145531 2146424 1 - . g566.t1 6 AUGUSTUS stop_codon 2145531 2145533 . - 0 transcript_id "g566.t1"; gene_id "g566"; 6 AUGUSTUS CDS 2145531 2146424 1 - 0 transcript_id "g566.t1"; gene_id "g566"; 6 AUGUSTUS start_codon 2146422 2146424 . - 0 transcript_id "g566.t1"; gene_id "g566"; # protein sequence = [MFRAAFPKADEQSEKDEVQWVKDNYDLSGNNGSSKDTSITRLAGTWVGPELARELGKSYLLDDLISLVVDARPDPNGN # YRRSGKGAAATPRPPSSTDSAVNNQASATSPSIAPNPSKRRKESSPVPAPPPSPPPERRNPLRRSNRTKSPAPKVSVLPLVKTPSRKAVRREVKEEEV # VTPGGSDETAVDEDAQAVEDVAGEQLHQQDIEEQKVLIEGLKAKRNAAMKASDGDIDGSEKSVVKRVREEEEEALRFNFKEPEVGERAISTNRRVDGY # FEEPRHKSLAWGVVAFAFGMGAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g566 ### # start gene g567 6 AUGUSTUS gene 2152053 2152442 0.44 - . g567 6 AUGUSTUS transcript 2152053 2152442 0.44 - . g567.t1 6 AUGUSTUS stop_codon 2152053 2152055 . - 0 transcript_id "g567.t1"; gene_id "g567"; 6 AUGUSTUS CDS 2152053 2152442 0.44 - 0 transcript_id "g567.t1"; gene_id "g567"; 6 AUGUSTUS start_codon 2152440 2152442 . - 0 transcript_id "g567.t1"; gene_id "g567"; # protein sequence = [MLKEEGGTLFDARSASLGHTLQGGVPSPMDRARAVRLSLKCMAFLEREHVKLLQQPVKARHATPDSAAIITIQSSSLK # WVPVQEMVAHADMQNRRGKNPWWANIKELAELLAGRPQLIGIHSKDLAQYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g567 ### # start gene g568 6 AUGUSTUS gene 2152679 2155095 0.06 - . g568 6 AUGUSTUS transcript 2152679 2155095 0.06 - . g568.t1 6 AUGUSTUS stop_codon 2152679 2152681 . - 0 transcript_id "g568.t1"; gene_id "g568"; 6 AUGUSTUS CDS 2152679 2153323 0.79 - 0 transcript_id "g568.t1"; gene_id "g568"; 6 AUGUSTUS CDS 2153395 2153532 0.83 - 0 transcript_id "g568.t1"; gene_id "g568"; 6 AUGUSTUS CDS 2153589 2153765 0.18 - 0 transcript_id "g568.t1"; gene_id "g568"; 6 AUGUSTUS CDS 2154643 2155095 0.4 - 0 transcript_id "g568.t1"; gene_id "g568"; 6 AUGUSTUS start_codon 2155093 2155095 . - 0 transcript_id "g568.t1"; gene_id "g568"; # protein sequence = [MKIAILTSGGDSAGMNAVVRAVVKVGILKQVYNLTSYLLSLTNFTRGCETWVVREGYEGLVRGNTEALSEQSLDEEPV # DLPDNTSPDGTSFNLIHNLRFGDGDLLKDGTGDHPGTRSLKGRYIVRVGFDDVRAWFAEVRRFPGILEHCAVMSPLQKAVWYGVVTSHFQPTLQGMEA # VETLLEATPTSPSYMIGIQENKITRVPLMEAVAMTRAVSAAIEAKDFEKAMSYRDPEFKESFEGFLKISTLDQEKVPEEQLPLCSKCSTELQVVQILW # LDSMGAPAGGMNAATRAAVRYCIRHGHTPIAVHNGFRGLLDDEVHELSWLGVDSWTARGGSELGTNRTLPSVDLGAVAAKFQEHQFHALLMIGGFETF # NSLLIMEEGRRHYPAFHIPMVHLPATISNNVPMTEWSLGSDTSLNALVDACDAIKQSASASRNRVFVVETQGGKCGYLATVGALAVGQRFIYEVICRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g568 ### # start gene g569 6 AUGUSTUS gene 2155215 2155577 0.59 + . g569 6 AUGUSTUS transcript 2155215 2155577 0.59 + . g569.t1 6 AUGUSTUS start_codon 2155215 2155217 . + 0 transcript_id "g569.t1"; gene_id "g569"; 6 AUGUSTUS CDS 2155215 2155577 0.59 + 0 transcript_id "g569.t1"; gene_id "g569"; 6 AUGUSTUS stop_codon 2155575 2155577 . + 0 transcript_id "g569.t1"; gene_id "g569"; # protein sequence = [MKSRRNTWDRVDRGHHVHAWPFLSNSIMVYSRFNEKETSPNPYINFITSLPAEDNEDARQFLRALAAQVRPIMKAHGL # TVNSLEEYEYNAVFAGRNWESGETIGAYLLELSSFIDAHNLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g569 ### # start gene g570 6 AUGUSTUS gene 2157660 2158891 0.61 - . g570 6 AUGUSTUS transcript 2157660 2158891 0.61 - . g570.t1 6 AUGUSTUS stop_codon 2157660 2157662 . - 0 transcript_id "g570.t1"; gene_id "g570"; 6 AUGUSTUS CDS 2157660 2158526 0.77 - 0 transcript_id "g570.t1"; gene_id "g570"; 6 AUGUSTUS CDS 2158745 2158891 0.61 - 0 transcript_id "g570.t1"; gene_id "g570"; 6 AUGUSTUS start_codon 2158889 2158891 . - 0 transcript_id "g570.t1"; gene_id "g570"; # protein sequence = [MLQNLANKPLYAKEAYMMTLNPFVENNKARINQFLNNLCEVGDFYDTLESPNDKQHLRILTDELGPAPAQVPRKENRT # IELSIYSRWETPVHDLQSALMDSVSSSDMLYMETKSIFVQLIRSIPNAPEKRPYNLAAIAERAATTKDATLVRKGIKVKEMLRELEEQKIIDQGDGYK # LMQEEVAAELVHLGNLREKVLLETKSLEAVYKTIGDHNNYLRSQLEQYKAYLQNVRLTATKDKGSTTGVGVVTVGGKEKKPAKSVVLGPYRFTHAQLE # KEGIIVESNVPDNRYVVTMSWLVQKKWTDNLLQSSKHLLQYHIAYAWYFHHRIALQRPRKGNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g570 ### # start gene g571 6 AUGUSTUS gene 2165970 2166986 0.64 - . g571 6 AUGUSTUS transcript 2165970 2166986 0.64 - . g571.t1 6 AUGUSTUS stop_codon 2165970 2165972 . - 0 transcript_id "g571.t1"; gene_id "g571"; 6 AUGUSTUS CDS 2165970 2166986 0.64 - 0 transcript_id "g571.t1"; gene_id "g571"; 6 AUGUSTUS start_codon 2166984 2166986 . - 0 transcript_id "g571.t1"; gene_id "g571"; # protein sequence = [MIAEVPTIAIDQVYIFDNTSVIHDEVLAHRIGLVPLNVDPRTMDGWEGEGDTPTDRNTLEFRVNVQCSFNPEYNTTDK # RGKASTTAGSANQNLSDEKLYSNYLFLSKHFEWNPAGEQLDKIKPVVLTPPDPLYPTYNDLKLPPLGALNPDIVLAKLRPGQAVEMVLHARKGVGKDH # AKWSPVATASYRLHPNIVITKPIRMERAEDFKACFADGVVVVNKKKGSFIKFIIIIIVSTDTSLPPLGTVSISPTHMRNDTVSREVLRDPEFRDSVEL # SRIRDHFIFEVESESAYRPEELLVEAIAVMRDKIARMREAAVALLGSEQTEEREDGDVLMQDAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g571 ### # start gene g572 6 AUGUSTUS gene 2280892 2281623 0.74 + . g572 6 AUGUSTUS transcript 2280892 2281623 0.74 + . g572.t1 6 AUGUSTUS start_codon 2280892 2280894 . + 0 transcript_id "g572.t1"; gene_id "g572"; 6 AUGUSTUS CDS 2280892 2281623 0.74 + 0 transcript_id "g572.t1"; gene_id "g572"; 6 AUGUSTUS stop_codon 2281621 2281623 . + 0 transcript_id "g572.t1"; gene_id "g572"; # protein sequence = [MRHPENLVDLTDSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRTHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNSEEIHAGTLQSPPEAPQRPPEAPQPPPEASQQPPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAIERVTPKPTKDSEEAYQKVEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g572 ### # start gene g573 6 AUGUSTUS gene 2281901 2282464 0.87 + . g573 6 AUGUSTUS transcript 2281901 2282464 0.87 + . g573.t1 6 AUGUSTUS start_codon 2281901 2281903 . + 0 transcript_id "g573.t1"; gene_id "g573"; 6 AUGUSTUS CDS 2281901 2282464 0.87 + 0 transcript_id "g573.t1"; gene_id "g573"; 6 AUGUSTUS stop_codon 2282462 2282464 . + 0 transcript_id "g573.t1"; gene_id "g573"; # protein sequence = [MDRLLREGTPAYFLHISPTKEESPTEEMLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKS # IPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALN # KITKKNRYPLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g573 ### # start gene g574 6 AUGUSTUS gene 2286710 2287321 0.46 + . g574 6 AUGUSTUS transcript 2286710 2287321 0.46 + . g574.t1 6 AUGUSTUS start_codon 2286710 2286712 . + 0 transcript_id "g574.t1"; gene_id "g574"; 6 AUGUSTUS CDS 2286710 2287321 0.46 + 0 transcript_id "g574.t1"; gene_id "g574"; 6 AUGUSTUS stop_codon 2287319 2287321 . + 0 transcript_id "g574.t1"; gene_id "g574"; # protein sequence = [MQTARGVHGDLHIRSTSSIQWFFNNAVDQDEGLYTLMLENSRFDSDRPFLTAAQHAGFTSPLPTRWNLPSSPYVVFVN # GSPSPRGCWTVDDLVPAIPSDDQLTQDWEQLMLQYMHHITDTPLPVPDPPVPMSSTGPVPESSDETNVEQSFEAPIVPVSSPSGGSHPPVPLFLSEQE # SPTSPSPPPRSSVPPSFSGPLPAYPSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g574 ### # start gene g575 6 AUGUSTUS gene 2292070 2296371 0.54 - . g575 6 AUGUSTUS transcript 2292070 2296371 0.54 - . g575.t1 6 AUGUSTUS stop_codon 2292070 2292072 . - 0 transcript_id "g575.t1"; gene_id "g575"; 6 AUGUSTUS CDS 2292070 2294904 0.69 - 0 transcript_id "g575.t1"; gene_id "g575"; 6 AUGUSTUS CDS 2295004 2296371 0.55 - 0 transcript_id "g575.t1"; gene_id "g575"; 6 AUGUSTUS start_codon 2296369 2296371 . - 0 transcript_id "g575.t1"; gene_id "g575"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNPAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERVQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEV # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRETRHRTLLAESDTL # MLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNTEVPEFLNPGNTATRSPQLRSGASPTVH # ALAQNATPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVYVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAV # HEEAVPPQGAPFGTPFVTGAQMNRPGMAFESARSQESIAMIQQQARVIETLQEQLREVKKGFTEGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGP # SPVVPQPRSWQATEPISFNRNTPTGARGGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGEGKGGFNPPPRVPPPHFSS # QSRDRERPPSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWH # RKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEY # TCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKL # DGAVRAQAESLRNLHGEKALQGWLSRFPGLELAPEAPYKSPLRREREPADVWTSNPKPAATGRFQSRPNWKEGRQRASAAWGEGESYDSENREEDEDC # CHCRDGGEWTEAVLRAGVTDTGRKWTPEERAEKWRRRRQELCMRCGRKEHWAKDCPNPESLERPAEDQGSSEGASKADSTRGRGTANQGGGRKDDSTR # PLERIRAGIVVEEREGMDDLWNVHILDSPKGGEQELLDEVGNGQGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g575 ### # start gene g576 6 AUGUSTUS gene 2297583 2300423 0.72 + . g576 6 AUGUSTUS transcript 2297583 2300423 0.72 + . g576.t1 6 AUGUSTUS start_codon 2297583 2297585 . + 0 transcript_id "g576.t1"; gene_id "g576"; 6 AUGUSTUS CDS 2297583 2300423 0.72 + 0 transcript_id "g576.t1"; gene_id "g576"; 6 AUGUSTUS stop_codon 2300421 2300423 . + 0 transcript_id "g576.t1"; gene_id "g576"; # protein sequence = [MTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRF # VWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSN # VPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHV # YGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEP # YQFDNFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYGIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDKLIPLIGK # YLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRS # CKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNM # LAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSLYFLVTGAEPLLPFDIVESTWLVNPPNR # ILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEM # DGTVLKEKVGAFRVLPHFTQEEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTNSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g576 ### # start gene g577 6 AUGUSTUS gene 2300684 2302134 0.19 - . g577 6 AUGUSTUS transcript 2300684 2302134 0.19 - . g577.t1 6 AUGUSTUS stop_codon 2300684 2300686 . - 0 transcript_id "g577.t1"; gene_id "g577"; 6 AUGUSTUS CDS 2300684 2301111 1 - 2 transcript_id "g577.t1"; gene_id "g577"; 6 AUGUSTUS CDS 2301193 2301325 0.84 - 0 transcript_id "g577.t1"; gene_id "g577"; 6 AUGUSTUS CDS 2301516 2301701 0.29 - 0 transcript_id "g577.t1"; gene_id "g577"; 6 AUGUSTUS CDS 2301741 2301908 1 - 0 transcript_id "g577.t1"; gene_id "g577"; 6 AUGUSTUS CDS 2301967 2302134 0.98 - 0 transcript_id "g577.t1"; gene_id "g577"; 6 AUGUSTUS start_codon 2302132 2302134 . - 0 transcript_id "g577.t1"; gene_id "g577"; # protein sequence = [MPIHHKKDLDIAQVAEPHLGALQQLLASYKSKKTNNPNKATISVLRRSTEYLHDLLEKPVTLRSHVRQVSNLTARQSI # IDTLCLGHKLFPDIVSDSHFEQHLKFMAFANDAHSFQNTFVRNRLLNRARSVHSDHEASTRADNSRFIRKSKKKATRFASSRDVKREPRSVRFDSDNR # RSTPYPTGPNKGSNKDEKSAVNKVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESESTKFIAATLNFQAAEFEFNANLVKTYA # TRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g577 ### # start gene g578 6 AUGUSTUS gene 2303147 2303805 0.49 - . g578 6 AUGUSTUS transcript 2303147 2303805 0.49 - . g578.t1 6 AUGUSTUS stop_codon 2303147 2303149 . - 0 transcript_id "g578.t1"; gene_id "g578"; 6 AUGUSTUS CDS 2303147 2303694 0.94 - 2 transcript_id "g578.t1"; gene_id "g578"; 6 AUGUSTUS CDS 2303757 2303805 0.49 - 0 transcript_id "g578.t1"; gene_id "g578"; 6 AUGUSTUS start_codon 2303803 2303805 . - 0 transcript_id "g578.t1"; gene_id "g578"; # protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTARELFWRSILDLQNAGEDPIVVLEALKTAKPNRRAIT # LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIQSGESTVHIDEHGHLVEASPPPDSATEALEGLKEVERGSADEGTSSPVGGSVPMELDLP # MIESLAERALSPEKGAESAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g578 ### # start gene g579 6 AUGUSTUS gene 2304403 2305107 0.29 - . g579 6 AUGUSTUS transcript 2304403 2305107 0.29 - . g579.t1 6 AUGUSTUS stop_codon 2304403 2304405 . - 0 transcript_id "g579.t1"; gene_id "g579"; 6 AUGUSTUS CDS 2304403 2304839 0.57 - 2 transcript_id "g579.t1"; gene_id "g579"; 6 AUGUSTUS CDS 2304900 2305107 0.5 - 0 transcript_id "g579.t1"; gene_id "g579"; 6 AUGUSTUS start_codon 2305105 2305107 . - 0 transcript_id "g579.t1"; gene_id "g579"; # protein sequence = [MMRLAPSKELDVFAPLRGKGSPGASKAVSPPKVSDVISPPPVTKAQAVPPRALRRNREIESLKADASSFLASPRSTHS # KDSDNELLSGFPLVDEAPRASSSAKVSVGRKEPKSKTTVKVVEDPKADHPPLAGMAYKRVRLPPRSRKNTSIASKGKARQIVVTDEDSTSNEVESEDE # DEDEDTAPPPKCLKTTSSISGKIFILHFLSHFINSIRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g579 ### # start gene g580 6 AUGUSTUS gene 2308834 2309982 0.83 - . g580 6 AUGUSTUS transcript 2308834 2309982 0.83 - . g580.t1 6 AUGUSTUS stop_codon 2308834 2308836 . - 0 transcript_id "g580.t1"; gene_id "g580"; 6 AUGUSTUS CDS 2308834 2309982 0.83 - 0 transcript_id "g580.t1"; gene_id "g580"; 6 AUGUSTUS start_codon 2309980 2309982 . - 0 transcript_id "g580.t1"; gene_id "g580"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGF # LGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ # PAERNYEIYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g580 ### # start gene g581 6 AUGUSTUS gene 2311751 2311978 0.57 - . g581 6 AUGUSTUS transcript 2311751 2311978 0.57 - . g581.t1 6 AUGUSTUS stop_codon 2311751 2311753 . - 0 transcript_id "g581.t1"; gene_id "g581"; 6 AUGUSTUS CDS 2311751 2311978 0.57 - 0 transcript_id "g581.t1"; gene_id "g581"; 6 AUGUSTUS start_codon 2311976 2311978 . - 0 transcript_id "g581.t1"; gene_id "g581"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g581 ### # start gene g582 6 AUGUSTUS gene 2313008 2314393 0.81 + . g582 6 AUGUSTUS transcript 2313008 2314393 0.81 + . g582.t1 6 AUGUSTUS start_codon 2313008 2313010 . + 0 transcript_id "g582.t1"; gene_id "g582"; 6 AUGUSTUS CDS 2313008 2314393 0.81 + 0 transcript_id "g582.t1"; gene_id "g582"; 6 AUGUSTUS stop_codon 2314391 2314393 . + 0 transcript_id "g582.t1"; gene_id "g582"; # protein sequence = [MSNHSFQHLLSSPHPPPTLYPQYPSCTPPQISENHNPHGHYPPTSHRMDVAYSGPPPLANLRANSTQSFIPRFPTLHR # EHPASLPPRAGVSNHQPLPGLFGGSRLAGSGRYTTEGVHVIQSTSSLSNDYGSLALHGQRVPSEPHHGPLKWQEPVICTNTDTSRLYSPVPILLPHPL # TPPPTQNSERSYGPTHDHRVVSILNGDVDSTLSCPVPRRALPSLSLFHEISPALAAPAGHHLHRPPIPPPGPRSVPPPGRLVPPPGPHSVRSPGPRSV # PPPGPRLVPSPGPRLVPPPGPRSVPSPGPHSVPPLGPHLILLPDHPPTLSPGPSPILSPGLPLIPSPNPIPSPGPSPPSPPLIPPPGCPPIRNVSASN # LGVSEKSLAKATSTLRNKLLNESISRFHAEQEERIGEIAEAHGVSFNRVKKLAGTSKHHRKRRINSAQDAILHAKTKELNEGMVLSRTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g582 ### # start gene g583 6 AUGUSTUS gene 2315071 2315406 0.42 + . g583 6 AUGUSTUS transcript 2315071 2315406 0.42 + . g583.t1 6 AUGUSTUS start_codon 2315071 2315073 . + 0 transcript_id "g583.t1"; gene_id "g583"; 6 AUGUSTUS CDS 2315071 2315406 0.42 + 0 transcript_id "g583.t1"; gene_id "g583"; 6 AUGUSTUS stop_codon 2315404 2315406 . + 0 transcript_id "g583.t1"; gene_id "g583"; # protein sequence = [MNYPNFRTKISAKYKVKIVGWPTDVDLMSPRDIIDPAKLDAVYDAWRSGLAYWSIMDKREYKKFMAQLEKDKAAGVQV # EVPRKVRSDRGGTHEKASTKRQHANNGDEPAAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g583 ### # start gene g584 6 AUGUSTUS gene 2315437 2315571 0.93 + . g584 6 AUGUSTUS transcript 2315437 2315571 0.93 + . g584.t1 6 AUGUSTUS start_codon 2315437 2315439 . + 0 transcript_id "g584.t1"; gene_id "g584"; 6 AUGUSTUS CDS 2315437 2315571 0.93 + 0 transcript_id "g584.t1"; gene_id "g584"; 6 AUGUSTUS stop_codon 2315569 2315571 . + 0 transcript_id "g584.t1"; gene_id "g584"; # protein sequence = [MDAEQETSDEEGNNKELGKDDDDDESDDSQGLEHENEDIDEPDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g584 ### # start gene g585 6 AUGUSTUS gene 2317130 2318347 0.69 - . g585 6 AUGUSTUS transcript 2317130 2318347 0.69 - . g585.t1 6 AUGUSTUS stop_codon 2317130 2317132 . - 0 transcript_id "g585.t1"; gene_id "g585"; 6 AUGUSTUS CDS 2317130 2318347 0.69 - 0 transcript_id "g585.t1"; gene_id "g585"; 6 AUGUSTUS start_codon 2318345 2318347 . - 0 transcript_id "g585.t1"; gene_id "g585"; # protein sequence = [MWQSAARTRTSSAFTSFFFNNTQWVSPAIHITRNPHSYGLIAHPTTDLPRSAFKQAEALTPARLTKIYWQLSKSSLTV # LNVLAAMSGVALSPLPTTVPVLLATAVGTALCSASANTLNQVQEVPFDAQMARTRMRPIVRRAISPLHATAFAAVSGITGPVILWTMTNPTTALIGAG # TLVLYAGPYTWMKRKSIANTWLGAVVGAAPPVMGWTACGGQLFPSSSFPVHIFPPSFMSALPETALDPSLINSSLAPLALFALLFSWQFPHFNSLSYV # VRGSYAQAGCHMLSVLDPQKNSLVSLRHALILIPTCSVLIPLSGLTTWWFALSSLLPNIIFLRASWVFWKNGGEKQARTLFRHSLWYLPLILGMMMAH # KQGVNWSQWIGLGSDDPEKPKDETHVVATTQSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g585 ### # start gene g586 6 AUGUSTUS gene 2321516 2322307 0.89 - . g586 6 AUGUSTUS transcript 2321516 2322307 0.89 - . g586.t1 6 AUGUSTUS stop_codon 2321516 2321518 . - 0 transcript_id "g586.t1"; gene_id "g586"; 6 AUGUSTUS CDS 2321516 2322307 0.89 - 0 transcript_id "g586.t1"; gene_id "g586"; 6 AUGUSTUS start_codon 2322305 2322307 . - 0 transcript_id "g586.t1"; gene_id "g586"; # protein sequence = [MKSQRIAVAGGTGRIGKHIVEGLLEIKQQYSLEIIVLSRSRSSDISYAGNNAPIVPVDYQDQSSMRKVLNDFQIDTVI # STLSGTTPDAFITSQESLLRAALSVPTIRRFAPSEFAVNSEQVPSIKLYQMKLPIIHSLRQVKQERTDSFEYSLFSCGVFMNYLGYGNTKPEGHKAHG # HMPHFPYIFDLSKRSADIPGDGEKQIVYTRAEDVGKFVAAATQLEAWEEYSEMAGDVLTMNEVLRLCEDVCGEWSPIIVVLVSCQSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g586 ### # start gene g587 6 AUGUSTUS gene 2323312 2324497 0.04 - . g587 6 AUGUSTUS transcript 2323312 2324497 0.04 - . g587.t1 6 AUGUSTUS stop_codon 2323312 2323314 . - 0 transcript_id "g587.t1"; gene_id "g587"; 6 AUGUSTUS CDS 2323312 2323601 0.54 - 2 transcript_id "g587.t1"; gene_id "g587"; 6 AUGUSTUS CDS 2323871 2324090 0.45 - 0 transcript_id "g587.t1"; gene_id "g587"; 6 AUGUSTUS CDS 2324363 2324497 0.38 - 0 transcript_id "g587.t1"; gene_id "g587"; 6 AUGUSTUS start_codon 2324495 2324497 . - 0 transcript_id "g587.t1"; gene_id "g587"; # protein sequence = [MLMNDAGETTSHLMGFFYRTIRIVENGIKPAYVFDGKPPELKKGVAPSEAEAQCAELARGGKVFYIPPDVIQSHPHPK # SQVYAAGSEDMDTLTFNAPILFRHLTFSEAKKQPISEINLTEKEKAVAEAAEEEEAEEEDPAPTSDVEQPDGSDIEEASSSKPKPKAKKKGAKGKGKG # GVSMPEEWPWEEAKELFLKPDVTPADELDVCLLQACVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g587 ### # start gene g588 6 AUGUSTUS gene 2325302 2328070 0.62 + . g588 6 AUGUSTUS transcript 2325302 2328070 0.62 + . g588.t1 6 AUGUSTUS start_codon 2325302 2325304 . + 0 transcript_id "g588.t1"; gene_id "g588"; 6 AUGUSTUS CDS 2325302 2328070 0.62 + 0 transcript_id "g588.t1"; gene_id "g588"; 6 AUGUSTUS stop_codon 2328068 2328070 . + 0 transcript_id "g588.t1"; gene_id "g588"; # protein sequence = [MGDDTWMAVFPDTFNINMTWPYDSFNVEDLHTVDNGVITHLFPLLESNKAPDLIIGHFLGVDHVGHRVGPFHPSMSSK # LQQMNATLSHVVDLLSDDTLLIVLGDHGMDHSGDHGGDGELETSAAVWIYSKGIELFDDHIGSIPSELVPFTTFPNAESPYRHIQQIDLVPTISLLLG # LPIPFNNLGSVIPELFWRETGSNPDSQVGESWSWGGIHKSAKLEGGTKPDGHLLTRALQLNALQVHTYLDTYRSSSSGAELDDAWPGLESTWHKTDAR # IPKLGSQNLVDMWNYTRLALSSCRSMWAQFNPYLMILGLISLSISLLSTCVVYIGIRRVASSSPTETNWEDWLSARLWQAVRGFAGGATIGFLASLAL # EIQGKGVDSLDCILFMAPFTSCIMIAVHSLPKNHTVPKALSVVSMSDLIVFIPFVLHVAAFFSNSFTFWEDRIVAFLLPSSLIPHILTGVRAPTARLR # RRILGFAGLTAVCVRLMAVSTICREEQHPYCHVTFYSSTLSTLDNDYTSAVVPPSASSSFAPLFALFGAPLVALALPIALRLFLRQSKSDQGLATVWF # SWVMVPSLSCGTGYWLIEYVETAGVVDESEWGTALRFCRTFLARAAFGWPTIVGGALWWNYPLCISVLAEEASERQSGRQVTILGFANAYGAPYMLFW # TITFSVVWAATQLTGQIILGLSAVALMSILEVLDGVRDVEAVEDAFKSNKLSEILQTGGDEFGVTGPQHDSSTKLKFTEIASLVLLALHAFFRTGHQS # TISSIQWKSAFLLSSTVTYPWSPGTAILNSFGPLWTVGVGAGLAGVWLKSPRSFVLPSVQDKKSEKNDQPTVHTLQTNDQIQASILLCCLCLTMYFLA # ILLTTSLSAAILRRHLMVWKVFAPRWMLGVVGVLVGDVSTISVYIGMWRIQKMVDKTLRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g588 ### # start gene g589 6 AUGUSTUS gene 2330632 2331294 0.75 + . g589 6 AUGUSTUS transcript 2330632 2331294 0.75 + . g589.t1 6 AUGUSTUS start_codon 2330632 2330634 . + 0 transcript_id "g589.t1"; gene_id "g589"; 6 AUGUSTUS CDS 2330632 2331294 0.75 + 0 transcript_id "g589.t1"; gene_id "g589"; 6 AUGUSTUS stop_codon 2331292 2331294 . + 0 transcript_id "g589.t1"; gene_id "g589"; # protein sequence = [MLPTERSLWTVIRAPFAYKKSQENFERKTHKRMIKAWDADPEVIDRWVKYLEKHAMGGVGIRVTKWERLPIGIGKTRL # ARVKEAFKAPIPNGVSSVDAKLLEVQQEGDSDANRKQAIQALGEKILKEELQTFKGSQKPPAASLGASGNTLATERVHVSADKPQVKGSPKIHAKGNN # KTSSTSTSKTKASPSYNSNSSAKAETVTPAKAEQSTSASAPGKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g589 ### # start gene g590 6 AUGUSTUS gene 2333334 2334851 0.31 + . g590 6 AUGUSTUS transcript 2333334 2334851 0.31 + . g590.t1 6 AUGUSTUS start_codon 2333334 2333336 . + 0 transcript_id "g590.t1"; gene_id "g590"; 6 AUGUSTUS CDS 2333334 2333353 0.32 + 0 transcript_id "g590.t1"; gene_id "g590"; 6 AUGUSTUS CDS 2333406 2333818 0.48 + 1 transcript_id "g590.t1"; gene_id "g590"; 6 AUGUSTUS CDS 2334025 2334851 0.99 + 2 transcript_id "g590.t1"; gene_id "g590"; 6 AUGUSTUS stop_codon 2334849 2334851 . + 0 transcript_id "g590.t1"; gene_id "g590"; # protein sequence = [MTGKSSALNNWQTTLRRQYTKRDPIANPIGPEPIKEDDYARELTSPEPPSTKEGTNEPTDDTVVRSKPSSREHSMFPE # NGKAPMVKPEDDFTTSTTSREKYHPSKAKDNAPEEESKDWLSLNMLEKLDSLHLLTEWQFQSPKRVPDRLWIQRVPPKPPRPPPKHSLKRKRIVDTNQ # TKTKLSSTKRLRLQNTIESDRNVAKSAVEPVPSTSGRHGRAAKDQANLKLDAQAKELAELNRQAALLASHSPGSNRKSSTRGASSSKLSSSPARPTRG # TSSARPLGTRQSARLRGSDDDEWQAIPDEWLQNDEDGDMEEKGKDKRGSPSLRSVSSISELTELSEEEEIPTPAEETRIKEEPVSPDKSQENVSMTQE # FVEWETVSCLNISCRYITMYSYHTLDCCYTLRVGTHSRTLAKRYSLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g590 ### # start gene g591 6 AUGUSTUS gene 2335753 2336139 0.41 + . g591 6 AUGUSTUS transcript 2335753 2336139 0.41 + . g591.t1 6 AUGUSTUS start_codon 2335753 2335755 . + 0 transcript_id "g591.t1"; gene_id "g591"; 6 AUGUSTUS CDS 2335753 2336139 0.41 + 0 transcript_id "g591.t1"; gene_id "g591"; 6 AUGUSTUS stop_codon 2336137 2336139 . + 0 transcript_id "g591.t1"; gene_id "g591"; # protein sequence = [MQYPQAMNMYPSLRSSVPSPYNQVPYGQGLGLDSGAPHISNGYIDAPMTNGSRAYGTTDVRSSQTYMDRSNAGPDSKQ # ILFSHYQPQQHGFVRNEHEQRGPQDLLTAYGHSAHSYNHYGNNNSSNEVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g591 ### # start gene g592 6 AUGUSTUS gene 2336177 2336560 0.7 + . g592 6 AUGUSTUS transcript 2336177 2336560 0.7 + . g592.t1 6 AUGUSTUS start_codon 2336177 2336179 . + 0 transcript_id "g592.t1"; gene_id "g592"; 6 AUGUSTUS CDS 2336177 2336560 0.7 + 0 transcript_id "g592.t1"; gene_id "g592"; 6 AUGUSTUS stop_codon 2336558 2336560 . + 0 transcript_id "g592.t1"; gene_id "g592"; # protein sequence = [MAEWNETSTNHAYEYSSTSSSTPSISMSHNSIERTSVVPESSSRHISHNKPAYYQQQEEWNSHSSSAERLNAISNSSS # HPIPHDLPTHHQQQQQWHSRHPTAASSQMLSQSNMPFATSPSPLQSHPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g592 ### # start gene g593 6 AUGUSTUS gene 2345564 2345991 0.74 + . g593 6 AUGUSTUS transcript 2345564 2345991 0.74 + . g593.t1 6 AUGUSTUS start_codon 2345564 2345566 . + 0 transcript_id "g593.t1"; gene_id "g593"; 6 AUGUSTUS CDS 2345564 2345582 0.76 + 0 transcript_id "g593.t1"; gene_id "g593"; 6 AUGUSTUS CDS 2345633 2345991 0.74 + 2 transcript_id "g593.t1"; gene_id "g593"; 6 AUGUSTUS stop_codon 2345989 2345991 . + 0 transcript_id "g593.t1"; gene_id "g593"; # protein sequence = [MADVPGGASGDWADDGVCTTDATLIPAVASATLSAASITAHVSSTASASSVSVQAASSAAAPTVSVSSAATSSFKTAS # IAPTVSVSSAVDASVASAKSVIIAASADSETLSATTSAVKRSRFFKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g593 ### # start gene g594 6 AUGUSTUS gene 2348780 2352145 0.73 + . g594 6 AUGUSTUS transcript 2348780 2352145 0.73 + . g594.t1 6 AUGUSTUS start_codon 2348780 2348782 . + 0 transcript_id "g594.t1"; gene_id "g594"; 6 AUGUSTUS CDS 2348780 2349718 0.73 + 0 transcript_id "g594.t1"; gene_id "g594"; 6 AUGUSTUS CDS 2349830 2352145 0.79 + 0 transcript_id "g594.t1"; gene_id "g594"; 6 AUGUSTUS stop_codon 2352143 2352145 . + 0 transcript_id "g594.t1"; gene_id "g594"; # protein sequence = [MNPAPPPPPPGYFAHPPPPGVGYYQYPPYMYPAPPPFQLSPLSAPPAHPAATIPGQDPKSNDMSSTHALAKSFGVAPH # IVNNASASPAPLYHYHPPAVVYNSSITPLPSSSTATARLAEEDLAVGSSGLDSGRDRVVQLEMPAPRDTAKWRVVSVFRSQHFSSTPSMDIWIPNDRN # TLLEIVDVYFTQLNPHRPVFFRHQFLESLNQLYDEGASSRPVFDPGFICSLYLVLALGTLSELNRSGYQGEAPVGDSAADHENDDSLLSPPSRPGKGK # RTAKSATTTSDTGGSRLPADWPAHDEFFDRALAVKPELRRQGRTLWRLVGSIVRLAIELGLHHDPTTQTLIKPKPSSSSPSATTDNGDTAYEDVPTFT # PQECTLRIWLWSIVLVHDRGTSILLGRPLAIAPSDSNTPRPSNRSGETIYTVAGSNVKQPSVNDHISEHFLLSAPIAEIQADIIISLYSPTRQSSETL # LRNASRIIKSIDLFRRSLPPKYMDYFTGTAAWSISKRHSLLASLDESTGLTLLKLAISRILLLRALFSSKELEYTERKRALVDAIVQAHNVIAIHTVL # VRYPEVGFFTSPVPLHIAAMVILYGRMSKCDVGIPSLIDGEGSEDGGSNAVRILMEDVWLALDMLPRFRWRWETGSGSSGGTTPLIAKLAEEVMETSL # SEAGLRGLGAPDESDKRGSNDATERGQNGRSRMIAGIGRQGPVGQPVLIPEPEWVEDVTSPNRGKNTGSTPVTASGMWVPTWTETVPSPKSQQTTPTL # QAAYPPSSYPRSSASAPTGVPSHPYPPPIPTSSPTHTDNSYPHPQYTFNPPVFGPQPVNGTNEKPPKATSSNAPPSATPTRSNGMQPSLSTHMMEVPH # SLFYPIYPDGVPVPPEGVHRSSTGTPRASNGPLSPPPQPPRLSRTTTSGSSAPAAQSSGATNSLLAAVAVQARAHGGQQGAPDIYMNEERGIQPGHAH # PSGGGYVALNSHGSYHVHTGTPYLPSHHLGQALNAQSSTAGPPPAAHQHTSSQLHHAAVNSPYPLHHSAHGSMPPPPPHTVWASHGVSARLVPGYHVH # SLVRSSSTRDQRVMLVNLPDYLGARI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g594 ### # start gene g595 6 AUGUSTUS gene 2352678 2353070 0.76 + . g595 6 AUGUSTUS transcript 2352678 2353070 0.76 + . g595.t1 6 AUGUSTUS start_codon 2352678 2352680 . + 0 transcript_id "g595.t1"; gene_id "g595"; 6 AUGUSTUS CDS 2352678 2353070 0.76 + 0 transcript_id "g595.t1"; gene_id "g595"; 6 AUGUSTUS stop_codon 2353068 2353070 . + 0 transcript_id "g595.t1"; gene_id "g595"; # protein sequence = [MSRSISSNPGCPPKVTYFGFTGSLSESHSSSSRSSLFLLSVAPSISPAALTFEADSTVLALTSDSLTLPADSTSEADL # TVSAEGTLEADFTVEAGSTVEADMTLVEADSGSPMSFGLQGMLGRGHIKPRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g595 ### # start gene g596 6 AUGUSTUS gene 2358508 2359047 0.81 + . g596 6 AUGUSTUS transcript 2358508 2359047 0.81 + . g596.t1 6 AUGUSTUS start_codon 2358508 2358510 . + 0 transcript_id "g596.t1"; gene_id "g596"; 6 AUGUSTUS CDS 2358508 2359047 0.81 + 0 transcript_id "g596.t1"; gene_id "g596"; 6 AUGUSTUS stop_codon 2359045 2359047 . + 0 transcript_id "g596.t1"; gene_id "g596"; # protein sequence = [MDHLHTLNDLTPKIRCDARGGVDPSLIFGIDSKLFQNTDAHTQDPSHVDEVQTLTLYRGSTASLPHKHGDDHEHAHEH # SGAANPLTNLPKLIMIDTLEECLTKLGKESVWRVKGFVRVQGVNDVETYIVNWAFGRYELTKSEPSVLVGDCSVQLTAMGEQGELRRAIRSFCRALEL # SIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g596 ### # start gene g597 6 AUGUSTUS gene 2359404 2361767 0.5 - . g597 6 AUGUSTUS transcript 2359404 2361767 0.5 - . g597.t1 6 AUGUSTUS stop_codon 2359404 2359406 . - 0 transcript_id "g597.t1"; gene_id "g597"; 6 AUGUSTUS CDS 2359404 2361676 0.9 - 2 transcript_id "g597.t1"; gene_id "g597"; 6 AUGUSTUS CDS 2361764 2361767 0.5 - 0 transcript_id "g597.t1"; gene_id "g597"; 6 AUGUSTUS start_codon 2361765 2361767 . - 0 transcript_id "g597.t1"; gene_id "g597"; # protein sequence = [MFQPTSSSDPLTVSSNSLSSVTSSPATTSAISSSSTSSSASATASPYLVFDLSSTELDTCSPFNIIWSWGIGAKPPVK # LITLSVTNINVTQQLPPASSSSSSLSASSQITNTFTDLDSSTNTVARRQIIPSVASGSVLATGTVSAAPGSSTQLAGLIESLSTALDPSVQSSFTWDQ # VNLPQGWYEFLVTATDAGDVLGGVGGIWTTWNASSEPIFIRNSSDVSCLATITTSTSSSSSGSTNTAGQSSPSAGGSLSTTSHVNSGAIAGGVIGGLA # ALVVIIGACLAYLRGRRYRNGLNDAGDGTSPRPNFGKWGALGSFDSANGSRSAPKSIVKAEGTDDFDPVTVLNTAANTRPQKSGGFRLGDIGLAAIGL # AKPQDSPPSAFTTKSKRVRRTRQAKDSSGTTESTGAIMSSSFSSSFSPPSSSAHGSYDPYADFPRGYSNTSTRQAEEDFAYSPSEQTGMPMRNLSPSS # SPTEEDYSKYQSYVPNTDSLDSGAPGVGTIPIGYEPSPFVTPPPSEPASRHNSRSYSRSSLAPSGNTQAFYALGISDSSTFDGFRPNRARSQSQNVSP # TSTRPMRGPDVPESPKHEFVSSAQNKRASSPDAFVYTLNPEQTQSSSSAGKAQSRRTPRKPVPSYTPDEALGAFTETVTSPTSPVYTYPGPVPTKPAK # AATTRRPAPTIPASESASSSTSSFPATTPTTYQRAMNPYGSHVPALEHKDSAQSLASLRNMEGDLSAYNAVLGNEGAKHMHILIPDMPLTQN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g597 ### # start gene g598 6 AUGUSTUS gene 2362900 2363244 0.69 + . g598 6 AUGUSTUS transcript 2362900 2363244 0.69 + . g598.t1 6 AUGUSTUS start_codon 2362900 2362902 . + 0 transcript_id "g598.t1"; gene_id "g598"; 6 AUGUSTUS CDS 2362900 2363244 0.69 + 0 transcript_id "g598.t1"; gene_id "g598"; 6 AUGUSTUS stop_codon 2363242 2363244 . + 0 transcript_id "g598.t1"; gene_id "g598"; # protein sequence = [MKATNLFHLPIDEEEDREIEGYQRKYLTWTSDQAVGTSQASSSKAPNLDTRSALSRAEDERNQTVNDILQNEDLYDVL # GVDKSKALDKLALRRAYLVRSKACHPEYVLASNSSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g598 ### # start gene g599 6 AUGUSTUS gene 2369149 2371694 0.04 + . g599 6 AUGUSTUS transcript 2369149 2371694 0.04 + . g599.t1 6 AUGUSTUS start_codon 2369149 2369151 . + 0 transcript_id "g599.t1"; gene_id "g599"; 6 AUGUSTUS CDS 2369149 2369349 0.06 + 0 transcript_id "g599.t1"; gene_id "g599"; 6 AUGUSTUS CDS 2370967 2371000 0.23 + 0 transcript_id "g599.t1"; gene_id "g599"; 6 AUGUSTUS CDS 2371162 2371694 0.9 + 2 transcript_id "g599.t1"; gene_id "g599"; 6 AUGUSTUS stop_codon 2371692 2371694 . + 0 transcript_id "g599.t1"; gene_id "g599"; # protein sequence = [MDIERNIQQATKDIDTILATGANQSKSVSHQHLDAPVASWADFRAYFGQWKHLKVLIGTAYSWFALDQYSNFMFSVPL # NTDGNAAPVDPLAALEKTTDAQIHQTKVQIPRLESLMDVSDRYNSDPYSLSLKARKHFREDKKIWKEKEKSDVQVKDRYALPTNFSLAEEDGETIKEA # REQWRKGREEILLRNSKRRKLAVETSIVPSSSGLSSTSSSAVVESLRARVLINTARQSRTSTNSASTFVNGRKSLVRNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g599 ### # start gene g600 6 AUGUSTUS gene 2372093 2374231 0.15 - . g600 6 AUGUSTUS transcript 2372093 2374231 0.15 - . g600.t1 6 AUGUSTUS stop_codon 2372093 2372095 . - 0 transcript_id "g600.t1"; gene_id "g600"; 6 AUGUSTUS CDS 2372093 2373370 0.26 - 0 transcript_id "g600.t1"; gene_id "g600"; 6 AUGUSTUS CDS 2373426 2373589 0.21 - 2 transcript_id "g600.t1"; gene_id "g600"; 6 AUGUSTUS CDS 2373640 2374231 0.15 - 0 transcript_id "g600.t1"; gene_id "g600"; 6 AUGUSTUS start_codon 2374229 2374231 . - 0 transcript_id "g600.t1"; gene_id "g600"; # protein sequence = [MVNFPGEPPRSGPVAAMHIQNVYKEYLLAFDTVYITSVVDSRRKSIQTPGQFPPQGPSMPFTPEALRSLSPHQLRMII # ACADKSPSELRARGMSDTMISFVETHRSSLQSMSADQENFGNEIRRPQLPQGPMAGNVGHAGNVGQPFPNLGNTNQPFRPPGEPQPTFPPGSSIPRPS # REQLSLAQMTINRNKAEYTARALPLMPGVDIPLESRGEYNSVLELAFRLANELDGKLALYSIVTKNEENTKKLSNGILSVQHQRSLLTSPNPKFIISF # ENLRTYSTQFQYASRYIAHILQNIFRGDSGPTVDQHPSYPGPVGRVVPSGQLPPNLQHSPAPNLPTQSNNSIPPRPPMPLNPPPPPSKNKKQSGAPTP # PASAATPIATAPTPSAAAAASPQTPKSPKPKSAPKKPKSRKPSTPKVNATPTLDHATIPTSSAGVKRPREEELDALQPSTDPSAGSSSNPLPTTVANE # PSPPKRAKTDWEGPISESLQKKNQVVENIKTEEDASQFLEQMTELIKMAGTEDQAALSSDISETLEQILKGYDGGIPDSDTFSTLGLNEVGSLDASAS # TSQILSSNDLTEFFDFSLFPNEDEDESKVGTPDLVSSSSTNPSPESQADADPAHHATALLDVKQEEYDPLRLGTLKEIDGGESAYYQSTDWKWDGHMA # TLEQPWAIFNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g600 ### # start gene g601 6 AUGUSTUS gene 2374820 2376092 0.46 - . g601 6 AUGUSTUS transcript 2374820 2376092 0.46 - . g601.t1 6 AUGUSTUS stop_codon 2374820 2374822 . - 0 transcript_id "g601.t1"; gene_id "g601"; 6 AUGUSTUS CDS 2374820 2375611 0.99 - 0 transcript_id "g601.t1"; gene_id "g601"; 6 AUGUSTUS CDS 2375776 2375782 0.63 - 1 transcript_id "g601.t1"; gene_id "g601"; 6 AUGUSTUS CDS 2375902 2376092 0.52 - 0 transcript_id "g601.t1"; gene_id "g601"; 6 AUGUSTUS start_codon 2376090 2376092 . - 0 transcript_id "g601.t1"; gene_id "g601"; # protein sequence = [MADRLSQYTMGHNFVPGAAGMHNHHQLSAMQQQQQLQPGQQQQQESSQQPHPGLSGFNDQNRAWPYMADLLRSQKLAQ # MQSQQQRFGLSIGGSGQSQQTTFLDQPNPSQHNMQMGFTGLGQHNPSYQQSMQHRQSMLQTLQGNQQHSRQLELMNLAQNQQNQNSPTNLGNRGVSIN # GAPQGLNPLQSQNDMFPAPNDMRRPSPHPSMPPSLLSGQPANTNGMVQNSRGTVNVQGRTINLGDLTERATTLRSLIQSQEMQMLQLQAQRTNMPDNM # FMARMRSLQSELVGRKESLNKIVTLMNICMQQGNGTNGPMCVEYSIAVFFSDILI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g601 ### # start gene g602 6 AUGUSTUS gene 2378263 2379180 0.96 + . g602 6 AUGUSTUS transcript 2378263 2379180 0.96 + . g602.t1 6 AUGUSTUS start_codon 2378263 2378265 . + 0 transcript_id "g602.t1"; gene_id "g602"; 6 AUGUSTUS CDS 2378263 2379180 0.96 + 0 transcript_id "g602.t1"; gene_id "g602"; 6 AUGUSTUS stop_codon 2379178 2379180 . + 0 transcript_id "g602.t1"; gene_id "g602"; # protein sequence = [MPPRTRAQFRANSEENTFFTTAQSFAPFSESISAIGQPCRCDRGFGPATVPTTLTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRHGQPPVVALARGRSITRIESPILQAIACRTGKQPQRHATSQSPRDPPPHFDLDTGDHDNQDPPVEPDDPGADNDNPDHNDLDEDSGSLPHG # EPGGPCSPIPPDIPNKQRVMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFNGSDPQKLKTFFVNLALVFNNRPKYFTDQRKVNYILSY # LSGSAKEWLVPDILDPDLDSLPAWKRPSRPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g602 ### # start gene g603 6 AUGUSTUS gene 2379252 2383754 0.28 + . g603 6 AUGUSTUS transcript 2379252 2383754 0.28 + . g603.t1 6 AUGUSTUS start_codon 2379252 2379254 . + 0 transcript_id "g603.t1"; gene_id "g603"; 6 AUGUSTUS CDS 2379252 2379497 0.41 + 0 transcript_id "g603.t1"; gene_id "g603"; 6 AUGUSTUS CDS 2379571 2379855 0.46 + 0 transcript_id "g603.t1"; gene_id "g603"; 6 AUGUSTUS CDS 2379951 2383754 0.8 + 0 transcript_id "g603.t1"; gene_id "g603"; 6 AUGUSTUS stop_codon 2383752 2383754 . + 0 transcript_id "g603.t1"; gene_id "g603"; # protein sequence = [MKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREA # GKPFPSGSSALFTPKPKPFSGGKPQNFSNSGQSSGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATI # ELYLNVSALSSIERSLVISLTTEFSLSNSAEPVSALLKFPTLVDSGSTDCFIDTRYVSQNSIPTTKISPVNLRLFDGSLSSKPITDTANIAVWFPSGE # LLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHFDSPQTSVPSAINAVVAKVAVPLPEPSPLVLLTIPETPPGDSPRSRSRSRSWT # LRAKPLSSKFPFEPIYSYPMVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRVIHSEVAARAADRSSTTPTVPPLHPSIPEEYTEFADVFDE # IAADSLPELKIDLEEGASPPLGRIYPLSEKELVALKDFIAKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDHYPLPLISDLLDA # PKRAKIYTKLDLAHAYHLIRIAEGDEWKTTFRTRYGSYEWKVMPFGLMNAPGAFQRFVNDIFSDMLNVCVIVYLDDILIYSDMPEEHREHIKEVLRWL # RKHRLYANPDKCEFNMDTVEYLGYILSPDGLTTSKEKVQTVLEWPVPRKVKDIQSFLGFANFYCRFIYNYSDIVVLMTRLTRKGASWIWDSSCQEAFE # NLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRMLHAAELNYNTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTNHKN # LEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDISYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEA # LHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSC # TICGRNKPRRHRPYGLLKPLLVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHIFSKHGVPNHVTSDRGSEF # VSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITIRPEVDMKSDL # ARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLCRIHPVFHV # SQLEPVTPNPFLNRTQSPPPPIEVDGEEEYNVAEILDFKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g603 ### # start gene g604 6 AUGUSTUS gene 2384700 2385095 0.8 - . g604 6 AUGUSTUS transcript 2384700 2385095 0.8 - . g604.t1 6 AUGUSTUS stop_codon 2384700 2384702 . - 0 transcript_id "g604.t1"; gene_id "g604"; 6 AUGUSTUS CDS 2384700 2385095 0.8 - 0 transcript_id "g604.t1"; gene_id "g604"; 6 AUGUSTUS start_codon 2385093 2385095 . - 0 transcript_id "g604.t1"; gene_id "g604"; # protein sequence = [MSTSCTTTTTVTSATTAGPSRSRTMNPPPADPVDDDEEELGEDNDEAIRRAEEKVHRMKARKAAAAAKKKAEEEAAKK # AAEEARRREEAAARELEERRRLLATAATARSQRGTSPSEVSASPRRPVVEVSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g604 ### # start gene g605 6 AUGUSTUS gene 2391073 2392749 0.94 + . g605 6 AUGUSTUS transcript 2391073 2392749 0.94 + . g605.t1 6 AUGUSTUS start_codon 2391073 2391075 . + 0 transcript_id "g605.t1"; gene_id "g605"; 6 AUGUSTUS CDS 2391073 2392749 0.94 + 0 transcript_id "g605.t1"; gene_id "g605"; 6 AUGUSTUS stop_codon 2392747 2392749 . + 0 transcript_id "g605.t1"; gene_id "g605"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSESISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLFTSDGQP # VQVLTPCRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPG # DPSGPGSPGGPGGPGGPGGPGGPHSSNSPDIPNEQRAMLDLLSGFKVSMETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTNQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGVYDAQGEAEDALGNLKMKETENIRFNTLAASTNWDSAALK # WAYGRGLAERIKDEMARLPEPATLAAYRLEVLRIDNRYWKREETKKCEAGKPFIARNPKKGSSDFKTGSTNQHNNSQPLGSSAPFTPKPKPFSGGKLN # NNGKPQNSLNSGQSGGQRPAFNHLGADGKVLSSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPGATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g605 ### # start gene g606 6 AUGUSTUS gene 2393082 2396645 0.99 + . g606 6 AUGUSTUS transcript 2393082 2396645 0.99 + . g606.t1 6 AUGUSTUS start_codon 2393082 2393084 . + 0 transcript_id "g606.t1"; gene_id "g606"; 6 AUGUSTUS CDS 2393082 2396645 0.99 + 0 transcript_id "g606.t1"; gene_id "g606"; 6 AUGUSTUS stop_codon 2396643 2396645 . + 0 transcript_id "g606.t1"; gene_id "g606"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNLLIDWASRNITFRNTSHLDSPQTSVPSAINPVVAKVAV # PLPELSPSVLPTILETPPGDSLRSRSRSRSRTSRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTAPTVPPLPLSIPAEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHTYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQQFVNDI # FSDMLDVCVIVYLDDILIYSDMPEEHQEHVKEVLRRLRHHWLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVKTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETNASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWHHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDLITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGCNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTYDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKVLSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYKLKLPDYLCRIHPVFHISQLEPVTLNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWASYEGT # DDEFSWVAADELHADELVPAFHAQYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g606 ### # start gene g607 6 AUGUSTUS gene 2402811 2403578 0.64 + . g607 6 AUGUSTUS transcript 2402811 2403578 0.64 + . g607.t1 6 AUGUSTUS start_codon 2402811 2402813 . + 0 transcript_id "g607.t1"; gene_id "g607"; 6 AUGUSTUS CDS 2402811 2403578 0.64 + 0 transcript_id "g607.t1"; gene_id "g607"; 6 AUGUSTUS stop_codon 2403576 2403578 . + 0 transcript_id "g607.t1"; gene_id "g607"; # protein sequence = [MAHNVRLALDYMQTAHGVHGDLHIRSLSSIQWFFNNAVDQDEGLYTLMLENSRFDSDRPFLTAAQHAGFTSPPPDSLE # PPLHRRMLSLSMALPHRGGAGRWDNLVPAIPSDDQLMQDWEQLMLQYMHHITDTPLPVPDPPVPMSSTGPVPKSSGEANVKQSLEAPIVQVSSPSAGS # HPPVPLFLSEQESPTSPSPLPRSPVLPLLFGSVASLSIDLTGDDDELYETEEAYASRIDVAREGTELAVGQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g607 ### # start gene g608 6 AUGUSTUS gene 2404588 2406309 1 - . g608 6 AUGUSTUS transcript 2404588 2406309 1 - . g608.t1 6 AUGUSTUS stop_codon 2404588 2404590 . - 0 transcript_id "g608.t1"; gene_id "g608"; 6 AUGUSTUS CDS 2404588 2406309 1 - 0 transcript_id "g608.t1"; gene_id "g608"; 6 AUGUSTUS start_codon 2406307 2406309 . - 0 transcript_id "g608.t1"; gene_id "g608"; # protein sequence = [MDRLLREGTPAYFLHILPTKEESPTEEILRASNSNDPERVQQPKDPENGNPGPEQGGVVKELDEEVSKRQETEELKKS # IPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSKKELKSLKEYIDEMLGKRFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALN # KITKKNRYPLPLIGTLVDQLRKAKIDLRAGYNNVRVAQGHEWKTAFRTWYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDD # EESHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRK # DSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASYLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAY # CEGSRHQIQVYSDHNNLQYFTTTKQLTARQAWWAELLSGYDFVINYRPGRLGVKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATILMNKD # LLVNC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g608 ### # start gene g609 6 AUGUSTUS gene 2406658 2407317 0.66 - . g609 6 AUGUSTUS transcript 2406658 2407317 0.66 - . g609.t1 6 AUGUSTUS stop_codon 2406658 2406660 . - 0 transcript_id "g609.t1"; gene_id "g609"; 6 AUGUSTUS CDS 2406658 2407317 0.66 - 0 transcript_id "g609.t1"; gene_id "g609"; 6 AUGUSTUS start_codon 2407315 2407317 . - 0 transcript_id "g609.t1"; gene_id "g609"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKLTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHEGTLQPPPEAPQQPPEAPQPPPEVPQQSLEAPLRAPRMGVKLEEVKDEEYEASQPG # PHKLFPLDKDLGPDDPILMGINEWLAFTSESTEEEMEEILEAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g609 ### # start gene g610 6 AUGUSTUS gene 2408596 2411055 0.31 - . g610 6 AUGUSTUS transcript 2408596 2411055 0.31 - . g610.t1 6 AUGUSTUS stop_codon 2408596 2408598 . - 0 transcript_id "g610.t1"; gene_id "g610"; 6 AUGUSTUS CDS 2408596 2409444 0.88 - 0 transcript_id "g610.t1"; gene_id "g610"; 6 AUGUSTUS CDS 2409593 2409618 0.83 - 2 transcript_id "g610.t1"; gene_id "g610"; 6 AUGUSTUS CDS 2409708 2411055 0.31 - 0 transcript_id "g610.t1"; gene_id "g610"; 6 AUGUSTUS start_codon 2411053 2411055 . - 0 transcript_id "g610.t1"; gene_id "g610"; # protein sequence = [MVQCKPENVGEFPPEQFDQKRQLHGSDGCFLAQKHSLPRNIEVPEFLNPGNTATRSPQLRLGTSPTVHALIQRVNLQM # KPVTPVSTQRYQFGKVRMDGEQHSSWISGQDLTARLVPNPVHVPPRRSNLSVIPYQGSVSMQSQAVGAENQRGLNQQRILAVHEEAVPLQEAPFGTPF # VMGAQTNQPGMAVELAHSQESVVMIQQQARVIEMLQEQLREVRKGFAAGEIPTGGPPSKTGNMAGLFGQAPMVMIENTRGGPSPVVPQPRSWQATEPI # PFTRRTPMGVREGNPWEEQSAPLPATPSMDRRRIQEWGARVQKAELGEYMRPEGGRYALEDSGIAASGGDRGGFKPPNRAPPPHLSNHSRDRERPPSQ # GERDHRGQVGRSGGGAPPPPPPPPPPSGGPGDNDSEGSNEGEHTGSSREGGRNEDDRRELSTEAPEVPPTHYDPDLSRLSNMGLTSDQPWYYDPRQGW # HHKVAPRPPNEGRNTWESNEEKNWITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLKGE # YTCLEDWTEFKQEFGSKFGPIDEADKARRRLAWMKQMPEESFANFFTRFNEYAPLTGFNDEALITYLKKGVAPWLPLQVVTGREEPRSYDGWTRVFTK # LDGAVRAQAESLRNLHGGKPLQGWLSRFPGLELAPEAPYKSPLRREREPADVWTSNPKPAVTGRFQNRSNWKEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g610 ### # start gene g611 6 AUGUSTUS gene 2416365 2416601 0.57 - . g611 6 AUGUSTUS transcript 2416365 2416601 0.57 - . g611.t1 6 AUGUSTUS stop_codon 2416365 2416367 . - 0 transcript_id "g611.t1"; gene_id "g611"; 6 AUGUSTUS CDS 2416365 2416601 0.57 - 0 transcript_id "g611.t1"; gene_id "g611"; 6 AUGUSTUS start_codon 2416599 2416601 . - 0 transcript_id "g611.t1"; gene_id "g611"; # protein sequence = [MDATRRRNSPPELPEAGPSAPSKKRRKAADSDEEEEREIEGEMEKDREEVEMEEEGEEENDEPALKKARSEKGKEREE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g611 ### # start gene g612 6 AUGUSTUS gene 2418896 2419861 0.99 - . g612 6 AUGUSTUS transcript 2418896 2419861 0.99 - . g612.t1 6 AUGUSTUS stop_codon 2418896 2418898 . - 0 transcript_id "g612.t1"; gene_id "g612"; 6 AUGUSTUS CDS 2418896 2419861 0.99 - 0 transcript_id "g612.t1"; gene_id "g612"; 6 AUGUSTUS start_codon 2419859 2419861 . - 0 transcript_id "g612.t1"; gene_id "g612"; # protein sequence = [MNNQSQHFIEQLPMSNGYIAILVIVDQSSKQAIFIPTFNTITSEQLAEPFVIYVFSKHGVPNHVTSDHGSEFVSVFFR # ALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSHLLLISEFAYNNAPNASTGITPFFANKGYHPNITVWPEVDMKSDSARDFVV # NLNELHVFLREEILLAQSCYKEQADRKRISHLEFPIGSEVFVLARHIRSTRPTEKFSEKYLGPFKVISRSGTLSYELKLPDYLCQIHPVFHVSQLEPV # TPNPSPNCTQSPPPPIEVDGEEEYNIAEILDSKLDRRYKHCPLRYYI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g612 ### # start gene g613 6 AUGUSTUS gene 2422055 2423047 0.83 - . g613 6 AUGUSTUS transcript 2422055 2423047 0.83 - . g613.t1 6 AUGUSTUS stop_codon 2422055 2422057 . - 0 transcript_id "g613.t1"; gene_id "g613"; 6 AUGUSTUS CDS 2422055 2423047 0.83 - 0 transcript_id "g613.t1"; gene_id "g613"; 6 AUGUSTUS start_codon 2423045 2423047 . - 0 transcript_id "g613.t1"; gene_id "g613"; # protein sequence = [MPFGLTSAPAAFQCFVNDIFSDILDVCVIIYLDNILIYSDTPEEHQEHVKEVLWRLRKHRLYANPDKCKFNMDTVEYL # GYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFYPHFIYNYSDIVVPMTRFTRKGAPWIWDNDCQEAFENLKIAFTSVPILAHWEPNRPII # VETNTSDYAIAAILSIQTVDGEIHPLAFLSRTLHAAELNYDTHDKELLTIFKAFKAWRHYLEGSGDLVDIVTDHKNLEYFSTTKILTHHQVHWSEYLH # QFNMVICFRPGKLGKKPNSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTTSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g613 ### # start gene g614 6 AUGUSTUS gene 2427074 2428711 0.91 - . g614 6 AUGUSTUS transcript 2427074 2428711 0.91 - . g614.t1 6 AUGUSTUS stop_codon 2427074 2427076 . - 0 transcript_id "g614.t1"; gene_id "g614"; 6 AUGUSTUS CDS 2427074 2428711 0.91 - 0 transcript_id "g614.t1"; gene_id "g614"; 6 AUGUSTUS start_codon 2428709 2428711 . - 0 transcript_id "g614.t1"; gene_id "g614"; # protein sequence = [MPPRTRAQSRVNSEENTFFTTAQSFAPFSESISAIGQPRCRNRSFGPATVPTMSTLPEAMEDQQFEYSTLYTGDGQPV # QVMTPRCGQPPMVAPARHQSTTRIESPILQAIARRTGKQPQRRANSQSPRDPPPHFDLDAGDHDDQDPPVNPDDPGADNDNPDNDDLDDNSSRLPGSE # PSDPSGPSGSRTPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRSKYFTDQRKVN # YTLSYLSGSAKEWFVPDILNPDLDSLPVWMSSFKALVKELQDNFGVYDAQGKAKDSLGNLKMKETENIRFNTLAASTNWDSAALKWAYGRGLAEHIKD # EMAHLPKPAMLADYCEEVLCIDNRYWKRKETKKCEASKPFIARNPKKGSSDFKAGFTNQQNNSQPSGSSAPFMPEPKPFSGGKPNNPGKPQNSSNSSQ # SSGQCPAFNHLSADGKVLPSERERRMKNNLCLFCSGKHQIADCNKQKARELKGRAAEVEETPEATPIIVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g614 ### # start gene g615 6 AUGUSTUS gene 2432748 2433785 1 - . g615 6 AUGUSTUS transcript 2432748 2433785 1 - . g615.t1 6 AUGUSTUS stop_codon 2432748 2432750 . - 0 transcript_id "g615.t1"; gene_id "g615"; 6 AUGUSTUS CDS 2432748 2433785 1 - 0 transcript_id "g615.t1"; gene_id "g615"; 6 AUGUSTUS start_codon 2433783 2433785 . - 0 transcript_id "g615.t1"; gene_id "g615"; # protein sequence = [MVNTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPHHVTSDRGSEFVSAFFRALGKVLSMELHYTSG # YHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAKFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILL # AQSCYKEQADRKRISHPEFPISSKVFVLAKHIRSTCPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPP # IEVDGEEEYNVAEILDSKLNRRYKRCPLRYYIRWAGYAGTNDEFSWVAVDELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g615 ### # start gene g616 6 AUGUSTUS gene 2436628 2437386 0.95 - . g616 6 AUGUSTUS transcript 2436628 2437386 0.95 - . g616.t1 6 AUGUSTUS stop_codon 2436628 2436630 . - 0 transcript_id "g616.t1"; gene_id "g616"; 6 AUGUSTUS CDS 2436628 2437386 0.95 - 0 transcript_id "g616.t1"; gene_id "g616"; 6 AUGUSTUS start_codon 2437384 2437386 . - 0 transcript_id "g616.t1"; gene_id "g616"; # protein sequence = [MILTWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIK # DEMACLPEPATLADYRQEVLRIDNHYWKREETRKREAGKPFVAQNPKKGSLDFKTGSTNQQNNSQPSGSSAPFMPKPKPFSGGKPNNNGKPQNSSNSG # QSGGQRPAFNHLGADGTVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEELEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g616 ### # start gene g617 6 AUGUSTUS gene 2439939 2443645 0.93 - . g617 6 AUGUSTUS transcript 2439939 2443645 0.93 - . g617.t1 6 AUGUSTUS stop_codon 2439939 2439941 . - 0 transcript_id "g617.t1"; gene_id "g617"; 6 AUGUSTUS CDS 2439939 2442316 0.96 - 2 transcript_id "g617.t1"; gene_id "g617"; 6 AUGUSTUS CDS 2442409 2443645 0.94 - 0 transcript_id "g617.t1"; gene_id "g617"; 6 AUGUSTUS start_codon 2443643 2443645 . - 0 transcript_id "g617.t1"; gene_id "g617"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHITCASLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQEQWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGPQREPNHTEADLEENEIITATEESPIHQIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQERDISPSLTFAGATIMCGLRRGMNGKAHLQQLGASGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKHDLYLCPEKCEFEQQQIEYLGLII # SEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALWAPDRPTRIEVD # ASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDF # HMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQVLEGLETVKKHGLQCLANGIAEWEEDNGLVYY # RGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNS # QGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYI # RLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFK # VGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSR # IRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g617 ### # start gene g618 6 AUGUSTUS gene 2464020 2467161 0.29 + . g618 6 AUGUSTUS transcript 2464020 2467161 0.29 + . g618.t1 6 AUGUSTUS start_codon 2464020 2464022 . + 0 transcript_id "g618.t1"; gene_id "g618"; 6 AUGUSTUS CDS 2464020 2464682 0.61 + 0 transcript_id "g618.t1"; gene_id "g618"; 6 AUGUSTUS CDS 2464789 2465308 0.51 + 0 transcript_id "g618.t1"; gene_id "g618"; 6 AUGUSTUS CDS 2466359 2467161 0.89 + 2 transcript_id "g618.t1"; gene_id "g618"; 6 AUGUSTUS stop_codon 2467159 2467161 . + 0 transcript_id "g618.t1"; gene_id "g618"; # protein sequence = [MEEDQQFEYSTLYTGDGQPVQVLTPRRGQPPWSLRLGAGQLLELILQSPSHSPPYGKTTQRRAASESPRDPPPHFDLD # TGDHDDQDPPVDPDDPGADNNNDDLDDDSGGYRVVSLVTPVGLAVPAVPADLVVLVDLVVLVPNSPDIPTSNELCWTLSGSRVPLRPWYRLAASAPSD # SSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSA # ALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGG # KPNNNGNPRTLRIPANPAVSAPQVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVAL # KDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRY # GSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g618 ### # start gene g619 6 AUGUSTUS gene 2470405 2470866 0.52 - . g619 6 AUGUSTUS transcript 2470405 2470866 0.52 - . g619.t1 6 AUGUSTUS stop_codon 2470405 2470407 . - 0 transcript_id "g619.t1"; gene_id "g619"; 6 AUGUSTUS CDS 2470405 2470866 0.52 - 0 transcript_id "g619.t1"; gene_id "g619"; 6 AUGUSTUS start_codon 2470864 2470866 . - 0 transcript_id "g619.t1"; gene_id "g619"; # protein sequence = [MSTSRTITTTTQKSPTAGPSRSRPAPPPPIDLTVPEESREDDDDDVEEDDDEAIRRAEEKVRRMKARKAAAAAKKKAE # EEAARKAAEEAQRKKEEAARELEERRRRMAEAATARSRRGSSPGGSSVSPQRPVVEIRKDKGKGKGKAQVSTDTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g619 ### # start gene g620 6 AUGUSTUS gene 2479153 2480301 0.72 - . g620 6 AUGUSTUS transcript 2479153 2480301 0.72 - . g620.t1 6 AUGUSTUS stop_codon 2479153 2479155 . - 0 transcript_id "g620.t1"; gene_id "g620"; 6 AUGUSTUS CDS 2479153 2479998 0.87 - 0 transcript_id "g620.t1"; gene_id "g620"; 6 AUGUSTUS CDS 2480141 2480182 0.88 - 0 transcript_id "g620.t1"; gene_id "g620"; 6 AUGUSTUS CDS 2480287 2480301 0.75 - 0 transcript_id "g620.t1"; gene_id "g620"; 6 AUGUSTUS start_codon 2480299 2480301 . - 0 transcript_id "g620.t1"; gene_id "g620"; # protein sequence = [MRIQSTFVNLSSVNDELDILAHLKHFLTNPLTALVSLVPHLPSGINALSLESTLQEPGSTDFKELLVQRLTFDRDDAD # NSNLTSSLPALTRAVHIACSQFRTRTRSIRLAYLLLQGLHGFLSEKGYKGLGNHWGSTTVPAFMSTAVAASTLSSRYPQYLSLQNYINLLQLHAQTHS # KQSVKDITYARTLLRKFRPEELSAYLNTLIPKLQELQNELGVDIPTGDDEGEESSNLNLAEVVRMLEEWRSEAEEVYRAYETVETGTRERNMNEAAVE # KFKLLKENLAEWMYEYLGYALFIILP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g620 ### # start gene g621 6 AUGUSTUS gene 2485119 2487100 0.31 + . g621 6 AUGUSTUS transcript 2485119 2487100 0.31 + . g621.t1 6 AUGUSTUS start_codon 2485119 2485121 . + 0 transcript_id "g621.t1"; gene_id "g621"; 6 AUGUSTUS CDS 2485119 2486511 0.32 + 0 transcript_id "g621.t1"; gene_id "g621"; 6 AUGUSTUS CDS 2486589 2487100 0.88 + 2 transcript_id "g621.t1"; gene_id "g621"; 6 AUGUSTUS stop_codon 2487098 2487100 . + 0 transcript_id "g621.t1"; gene_id "g621"; # protein sequence = [MQPNTSTPFEATSTTSSPAVASRSSQSPSNSSVDRLSLPPELTDYILDYFHDDKHTLFTCSLVSRSFNATCRYHVFSK # GIEISSTPEVRKRKVVEGIEGVEDDIEHARKKGKENQDLRTEVGLTTHTYINPASSAASFVRIVLAPSSTVAPFLQELCLVLRPSFSLYSVPPKSAVP # ANAWLDELLALLPATTVSSSSPFLPPYPLTHADSFPPAGTSQAHRRNPFHIRTLRIFRHGVDLSPFSRLALHQNFAHTVRTLALFETTLQGRSLQRDM # EWVCGFGKLEDLLFYGHHRGEKRGRRAAFMERGEGEGLIRDIEEPATTEEESPWGWGHSEGGRIFDLNEAPEVMDARGRAKIRLPLSIRRLRLDLPGP # ALEAVMRWLLAHGSSGSTEVKSKSHSDRSKEEIEAQREGGSQGSIEGVPCVSTLHIFRVMDDEMPALRAYLCACKDTLEDLMMFLYQGHTKRDDFDLS # SHTALRSVYLASNGSKPMRVLHDILSTLQALPTSQMRKIYLQIPQWQLASDDDAWGTLDDLLKGLLESSGKELKVSAIVDGRHKYDNSNENEEDVTFG # LRCKLRERLPLSTSFMSPIGSARSLDKARNEKQDNSRFTILSNSTREMAQYVDEVFGRMRVSLTRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g621 ### # start gene g622 6 AUGUSTUS gene 2487949 2492245 0.43 + . g622 6 AUGUSTUS transcript 2487949 2492245 0.43 + . g622.t1 6 AUGUSTUS start_codon 2487949 2487951 . + 0 transcript_id "g622.t1"; gene_id "g622"; 6 AUGUSTUS CDS 2487949 2488275 0.43 + 0 transcript_id "g622.t1"; gene_id "g622"; 6 AUGUSTUS CDS 2488352 2492245 1 + 0 transcript_id "g622.t1"; gene_id "g622"; 6 AUGUSTUS stop_codon 2492243 2492245 . + 0 transcript_id "g622.t1"; gene_id "g622"; # protein sequence = [MFGCFFKDKPHAAMNVDADGRRLPVDSPIIGHTLRTVSSNSSISSAASGASLNRQPRTRGRSRTVTGNSAIKPNTTNV # VNHDQMSISTGPVAADTSRAEESNAEEPIRMASQLAALKTKQPPSAFSRVPLSQIDAIEGVVVNVRDSMITQESEQTNISTVYPLSTLSSATASPRSP # TFSERSVQVDDFKSFEEDDVSYRLRLLVNNNYFLPPAHSKPLPAQLIPATNPNAVKKFPAPTFLDLFRIGRSKSKPPTPTSESGNGGQALTPALRTTS # DATAVSGFPMQMQTAVSSSSSSAPPRTSNLGRQPDRSGRVVVVREKMADLASAAKQAEFEVKIRSLQRDTRREQAVNLPSMDDVIDPTDAVDLPLPSS # AYPFAVQTSALHGLGVHESVGAAALASRLPPPRDRSSALSSLGPDDDEEDWKKALLKAAVGHSFDNLTVAAEGALARSPRSPRSPSSSMMSSLPPGSP # APSPVPITSVPVPAARINKKIISSPIQLDTSLSKSPSVHSASHIQTHAFTNHSRPRGWSSPASPTSPSSAPSPIPIRTETPLDLMPLMPPPRSPKSPR # SPKSVKREIINPVYSISQTDLTETAGPAAASVSQGWNGGNTNHIYTMTPPPGYWRSGGLGMTPRDSSESSQSSFRPRDSSDRETTNSNTSRSRRTAGS # GVADPETPDSISMYSTVTGVFPDEENENLPRASSSRSTITSTAQSPTTSAFQDALSRNPSELRIDGDGHAHQQSTDPPPVPSLAGPTDGTSAPSASVS # SPFQPLEPIERSAPAAPASPRPPSASSLPIPSTSLTPATPVSAPSRTTSLHYRDLRNRHFSALMQNNTLPTYASYLSNPPSAYITNMPPPPTLTHRSA # SDHGHGTFTPPPPALRKRPPTAPAAPILTPRIELIEISAPEPTTPPFPSFASLPSFPSLPTIRSPSSPSSARSVHSARSAPPSPPSPLSPLSSSYPSS # QSPSSLPSQSQPSLIERRHHGVGNPLRGSLHIPTSIIPPAIHSAPPPATPPSFSSSLPLFAGPSSAGPSSMMMMTPPSSSMSFFDTIQTQPNAMDYLD # ESSDESSDDDDEDEDEDECEYDNEGDENRAGNENIEKDDDNHDDEGEEDFRTAEGGTTAGSGRERGASVTNSMLSSLSAYSTSSAQPTARRPSTSRSN # ISSHSNLSNHSNRSNFSIRTPLMRLGNHSTPYVSHTSLHASDTGIDRRLPIGNIAESKSPREFFTKKMRDDEQVLESKWDLWKYTRVGQGEGVRADVV # TGSGVGTGTGAEIAGEVEVAAGPSSRSYSYSYSSHPYARAYGPHHSRNYSRDAPSSFAGISGSSGTAVGGSRIRATSSSSDRGYGYGYGSQTQTQQAQ # TQAQQKMESKKLDGMLKMHMEAEKDQMKKMAERMKQTQIQDKASGGRGAIKSKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g622 ### # start gene g623 6 AUGUSTUS gene 2494406 2494822 0.72 - . g623 6 AUGUSTUS transcript 2494406 2494822 0.72 - . g623.t1 6 AUGUSTUS stop_codon 2494406 2494408 . - 0 transcript_id "g623.t1"; gene_id "g623"; 6 AUGUSTUS CDS 2494406 2494822 0.72 - 0 transcript_id "g623.t1"; gene_id "g623"; 6 AUGUSTUS start_codon 2494820 2494822 . - 0 transcript_id "g623.t1"; gene_id "g623"; # protein sequence = [MSQDKDSSAFAATRLTSNTFLIKEYDDIYSEHPHIYAIIFPSTSNLSNISNTSESSSKVGHNMAGTIILIDTGCGGAS # NDPEVRVTNVREFIETVDVPENGGRPLNGLDSQSGLEAGKRMGYIVVLTHCHYDHIRKSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g623 ### # start gene g624 6 AUGUSTUS gene 2495890 2496678 1 + . g624 6 AUGUSTUS transcript 2495890 2496678 1 + . g624.t1 6 AUGUSTUS start_codon 2495890 2495892 . + 0 transcript_id "g624.t1"; gene_id "g624"; 6 AUGUSTUS CDS 2495890 2496678 1 + 0 transcript_id "g624.t1"; gene_id "g624"; 6 AUGUSTUS stop_codon 2496676 2496678 . + 0 transcript_id "g624.t1"; gene_id "g624"; # protein sequence = [MITAARHRTDTQFDNAPSLYEDGSPMWSILVRSDVAKQIAALEKVEREEETKIRRERKERADMAAAQAAALAAQSASA # MNGGAGGSGGGDDDLDGFGGGGGGKKKRKKDGPGVTAKNMSVDVQKKMSNAAASHAAGLAGRYSWMTAGASSTGSSTPKKTVVAAAPAAATTTTTTPG # ALSSSLTGAGASAASTTATLSTPSAGGNSSGWARPYVSAKKTTETNTTQEIVEGDTRTAITMRDAMFVIEKERGHGGGRGAAKGWT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g624 ### # start gene g625 6 AUGUSTUS gene 2496738 2497094 0.57 - . g625 6 AUGUSTUS transcript 2496738 2497094 0.57 - . g625.t1 6 AUGUSTUS stop_codon 2496738 2496740 . - 0 transcript_id "g625.t1"; gene_id "g625"; 6 AUGUSTUS CDS 2496738 2497094 0.57 - 0 transcript_id "g625.t1"; gene_id "g625"; 6 AUGUSTUS start_codon 2497092 2497094 . - 0 transcript_id "g625.t1"; gene_id "g625"; # protein sequence = [MSSTSTSTAHITVLYFAAASTTLGITEEKIPIPEKGFYLSQLKDLLVERHSRDNPSNDNGSGKKGGGGGEKIGEALRK # VLDSSQWSVDAEMVDDDEDLTKVELGDGVEVAVICPVSGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g625 ### # start gene g626 6 AUGUSTUS gene 2505028 2505720 0.59 + . g626 6 AUGUSTUS transcript 2505028 2505720 0.59 + . g626.t1 6 AUGUSTUS start_codon 2505028 2505030 . + 0 transcript_id "g626.t1"; gene_id "g626"; 6 AUGUSTUS CDS 2505028 2505720 0.59 + 0 transcript_id "g626.t1"; gene_id "g626"; 6 AUGUSTUS stop_codon 2505718 2505720 . + 0 transcript_id "g626.t1"; gene_id "g626"; # protein sequence = [MKGFQTYPSLARENRARKTHKTDEISSLFKKMDIGLKLKLNFRIDKENRKRREKSLEFQLGNSVDDASDIASFVTIDT # ISLDNVRKDPTTFERLKDFLTTDTLDFFRQRNEEEGDRRSRVRGREEEAEEGARKKRKSGKVTLVPRSAGPRVTTFDTLLFDTIDAFPIFPLFLFTNK # NLDLINTHMPELKCAKILHIEGKPHVLDLKEIAKWVKETGGIFRDEDLDFIQWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g626 ### # start gene g627 6 AUGUSTUS gene 2508348 2509832 0.99 + . g627 6 AUGUSTUS transcript 2508348 2509832 0.99 + . g627.t1 6 AUGUSTUS start_codon 2508348 2508350 . + 0 transcript_id "g627.t1"; gene_id "g627"; 6 AUGUSTUS CDS 2508348 2509832 0.99 + 0 transcript_id "g627.t1"; gene_id "g627"; 6 AUGUSTUS stop_codon 2509830 2509832 . + 0 transcript_id "g627.t1"; gene_id "g627"; # protein sequence = [MHSPFDRILAPVSSGAGTMAPRTSSSQIASRTLLDDPFATQSIPTPSKYDNNNKPSIHDPFSDPFATPTTSSPQQSQQ # PKQLPSKLTNRKPKKGCEITPNPLRPNVRAADRIHAWNTPYSIQKRLEESNSLPAKVIKLGEQVMAKGTVKSTKEVYAAGLLRYNQFGDLMGISEDDR # MPASDRLIIGFIGHYAGKVLGKSISNWLSGLRLWHETMGAPWPADSRRIRQARRGANIERSHHKRSPRHPITIEHMRALHKALNFSIHFHCAVWALAC # TAFLACQRLGELTIPSQNAFNPKFHVSQNTNSITFTSKPASVHFHIPWTKTTKEEGASVVATSPLGDNMEFMCPSKAIQRHLAKNADIPEDSSLFGYI # DENGKPQHMVKKVFLEFCFNIWNHAALQSVLGHSFRIGGAVWLLLAGVPPEIVAATGGWTSLAFLLYWRRLESIIPQHITKAYEKSQWNTLRDKVDSF # RKTNKISNKFIKACVTGNDIEIEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g627 ### # start gene g628 6 AUGUSTUS gene 2510735 2512622 0.42 - . g628 6 AUGUSTUS transcript 2510735 2512622 0.42 - . g628.t1 6 AUGUSTUS stop_codon 2510735 2510737 . - 0 transcript_id "g628.t1"; gene_id "g628"; 6 AUGUSTUS CDS 2510735 2512231 0.45 - 0 transcript_id "g628.t1"; gene_id "g628"; 6 AUGUSTUS CDS 2512431 2512622 0.42 - 0 transcript_id "g628.t1"; gene_id "g628"; 6 AUGUSTUS start_codon 2512620 2512622 . - 0 transcript_id "g628.t1"; gene_id "g628"; # protein sequence = [MELPDEILTQIFDLAADEDVIFQYGLPTVMAETAWFQNALDEWALRSPQEAINIIQRRSYATKKSSVGLGWWTKRIHL # TRYYASPNRGASQDDMCNALTTIVKHCPNLSIFVVEWPMPSATFGLVADSLFKYTRKALHTVHWHVSAEAIPKIIWALDSLPLVLAAHIEFDPPTHTT # EIHESLHLGSAQNVALNLPYLQQLTLRGSFSEFLEQAVDWILPGLRNLSIDCGNSRSETPDIVGFLERHGDKLKVLDINSIPPLEVPDILELCPQLEV # FSFNADWRFQAPTLPATTSDGIPITDDSEPDGASRQRRRQSNTMRLSLGSYFNETSILTHTPHPRIHTIGLHGLLYAFGVGYARIFSSEEPFRSRVVR # RSNDLNFGALNRAQFPQLRCIRILSRTLLNDLNKADGPVQDDEVDGMDRWERWWDRCHESNIRLEDCTGGEFGQLPLDAEEENIEEEEEEEEGDGQAN # DSEEYSSGGYSDEWEVEVPSIEENDDGLHTQELRQLIKECQAMAEERDESPFSGFIGPAFNLSSSMSSATGHSSAIADESTLLPRPVQLQAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g628 ### # start gene g629 6 AUGUSTUS gene 2515727 2517190 0.3 - . g629 6 AUGUSTUS transcript 2515727 2517190 0.3 - . g629.t1 6 AUGUSTUS stop_codon 2515727 2515729 . - 0 transcript_id "g629.t1"; gene_id "g629"; 6 AUGUSTUS CDS 2515727 2516364 0.79 - 2 transcript_id "g629.t1"; gene_id "g629"; 6 AUGUSTUS CDS 2516746 2517190 0.3 - 0 transcript_id "g629.t1"; gene_id "g629"; 6 AUGUSTUS start_codon 2517188 2517190 . - 0 transcript_id "g629.t1"; gene_id "g629"; # protein sequence = [MHSAKSKSKGVSTSSLFDLKAEISKKEDEFARDKAAGKTYTLGRVNRPDKVVTLQITALQLAQLSQQKPTKWSLPNKG # VQSRAARDLVEQESVSKPTLENARISLERKSVKYHQLVKGKTAGLTEKQYDALLVDVRWSVLSLRYLGLKXNAQILQNHFPTYQHTEDRITEIINEHS # EENNPLEKHYDPNSEIRDRGAASYTFSTDEETRQARLNELKSRHLETDAIRKEMGAVDVLPGEIEGMQVPEVRSSVKGSEKRKREMEERRKMLDAKRK # KVGTRTVIEEPQPDTVSASTSGTTTSLKRNSQTPGLPQQVDPFSALESATFSKPPPNKGKGKSSSQHDADEFLAQLGNEMLNKKRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g629 ### # start gene g630 6 AUGUSTUS gene 2520217 2520678 0.98 + . g630 6 AUGUSTUS transcript 2520217 2520678 0.98 + . g630.t1 6 AUGUSTUS start_codon 2520217 2520219 . + 0 transcript_id "g630.t1"; gene_id "g630"; 6 AUGUSTUS CDS 2520217 2520327 0.98 + 0 transcript_id "g630.t1"; gene_id "g630"; 6 AUGUSTUS CDS 2520385 2520678 0.99 + 0 transcript_id "g630.t1"; gene_id "g630"; 6 AUGUSTUS stop_codon 2520676 2520678 . + 0 transcript_id "g630.t1"; gene_id "g630"; # protein sequence = [MKNVVAAFKEAATILLSLQNEDSADDILGKIIHLSNEATAHRAQIEQIVKEDELGRFITNHTRPVKANHKKRPGQGLS # PSPAPAIKPRTRSTRPNGEENPEPKYIREATNKKVKVRKKQRSKVDVIASEMTFQM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g630 ### # start gene g631 6 AUGUSTUS gene 2525401 2526685 0.35 - . g631 6 AUGUSTUS transcript 2525401 2526685 0.35 - . g631.t1 6 AUGUSTUS stop_codon 2525401 2525403 . - 0 transcript_id "g631.t1"; gene_id "g631"; 6 AUGUSTUS CDS 2525401 2525929 0.84 - 1 transcript_id "g631.t1"; gene_id "g631"; 6 AUGUSTUS CDS 2526057 2526324 0.72 - 2 transcript_id "g631.t1"; gene_id "g631"; 6 AUGUSTUS CDS 2526369 2526552 0.53 - 0 transcript_id "g631.t1"; gene_id "g631"; 6 AUGUSTUS CDS 2526611 2526685 0.79 - 0 transcript_id "g631.t1"; gene_id "g631"; 6 AUGUSTUS start_codon 2526683 2526685 . - 0 transcript_id "g631.t1"; gene_id "g631"; # protein sequence = [MKWDVEADPTDVDDDDNDEFERLRKELRIFMDSILAIDQDLVTDSVRQYALTTIEAYKNRAEVKWNEAELGIYLVYIF # GEINKSTWSGGKGRAAFCLAPAIPKDVPKDARKSIDYGEYPLTTHGELLFALVESGMSAYPHQTVALQFFETVSRYNDFFKVRKECIVPTLEAMIDTR # TDIPLEFVPNISQSIRDLLAIEVQIPEPDEVEVDLLTDAVKSPTFDAQLYLFETLGILISLLFKNPTEQKGLLLSFVKPLMDDLSSALQGSASSNIKE # LASGGSGLEGPEIVPVVQLHHLMMALGSIAKGFPDYPSPLPDDYILPPVDVFAEIAQAILVCLENTNALKVIRDAVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g631 ### # start gene g632 6 AUGUSTUS gene 2532401 2532916 0.78 - . g632 6 AUGUSTUS transcript 2532401 2532916 0.78 - . g632.t1 6 AUGUSTUS stop_codon 2532401 2532403 . - 0 transcript_id "g632.t1"; gene_id "g632"; 6 AUGUSTUS CDS 2532401 2532916 0.78 - 0 transcript_id "g632.t1"; gene_id "g632"; 6 AUGUSTUS start_codon 2532914 2532916 . - 0 transcript_id "g632.t1"; gene_id "g632"; # protein sequence = [MIGLYSLSNATTPESTSLINSFLASASEVIGTTLPNSLLLTPTATTPAYSFNTSVPASTGAIVQAALATSTYSPIFGA # VTTIPDSATLNLSAIPLIQPLPTVATYTVTDSAGMISTSVSRISIPSIVLGAPPGWSSAGFTVRAPAFTLLLSFVVFPSLLSSLLHCTSLDFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g632 ### # start gene g633 6 AUGUSTUS gene 2537312 2537509 0.96 - . g633 6 AUGUSTUS transcript 2537312 2537509 0.96 - . g633.t1 6 AUGUSTUS stop_codon 2537312 2537314 . - 0 transcript_id "g633.t1"; gene_id "g633"; 6 AUGUSTUS CDS 2537312 2537509 0.96 - 0 transcript_id "g633.t1"; gene_id "g633"; 6 AUGUSTUS start_codon 2537507 2537509 . - 0 transcript_id "g633.t1"; gene_id "g633"; # protein sequence = [MVEHCLLLGESTGSSTTAPTSTSTTSASSSSTGTGTTTSTGASPTGACGSAAAWSSAVNLQQPKY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g633 ### # start gene g634 6 AUGUSTUS gene 2538497 2538815 0.43 - . g634 6 AUGUSTUS transcript 2538497 2538815 0.43 - . g634.t1 6 AUGUSTUS stop_codon 2538497 2538499 . - 0 transcript_id "g634.t1"; gene_id "g634"; 6 AUGUSTUS CDS 2538497 2538508 0.46 - 0 transcript_id "g634.t1"; gene_id "g634"; 6 AUGUSTUS CDS 2538582 2538815 0.62 - 0 transcript_id "g634.t1"; gene_id "g634"; 6 AUGUSTUS start_codon 2538813 2538815 . - 0 transcript_id "g634.t1"; gene_id "g634"; # protein sequence = [MIEPTVSDLDYEYPANTAQGQGFSDLITELRTAFNNLAAQKGDSTPYELTAAVSANASNYQWLNIPQVDAALTYWNLM # DRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g634 ### # start gene g635 6 AUGUSTUS gene 2540916 2541479 0.52 - . g635 6 AUGUSTUS transcript 2540916 2541479 0.52 - . g635.t1 6 AUGUSTUS stop_codon 2540916 2540918 . - 0 transcript_id "g635.t1"; gene_id "g635"; 6 AUGUSTUS CDS 2540916 2541479 0.52 - 0 transcript_id "g635.t1"; gene_id "g635"; 6 AUGUSTUS start_codon 2541477 2541479 . - 0 transcript_id "g635.t1"; gene_id "g635"; # protein sequence = [MCDREVPPVAHSIPGPPYNLLLVERPDALNAFSYGFGPDGGGGIVVYSGFINDILARIPMDTSTPSPPQPQSWWSSFL # GGPPPSRQFVPTEKHTSELAILLAHELAHLLLSHHLETLSSATVIIPGTLSIFADVIRVLIFPVTMFFGPFVNDAVAQLGRMGSGELTKVGEYCTSLK # QEHEADVVSAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g635 ### # start gene g636 6 AUGUSTUS gene 2544524 2545303 0.63 + . g636 6 AUGUSTUS transcript 2544524 2545303 0.63 + . g636.t1 6 AUGUSTUS start_codon 2544524 2544526 . + 0 transcript_id "g636.t1"; gene_id "g636"; 6 AUGUSTUS CDS 2544524 2545303 0.63 + 0 transcript_id "g636.t1"; gene_id "g636"; 6 AUGUSTUS stop_codon 2545301 2545303 . + 0 transcript_id "g636.t1"; gene_id "g636"; # protein sequence = [MAQNAQDLPIVSDTKSSNLNREPTVAGGGTRIASGIVDNGNTELTDEPEQHDITAHPNGSEGWLPATDLPPPSDGATS # PSFQPARSGSVLKKRRPGSIASRASSVRGGVISDGVERNRSTRSVESTRSRRTMLTNADGKPVNGSAFINGAGITGPSATATADDSLHQRMQSADDAL # TGKQKKKIGKVEGWSFAYYQTRSCILKLSTVKQSQRLSKVIKSESKVEKQSMDIAIQELGELQKVQKSLVKVRAFLIPYKDHD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g636 ### # start gene g637 6 AUGUSTUS gene 2548780 2550834 0.59 + . g637 6 AUGUSTUS transcript 2548780 2550834 0.59 + . g637.t1 6 AUGUSTUS start_codon 2548780 2548782 . + 0 transcript_id "g637.t1"; gene_id "g637"; 6 AUGUSTUS CDS 2548780 2550834 0.59 + 0 transcript_id "g637.t1"; gene_id "g637"; 6 AUGUSTUS stop_codon 2550832 2550834 . + 0 transcript_id "g637.t1"; gene_id "g637"; # protein sequence = [MPRHSRDLLRTAHLARLTLAHSRFVLVLQGIAHSSANPPPQESDILIPLSADTHLADSSYRSHNRASSAGSVRELVFP # APLAPGHTAIQTSRSMTDLNVVDAASSSGKHSAHSRAATDSPSALRKDRPGFKRNSSNPSNKQWNGYPSFPASASTPSISISLTDSISKSNKRFSVAS # LRGKASRLPPPPVAESRALREYSSSFGWRRGLNDAKGKWEATIPSYRSTSAISKNIFRESAGYSSEVDDDELFSTPRRRFAGSDMGVSGSESSFSEGT # SSTTSSSTSASNSTSATSISALDSPPPLSQKEQLSGAEVLAINRGRLRSAATDARGMRPRSIGHSQPLSVLNSDFSPPSSAQSRASTLSPGKPRASTS # RRGQLRSIPSAIGLPGVDLGHNNPHALNLATSRIRAPVLRVFVPSSDMTLPYTTDSSDEGGVSRCEDELIRAGLWEHLSVGDVVCNLGYVPPSVSPSQ # SSSDAVWLIFNGYQLIPFTFGAQDSRGILPVYTTPEPNYPGQEAWALPSWGYYEHLFQQELSLRGSPGGRKAGMEQKMNMNTRILISKIPVSPLQLDV # MHQPSLISVAMNIPSPHSPGGIVVVKKWVWTLRVWVGLSSRSNFVSSLTDNGLETEVGPGWEGEWILEGDGTKEGRESLLSCLRRDQQRMDKMEWELV # RDRCGKGKVWLRSVICVF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g637 ### # start gene g638 6 AUGUSTUS gene 2552022 2553098 0.98 - . g638 6 AUGUSTUS transcript 2552022 2553098 0.98 - . g638.t1 6 AUGUSTUS stop_codon 2552022 2552024 . - 0 transcript_id "g638.t1"; gene_id "g638"; 6 AUGUSTUS CDS 2552022 2553098 0.98 - 0 transcript_id "g638.t1"; gene_id "g638"; 6 AUGUSTUS start_codon 2553096 2553098 . - 0 transcript_id "g638.t1"; gene_id "g638"; # protein sequence = [MVSTHPFVCWVRADSSAPRSIFCSSFNSLWYPTIQFTCKIYDPETQKSTWKSINVSNFTCPPTGLDRRSCKADEFSFT # HKSKPDSDYPESYIIQANPAPDLQIFLEVTRPASASGWKIGSGDDGGYSKFGPDASNPEGYVIHRFWPLMKSSGHIVVNGKATPVEGQGMFVHAIQGM # RPNLVAASWNFGNFQSPELGGVSAIQMEFTTIGAYGVKGAGSGGVAVNIGSLVVGGKLVAVTAETKYPGETSDANAPVKCRVTHLKPALDADTGYQKP # CELLFEWAGPSLVADKPGTYSASLNVDVGDIQQPKGLIEKVDVLAEIPKVLKLAVNYVAGTKPYIYMVRVFHRYFFFQISDYAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g638 ### # start gene g639 6 AUGUSTUS gene 2553762 2554088 0.67 - . g639 6 AUGUSTUS transcript 2553762 2554088 0.67 - . g639.t1 6 AUGUSTUS stop_codon 2553762 2553764 . - 0 transcript_id "g639.t1"; gene_id "g639"; 6 AUGUSTUS CDS 2553762 2554088 0.67 - 0 transcript_id "g639.t1"; gene_id "g639"; 6 AUGUSTUS start_codon 2554086 2554088 . - 0 transcript_id "g639.t1"; gene_id "g639"; # protein sequence = [MKWSNHDRLFTYGVCLVGWPSDIPAKNPSTLKADQNKRLLELLNNGTLRFIKNIMLSSDSDQAQAGPVWEGTEPGENE # DEGTIDQSDEMFSWAIQYEDDDPVDVSLSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g639 ### # start gene g640 6 AUGUSTUS gene 2554979 2556370 0.14 + . g640 6 AUGUSTUS transcript 2554979 2556370 0.14 + . g640.t1 6 AUGUSTUS start_codon 2554979 2554981 . + 0 transcript_id "g640.t1"; gene_id "g640"; 6 AUGUSTUS CDS 2554979 2555230 0.6 + 0 transcript_id "g640.t1"; gene_id "g640"; 6 AUGUSTUS CDS 2555309 2555580 0.45 + 0 transcript_id "g640.t1"; gene_id "g640"; 6 AUGUSTUS CDS 2555638 2555774 0.68 + 1 transcript_id "g640.t1"; gene_id "g640"; 6 AUGUSTUS CDS 2556147 2556370 0.55 + 2 transcript_id "g640.t1"; gene_id "g640"; 6 AUGUSTUS stop_codon 2556368 2556370 . + 0 transcript_id "g640.t1"; gene_id "g640"; # protein sequence = [MGRTKTKKQAASKPTIPSSAQPAPATPSIPSLLEKAQSLIVQCDYELAARFIQRILDQQPSNAEAKEMLGVVQLEMGD # IDAAKQTFSSLLPPNSAAPSPPPPSAHLYLAQISDDEPKVALQHYQSAVELLYVQLKGKERAGQNGTSDDEIELKSNIVRALIGQVEIWMDPSYDLCF # EPQAEKTCEDLLETALKVDPDNSEALQSLASVRMSQQRPEDAKASQTHVYIQLFLQLHIHQEHPDKPLLEHTQELIANLEGMGIKPSPPGEGEDEADD # GEWVDDDADSDDGDEDVEMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g640 ### # start gene g641 6 AUGUSTUS gene 2557500 2558399 0.99 + . g641 6 AUGUSTUS transcript 2557500 2558399 0.99 + . g641.t1 6 AUGUSTUS start_codon 2557500 2557502 . + 0 transcript_id "g641.t1"; gene_id "g641"; 6 AUGUSTUS CDS 2557500 2558399 0.99 + 0 transcript_id "g641.t1"; gene_id "g641"; 6 AUGUSTUS stop_codon 2558397 2558399 . + 0 transcript_id "g641.t1"; gene_id "g641"; # protein sequence = [MHYPNYATTPRAFLLSLTSIAPPHALLVAHWGSEGAAALSLPTKEYLQSSAWVEERPPPQPRAARRGRPREDNHLHPD # TSLVSDDVRSVRTGSDFYAGARSNSPSSSAFTARDNSGVYPDFLSAHTTVSEPLTSPNPKSRSRSRGGAGGMSQMSPTATTTTARRYGHDEDELDSSQ # GGTEVTDEDVDDGVVDEVGAQDAFVSGMIYALSRRILPGAPFTPSSHGEADPSASLGENDKNRWRLDECLRQVVYCYSSLGTQKSDNSYLLCRFATEL # AGRKARRRNWVGLADEMERAGWFDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g641 ### # start gene g642 6 AUGUSTUS gene 2566433 2566732 0.61 - . g642 6 AUGUSTUS transcript 2566433 2566732 0.61 - . g642.t1 6 AUGUSTUS stop_codon 2566433 2566435 . - 0 transcript_id "g642.t1"; gene_id "g642"; 6 AUGUSTUS CDS 2566433 2566732 0.61 - 0 transcript_id "g642.t1"; gene_id "g642"; 6 AUGUSTUS start_codon 2566730 2566732 . - 0 transcript_id "g642.t1"; gene_id "g642"; # protein sequence = [MKKKKESKNAKAAMESGLMTLPTPSLANGGSPAPTGFASVGSNGSPGPRAGFSRISSTVETTSQNGTGTPSERSKVAF # GFGTKRKANEEATGSPPAKRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g642 ### # start gene g643 6 AUGUSTUS gene 2567005 2569263 0.16 - . g643 6 AUGUSTUS transcript 2567005 2569263 0.16 - . g643.t1 6 AUGUSTUS stop_codon 2567005 2567007 . - 0 transcript_id "g643.t1"; gene_id "g643"; 6 AUGUSTUS CDS 2567005 2567789 0.86 - 2 transcript_id "g643.t1"; gene_id "g643"; 6 AUGUSTUS CDS 2567843 2568056 0.98 - 0 transcript_id "g643.t1"; gene_id "g643"; 6 AUGUSTUS CDS 2568097 2568330 0.68 - 0 transcript_id "g643.t1"; gene_id "g643"; 6 AUGUSTUS CDS 2568434 2568570 0.57 - 2 transcript_id "g643.t1"; gene_id "g643"; 6 AUGUSTUS CDS 2568775 2568953 0.59 - 1 transcript_id "g643.t1"; gene_id "g643"; 6 AUGUSTUS CDS 2569103 2569263 0.43 - 0 transcript_id "g643.t1"; gene_id "g643"; 6 AUGUSTUS start_codon 2569261 2569263 . - 0 transcript_id "g643.t1"; gene_id "g643"; # protein sequence = [MEESISLEETNRIRVSIGLKPITDDSNPVDDEEKQAEDNYAKRREHEAKERETKNRRELNASLKGPTLGDADDDTDNV # LKWIKKNKKKEKELAKKRLQEFDRMDKAIQEDYTEQDELQNIEMAEDERQRKNQELKTKKHDYTGYDDDEFVEGNVGMKRAGFRLGSSVVSKKVTNKP # KIETTTSLNKTLLSIDYKSKFSNLRLNHSRSYKIIRESGNYRLSKGGGYRIQKTQGDLNLLTKKKRPNRRVPAEAELAPEDEMDIDPTPVPRVPDLDV # NFVDDDELQAALARSRRAKLAKPKKVTPEELARRVAEEREEQEKKASTKAEDGDIKMGDDEEAGGLVFDDTSEFVRAVGNNPITVKKEPKEKTSPSAR # EFSRPHSLSRDVSMAPGDEVLHEIEAGEAVKDEDDDDEDDMEILNMIEAAIKAEESEQHNAADNAVGTSSEQNFKSGMASTLNILRQQGILAAPSSDQ # KEREHTQLQRDLWLADQRRRVAQRELERLQSRGGNKDQATREYENRLREQQEARENLETFKHYKPDVNIVYYDEHGRALTPKEAWKALSHKFHGRVLG # R] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g643 ### # start gene g644 6 AUGUSTUS gene 2575198 2575521 0.85 - . g644 6 AUGUSTUS transcript 2575198 2575521 0.85 - . g644.t1 6 AUGUSTUS stop_codon 2575198 2575200 . - 0 transcript_id "g644.t1"; gene_id "g644"; 6 AUGUSTUS CDS 2575198 2575521 0.85 - 0 transcript_id "g644.t1"; gene_id "g644"; 6 AUGUSTUS start_codon 2575519 2575521 . - 0 transcript_id "g644.t1"; gene_id "g644"; # protein sequence = [MEDPAAYAGIIGGDFNAIDDDAEEQIRDLRLSDPGEPSQFADAKEFHTWGFHETKPLKFPTCRMDKIVFTPHGEVTLD # PPVIFGQNAKTEEEEWVSDHYGLLTTFSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g644 ### # start gene g645 6 AUGUSTUS gene 2578992 2580485 0.31 + . g645 6 AUGUSTUS transcript 2578992 2580485 0.31 + . g645.t1 6 AUGUSTUS start_codon 2578992 2578994 . + 0 transcript_id "g645.t1"; gene_id "g645"; 6 AUGUSTUS CDS 2578992 2579565 0.96 + 0 transcript_id "g645.t1"; gene_id "g645"; 6 AUGUSTUS CDS 2579662 2580173 0.33 + 2 transcript_id "g645.t1"; gene_id "g645"; 6 AUGUSTUS CDS 2580249 2580485 0.79 + 0 transcript_id "g645.t1"; gene_id "g645"; 6 AUGUSTUS stop_codon 2580483 2580485 . + 0 transcript_id "g645.t1"; gene_id "g645"; # protein sequence = [MEHPEHEDQVDHDQEQFITDEDVLAEVPDDGDQLMDEDYEDEEDDTVGELVPGSSGSVEDNSVQSFPNHQSSVFAVAV # HPTQPLAVSGGEDDLGYIWDITDGEVIVKLTGHSDSVVCVGWSYDGEIVSTGGMDGKIRLWRRVGKENYRSWEFLTELQGPDEVMVSRPPIPSPFTLS # SHSQYKVLEMAPKRKLPTGNTMQVFAGHTGPVQCGTFTPDGMFYLYLTVRSSFIQCILTGKRIVSACGDGTLILWDPRSPTPVFKLTAQDARFDLDGI # TSLGVNPSSTLAVVGGAAGGVRVVSLTKGEVVSALGGHTEGESVEAVEFIDLTGAGSGPGVVATGATDGKICLWDLSTMRLRSTVEHSDAVTTLLAVP # PPNNHLLISGSADKTLRTWDARTGTLIKAHRGHQGPILGASLGLNGSVVVTAGDDGVSLVFTTEPEEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g645 ### # start gene g646 6 AUGUSTUS gene 2582596 2583222 0.71 + . g646 6 AUGUSTUS transcript 2582596 2583222 0.71 + . g646.t1 6 AUGUSTUS start_codon 2582596 2582598 . + 0 transcript_id "g646.t1"; gene_id "g646"; 6 AUGUSTUS CDS 2582596 2583222 0.71 + 0 transcript_id "g646.t1"; gene_id "g646"; 6 AUGUSTUS stop_codon 2583220 2583222 . + 0 transcript_id "g646.t1"; gene_id "g646"; # protein sequence = [MCFEWWSSEWCQVCKNINIREPLRIIDHMNFTSCFKVDQTKGLINLSGTNRALNLNQTTPATGPAGSASHIIFSEDNT # QLIASVKGVPPTPGFLAVWDVATDGSLSPVFKTITPSQGGLLPFSMTVIEGKNALLATDAGVGFDIFDLSTSGGNASSVVPIDGQSATCWSSFSNQTG # NFYLTDIGTSMVTEVNVDDNLKGSIVKVRMPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g646 ### # start gene g647 6 AUGUSTUS gene 2585074 2585442 0.56 - . g647 6 AUGUSTUS transcript 2585074 2585442 0.56 - . g647.t1 6 AUGUSTUS stop_codon 2585074 2585076 . - 0 transcript_id "g647.t1"; gene_id "g647"; 6 AUGUSTUS CDS 2585074 2585442 0.56 - 0 transcript_id "g647.t1"; gene_id "g647"; 6 AUGUSTUS start_codon 2585440 2585442 . - 0 transcript_id "g647.t1"; gene_id "g647"; # protein sequence = [MSRKALIKKLGELMKFRQGLNLNRENFSDIPDFYWTEPELERERYNLFSDNDYNAINLSGYFKSMSDALEIKLRTDLV # NDKITYAAEAQSVLRQLLTEVGISVQILFLYVYLIMLFISVVLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g647 ### # start gene g648 6 AUGUSTUS gene 2592256 2594227 0.64 - . g648 6 AUGUSTUS transcript 2592256 2594227 0.64 - . g648.t1 6 AUGUSTUS stop_codon 2592256 2592258 . - 0 transcript_id "g648.t1"; gene_id "g648"; 6 AUGUSTUS CDS 2592256 2593056 0.92 - 0 transcript_id "g648.t1"; gene_id "g648"; 6 AUGUSTUS CDS 2593694 2594227 0.72 - 0 transcript_id "g648.t1"; gene_id "g648"; 6 AUGUSTUS start_codon 2594225 2594227 . - 0 transcript_id "g648.t1"; gene_id "g648"; # protein sequence = [MSRRAVTPSLEASQQSHIDDLVQRNRTHEQTIRKLKDELAQEKNRAKTVVQDIQTKLHAEKREWREACDTLQSCHRIH # QLRLHVELEKQRSGQLAEQDLLRKEKVAALQREFAITKFQIQESLLERQILELEDKVAELEQLRDEERQASRARILELAAHVEMQEKRLKASEEARAN # LEDSPVESEEEVARTVSQAGPLSPVPIPAAETSQSKIASKKSSAKPSSRRMRKASASAASSSSYSPLDVNADAHDIPATAHAKGKRKHTADSDSGTEI # EQPQRTTRSRLKPNTKEIAPANDLEIEIIPQEDIKGRKGKRKAFPLHAINEEQVEGDGAQSAVPAKRRKRNDDPERPKPKVRGVGKNTLPSRAESTAS # TATVDPESGGSSSHKPGTTKKRKINLFQSSSKMDLSNLDFGSQVRSVIAMFNHSENPYLRFREAGSLQCSRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g648 ### # start gene g649 6 AUGUSTUS gene 2594391 2595251 0.59 + . g649 6 AUGUSTUS transcript 2594391 2595251 0.59 + . g649.t1 6 AUGUSTUS start_codon 2594391 2594393 . + 0 transcript_id "g649.t1"; gene_id "g649"; 6 AUGUSTUS CDS 2594391 2594453 0.64 + 0 transcript_id "g649.t1"; gene_id "g649"; 6 AUGUSTUS CDS 2594542 2594567 0.92 + 0 transcript_id "g649.t1"; gene_id "g649"; 6 AUGUSTUS CDS 2594672 2595251 0.94 + 1 transcript_id "g649.t1"; gene_id "g649"; 6 AUGUSTUS stop_codon 2595249 2595251 . + 0 transcript_id "g649.t1"; gene_id "g649"; # protein sequence = [MGAKLTAEVEAQADSAGVRTDESASEWNSLFHVEEYSDLYYDPTILRESAQKQYEEENGPSEEQQERQGQTLNIQRDN # SFHLSNPHNPPPNRHSGPMGGGPPPINYPYPNSPSVMRGPGPGQGFPPGMPSNQYGRHDASPARMQMHMSGGMGGVVGGGMGMGGMGNMGGMGGGIGS # IGGNMDFGHQNPAMAMGGGGMGGMPSPGMMAGRRMTRGMTEEYGMH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g649 ### # start gene g650 6 AUGUSTUS gene 2595508 2596131 0.9 - . g650 6 AUGUSTUS transcript 2595508 2596131 0.9 - . g650.t1 6 AUGUSTUS stop_codon 2595508 2595510 . - 0 transcript_id "g650.t1"; gene_id "g650"; 6 AUGUSTUS CDS 2595508 2596131 0.9 - 0 transcript_id "g650.t1"; gene_id "g650"; 6 AUGUSTUS start_codon 2596129 2596131 . - 0 transcript_id "g650.t1"; gene_id "g650"; # protein sequence = [MRWDYGNVQTGTCEETIDGGNHFRYWIQNGSAADSNAVFVAASYELPASSTSRTSREVICLTHEAPSCRLGNHDIVVN # GYNFGRDWIVGNITGSTIPTTSLTNSSSYSGNTSSNGFSLSTTVQYVSGLLPNTSVGINHNLTVATDGENAVDGFVAVLTVKITATNSSASAAPSATS # NSSSNSAAPIMLTSCLPLLLLPLVVLTSYPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g650 ### # start gene g651 6 AUGUSTUS gene 2599649 2601904 0.78 - . g651 6 AUGUSTUS transcript 2599649 2601904 0.78 - . g651.t1 6 AUGUSTUS stop_codon 2599649 2599651 . - 0 transcript_id "g651.t1"; gene_id "g651"; 6 AUGUSTUS CDS 2599649 2601904 0.78 - 0 transcript_id "g651.t1"; gene_id "g651"; 6 AUGUSTUS start_codon 2601902 2601904 . - 0 transcript_id "g651.t1"; gene_id "g651"; # protein sequence = [MQSDANVFNVEEEESLFGSPPPSPRIGRSPSPVLALPSRSGSIVKLQNVGTIALPGSHYISELPVNPLVLPSSFSTQA # AAKPLAPFQISAGHFGGPTSPHHSSSSSTPCSSRASSQGPLSGQSKGKHGRRRREDESRVVRVPPPEIPLPDPTGPPPANWLRSQSALLGHAGLIGGV # KTSTLSNRHFRGSTAKNPIVIDDNQHSNQQQHHHPSPKRSRPAPRYQLPLCLDLPAPSIQEIVRILIKQREIFPVLQNILKLSRNGFPGFIKDTNNSP # SPGPVPKKRKLNKVPAGAVDWDVPYPFQPGEGPEAYSATWEQTRGKQLVSQLVSLIKAASRKAAIRKYMEQDRQIELQTTMQDHNLMKEWEHAMPKVE # GHYRHETTLYGLPDMPSQDILADASNNPVKSSDLPVRSSPAPESSPFDELLASLLTVSPKSGDSNEAATSPSNLGSLFANTGAQESTPELDQSVIDNW # MSIFQTYQVPPSLEETATYFSDSSSLAPQIAGPSSIPDLPLDLGPWARVSNGPGDGNHLSHSVVSLYPTSNIGGQPQTDAHSSDSTSFDLKSLAPSMN # PWDTELVTPMLPTAGYLDAFNGLIPTSSPKEYGEPYFSSGMMEEGIGGSGGHLPMGLMDCPQGMWWRTISETVRTHHNKELQGIDQPAKHPPNFSAVP # LSALFPTLARNMPPPPTITGTSSVFTPPAVRPYNSSGRTINKVDLLSRARERRAQLADEILKTRTQLWETTIEHGVLTRLAKLYT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g651 ### # start gene g652 6 AUGUSTUS gene 2602670 2605793 0.55 + . g652 6 AUGUSTUS transcript 2602670 2605793 0.55 + . g652.t1 6 AUGUSTUS start_codon 2602670 2602672 . + 0 transcript_id "g652.t1"; gene_id "g652"; 6 AUGUSTUS CDS 2602670 2603323 0.55 + 0 transcript_id "g652.t1"; gene_id "g652"; 6 AUGUSTUS CDS 2603493 2605793 1 + 0 transcript_id "g652.t1"; gene_id "g652"; 6 AUGUSTUS stop_codon 2605791 2605793 . + 0 transcript_id "g652.t1"; gene_id "g652"; # protein sequence = [MLKFDRVEDADQVYRTGVKRHARPIERLKARYTDFRKRHGKKPVISQDISKTNTAAACSPKQLSSAASRYATMLAPPQ # PGKPPEKLRFDMTLLYTEKTGEFCFEEARTRSMGLLRKEWPVLPVESLAHSARSSSLTVLRPGEGRFGKRKSMLAGEPTVTINTREALEDVFGMYNSP # ERTIRMGSKHAPVKKIEPVAMPRMTTSPPTTLGDGIHKSAGLFTPFVDLENKTPTHKSRSAFAEKEAAPHQNENLLQDSKKFTKRDNTSVESIFSQKV # FIPESEIQPLPLREAHTEDHGQPRPKTILTHERAKSDHDVGKASHPVAFRPFVDPGPETSFKVFSRPSEGKSIFTPKLSTMKLSVPPAKQPTFTPYKD # PAEDNIQIEPLTEKKHQSHVDYDEPEYDEEFDQGNTPHQQEQQDAIDLDQYPEEDDNDYSDDFIDEECQEDVVEPLREELGEMYDGQEVDYHDVPFGG # RFGQFSVMTPITERTFEYTSTSHSTFNTPSILSKHAPVIEEEQDSQLEAAQLVPDGADEFEHEDEAGGLHDIHPLRLPSEASISTLTQSTSKLSLVDT # LTLSSNFKPSNPCNPFDPPIFQALLSRLNADSQYYDLTGTYHNGYDELQKYAKKNRKTSSSSGGGDAVHSLTLNGQKFVVSEKLGEGGFGAVFKARDC # GALSDCDSDFEDEDEMEGDEASMVALKVVKPRNIWEYHVLRRLHSALPPANRRSIVFPHALYAFRDESYLVLDYCPQGTLLDIVNTAESAGVSQQGAC # LDELLVMFFTIELLRLLEIMHDIGFIHGDLKIDNCLLRLEEVPGGPSSWSSAYRPSGEGGWSYKGLKVVDFGRTIDTRLFPANQQFIADWETDERDCI # EIQQGKPWTFQTDYFGLAGIIYCMFFGKYIQASAIGSSTSPDGKVKFRLTTPLKRYWQTNLWERLFHLLLNPVDVRSHGHMPLSEELGSIRTDMEAWL # QANCNRTTGTLKGLLKKVEMSCLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g652 ### # start gene g653 6 AUGUSTUS gene 2607123 2608903 0.59 - . g653 6 AUGUSTUS transcript 2607123 2608903 0.59 - . g653.t1 6 AUGUSTUS stop_codon 2607123 2607125 . - 0 transcript_id "g653.t1"; gene_id "g653"; 6 AUGUSTUS CDS 2607123 2607911 0.83 - 0 transcript_id "g653.t1"; gene_id "g653"; 6 AUGUSTUS CDS 2607962 2608109 0.87 - 1 transcript_id "g653.t1"; gene_id "g653"; 6 AUGUSTUS CDS 2608211 2608259 0.99 - 2 transcript_id "g653.t1"; gene_id "g653"; 6 AUGUSTUS CDS 2608331 2608630 0.97 - 2 transcript_id "g653.t1"; gene_id "g653"; 6 AUGUSTUS CDS 2608705 2608903 0.71 - 0 transcript_id "g653.t1"; gene_id "g653"; 6 AUGUSTUS start_codon 2608901 2608903 . - 0 transcript_id "g653.t1"; gene_id "g653"; # protein sequence = [MTKTSQRYEGVVFSTNGEGDTTGVTLKDVKELTNPGAPLKDQLFIASTNIENWSSGPADAKFTNGDNISQKKTGGGGE # KELQAWQAPPDAPATSEGTQFARGDDVTFGPGSNSNASWDQFTTNEKLFGVKATYDEDAYTTKLDRSAPEYKERAREAQKIADEILGVQERNQAHDDS # GINEEDKKPGLPNATKTEIPKVSVNGPDGATISSTSQSPASSSKNPSPAPNANANKPPADALPALREFVANEKQRLTEKRQALAKSEMDKRMADLVKF # SQSFKVLLSRLQFPYLNYQQLNKPIPDDLVPILAKDEDKQKQIREKSNKDANSSQARNIGSSVSTHSVPARGPHITTAKVVEAGRKTAATATSTTKAT # TQAAGVAASATNKAEATKPTKPMMFIQPIPPFKGSKRQSLQPSPNANGVSNGANAAQVSGATKAPVPNAPANRLNAGLNVKASTFNPRAVAFTPVGFF # WSLSTPVVVSHSVRFSSGRSFSWT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g653 ### # start gene g654 6 AUGUSTUS gene 2612014 2613336 0.11 + . g654 6 AUGUSTUS transcript 2612014 2613336 0.11 + . g654.t1 6 AUGUSTUS start_codon 2612014 2612016 . + 0 transcript_id "g654.t1"; gene_id "g654"; 6 AUGUSTUS CDS 2612014 2612295 0.17 + 0 transcript_id "g654.t1"; gene_id "g654"; 6 AUGUSTUS CDS 2612385 2612597 0.77 + 0 transcript_id "g654.t1"; gene_id "g654"; 6 AUGUSTUS CDS 2612666 2612844 0.94 + 0 transcript_id "g654.t1"; gene_id "g654"; 6 AUGUSTUS CDS 2612913 2613336 0.72 + 1 transcript_id "g654.t1"; gene_id "g654"; 6 AUGUSTUS stop_codon 2613334 2613336 . + 0 transcript_id "g654.t1"; gene_id "g654"; # protein sequence = [MENFTDESSDLPVFPELMIRQCAEWPEGEPNSSVQHTFELPIDSELLFLVARGPSINGNINITQSDEEGDSAVVSIRT # HYDDETLLDSIKLCDVSSHPHPHRHMHNIYFDINVAFPKHSEKSPLVVSDFRTEMHGIFGHQVANLSEAIVFNSVSLTGAYKPVKVNSLQAHSVRIES # PHSPIEGNFTVRKSLRLSTANARINITANLLNDETDEDMTELIMNTANSPIEASVSLFSVDAGEITSSGGAFRVRARNANSPVKVAFPTAPINSTVVL # DAKTAVAPLDVQMHGTFEGAFTVHTTPFDKRVVVAEEGLDPEGKGRKRNLIFDRYTGGISEGTVFWGQGEPGKQRGSVRLDTVSGQVSLKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g654 ### # start gene g655 6 AUGUSTUS gene 2614121 2614939 0.54 - . g655 6 AUGUSTUS transcript 2614121 2614939 0.54 - . g655.t1 6 AUGUSTUS stop_codon 2614121 2614123 . - 0 transcript_id "g655.t1"; gene_id "g655"; 6 AUGUSTUS CDS 2614121 2614939 0.54 - 0 transcript_id "g655.t1"; gene_id "g655"; 6 AUGUSTUS start_codon 2614937 2614939 . - 0 transcript_id "g655.t1"; gene_id "g655"; # protein sequence = [MIVDKSKEPEDAPPAYAAINSGSSGSTSFNDNKLPHSPLPVSEPISPTPSSFSSKGKGKVPAVSSWWSFGTSQTAREI # RTTVLGIVRDLVKVKSGNAVAAQSILESCAEACSGYSLSLSSLLQEKSIESHTPLYWAIINRPPDKSDDAINGTSDLLTTLLSYTAPLSPDILVEVRQ # ACLITDDQLLFQRLRLSPEFASLSGTDEMLLGEVMIPDDVTVKNMLGDDGAFAVDFRIPHFQKRMRVSNEVGVEFIARGTMIIYSSSNFDTNLSPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g655 ### # start gene g656 6 AUGUSTUS gene 2622019 2622831 1 + . g656 6 AUGUSTUS transcript 2622019 2622831 1 + . g656.t1 6 AUGUSTUS start_codon 2622019 2622021 . + 0 transcript_id "g656.t1"; gene_id "g656"; 6 AUGUSTUS CDS 2622019 2622831 1 + 0 transcript_id "g656.t1"; gene_id "g656"; 6 AUGUSTUS stop_codon 2622829 2622831 . + 0 transcript_id "g656.t1"; gene_id "g656"; # protein sequence = [MNQSTSPESLHFISYPLSENDNFSDSDWLEIASNRESDTESVSSNNGAASSSHSRRSSISTGSSRSGDVEAWEGFLEE # ITDEVEAKINEFNPTNPDNEQSTSPFIDLDEDYLEERRVRDGLNQSLTSTLGTSRISSHPSTVHNSLRDLRLSFPDPLSSSHDEMNRSYDRVSSSEAA # SATLTEGGENDELGSSQVDMPEITLIRDPGLPPTPEAPGQNALQSIQIHSTVRSSNLQVVLYGHLSSGVLSTSYSAKLSSEEKSLESTDQKQNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g656 ### # start gene g657 6 AUGUSTUS gene 2622890 2624206 0.34 + . g657 6 AUGUSTUS transcript 2622890 2624206 0.34 + . g657.t1 6 AUGUSTUS start_codon 2622890 2622892 . + 0 transcript_id "g657.t1"; gene_id "g657"; 6 AUGUSTUS CDS 2622890 2623266 0.43 + 0 transcript_id "g657.t1"; gene_id "g657"; 6 AUGUSTUS CDS 2623525 2624206 0.44 + 1 transcript_id "g657.t1"; gene_id "g657"; 6 AUGUSTUS stop_codon 2624204 2624206 . + 0 transcript_id "g657.t1"; gene_id "g657"; # protein sequence = [MTSLSLQPRSDYNPDRPSLGIVFHPLADATIAEHTAYLPVVVGNNDDSFEKEFQEAQVAWASYHIPPHRVVRLEGSSS # SSMFAAEDVDKLDPYNTHQAIQRIIRQEKPASWVGLFEQFNTVHAVTLRSVISTSRASGPSTTAFPLSSRAEEQHAGPVTPLEASLMKSSKEVMIRPS # TSISAQASDISSFLDPVTSTSAPQRPPSAVATRLVDSLSEIVVTSMKALIEVVEHDLKDLMVAIDDLMLALHRSTSIVVEQSKSAAQSVWEQLDYRNA # RAKDRARELKDKGMQLMSYAGNHILGRTTDAKQTANFFKDLITSRRRQLKDKLKHGAQRARHRARHHKSGIKSHRMDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g657 ### # start gene g658 6 AUGUSTUS gene 2626735 2627382 0.25 - . g658 6 AUGUSTUS transcript 2626735 2627382 0.25 - . g658.t1 6 AUGUSTUS stop_codon 2626735 2626737 . - 0 transcript_id "g658.t1"; gene_id "g658"; 6 AUGUSTUS CDS 2626735 2627382 0.25 - 0 transcript_id "g658.t1"; gene_id "g658"; 6 AUGUSTUS start_codon 2627380 2627382 . - 0 transcript_id "g658.t1"; gene_id "g658"; # protein sequence = [MTGSSYSYLQGQNSSALGQMSYNPVQQQLQSPGYNSIAQFDPYSSVGGQGGNPSSAQHQPPSFQSPTSPISPTTPITT # SRSASGAIHPREYIKTHKAEVESWDPYAWKQLLNAFDDLKEAWASRKNEIDGRAQQLLMQMQYSGGYHPQMQQEAERLRAVCGSSPRCVSISSVTSQL # SKEADINHGVPFGYLASWANSDHNNHVYRLCGRFIFPNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g658 ### # start gene g659 6 AUGUSTUS gene 2631736 2632467 0.66 - . g659 6 AUGUSTUS transcript 2631736 2632467 0.66 - . g659.t1 6 AUGUSTUS stop_codon 2631736 2631738 . - 0 transcript_id "g659.t1"; gene_id "g659"; 6 AUGUSTUS CDS 2631736 2631972 0.99 - 0 transcript_id "g659.t1"; gene_id "g659"; 6 AUGUSTUS CDS 2632023 2632150 0.94 - 2 transcript_id "g659.t1"; gene_id "g659"; 6 AUGUSTUS CDS 2632206 2632467 0.71 - 0 transcript_id "g659.t1"; gene_id "g659"; 6 AUGUSTUS start_codon 2632465 2632467 . - 0 transcript_id "g659.t1"; gene_id "g659"; # protein sequence = [MCDQLVNSCGADATAKATCASAAAAADTATAKTGAQADKFNAVFGIQTNFAAVPVVSDQGVTLGVGEYLFTYLLSIPT # GSDFDAHFLYGSGTSAAASATSAVAVASAASATTTSIAATVADTATSSDPCPATVTVTVTAADAASTSAAATDAATDATSAADVATTSVAVASATAAA # SSSAAVATSTASAADIGNFGRAHQRSSIFFST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g659 ### # start gene g660 6 AUGUSTUS gene 2634043 2634528 0.75 + . g660 6 AUGUSTUS transcript 2634043 2634528 0.75 + . g660.t1 6 AUGUSTUS start_codon 2634043 2634045 . + 0 transcript_id "g660.t1"; gene_id "g660"; 6 AUGUSTUS CDS 2634043 2634528 0.75 + 0 transcript_id "g660.t1"; gene_id "g660"; 6 AUGUSTUS stop_codon 2634526 2634528 . + 0 transcript_id "g660.t1"; gene_id "g660"; # protein sequence = [MHCIPVTWPTARLKDTPRELFGRLMQCRTGHAYIGEYYSQFVPNENVNCPCGEELQTREHILRACPRYEDHRQILQKA # SEDICLKDILGTSEGIEALTEFLDESGAFTRTGRPRTTPTEPSYTPLGIWEEITFHEMEEENGTLEADWREETVDSTNKGTEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g660 ### # start gene g661 6 AUGUSTUS gene 2635814 2636158 0.79 - . g661 6 AUGUSTUS transcript 2635814 2636158 0.79 - . g661.t1 6 AUGUSTUS stop_codon 2635814 2635816 . - 0 transcript_id "g661.t1"; gene_id "g661"; 6 AUGUSTUS CDS 2635814 2636158 0.79 - 0 transcript_id "g661.t1"; gene_id "g661"; 6 AUGUSTUS start_codon 2636156 2636158 . - 0 transcript_id "g661.t1"; gene_id "g661"; # protein sequence = [MFSRAISAARPAATRALRSNSKPLNLRAFSVTPRASSGGHGPAPPGLFGPGAKPGEVPGIAEQSTGLERLQYLGDAEG # IEVFDTAPLDSSRIGTKKDPILVPSPVGFQSFSASL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g661 ### # start gene g662 6 AUGUSTUS gene 2643387 2644184 1 - . g662 6 AUGUSTUS transcript 2643387 2644184 1 - . g662.t1 6 AUGUSTUS stop_codon 2643387 2643389 . - 0 transcript_id "g662.t1"; gene_id "g662"; 6 AUGUSTUS CDS 2643387 2644184 1 - 0 transcript_id "g662.t1"; gene_id "g662"; 6 AUGUSTUS start_codon 2644182 2644184 . - 0 transcript_id "g662.t1"; gene_id "g662"; # protein sequence = [MTDRTETIQQLVQENFEALDFIPLRIENAFDPAWWDRVGGKLTSDMNADLINDGALDPLQIFIVSISDSDLFVSTVFD # SPASDPVQRLRSYISALPTHTAIDSTIHTLIRILLLYTARSTRSSHLLLGTSLTSLSINLISSIAQGGGFSVREEAQEEWKSDSMETVRLIRPLQEIT # MKECSMWAWWNNLRVLGKQRHPGVKQGIGALTKGAPSSMRYENFISFKSSDFIVGLERDYPSTVSTIARTCAKLAPRVGALGSCILCER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g662 ### # start gene g663 6 AUGUSTUS gene 2645333 2645698 0.98 + . g663 6 AUGUSTUS transcript 2645333 2645698 0.98 + . g663.t1 6 AUGUSTUS start_codon 2645333 2645335 . + 0 transcript_id "g663.t1"; gene_id "g663"; 6 AUGUSTUS CDS 2645333 2645698 0.98 + 0 transcript_id "g663.t1"; gene_id "g663"; 6 AUGUSTUS stop_codon 2645696 2645698 . + 0 transcript_id "g663.t1"; gene_id "g663"; # protein sequence = [MYFDIVRKEYSRCSIEIHPLQPLIDIPAYDVALDDKSLVPADPPPLPPTSEHLPAIPAQTYIYNDLENLEADLWSFED # FIKNNAWKWYGDASNDNPDITEVDRRRELGTTSTVEGTIEVLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g663 ### # start gene g664 6 AUGUSTUS gene 2646068 2647588 0.98 - . g664 6 AUGUSTUS transcript 2646068 2647588 0.98 - . g664.t1 6 AUGUSTUS stop_codon 2646068 2646070 . - 0 transcript_id "g664.t1"; gene_id "g664"; 6 AUGUSTUS CDS 2646068 2647588 0.98 - 0 transcript_id "g664.t1"; gene_id "g664"; 6 AUGUSTUS start_codon 2647586 2647588 . - 0 transcript_id "g664.t1"; gene_id "g664"; # protein sequence = [MISYLENHRKGFQKAAGIAGGLYLVRGYIHSRLEEVKEKIELERLAQDILHRRYEQTQEDVGYTVMALLSNLGEQILE # EMDVEAVIGELQMMSNKSFLEGSESMSASVSSSISSSSALSTSGLQGWVDAAGAQAHSPTGYSSSEETSSVTSGSFISNISTIESEPNSSSASVASLP # STSSDPTSSRSKAQLWNSVKLLTFTRTLTTIYSISLLTLLTLTQLTILARVKYIRAIKHMSSEEDQEAALEGELGMSNMLFMALKARFGIPQQPLLKT # FLPSVHELLFAPADDEDLPEHPLSNIAFETLSADYLTLSYYLLHIGWKNLSTHIQSAVEEVLEGVSLKTRLSESDVHRLLKDMMQRVALEGLTASMLP # NTEDMVRSVLVLGGRDDHDPYSPSQGAALSTSMDDLLSETRTLFSSYRFTEVLDTCVDWAVDSLMKSFEGEGRVFASGDAEAPRVRLASILPPLASWS # RTSLLALPSELVDGILAKDETRTFSAWIWAKFELEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g664 ### # start gene g665 6 AUGUSTUS gene 2648304 2650428 0.46 - . g665 6 AUGUSTUS transcript 2648304 2650428 0.46 - . g665.t1 6 AUGUSTUS stop_codon 2648304 2648306 . - 0 transcript_id "g665.t1"; gene_id "g665"; 6 AUGUSTUS CDS 2648304 2648991 0.48 - 1 transcript_id "g665.t1"; gene_id "g665"; 6 AUGUSTUS CDS 2650145 2650428 0.47 - 0 transcript_id "g665.t1"; gene_id "g665"; 6 AUGUSTUS start_codon 2650426 2650428 . - 0 transcript_id "g665.t1"; gene_id "g665"; # protein sequence = [MYSTEGKIKEPNLAAEAGQGLMSAVSSYARGDMGGVFKSAMGLVKVASGNTKKTEEYARRTKTSAADAVRCLSFSCQR # DTDQIHSLSRSHGADARALLAKVSYNPSSDVLVSVGDIVAKGPHSGSMQVLEFMASHNITAVRGNHDQKVIEWRTWLEWIHSLPGGSNWLFQVQDKWE # KAQERGADDVEEWVEEQVRHDKKHSKWWKKIPEEWQLFGDHYRIAEGMTQEQYSYMIQRPVRIHVPHAHTFIAHAGILASDPNYKRKDKRQPLSHIPI # LYEAETRKEDTSFLRRLQELAILNEIPQNLIPWVTLNMRGVLDDHTVTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g665 ### # start gene g666 6 AUGUSTUS gene 2656378 2657852 0.8 - . g666 6 AUGUSTUS transcript 2656378 2657852 0.8 - . g666.t1 6 AUGUSTUS stop_codon 2656378 2656380 . - 0 transcript_id "g666.t1"; gene_id "g666"; 6 AUGUSTUS CDS 2656378 2657275 0.8 - 1 transcript_id "g666.t1"; gene_id "g666"; 6 AUGUSTUS CDS 2657344 2657852 0.8 - 0 transcript_id "g666.t1"; gene_id "g666"; 6 AUGUSTUS start_codon 2657850 2657852 . - 0 transcript_id "g666.t1"; gene_id "g666"; # protein sequence = [MVYIPGSPVTTLGGLLKEAEKEVQEEQFRAVSPRISKSGSLMPEDNALVGMGLGERASYRTPLPAKYGLAIRPQSTLV # HEIRDVEDDHQNDQQLAYKEWTKEEWRILDACFTDERIDLASRSSSNSISSPLNDGHEDVPLAEVDFVDVDVVVQRFIVEMGGDDITNARGCLRARAK # AIQKKQRAGHVAPPTTPYTPRTISKSREPSSSMEVPDFTPLNRRPFPLRNPVLLPPPGGSTAPFSSIPDDVVEEPRRHKVPSTLLAPRYSHLLHEAVA # ISRELASEEPSLTNSEMGTLNYLSFPTVKTSSLPKAGLGRLFSYIPGFLKTPATSTRKAHDSKPGLPLPPAEIIDKHRGPIVTPARPPAPKSKPPKEL # VNLHHQPVPDKKETSKIPRKVPQRMVQLNQVGLPKERQEPIVRPRRSSGGSVKDLIKTFESFDDNAQHTASVRNIGNWKKGLPGSEKSCSKPLWKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g666 ### # start gene g667 6 AUGUSTUS gene 2658075 2660254 0.56 - . g667 6 AUGUSTUS transcript 2658075 2660254 0.56 - . g667.t1 6 AUGUSTUS stop_codon 2658075 2658077 . - 0 transcript_id "g667.t1"; gene_id "g667"; 6 AUGUSTUS CDS 2658075 2659169 0.62 - 0 transcript_id "g667.t1"; gene_id "g667"; 6 AUGUSTUS CDS 2659223 2660254 0.56 - 0 transcript_id "g667.t1"; gene_id "g667"; 6 AUGUSTUS start_codon 2660252 2660254 . - 0 transcript_id "g667.t1"; gene_id "g667"; # protein sequence = [MAATHSFVGSSYTTIHNGDLATDAQATPNPKPRKQSRKFNRAHVRTVSNQSDTSIQTTPSPTRGSGIATSTLTEQELL # PLPSSLTGHSVQATPSRKRRQSKLMRSPHTFNPNADYIPTFRTDSDEESTNVENNQSRWPYTKKTVRMGRRSVTPATIPPYEPPPVMFTPPREVVHSP # VTSTTKSKRKAGKSKGLKLDLQIKSEPPDIDYLNAPMPPPSPTDDPLLLSGPPEGSCTPSRSRTMRDASVSADFAQNIRKQPSFALEKESLPPSSPPA # QDDSSSSPSQATYHWPNTGVVQEDDRSTDSMELDMQPHEYAEMEGIPYFGFGLEGFAVASAGAWSDSDEEGPHTPMRETGVIDEGIGEFTGHWRMTQV # PTKADPPSSTTRTRMDEWGRPKSPYPYRRPSSSSSLPRVGSTSPSPSHPKSRVNASATADVEEADRSVPLADEDHTITLHPPLTEPPSAQEAETRSYH # EHKNIEDAEEQEEQEVRALSISADDEGEDSADEEEVRRLSLGPEQQFEQKDPDFEQEESEVEDLNLSSASFDMIVGDHIAEPSGVTATAHTPRRVHSA # ESQACSSPAPLRDLAFLSDKRRGNTRLSALERAKELFGTRSSPVKPLSGLAQIFDDDEQDAEAAHSSHQVNERPITVDKVFEEEEEELKMDAAEDAAE # MSSGDESDPMSQDPGLVQITSSDPKAAARAAAILKQVTYFFC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g667 ### # start gene g668 6 AUGUSTUS gene 2660378 2660779 0.87 - . g668 6 AUGUSTUS transcript 2660378 2660779 0.87 - . g668.t1 6 AUGUSTUS stop_codon 2660378 2660380 . - 0 transcript_id "g668.t1"; gene_id "g668"; 6 AUGUSTUS CDS 2660378 2660779 0.87 - 0 transcript_id "g668.t1"; gene_id "g668"; 6 AUGUSTUS start_codon 2660777 2660779 . - 0 transcript_id "g668.t1"; gene_id "g668"; # protein sequence = [MAITENALPASPLERNSVPHIDLSKTFNTTGTKKNRNQNSTPSSSSRKPMGNLNRLSGHAKPLGLLSPPSSQINVLSG # EPNSERNSDRHSDYEPREKDEDPARLLISPPPEEELQQINISQRSSFHKPSVSVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g668 ### # start gene g669 6 AUGUSTUS gene 2665574 2666038 0.98 - . g669 6 AUGUSTUS transcript 2665574 2666038 0.98 - . g669.t1 6 AUGUSTUS stop_codon 2665574 2665576 . - 0 transcript_id "g669.t1"; gene_id "g669"; 6 AUGUSTUS CDS 2665574 2666038 0.98 - 0 transcript_id "g669.t1"; gene_id "g669"; 6 AUGUSTUS start_codon 2666036 2666038 . - 0 transcript_id "g669.t1"; gene_id "g669"; # protein sequence = [MPNPTYTGYLRNPSRIPDVKSPLDKGSSPNTPTRITIPPSSVFDQAAEIERLPAANYSSSSNSQDVDEALLEESYVPP # VDEGLDDLWETLRQKKELKMAKETPKVRSLQEQPVEEEFSHIEAPDLDVPVGTQRSETLRRQKSMCVHQSGWNLVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g669 ### # start gene g670 6 AUGUSTUS gene 2668200 2669097 0.37 + . g670 6 AUGUSTUS transcript 2668200 2669097 0.37 + . g670.t1 6 AUGUSTUS start_codon 2668200 2668202 . + 0 transcript_id "g670.t1"; gene_id "g670"; 6 AUGUSTUS CDS 2668200 2668207 0.37 + 0 transcript_id "g670.t1"; gene_id "g670"; 6 AUGUSTUS CDS 2668308 2669097 0.86 + 1 transcript_id "g670.t1"; gene_id "g670"; 6 AUGUSTUS stop_codon 2669095 2669097 . + 0 transcript_id "g670.t1"; gene_id "g670"; # protein sequence = [MSTNNDSERYASHSSSRQVPSTKSHIKRPPNPNPTSTQPLPSPALTQAGSQYQSKQDQTNQQSAPPSSFEPPRKFTDS # DNTGSVRSLSQFPAPPTHFPLPPPLTQRRSTGSSSPVTSFPSLNANRFERQSPGSEDVLDNTTTDSSSNPLKLVSFERPALNETIVQSKQAQSPQQSQ # LDEATSERKVSTNYTARDQPSASPTQSSSTHSYSSKSGPDSKEERTGSAGQEVARAGSNGSIVATMRNRYSYTVSKVLITLRLALTYQF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g670 ### # start gene g671 6 AUGUSTUS gene 2669258 2670133 0.92 + . g671 6 AUGUSTUS transcript 2669258 2670133 0.92 + . g671.t1 6 AUGUSTUS start_codon 2669258 2669260 . + 0 transcript_id "g671.t1"; gene_id "g671"; 6 AUGUSTUS CDS 2669258 2670133 0.92 + 0 transcript_id "g671.t1"; gene_id "g671"; 6 AUGUSTUS stop_codon 2670131 2670133 . + 0 transcript_id "g671.t1"; gene_id "g671"; # protein sequence = [MRQGEVLRDQPSPSSPTNHPSGSELLEDERRRHQQRLNQLAELEIQDKERELRLREQEIKLRSQELEREKAMLISRNE # VVFTREPSDLESIARNPQPPLRLRDRQLSFQQPQKSGAHTDAASSPFPSRPLSQYSSASTTNLVPPRPSSYGASDAGSAYTRRDSSQNSSTSTSNHAP # YCGCENCSASKYKTSSPLASPVRPEKEKPKGWMRRLSMPIVGGNAFLDSKKNKDSGYGTGKGVRSLDSKKNASTTGLITSITEEGRFGAVSGRRSYDS # GGISNRSTTNLGLNTRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g671 ### # start gene g672 6 AUGUSTUS gene 2670842 2672425 0.74 - . g672 6 AUGUSTUS transcript 2670842 2672425 0.74 - . g672.t1 6 AUGUSTUS stop_codon 2670842 2670844 . - 0 transcript_id "g672.t1"; gene_id "g672"; 6 AUGUSTUS CDS 2670842 2671516 0.88 - 0 transcript_id "g672.t1"; gene_id "g672"; 6 AUGUSTUS CDS 2671622 2671776 0.78 - 2 transcript_id "g672.t1"; gene_id "g672"; 6 AUGUSTUS CDS 2671881 2672240 0.99 - 2 transcript_id "g672.t1"; gene_id "g672"; 6 AUGUSTUS CDS 2672284 2672425 0.98 - 0 transcript_id "g672.t1"; gene_id "g672"; 6 AUGUSTUS start_codon 2672423 2672425 . - 0 transcript_id "g672.t1"; gene_id "g672"; # protein sequence = [MESTSPNAVAGPSNPRSSPSHPTSSANPSNTPHSHADQPSQLFLPTPDHVTKGPQQLPAYIQSTQDLLGKFHLHDAYD # KYVRFFNASSEDAPIPNDRNEAVSASPPTAGQNGLMGASDKGKGKEVAPAPIAQTPAADGQDGDDEDGPGGKGEKKKKNSYKHLIKGVPAPPKQRVRI # SEFDSRTQRDAFTVSLEGLKGVSLDLRLRLSEWLHISFCSGILKELKRLAKAQMQAQSQASTHQSSPAASTPIPAPVPTSATASAFPNLASTPRPSNL # SSTPRPAGSGTPRPHPTAAAPPTIRPGSAKPGLQPVQIPGPGIRVTTPLRTATPTGPHPLSAPPLSASFVSPPGSFSAPQPPSNALNAVVPPRGKKRE # RDESMPAPANGNGVAQVNFNGNSANIGATPNTIPKAIIGARAGNNGVRPRPIPPPMKKQRIVCFLGSLVLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g672 ### # start gene g673 6 AUGUSTUS gene 2674797 2675438 0.41 - . g673 6 AUGUSTUS transcript 2674797 2675438 0.41 - . g673.t1 6 AUGUSTUS stop_codon 2674797 2674799 . - 0 transcript_id "g673.t1"; gene_id "g673"; 6 AUGUSTUS CDS 2674797 2675438 0.41 - 0 transcript_id "g673.t1"; gene_id "g673"; 6 AUGUSTUS start_codon 2675436 2675438 . - 0 transcript_id "g673.t1"; gene_id "g673"; # protein sequence = [MTMAPRVEVFTQLACASTHHHTQRTYNHTLDNASLNLLDSHTLSLYYTLDPLGPHLPEHLSIPTIPTSTEHTSPVDPP # DDDEPDPDDDPRKLPSPQCIRDPQVQKEAARIQTILTTTMGLLSAFSTGWWGHFSERHGRTRVLAMATLGLFLTYVRVCVHDRSFIISVPMSVLGIIG # GTACTYTHTERARLFIEPVRLMPHAITASIMTITKAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g673 ### # start gene g674 6 AUGUSTUS gene 2678755 2679654 0.86 - . g674 6 AUGUSTUS transcript 2678755 2679654 0.86 - . g674.t1 6 AUGUSTUS stop_codon 2678755 2678757 . - 0 transcript_id "g674.t1"; gene_id "g674"; 6 AUGUSTUS CDS 2678755 2679654 0.86 - 0 transcript_id "g674.t1"; gene_id "g674"; 6 AUGUSTUS start_codon 2679652 2679654 . - 0 transcript_id "g674.t1"; gene_id "g674"; # protein sequence = [MLSNGFIRNHAIGILADDDGFRFHYYDRSKVVESEVSFSRPDLLHYFLTVTTLPFTSTSTNFFLSQAFNILDDEWKKL # FMAMVCQLNKLSSEKLGFIPNLHLDKYDHLRDPEQFSQQFANDPQGLVGAHYSFKGSDGVVHIVVIEQVLYRAEGIIGRCSVVVEVTCICQDSGCKWN # GERKIMKISFPSKSRPSEEGLIYDARSKAESSGEHWALNHLPKVIDSITLPYHEKETVQGRLKTHLKDKYEERVMRVTVLEKLHPLSELEDPREFAQV # FYDVLQSALLSTSLLVHSIMISFCF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g674 ### # start gene g675 6 AUGUSTUS gene 2680309 2681046 0.96 - . g675 6 AUGUSTUS transcript 2680309 2681046 0.96 - . g675.t1 6 AUGUSTUS stop_codon 2680309 2680311 . - 0 transcript_id "g675.t1"; gene_id "g675"; 6 AUGUSTUS CDS 2680309 2681046 0.96 - 0 transcript_id "g675.t1"; gene_id "g675"; 6 AUGUSTUS start_codon 2681044 2681046 . - 0 transcript_id "g675.t1"; gene_id "g675"; # protein sequence = [MEASPQNNLLAQAPLTHTPKQKQAGGPPVVKNTPGSHNYTAHAKDKVPQRASVLNKFLQDDISDRAVLSLDDFATLIL # DLPPDWRIKEEFSLLPESEVVRETFEAYLTAAIGATEGEGKRKKKGKAAAVREKELYQPLANLLNSLRDGKGRHMKRDIDEKIFYVQDPRPLLGSLLE # RKPDLGAIYIQLLELTKNAKLSKYLGKNKIAGVFWGLLLFFVEVKHEKGRFIGLNITKEGTHAEVCSFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g675 ### # start gene g676 6 AUGUSTUS gene 2695167 2697164 0.37 + . g676 6 AUGUSTUS transcript 2695167 2697164 0.37 + . g676.t1 6 AUGUSTUS start_codon 2695167 2695169 . + 0 transcript_id "g676.t1"; gene_id "g676"; 6 AUGUSTUS CDS 2695167 2696123 0.62 + 0 transcript_id "g676.t1"; gene_id "g676"; 6 AUGUSTUS CDS 2696196 2697164 0.42 + 0 transcript_id "g676.t1"; gene_id "g676"; 6 AUGUSTUS stop_codon 2697162 2697164 . + 0 transcript_id "g676.t1"; gene_id "g676"; # protein sequence = [MRHDAIDPCLGFYPSVLAHVAANAAAAAVSQTTPGVYTNTSNDLTPSQNRKRKTEEELPRIDATPTGQTKPEPATVIH # EKRPNPESNKRRDVKRPRKYAKQRQKQPKNDVDTGSEQETSESLSPSPIKGTFKHNPMRIHSPADKTDVHSRVKRKRRRLLADCLLQAAVLSGVNPVD # SLIEPDPSAPPPTRKPLQFEIPDFFRHTPESQLKRRPSWTLVDPHRTTSIRTASFASVREKQTLAPSSLNPTLKPLTGWSTSTFSRPSKEKKNEAAFK # HAKIRASSSKVNTEVRYGSRRPLTLVPIEQSELLENKITPRVSRSLTSHVIGTGIATKTSPPPLTLINVLTKDTPVIKSTNQASSPSHLPQVSHIDLA # SEIDNIGFNTDPDRELKPSAAVAPLAYVSIPPSPKLIEELQVSPLLQNLPALILNPTLPSVPLLASLASAFNTLGEVQHSSSNGFSSPISSTSTKSHS # VSTPSRPDTISADSSKKPAKPLSSFFDEFLETVRVATSASQHHQKVNVLSSIRRERFVSSRKTERGINLSDAPQPHVSAGIQVQSHPRDEAGDYIFDE # WALRTTSKVESEHVELKNDSQEMHNGPSMTTRDLLAVLQPSQFQIILPPLSPTPASQTNPIRSSMSGLRAFYM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g676 ### # start gene g677 6 AUGUSTUS gene 2700295 2701299 0.89 - . g677 6 AUGUSTUS transcript 2700295 2701299 0.89 - . g677.t1 6 AUGUSTUS stop_codon 2700295 2700297 . - 0 transcript_id "g677.t1"; gene_id "g677"; 6 AUGUSTUS CDS 2700295 2701299 0.89 - 0 transcript_id "g677.t1"; gene_id "g677"; 6 AUGUSTUS start_codon 2701297 2701299 . - 0 transcript_id "g677.t1"; gene_id "g677"; # protein sequence = [MVGVPEEILDWMRRRYSGRKTQLSFDDYISQPFAVPGGEDQGDPFAAVGYILYAAGLLTTFKTLDKEEGFGFMDDVAA # MKWGRDINQLHAEIGQMMNKANGPLEWAASHNCQFGVPKFKLVDFNRQRKPHPTEPRKTVPITGSGVQLRGTLIKSEPFTKFLGTLMDRQLRWNEQHA # AMVRKGQQWVAQFRRVARMRDGMVAQLVRQLYKAKALPRMLYAADIVLTPASRRSEKKWTQASQTRGIIRKLTSIQRQAALLITGAMTTTAMDILNIH # AALLPLPLEIERHRHRAATRLLTLPEEHPLSDRIKDGARNQQRTHHFSPIHDLMARYGLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g677 ### # start gene g678 6 AUGUSTUS gene 2701857 2702621 0.96 + . g678 6 AUGUSTUS transcript 2701857 2702621 0.96 + . g678.t1 6 AUGUSTUS start_codon 2701857 2701859 . + 0 transcript_id "g678.t1"; gene_id "g678"; 6 AUGUSTUS CDS 2701857 2702621 0.96 + 0 transcript_id "g678.t1"; gene_id "g678"; 6 AUGUSTUS stop_codon 2702619 2702621 . + 0 transcript_id "g678.t1"; gene_id "g678"; # protein sequence = [MSMKAYLAEKYMSGPKADAILARDPLKKKKKRKAKDEGFAVQKALIKDDDVGWGHEPNDEDEDMAEAVIEKDRGFKKR # KTAASGEGSSGWTTVRPAVEEHPAPDEQPLLIVEEEEEKPFVGGLVKGQMKKPGPKQVSEPEETAEEIARMQETVYRDATGRKIDTKAARAEAARKKR # EKEEKEAQKMEWGKGLVQREDKEKMKAELEKLKSRPFARGVDDKELNEEQKAKDLWNDPAAAFLTVCFVFNIHCHGFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g678 ### # start gene g679 6 AUGUSTUS gene 2706406 2706715 0.45 - . g679 6 AUGUSTUS transcript 2706406 2706715 0.45 - . g679.t1 6 AUGUSTUS stop_codon 2706406 2706408 . - 0 transcript_id "g679.t1"; gene_id "g679"; 6 AUGUSTUS CDS 2706406 2706652 0.97 - 1 transcript_id "g679.t1"; gene_id "g679"; 6 AUGUSTUS CDS 2706708 2706715 0.45 - 0 transcript_id "g679.t1"; gene_id "g679"; 6 AUGUSTUS start_codon 2706713 2706715 . - 0 transcript_id "g679.t1"; gene_id "g679"; # protein sequence = [MMLYTPANTFVAAFHFTIALLPGGPSMITLPPIWYKPELVKTEKELEDEELKALLARNLRESKKSKKKKAAKEGVEAG # DDANEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g679 ### # start gene g680 6 AUGUSTUS gene 2710328 2711218 0.55 - . g680 6 AUGUSTUS transcript 2710328 2711218 0.55 - . g680.t1 6 AUGUSTUS stop_codon 2710328 2710330 . - 0 transcript_id "g680.t1"; gene_id "g680"; 6 AUGUSTUS CDS 2710328 2711218 0.55 - 0 transcript_id "g680.t1"; gene_id "g680"; 6 AUGUSTUS start_codon 2711216 2711218 . - 0 transcript_id "g680.t1"; gene_id "g680"; # protein sequence = [MDLFPVDSIPSSTRSSMTVFSTSPWDRSDDDLMDGTLKKKTSLSPLQESPTSTLPTPISHISPKSANSHKMYSSSFVP # QLPPVPSPPLADSSFHTNPQDHSRLKAAWDAMLSRRFLAPQLITVLPFYLSSCFVDVKTHPTLHIPLPPNSSLSDSKLFCSDYSSSANAFNPEEQFEL # KRSTGRHSDEENPRRRDSTLARDPKKVFSWAPMHLARTVQTVKACKEAIWDEYDKLHSPDLPPTITQARLKEGHRAVVSSKSAARESFDRAWDNWEKS # VTFNPTRSLITVLTVLLRYFLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g680 ### # start gene g681 6 AUGUSTUS gene 2712348 2712884 0.95 + . g681 6 AUGUSTUS transcript 2712348 2712884 0.95 + . g681.t1 6 AUGUSTUS start_codon 2712348 2712350 . + 0 transcript_id "g681.t1"; gene_id "g681"; 6 AUGUSTUS CDS 2712348 2712884 0.95 + 0 transcript_id "g681.t1"; gene_id "g681"; 6 AUGUSTUS stop_codon 2712882 2712884 . + 0 transcript_id "g681.t1"; gene_id "g681"; # protein sequence = [MTSIVQRTSWRAARLSLARYASSSTSASGRAYVPLDIDTNPEPLQDYQYAPPISHQYRAPYGWDDMQMRRNFGDPVSD # VALSILETHSNLQLPEHDELMSMWGPDLPPPGVKPRTALIHFLLAVAGFTGIFYTTKWVLTPEPHFIRRTYPYDGLATALGGLPENKVCVAAQSHCNL # YN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g681 ### # start gene g682 6 AUGUSTUS gene 2714803 2715741 0.58 - . g682 6 AUGUSTUS transcript 2714803 2715741 0.58 - . g682.t1 6 AUGUSTUS stop_codon 2714803 2714805 . - 0 transcript_id "g682.t1"; gene_id "g682"; 6 AUGUSTUS CDS 2714803 2715741 0.58 - 0 transcript_id "g682.t1"; gene_id "g682"; 6 AUGUSTUS start_codon 2715739 2715741 . - 0 transcript_id "g682.t1"; gene_id "g682"; # protein sequence = [MDLQLLIFLFPAGVIMCFRELRDEHVFVIIYAVVASYFAGVMVRLMLTLTPVVCVSAAVALSTLLDTYVEAREPDVPE # ERTEANGSSAPDGKKTKKAGGAVGSQASTTAVAAASSAISDFVSATRSSASSPRQKGIWGADTRLVILLNAIGMLVFFVFHCTWVTSNAYSSPSVVLA # STNPDGSQHIIDDYREAYYWLRMNTPQDAVVMSWWDYGYQIAGMADRVTLVDNNTWNNSKFSIFEKNNQVIHSLLAHIATVGKAMSSPEEVAYPILRK # HDVDYVLVIFGGLLGYSGDDINKFLWMVRNFLRFTIHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g682 ### # start gene g683 6 AUGUSTUS gene 2717549 2718082 0.75 - . g683 6 AUGUSTUS transcript 2717549 2718082 0.75 - . g683.t1 6 AUGUSTUS stop_codon 2717549 2717551 . - 0 transcript_id "g683.t1"; gene_id "g683"; 6 AUGUSTUS CDS 2717549 2718082 0.75 - 0 transcript_id "g683.t1"; gene_id "g683"; 6 AUGUSTUS start_codon 2718080 2718082 . - 0 transcript_id "g683.t1"; gene_id "g683"; # protein sequence = [MIYDQVNAINRQGNLNVFFDVSAGSGTAAPRKRQAYASKRLQQVVSDFRKKRNSAGTSTTAESSSDDDSQKSEDREDA # QPPKKKKRTSKKVKEKSNSGNLATRSKKPTARRPRATKKSNVSGEDEDGGAFVRGPEAGNAAAPSTPLAVNLRPRPKPKPNNRRGALSNHDDSILGKE # R] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g683 ### # start gene g684 6 AUGUSTUS gene 2718948 2721616 0.2 - . g684 6 AUGUSTUS transcript 2718948 2721616 0.2 - . g684.t1 6 AUGUSTUS stop_codon 2718948 2718950 . - 0 transcript_id "g684.t1"; gene_id "g684"; 6 AUGUSTUS CDS 2718948 2720235 0.91 - 1 transcript_id "g684.t1"; gene_id "g684"; 6 AUGUSTUS CDS 2720338 2720684 0.39 - 0 transcript_id "g684.t1"; gene_id "g684"; 6 AUGUSTUS CDS 2720736 2721090 0.59 - 1 transcript_id "g684.t1"; gene_id "g684"; 6 AUGUSTUS CDS 2721456 2721616 0.45 - 0 transcript_id "g684.t1"; gene_id "g684"; 6 AUGUSTUS start_codon 2721614 2721616 . - 0 transcript_id "g684.t1"; gene_id "g684"; # protein sequence = [MIFSSNRCLHVSHEPRLENMEGKIVAIDSSIWIYQFQATMRAKDGRALVNAHVLPTKGKGSADEGPIELNDGTVYLED # IDSAIPSTPHKKTSKAKEPTSSAKKNKFYDHDPYRLPDVNLEERVAVATRSSAPDPRLATEDELRLFIENMRPEDFDVTSPAFRELPTEVQYEIQMLK # SAPTPLDFSKQQIKNLKQRNSLTQQLLTTTDSIGKAHISIPVRIASERNREYMLIRNEGATGGWILGIRDEGTKQKPIIIDHEEKKTQGNGKGNIKIG # QDSDEDDDMEEVSIHSALSAISRRYKPKPLAPLNTKGKQKAVTIPLFDLDEDDENEVSSVQAQQQDYWEEDEELAFAIQESLEYSNVHTSTGASSSRT # QVPFEMSQGTGHQDTPPGAGSRSRLETALSIANASASRSSDHEPVRSSTSFGQPFLLRSTPISGPVVESKSRVTTSDTVSNVSAGLNQLPSQSPSQIV # PAVPVAKKTSPSSVKTTIYSGNLLKPEVNSSLPKGSNKSTIVPPAASSIIELGLQPEKAPSMPLREDDVDGAEVSGVKENNHAYMIVPPLSSEDEDDM # EEISMRNSLTIRADASPPPDEPTIMSTSELDSELNPGTHQITISPLGSSPPEKPPSEHDRSRPPTPPLDEDWDAAHEMNPDAEEGDFAQFVSQVKGRN # IDDVRREIDAEIASLDQQRKNAMRDAEDVNQQMVTQIMVHSERSYSMNTC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g684 ### # start gene g685 6 AUGUSTUS gene 2724123 2725315 0.46 + . g685 6 AUGUSTUS transcript 2724123 2725315 0.46 + . g685.t1 6 AUGUSTUS start_codon 2724123 2724125 . + 0 transcript_id "g685.t1"; gene_id "g685"; 6 AUGUSTUS CDS 2724123 2724372 0.81 + 0 transcript_id "g685.t1"; gene_id "g685"; 6 AUGUSTUS CDS 2724735 2725315 0.6 + 2 transcript_id "g685.t1"; gene_id "g685"; 6 AUGUSTUS stop_codon 2725313 2725315 . + 0 transcript_id "g685.t1"; gene_id "g685"; # protein sequence = [MAGRGNYGYPYNYPGQGPPGNNPNAPPVYNPTAPPGHNPNVPPGHNQAPPAYYPNAPPGANHGQYQAYHYPGNTGNYT # GSVPHVLEGLPATLGQLPAGAVPPSYNYARNEGPLHSHGYSPPSPEVFNLHPQPQRGRTAQVPVVPGVPVPIHGGGLRRHGQLDNTSSNGSGSGDHVS # DESKKSTDENKYVVGHLSLGSHHSNAAGPSSGRNITPTADGFTKCSVCGQAYVVSDRDAHDSGCPGNAQSARKEGNDNDTAGKDKGKGPKGKGKSGNT # RK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g685 ### # start gene g686 6 AUGUSTUS gene 2729146 2730072 0.99 + . g686 6 AUGUSTUS transcript 2729146 2730072 0.99 + . g686.t1 6 AUGUSTUS start_codon 2729146 2729148 . + 0 transcript_id "g686.t1"; gene_id "g686"; 6 AUGUSTUS CDS 2729146 2730072 0.99 + 0 transcript_id "g686.t1"; gene_id "g686"; 6 AUGUSTUS stop_codon 2730070 2730072 . + 0 transcript_id "g686.t1"; gene_id "g686"; # protein sequence = [MRNKPRSRSAPPFSTHDFGVGWELREDGIEIEDLHMDSADLAEFSTIDIFRDYHPRSMYWVDNDKVLKLFSYLIDVSV # IVANMDLARTRIPVPRVLRYGQSGNCSYILMERIPYPNLAAEMRRLGIKSMPWGLTHAMDYIVRELADVGLSHNDLVPRNVLVDNNGMIVSVIDWDHC # TQHHRGGEYARKIRGLSYFKDVGEKDWYHIFLRYAPDRTGEEIMIGCSKWHSKLGLQWPLVKSKAFQLASSPSSDPRNLSFSVSSRTSFSSKSNRRTF # GQRQKIHPITVEPVDATFHPTHIRDSAFPNISTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g686 ### # start gene g687 6 AUGUSTUS gene 2730590 2731022 0.63 - . g687 6 AUGUSTUS transcript 2730590 2731022 0.63 - . g687.t1 6 AUGUSTUS stop_codon 2730590 2730592 . - 0 transcript_id "g687.t1"; gene_id "g687"; 6 AUGUSTUS CDS 2730590 2730856 0.99 - 0 transcript_id "g687.t1"; gene_id "g687"; 6 AUGUSTUS CDS 2731008 2731022 0.63 - 0 transcript_id "g687.t1"; gene_id "g687"; 6 AUGUSTUS start_codon 2731020 2731022 . - 0 transcript_id "g687.t1"; gene_id "g687"; # protein sequence = [MTGWMNNLRYRVDEAEEDRGQSKDDEDALEVEDEYEDLRAGTKNQHGISYANSKEESEDEWDGIWRPEPTGGMSDEDT # SQVPEFCVPSSASGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g687 ### # start gene g688 6 AUGUSTUS gene 2733104 2733631 0.68 + . g688 6 AUGUSTUS transcript 2733104 2733631 0.68 + . g688.t1 6 AUGUSTUS start_codon 2733104 2733106 . + 0 transcript_id "g688.t1"; gene_id "g688"; 6 AUGUSTUS CDS 2733104 2733631 0.68 + 0 transcript_id "g688.t1"; gene_id "g688"; 6 AUGUSTUS stop_codon 2733629 2733631 . + 0 transcript_id "g688.t1"; gene_id "g688"; # protein sequence = [MGLTNYHSDLIKLQSRYVSPSAPLPSSVHTQNEAPLRPYDYSPPAPEHFGMYPTPQRQKTAEAQMDGLQRRGKAGNMS # DIGDNGHQFTKFKKYSNKNVYDSVLKRHHSGSRPRTGVAGSSSIRRNIVPTAFGFEKCQLCGQPFGTSDTGNHERNCLGHITTKGKGKGTREDAGKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g688 ### # start gene g689 6 AUGUSTUS gene 2735178 2735987 0.95 + . g689 6 AUGUSTUS transcript 2735178 2735987 0.95 + . g689.t1 6 AUGUSTUS start_codon 2735178 2735180 . + 0 transcript_id "g689.t1"; gene_id "g689"; 6 AUGUSTUS CDS 2735178 2735987 0.95 + 0 transcript_id "g689.t1"; gene_id "g689"; 6 AUGUSTUS stop_codon 2735985 2735987 . + 0 transcript_id "g689.t1"; gene_id "g689"; # protein sequence = [MQSKPRSRSAPPFSTHDFGIGWELREDRYELEDLHMDPHDLAEFSSVEIFRDLHPRAMYWVDEDKVLKLFSYLIDVSV # IVANMDLARTRLPVPRVLRYGRSGNCSYILMERIPHSTLAIEMDQLGMNFMPWQLTQTMDHIVRELADLGLTHNDLVPRNVLVDKNGMISSIIDWDPC # TPHHRGGEYARKIRNFDLHWRYGEKEWYHIFLRYSFDRTGEEISIGCSKRHPKLYLQWPLVKSKASQLMNPPVTDRRNQSFSVRSTISPSIQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g689 ### # start gene g690 6 AUGUSTUS gene 2740440 2741527 0.36 - . g690 6 AUGUSTUS transcript 2740440 2741527 0.36 - . g690.t1 6 AUGUSTUS stop_codon 2740440 2740442 . - 0 transcript_id "g690.t1"; gene_id "g690"; 6 AUGUSTUS CDS 2740440 2740807 1 - 2 transcript_id "g690.t1"; gene_id "g690"; 6 AUGUSTUS CDS 2740967 2741406 0.58 - 1 transcript_id "g690.t1"; gene_id "g690"; 6 AUGUSTUS CDS 2741463 2741527 0.45 - 0 transcript_id "g690.t1"; gene_id "g690"; 6 AUGUSTUS start_codon 2741525 2741527 . - 0 transcript_id "g690.t1"; gene_id "g690"; # protein sequence = [MKTSTTRLPSSLLEQIQESDGANRRRSQKPSRKESRKQLRAERKHRKAEFFSNHNLKRPAAPAADSPPKKKVKFNVDD # PQKPASLPKASTSKLKNKVSLESNGTDDAKAAPKATALERLGSKQSKSLSLTTPIRTQQEKKEDAYIAYLEAKLGYSKGKKAKRLDDGLDDELRYHVD # ESEPEEDSEDSREDDEGMENEDLGGEEEEEDVSDLQKLEHGASDAEGEGEEDEWHGIGQRESTDGISDEDTSEVPEVFVPSSAPSAYFLSSYWNNAHI # SSISYTICSSTFACKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g690 ### # start gene g691 6 AUGUSTUS gene 2741842 2742366 0.82 + . g691 6 AUGUSTUS transcript 2741842 2742366 0.82 + . g691.t1 6 AUGUSTUS start_codon 2741842 2741844 . + 0 transcript_id "g691.t1"; gene_id "g691"; 6 AUGUSTUS CDS 2741842 2742366 0.82 + 0 transcript_id "g691.t1"; gene_id "g691"; 6 AUGUSTUS stop_codon 2742364 2742366 . + 0 transcript_id "g691.t1"; gene_id "g691"; # protein sequence = [MNPATDMQKIIEEVEVQLLESDLRDSMLHGTGIPNNVANINTAYSKLTGPPILVQIEAITDVGVSAYSLHKTRLIREE # RRDAGEEQEGEADGEVEGEGPIPNYTRSMLRLELSDGATTLRAAEYRPIHELTLGHTPLGYKVSGRTPVNEKVRFLRDGIRTVCSCRFRMPKYAGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g691 ### # start gene g692 6 AUGUSTUS gene 2742515 2743330 0.92 + . g692 6 AUGUSTUS transcript 2742515 2743330 0.92 + . g692.t1 6 AUGUSTUS start_codon 2742515 2742517 . + 0 transcript_id "g692.t1"; gene_id "g692"; 6 AUGUSTUS CDS 2742515 2743330 0.92 + 0 transcript_id "g692.t1"; gene_id "g692"; 6 AUGUSTUS stop_codon 2743328 2743330 . + 0 transcript_id "g692.t1"; gene_id "g692"; # protein sequence = [MPRLPELDVDPAVQAVLLAPPVPNMGNVRSPLREISPPPSPTLVGSAHPHSDDEDQPRRRRIPNASASTANRGNTLPH # NDVVSSALFKETVPNQRASSSINAVRQALPLSLAVRGPIVIESDDEDENTTWESRNRPMRPIPARARSSTSSAKPPSPSAGKGKEKATESDYDDDMFE # ELPSSFYDEIDKVELAVGMKSLSTASVVSTSTGRGSTTDHSASFSVVHSEVITVEDDDEDDKENVPAPTRHVRQRRGVPPIMVATDDILELSDSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g692 ### # start gene g693 6 AUGUSTUS gene 2745106 2745936 0.8 + . g693 6 AUGUSTUS transcript 2745106 2745936 0.8 + . g693.t1 6 AUGUSTUS start_codon 2745106 2745108 . + 0 transcript_id "g693.t1"; gene_id "g693"; 6 AUGUSTUS CDS 2745106 2745936 0.8 + 0 transcript_id "g693.t1"; gene_id "g693"; 6 AUGUSTUS stop_codon 2745934 2745936 . + 0 transcript_id "g693.t1"; gene_id "g693"; # protein sequence = [MTVASSYFSSSSSLSSSSSTSPAVTSSTPLPFISYFASTTPDSPSKRARLKTLLFLQASGLYDVSVVKERILSASDGP # SKPTKGKHKPLLSLELAVLESKLGNHRAVLECLVREVGDGVSAEAYCTGNNGPGSNGGRQVIPTRLCRSIAENTEGLGNWKSVVIATTKEASEEKGVA # NGTLLRMLLEVYMSIGDAEKQHSSRIDQEQVQQVQVARLLNSQGVHLDVCDVSNLSFPLSLVLIPSHPQSGDSNASLILAITSTLLLHYAVMSAHVTY # FT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g693 ### # start gene g694 6 AUGUSTUS gene 2750454 2751050 0.84 + . g694 6 AUGUSTUS transcript 2750454 2751050 0.84 + . g694.t1 6 AUGUSTUS start_codon 2750454 2750456 . + 0 transcript_id "g694.t1"; gene_id "g694"; 6 AUGUSTUS CDS 2750454 2751050 0.84 + 0 transcript_id "g694.t1"; gene_id "g694"; 6 AUGUSTUS stop_codon 2751048 2751050 . + 0 transcript_id "g694.t1"; gene_id "g694"; # protein sequence = [MTSEEIREKRRADRKQFKLDRAAAIAKVAAEAETIFETEGRVVVPALFGPEIPSGATWKPKTAESEPALEQKPGSPEN # AKSKGEDEGEGEEEEEPLEDMEHLQLTLPEAFFLAWNFDCLTILDPETACYVFYFVFQYLKFDSSFTRTNLYRYQKYGLLSNKFTSHPRYQPSPHPSF # NSTTLSLSIMLCTTTIDLLAGW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g694 ### # start gene g695 6 AUGUSTUS gene 2752422 2753336 0.98 - . g695 6 AUGUSTUS transcript 2752422 2753336 0.98 - . g695.t1 6 AUGUSTUS stop_codon 2752422 2752424 . - 0 transcript_id "g695.t1"; gene_id "g695"; 6 AUGUSTUS CDS 2752422 2753336 0.98 - 0 transcript_id "g695.t1"; gene_id "g695"; 6 AUGUSTUS start_codon 2753334 2753336 . - 0 transcript_id "g695.t1"; gene_id "g695"; # protein sequence = [MSKLNPQTTHYEFLGPVGTFFISVGVPSMIYGLYYGCSEQTGGCPPPTLTLSKLTSELTALPVTISLHDISWWQGLWQ # EVWDTEAALMYLAWYAFCVVAWRVLPGAQVEGTRIRDGSVKKYKINAFSTFLLALGLVTGVIIRFGPEKFTFLYERWVGFATAAILMSIAQAFVVYAM # SFREGALLALGGNTGNWVYDWYIGRQLNPTLSIFGAEFDIKSFNELRPGLILWALIDISMVCEQAVRRGGIGNVTDSMWLVLLFQVGYVADGLYNEPA # ILTTMDITTDGFGFMLSVGDLAWGVYALPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g695 ### # start gene g696 6 AUGUSTUS gene 2757390 2757725 0.73 - . g696 6 AUGUSTUS transcript 2757390 2757725 0.73 - . g696.t1 6 AUGUSTUS stop_codon 2757390 2757392 . - 0 transcript_id "g696.t1"; gene_id "g696"; 6 AUGUSTUS CDS 2757390 2757725 0.73 - 0 transcript_id "g696.t1"; gene_id "g696"; 6 AUGUSTUS start_codon 2757723 2757725 . - 0 transcript_id "g696.t1"; gene_id "g696"; # protein sequence = [MKEFWGGNQDFEYDHEKYWPTLVDLCKARKVKWMDEWRKLGGRIGLCESDYKNGGSGQPVTDADSPQKEEADTSTETP # KATEVGVPTLGVIALESGDGPASIEQAAGVNTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g696 ### # start gene g697 6 AUGUSTUS gene 2761329 2761820 0.77 - . g697 6 AUGUSTUS transcript 2761329 2761820 0.77 - . g697.t1 6 AUGUSTUS stop_codon 2761329 2761331 . - 0 transcript_id "g697.t1"; gene_id "g697"; 6 AUGUSTUS CDS 2761329 2761820 0.77 - 0 transcript_id "g697.t1"; gene_id "g697"; 6 AUGUSTUS start_codon 2761818 2761820 . - 0 transcript_id "g697.t1"; gene_id "g697"; # protein sequence = [MVDILKNAWGEKLVEGKLTDDSEQEVKVSPRELKGRIILMVRSFHSDLLYLISSQVEYYAPSNFAEVEAEEELEELDP # DQEEESTTSDSIVEGEDLPQVLVGEIERGKISDELAALGYYARSWKPTKGWLQQGIFLSQTQFSPFFTFHRTYRSSSYPHQHLRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g697 ### # start gene g698 6 AUGUSTUS gene 2763068 2764861 0.9 - . g698 6 AUGUSTUS transcript 2763068 2764861 0.9 - . g698.t1 6 AUGUSTUS stop_codon 2763068 2763070 . - 0 transcript_id "g698.t1"; gene_id "g698"; 6 AUGUSTUS CDS 2763068 2764861 0.9 - 0 transcript_id "g698.t1"; gene_id "g698"; 6 AUGUSTUS start_codon 2764859 2764861 . - 0 transcript_id "g698.t1"; gene_id "g698"; # protein sequence = [MTPAQSQANRSLPGSRAHSVDSTSFHTPAAVTSTANSKRSSMLGPARNEPPPAPTVIPEVVAATPSLRASSVRSSRPS # LSRTPTENGSRVDFSRDQSRGRSTYKGKERTIPSPPPTDDSMGTASTATSNRNSSSRLADTLSSVWGAVSPTARSIAESLKSKEATPLSSPIKRELRE # ILHSPPAPLPEPAPSAPVEEAPMSAVDMPGAFGTGVPAAEAELAQAEPSPTAAEYLEAAAWGSFTSAGEATGANMGPTNLRISTALSNRAPSAVISPI # NLPEMNMDLATQPIIDAGSTDGMLSLSNEAFLASDESSDLLSGPPESAPSNTNNLADLLGTVSSEVKSPTKASPKPASSPNPPNPTTPAAEVPPTSSK # SPWGTPKPAGTPRAASKLGSKIPSRVATPLTATTPKPAATPKAATPVPASSPKPETSELPPPTSELVEPVAVESQEPTVENAVPDPTTQQTIETPAEN # TVPSAPEHPSEPDATAALANIPPTETPEPAEVPAEPAVEATAETTQPSNAVTEETAAPETTVAATPDESTPGTAPGTAPGTPGDGLNGADIEGEAEEG # DDKDTKEEEATTPGGKKKKNEKKKKKKGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g698 ### # start gene g699 6 AUGUSTUS gene 2768037 2768729 0.33 + . g699 6 AUGUSTUS transcript 2768037 2768729 0.33 + . g699.t1 6 AUGUSTUS start_codon 2768037 2768039 . + 0 transcript_id "g699.t1"; gene_id "g699"; 6 AUGUSTUS CDS 2768037 2768729 0.33 + 0 transcript_id "g699.t1"; gene_id "g699"; 6 AUGUSTUS stop_codon 2768727 2768729 . + 0 transcript_id "g699.t1"; gene_id "g699"; # protein sequence = [MRKTIDETRRELARTQAEMTKLQERCRLLERTLFETREILKVRDEELEKLKEKQADTRSLNNHDDREDEQSRSFVEQE # DDGHPGSMLDENRALSKTTEVFMTRTDAWSGAQVLQAIHDLNSEILQFSAAATELCTFGSTSSSKVAIQATQDTASRLGPSMVRILSGRDHSQDPILV # QLALQGCISTCVARALSVFCMGFPTKADAVLTQIYSHMYAAGETLNIDTKNARS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g699 ### # start gene g700 6 AUGUSTUS gene 2771628 2771978 0.88 - . g700 6 AUGUSTUS transcript 2771628 2771978 0.88 - . g700.t1 6 AUGUSTUS stop_codon 2771628 2771630 . - 0 transcript_id "g700.t1"; gene_id "g700"; 6 AUGUSTUS CDS 2771628 2771978 0.88 - 0 transcript_id "g700.t1"; gene_id "g700"; 6 AUGUSTUS start_codon 2771976 2771978 . - 0 transcript_id "g700.t1"; gene_id "g700"; # protein sequence = [MEEIIDDDHAIISTASGPEFYVSIMSYVDKDLLEPGCQVLLHHKTQSIVGVLQDDADPMVSVMKLDKAPTESYADIGG # LETQIQEIKVCILCLDFYHVSESRIGICRATSNASRVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g700 ### # start gene g701 6 AUGUSTUS gene 2777223 2777909 0.82 + . g701 6 AUGUSTUS transcript 2777223 2777909 0.82 + . g701.t1 6 AUGUSTUS start_codon 2777223 2777225 . + 0 transcript_id "g701.t1"; gene_id "g701"; 6 AUGUSTUS CDS 2777223 2777909 0.82 + 0 transcript_id "g701.t1"; gene_id "g701"; 6 AUGUSTUS stop_codon 2777907 2777909 . + 0 transcript_id "g701.t1"; gene_id "g701"; # protein sequence = [MFTTLVTVTLFAAAAINGAAAQLNIQTPSMTTVLLKVFTAYCLDSLPFVQCEPVDITWSSTTGPYNLIMVSPDDPCGD # ALYGKNHSIRNSFPKKSSFFLLSVDLGDQDGTSVSWTPNVAPGTQLELSLVDANDDEAWSGTVWTFNDLYRVPLELMNVIYFQITVAQGSDTSCVPAD # ALAAASSSSVAAASSSVSSSSADASSAVSSISASVAVTGTTYVYITTMLATV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g701 ### # start gene g702 6 AUGUSTUS gene 2780148 2781656 0.92 + . g702 6 AUGUSTUS transcript 2780148 2781656 0.92 + . g702.t1 6 AUGUSTUS start_codon 2780148 2780150 . + 0 transcript_id "g702.t1"; gene_id "g702"; 6 AUGUSTUS CDS 2780148 2781656 0.92 + 0 transcript_id "g702.t1"; gene_id "g702"; 6 AUGUSTUS stop_codon 2781654 2781656 . + 0 transcript_id "g702.t1"; gene_id "g702"; # protein sequence = [MNIFASTSSDKGRTPTSNNVISSFIRRATSPLRSFESPPGPSIFPSISKKNTQESTLSRSSSRKNLNSGHSHSYMHSI # PDPHLLSPPTSPTRPVHTPSQRTAAKGSSSPVKFSSSSFKSSTQTSLSAMSNHDIFEDGGLFTSADIRRAISDLDEDAKNVLRAFDELEESALKRTKS # KNHSSRSHSAAPPSSFSLNLLSAPTMQHRSRSDSAATATVSGRSAASADDSLSRSGHPRLRSQSTTSIQPMTRLDPPHKSNSNLGTPHSTSSRTPTLH # RKGSVSSLASSIFSLKAKASMPSLPSLPSIPSISTMPSITRSRSGSVASSTTSSNPSNSVFSSSGKSVEGMPSMSTEWSSFGQGRSSTSTGASSIHTT # TSTSSTGRTSLSSGHGHTSSVTAAPPVHRSRSTSEFSSSNSSVQFRGNSTNSGRAGPSGHSKYRSGERERGRTKGDQDGLDDLDELDELGEIHQIQQR # KRDVIGRYDARREYLKARLRGAELHEKVVKGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g702 ### # start gene g703 6 AUGUSTUS gene 2784836 2785135 0.38 + . g703 6 AUGUSTUS transcript 2784836 2785135 0.38 + . g703.t1 6 AUGUSTUS start_codon 2784836 2784838 . + 0 transcript_id "g703.t1"; gene_id "g703"; 6 AUGUSTUS CDS 2784836 2785135 0.38 + 0 transcript_id "g703.t1"; gene_id "g703"; 6 AUGUSTUS stop_codon 2785133 2785135 . + 0 transcript_id "g703.t1"; gene_id "g703"; # protein sequence = [MPDIASMSAECTLESSNTGGCVYIGLADVDGTSLVTVTETGLPVSFYEVPISAATGSSVDSPSSSPTTTAKADNGATL # NQQISLLGSITVGLLGTCLIW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g703 ### # start gene g704 6 AUGUSTUS gene 2788170 2788838 0.92 - . g704 6 AUGUSTUS transcript 2788170 2788838 0.92 - . g704.t1 6 AUGUSTUS stop_codon 2788170 2788172 . - 0 transcript_id "g704.t1"; gene_id "g704"; 6 AUGUSTUS CDS 2788170 2788838 0.92 - 0 transcript_id "g704.t1"; gene_id "g704"; 6 AUGUSTUS start_codon 2788836 2788838 . - 0 transcript_id "g704.t1"; gene_id "g704"; # protein sequence = [MIETKLELVFLQRYQSNTTSTPTTPSEHRWSDVIPPKTALKFAVVWDSDDLVVFSGGELLEDSRTEELLLGSPLSPSD # ACSQAFSVGQSTMPLSDKSSTMLYFRDNMGSVLTENHPPPTSDSEKRMIWGRTQTSSTLEGLDVYLRGSLMGQAHRNNRYYSCLDNLDGQFEFDPRTS # FAKEYLRKVESKDIVDDAVTDEGFFEVEIAPRQHQILAKPSSRVRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g704 ### # start gene g705 6 AUGUSTUS gene 2793362 2794331 0.24 + . g705 6 AUGUSTUS transcript 2793362 2794331 0.24 + . g705.t1 6 AUGUSTUS start_codon 2793362 2793364 . + 0 transcript_id "g705.t1"; gene_id "g705"; 6 AUGUSTUS CDS 2793362 2793452 0.55 + 0 transcript_id "g705.t1"; gene_id "g705"; 6 AUGUSTUS CDS 2793581 2793760 0.54 + 2 transcript_id "g705.t1"; gene_id "g705"; 6 AUGUSTUS CDS 2793829 2794331 0.27 + 2 transcript_id "g705.t1"; gene_id "g705"; 6 AUGUSTUS stop_codon 2794329 2794331 . + 0 transcript_id "g705.t1"; gene_id "g705"; # protein sequence = [MEVEHQIAKLLVQLSKSQDDEIGDGTTGVVDGFDRACKVAVEELDRISDRVEFSKTDTSNLLKTAMTSLGSKMYVLLV # SQDGLFYEYPHPYLERRDVSFDLIKVDGKVGGSLADTTLIKGVLLDKDMSHQQMPRSVNDARLAILTCPFEPPRPKTKHKLEISSVDEYKKLQAYEKE # KFIDMIKRVKDTGANLVICQWGFDDEANHLLMQNDLPAVRWVGGPEIEVNHVFRSAAYNCSKHSSLLRSQHKVVLFLGSKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g705 ### # start gene g706 6 AUGUSTUS gene 2800158 2801063 0.49 + . g706 6 AUGUSTUS transcript 2800158 2801063 0.49 + . g706.t1 6 AUGUSTUS start_codon 2800158 2800160 . + 0 transcript_id "g706.t1"; gene_id "g706"; 6 AUGUSTUS CDS 2800158 2801063 0.49 + 0 transcript_id "g706.t1"; gene_id "g706"; 6 AUGUSTUS stop_codon 2801061 2801063 . + 0 transcript_id "g706.t1"; gene_id "g706"; # protein sequence = [MGKFYDLPVEIIEEILLQCDPIEVGIISCCSRLFYDLVYNSPGDSSQHIWRALYLAQPFDDPTRCVSQNGRPRVGQFD # WRSELQAIIRARTVLEDVSICKPHERIQVLKTLLNMVCWVPPLGSYGDIIENLSQNLLWVTAVTRGGVFLDPGKIGLPSDDPELAEEEAQLRARLHTT # IGLTPADYKPASRLAARAYIYNMRHYNWSNEFGPFLPSSTEGSGVGKVNWVHMKHIHHSMTMHMLELADDAGFEVVIYPLSFPYTQIIIPEGIDLDQE # DDWAGVNGVWTVSFCFVDHALLLREHH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g706 ### # start gene g707 6 AUGUSTUS gene 2806063 2807814 0.36 - . g707 6 AUGUSTUS transcript 2806063 2807814 0.36 - . g707.t1 6 AUGUSTUS stop_codon 2806063 2806065 . - 0 transcript_id "g707.t1"; gene_id "g707"; 6 AUGUSTUS CDS 2806063 2807113 0.83 - 1 transcript_id "g707.t1"; gene_id "g707"; 6 AUGUSTUS CDS 2807255 2807367 0.42 - 0 transcript_id "g707.t1"; gene_id "g707"; 6 AUGUSTUS CDS 2807448 2807591 0.5 - 0 transcript_id "g707.t1"; gene_id "g707"; 6 AUGUSTUS CDS 2807680 2807814 0.58 - 0 transcript_id "g707.t1"; gene_id "g707"; 6 AUGUSTUS start_codon 2807812 2807814 . - 0 transcript_id "g707.t1"; gene_id "g707"; # protein sequence = [MSVARGYSIISKCPSRGSGPDSRNNIIRKPSGKISIFGGYHSAYLDEGKSWSAADNIPAGEATMVIEHPFEKNYVRVL # AIIVVAMLMLKIGLCPSLLNRYLFTLIQRSTDTYSTKERPVIKLAGELYVMTNTVDFKHEAHSDLIYCVAFDTLEGMHSLSHSRLYSTTTFFDEDMTV # EDLGIGSKNAKGVFAFAIVAKYAVVALKDMSADNNGEMLLYVSVDTKTWAKAQFPHASSARLRENAYTIVESTTHSLAVDVVLQDQGTIGTLFVSNSN # GTFFVQSLKDTNRNDMGFVDFEKLFGVDGVGIANVVANAEEVEGRGASKLLKSVMTFDDGSNWSPIKPPSYDSSGARVNCNPGDDDCGLHLWSVTAPH # NFGRIFSSPAPGIVMGVGSIGKTLLPYEDCDTFLSTDAGLTWKMITKDAHKYEFGDSGSVIIAINDEDGVDNILYSLDMGVTWSVPSLALICVHLPFS # YTQEKLQSRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g707 ### # start gene g708 6 AUGUSTUS gene 2808930 2812346 0.04 + . g708 6 AUGUSTUS transcript 2808930 2812346 0.04 + . g708.t1 6 AUGUSTUS start_codon 2808930 2808932 . + 0 transcript_id "g708.t1"; gene_id "g708"; 6 AUGUSTUS CDS 2808930 2808932 0.44 + 0 transcript_id "g708.t1"; gene_id "g708"; 6 AUGUSTUS CDS 2809089 2809283 0.7 + 0 transcript_id "g708.t1"; gene_id "g708"; 6 AUGUSTUS CDS 2809449 2809574 0.98 + 0 transcript_id "g708.t1"; gene_id "g708"; 6 AUGUSTUS CDS 2810390 2810824 0.16 + 0 transcript_id "g708.t1"; gene_id "g708"; 6 AUGUSTUS CDS 2811828 2812346 0.51 + 0 transcript_id "g708.t1"; gene_id "g708"; 6 AUGUSTUS stop_codon 2812344 2812346 . + 0 transcript_id "g708.t1"; gene_id "g708"; # protein sequence = [MTKSARPDASSRDSPSLRRQITTLGGSTIFAFYFVRLLSCVALVVIGTIELVRSKSSVDTALIFIFGCISTWEIQGCA # TGWLRWKLHVGQNWVVVSSRSSSSAVRSKKTDDEDDQKASEAISSNYPSASASPSQSESDSSTPPDSGDEEDQRTLQSDTHSRAATNATEATDATDTT # LRPGSSSSSKVIKSKEPSKVSALALTTDSSKNPKSQKIKSEKAKNILGKLSNLVTTDMQNITDGKEALRLIIQVPIQTELLDTFQTHPHTTGSAASDE # LGIPVTAPPPPFPTQEIGFRNVTFSWSNDYSGHSDEYQSGLSTPTSTRSEPFEPSISSSITPTSQSPRSIKRQFTLKIPDEVIFQRNTINLIVGSTGS # GKTSMLMALLGEMHFIPHNSGLHQPWFNLPRGRGVAYAAQESWVQNATIKVSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g708 ### # start gene g709 6 AUGUSTUS gene 2812698 2813424 0.22 + . g709 6 AUGUSTUS transcript 2812698 2813424 0.22 + . g709.t1 6 AUGUSTUS start_codon 2812698 2812700 . + 0 transcript_id "g709.t1"; gene_id "g709"; 6 AUGUSTUS CDS 2812698 2812949 0.22 + 0 transcript_id "g709.t1"; gene_id "g709"; 6 AUGUSTUS CDS 2813032 2813424 0.82 + 0 transcript_id "g709.t1"; gene_id "g709"; 6 AUGUSTUS stop_codon 2813422 2813424 . + 0 transcript_id "g709.t1"; gene_id "g709"; # protein sequence = [MLLTALLVSSVHTSKWIVEKCFKGDLVKDRTILLVVSVGVSTPPLQALLNVTVPPHYTAPYSHFYDYLQVLVDTQYLP # NSSHCRVDGSSAENVENVETIETIEQIEDEIAGNHDGSGGSNGEGDGTKSKKSPPVEGQGKLIVAEEIQIGNVGWPAGLCFSNSHFHTLITFISSAIA # HKRARRTTRYPIRRLRVRQFPTLGVGRDLPDMVSWYLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g709 ### # start gene g710 6 AUGUSTUS gene 2825216 2825797 0.68 + . g710 6 AUGUSTUS transcript 2825216 2825797 0.68 + . g710.t1 6 AUGUSTUS start_codon 2825216 2825218 . + 0 transcript_id "g710.t1"; gene_id "g710"; 6 AUGUSTUS CDS 2825216 2825797 0.68 + 0 transcript_id "g710.t1"; gene_id "g710"; 6 AUGUSTUS stop_codon 2825795 2825797 . + 0 transcript_id "g710.t1"; gene_id "g710"; # protein sequence = [MNVAKQHHKALMADRSLPIAKALEPLMSVAQMTLTNFDKVFLSQVGGPPPQFPYATVNEYYNAMSSHECVGGITIPYL # AINSADDPVVQYVPMHGAGNGFAVMVLTSGGGHLGWFNDSSGKDRWTTKPVLEWLQLMGEGVVCQAGGERGHKIILWEDGFLRNEGGNDDLGCKECEG # GGLINGNAGVEGLRKGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g710 ### # start gene g711 6 AUGUSTUS gene 2828320 2830101 0.85 - . g711 6 AUGUSTUS transcript 2828320 2830101 0.85 - . g711.t1 6 AUGUSTUS stop_codon 2828320 2828322 . - 0 transcript_id "g711.t1"; gene_id "g711"; 6 AUGUSTUS CDS 2828320 2830101 0.85 - 0 transcript_id "g711.t1"; gene_id "g711"; 6 AUGUSTUS start_codon 2830099 2830101 . - 0 transcript_id "g711.t1"; gene_id "g711"; # protein sequence = [MTEEEVKEYEKERAKEAKEKEREQVTERQRERSRMQQQAIEREKDRERATQQGKSEPGEIKEIVGRLGALEGLVKTDI # SGRVSKVEDVVGGFNRIQERKEKEERERQARLAVEAKEAREAREREERFKERLERDVREREQKERERDQREREKENQRQKEEKERQQREERERLVLNQ # VKKEMESLKSVIGALQSQPSSGSGSSSVGSDIEARTQLALLEERIGSIEGGVKEALDLGNNALKTIKSSSQHPDSQSNWWSKISPSSSSKSGLTIKST # DGQDVTSLLTHLVSSAVSSAISIHSKDSIARADYALHSGGARVIPSLTSDTFALRIPSTFTSQLLGLIPFSGSGFGFGGPGSVAVGRPPVWALHPDIT # NGLCWPFPGSHGQLGIALAAPVVVDSVTIDHVAAETAYEDGLVEVEEEGQDGDEDVEDGHVDKTNRRRSKRRSAPREMEVWGLVEGRENIHKVKEWRE # GLITQRQAKNAARERGEEQDFNHLDDLLGTSELDVPYPSTLPKSPTYIRLASFTYDIHSPSHIQTFPVLPYLSKYGKLGEAGVDFGVVVLVVRSNWGM # EEYTCLYRVRVHGERGMIGGIEESW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g711 ### # start gene g712 6 AUGUSTUS gene 2830801 2831889 0.83 - . g712 6 AUGUSTUS transcript 2830801 2831889 0.83 - . g712.t1 6 AUGUSTUS stop_codon 2830801 2830803 . - 0 transcript_id "g712.t1"; gene_id "g712"; 6 AUGUSTUS CDS 2830801 2831689 0.86 - 1 transcript_id "g712.t1"; gene_id "g712"; 6 AUGUSTUS CDS 2831741 2831889 0.83 - 0 transcript_id "g712.t1"; gene_id "g712"; 6 AUGUSTUS start_codon 2831887 2831889 . - 0 transcript_id "g712.t1"; gene_id "g712"; # protein sequence = [MSFAGTPLGQGRRLDHQTFLGKPPSSNGSTGNNNPQTQRITPVPTSYSSGAPPLGSRSPPKPSSSRERVDTTNLNPEK # WSVRDTSVNAASAIYQAMSNPNTAWASSSRTARTSNPPRSTSVEYESQASNNARRLGAPPSRLGSKTNNKPLSMNSSSRSIVPDSEGEQSQSQILDYS # REKSPFSFDQLTNLAQTAIQKTSYFVREKQREDQQPNGNASYDYSAEEREYQQYERNVNANASSSKNLSSSAVHRKNRISTDNKAYKPSQEELEESSD # DDVSDTRRRRRKKGASGPAGGPLTTLPKVGPEKRRKKGSRKTKGGAANGEEEDEEEETDKEQVKPKSNSYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g712 ### # start gene g713 6 AUGUSTUS gene 2837424 2838326 0.68 + . g713 6 AUGUSTUS transcript 2837424 2838326 0.68 + . g713.t1 6 AUGUSTUS start_codon 2837424 2837426 . + 0 transcript_id "g713.t1"; gene_id "g713"; 6 AUGUSTUS CDS 2837424 2838326 0.68 + 0 transcript_id "g713.t1"; gene_id "g713"; 6 AUGUSTUS stop_codon 2838324 2838326 . + 0 transcript_id "g713.t1"; gene_id "g713"; # protein sequence = [MDENEIIDISSDESENGSAGDTDGKREFLEPIVQGVVDALGGYEENVYRMGDQVNGCLKDLKKLWRKDETDDDRTVAR # IFWKTRVLPNDLVPILLATAGQGLVEDKRAIACADLMTAMTWPIDLAEELKELDDQLDSKADYTELLQSHLHYKAAVLKPGVLEALFGIVLPPLTKGP # QERTERDGQIVNVVLHLVRNLAFIKDLPANTFLSADHAEFSSMQSKLIRMLSDSHILQLVLTIAANSDNDPLFDSWNTIVLEIIYLSLRGVQPSSLSM # DQSKVCIITLLTIRYHKLATCILAPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g713 ### # start gene g714 6 AUGUSTUS gene 2839475 2841453 0.61 + . g714 6 AUGUSTUS transcript 2839475 2841453 0.61 + . g714.t1 6 AUGUSTUS start_codon 2839475 2839477 . + 0 transcript_id "g714.t1"; gene_id "g714"; 6 AUGUSTUS CDS 2839475 2839582 0.98 + 0 transcript_id "g714.t1"; gene_id "g714"; 6 AUGUSTUS CDS 2840050 2840227 0.86 + 0 transcript_id "g714.t1"; gene_id "g714"; 6 AUGUSTUS CDS 2840329 2840473 0.89 + 2 transcript_id "g714.t1"; gene_id "g714"; 6 AUGUSTUS CDS 2840540 2840693 0.88 + 1 transcript_id "g714.t1"; gene_id "g714"; 6 AUGUSTUS CDS 2840755 2841453 0.78 + 0 transcript_id "g714.t1"; gene_id "g714"; 6 AUGUSTUS stop_codon 2841451 2841453 . + 0 transcript_id "g714.t1"; gene_id "g714"; # protein sequence = [MIPKGDEEVPEEEEPQQQDDDDVVHETMFTFEAFEMAFFPKNRGNWKQYSSWEPPPKGGKSKSVEDIRFPQEVQVKKG # YSWSDQVGITIASLVEAAKAERERIIEEVDKKGGDDSDEDVDDTDTQSKLLGPSVDTQAKLTDYRDDEHADAATKNPNLKLLFRLSKCYILDEGTFRL # SDIREIKLMVGFRRRRTGVFLETPFDLEGKKASQLMSKKSRRRRRVKAPELDADEDEDEPRQQKKKEKKKKEEVQYKSAQFIEDSDAEYGDIDSFLEL # EKKRREKTESAAAALGEGRSGAMKSTGTKKRRRKAGDTGKSVTGQKKRKGAEDAVEIAPADNSESSSEDESETHGRTNDDEERVAKGGTAEATIEKPR # PRPRPKPKAPPLDDSMIQSFLLSQADGEDQAESGFPPTKAGSRKKGRLIISDEDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g714 ### # start gene g715 6 AUGUSTUS gene 2849024 2850520 0.99 + . g715 6 AUGUSTUS transcript 2849024 2850520 0.99 + . g715.t1 6 AUGUSTUS start_codon 2849024 2849026 . + 0 transcript_id "g715.t1"; gene_id "g715"; 6 AUGUSTUS CDS 2849024 2850520 0.99 + 0 transcript_id "g715.t1"; gene_id "g715"; 6 AUGUSTUS stop_codon 2850518 2850520 . + 0 transcript_id "g715.t1"; gene_id "g715"; # protein sequence = [MADQNRVAKLDKLLGNVLNGKATISTATQSKQFIEAICAQADHAGCVDRIIAAGSQGLGAIQASLRTDLSSAFFDGPA # TTLLTYLQDPTIKAISGGRFLEKILQAIVDPPIFWTPFVEAFRNRGLSEPTQKCFSWLLLQLMKSSTDATSPYLSIALDVEPLMAKSHILDVRNFSAG # IRNVISVLSAPPTTTSTTQEDHPPGGRHDNDFKDFRAIAILPTSDEIACATPPFLRISSALDDPDTEEFREAIYLDHFFRLTREEMINEMREELQLAL # GKQPRKNHCGLTVNGMKLVGVDIGGDERRAKWGLVFECLKDWPQLASLDSEKRISFFKAKENQKILKNGSLCVFVIGDKAVAFPTIRRDETLLAKKPP # RIVLELGGESAVTELLLKTQVTTSVRLIPINTAIFAFEPILNTLKRMKTLPLVDEILFWNPDKPLRGPSYPFPLEQAISNISRNPQTDVGAMLELGKK # IVLDDAQAKSLLSGLKQNLSIIQGPPGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g715 ### # start gene g716 6 AUGUSTUS gene 2850767 2851450 0.8 + . g716 6 AUGUSTUS transcript 2850767 2851450 0.8 + . g716.t1 6 AUGUSTUS start_codon 2850767 2850769 . + 0 transcript_id "g716.t1"; gene_id "g716"; 6 AUGUSTUS CDS 2850767 2851450 0.8 + 0 transcript_id "g716.t1"; gene_id "g716"; 6 AUGUSTUS stop_codon 2851448 2851450 . + 0 transcript_id "g716.t1"; gene_id "g716"; # protein sequence = [MLLRNQPRSYRFSKGDNSIITQLKADGELRGLGLQQSFDSFIQSSVGDADLLVHLEFEEPEFFEAFSVPVSEDGMATV # GKGGRAVNEFYLVNRWRQGQDAGVFRRQQNILNSTHIWNIAKADRKALEDKWVQEILTEKIDTLYKQARRYNETQIELEQKFRERDVAVMKSKRIIGC # TTTAAAKYASDLHEVGINVLLVEEAGEILESHVITALSSSIEQVILIGDHK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g716 ### # start gene g717 6 AUGUSTUS gene 2852739 2854273 0.4 + . g717 6 AUGUSTUS transcript 2852739 2854273 0.4 + . g717.t1 6 AUGUSTUS start_codon 2852739 2852741 . + 0 transcript_id "g717.t1"; gene_id "g717"; 6 AUGUSTUS CDS 2852739 2853241 0.52 + 0 transcript_id "g717.t1"; gene_id "g717"; 6 AUGUSTUS CDS 2853391 2854273 0.42 + 1 transcript_id "g717.t1"; gene_id "g717"; 6 AUGUSTUS stop_codon 2854271 2854273 . + 0 transcript_id "g717.t1"; gene_id "g717"; # protein sequence = [MKRQQEEQEHHKQLKELEQKISEQQELARDAQSKRQRDNELQQKAADVEEAKTLTQRAISLAQQIRQQVFPTFTTAST # DPLKPPQPPTQRATTSSDTTQRLPAVLTSPSSNSKLSSESEDRWQYKKNIEGVNNQAVDAILKMTGLEKVKSEVLKILDSIEVKQRQGARSVGVISGS # AFEETTGSKLASDGVKNTEALLDKVKNAGGGVIFIDEAYQLVSGAYGGKEVLDFLLAEMENNIGRLVFILAGYNKQMEKFFEHNPGIPSRVPHTFHFH # DYSDDELRLMFERKLHEKFDGRLKVEAGVHGLYGRIAIRRLGRGRGREGFGNARALENLVSIILKRQASRITKERTSGTRPDYLQLVKEDLIGPDPAT # AILQCGSWTKLQELTGLNSVKRSIEDLYDIIWRNYARELNEEEPLQMTLNKCFIGSPGTGKTTVAKLYGQILVDLGLLSNGEGEYLMNC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g717 ### # start gene g718 6 AUGUSTUS gene 2855321 2856700 0.95 + . g718 6 AUGUSTUS transcript 2855321 2856700 0.95 + . g718.t1 6 AUGUSTUS start_codon 2855321 2855323 . + 0 transcript_id "g718.t1"; gene_id "g718"; 6 AUGUSTUS CDS 2855321 2856700 0.95 + 0 transcript_id "g718.t1"; gene_id "g718"; 6 AUGUSTUS stop_codon 2856698 2856700 . + 0 transcript_id "g718.t1"; gene_id "g718"; # protein sequence = [MGEVYFDLGLLSSAEVHECSASDLVAQYVGQTGPRVQDAFKRAAGKVLFIDEAYRLGQGHFSQEAVDEIVTLLTDERY # KGKIVVILAGYSEDINQLLSSNRGLSSRFTEEVIFNNLQPKECMSILVNDLAAKKVMLAGIDDATKEIHQNVLELFNEFISLNDWGNARDVKTLAKKM # IEKTFVRNVTIGDSLVLSSEDALDVAKDMLADRRSRMVVSPGSTRHKGTDAPVQLAPIVPPQAPPPPSVGTNTATSAAPQKRQRERRRQPKKAQQLTK # DTESDGSGSSAPKQNPRRNADEPKHVQSGYDARRDSGVSDEVWAELQKAKAEQEANKVRAQKKLDAAIKAAVDAAKKATEERRRVQALAEKIKKEQDR # LKKEELERQRKEQLIKEKEAIRRRKEKEERLKAEKEAQERAKRKEEEAQKKLQQMGVCVAGFRWIPCGTGYRCAGGYHFVSNSELQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g718 ### # start gene g719 6 AUGUSTUS gene 2857082 2858698 0.74 - . g719 6 AUGUSTUS transcript 2857082 2858698 0.74 - . g719.t1 6 AUGUSTUS stop_codon 2857082 2857084 . - 0 transcript_id "g719.t1"; gene_id "g719"; 6 AUGUSTUS CDS 2857082 2858698 0.74 - 0 transcript_id "g719.t1"; gene_id "g719"; 6 AUGUSTUS start_codon 2858696 2858698 . - 0 transcript_id "g719.t1"; gene_id "g719"; # protein sequence = [MLILIRTSTARSSMIYTWVLVCHYLPLVDTLPLTAGWVDVWGRGSHGNGGFGSFKAISHIAPSSLGLSVALFGQAWTW # ESEQDKPGWNWDSWWTYERKLWAGKADPAEEITVPVMPPLKNGESPCEVGVHDVFTPIVSYFQRTPPPDPLLLPFHTTFSPGVGRRWFVKGREVFHRP # EGWTDIDKQTSLGDMVWPKPIVSWEGEIMDPEGLDLPNAKSQICMDNAWNGGSSLRLSLVAFGTESENAAFRCIWIPVQSLATSVGRMYEASAVYKLE # TDVAGVDIDVALSIKGSESSPTTRYPKFDIESLPSEDMDLGRGWSLLKIRFNLGNSIIGDINRLSSMGLVITIVSEETTQPLAFSLLLGQLNVYPSIP # YSIPPHVTSLLWAHFSPSEPETTSFPNVPASLGVLTWEISTSFPSHALPRITSPDDPLAAWPAQPSAEAWFPKLLYANVYALEYQTDGTPSKVEDAIW # IGTSGCGYEGMRNTFIVQSGIALSSTPDTATVGEGVLRIGNGKMRFYVQGVTETGNVLDWTRCVYIDM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g719 ### # start gene g720 6 AUGUSTUS gene 2861099 2862115 0.99 - . g720 6 AUGUSTUS transcript 2861099 2862115 0.99 - . g720.t1 6 AUGUSTUS stop_codon 2861099 2861101 . - 0 transcript_id "g720.t1"; gene_id "g720"; 6 AUGUSTUS CDS 2861099 2862115 0.99 - 0 transcript_id "g720.t1"; gene_id "g720"; 6 AUGUSTUS start_codon 2862113 2862115 . - 0 transcript_id "g720.t1"; gene_id "g720"; # protein sequence = [MVAFTGYGAQSRRQRKLIGLAFSKERIPAYQGLIERETAGFLTGLVSAHTSSASTASSSSQPLPSRFLSYIPLIRRYA # GQLTLSVIYGYTVPTSYTQNVHDKFLDMAEDCVDILSNKIASGGGIWLVDIFPWLKKAPKSLESIPLFSFLPKSRAWKAKMVEFVEKPFEWVKAEIEK # GTQKPSFCSTLLENSDAVVPSAVTNGHMKRKSDISPELLSSWALASSAVAKPVTANAKEYAQFEFDLKWTANSMYSASGDTTVTTVMHYFLAILQDMD # TGGEVVRKARLELDLVTGLGRSNCQISSVDLIPDIPVFTPFHSGRLSSSNQTPSSKFIGSIRRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g720 ### # start gene g721 6 AUGUSTUS gene 2864476 2864735 0.58 - . g721 6 AUGUSTUS transcript 2864476 2864735 0.58 - . g721.t1 6 AUGUSTUS stop_codon 2864476 2864478 . - 0 transcript_id "g721.t1"; gene_id "g721"; 6 AUGUSTUS CDS 2864476 2864556 0.58 - 0 transcript_id "g721.t1"; gene_id "g721"; 6 AUGUSTUS CDS 2864640 2864735 0.58 - 0 transcript_id "g721.t1"; gene_id "g721"; 6 AUGUSTUS start_codon 2864733 2864735 . - 0 transcript_id "g721.t1"; gene_id "g721"; # protein sequence = [MKKSEVNGDNTNEVYQFLKSQKSGILGLTRIKGNVVNRWASTTTPQAIDGDIAKLVAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g721 ### # start gene g722 6 AUGUSTUS gene 2868611 2869111 0.36 - . g722 6 AUGUSTUS transcript 2868611 2869111 0.36 - . g722.t1 6 AUGUSTUS stop_codon 2868611 2868613 . - 0 transcript_id "g722.t1"; gene_id "g722"; 6 AUGUSTUS CDS 2868611 2869111 0.36 - 0 transcript_id "g722.t1"; gene_id "g722"; 6 AUGUSTUS start_codon 2869109 2869111 . - 0 transcript_id "g722.t1"; gene_id "g722"; # protein sequence = [MDISFARQRMFYARPNFTPSRYIVVGLPLNRKDQTWYNPPKLTDIVDVLNRLQLSFGSKIVQDPDVHAQAEKSRRFSK # YVFPRQYGLANASMFEVSKYEPSYIPDFADRDSEIEVITLSLEIIQCDLNIFTDAGSMQDSKESKGGFTTFGKVNMEAREVQVSIVTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g722 ### # start gene g723 6 AUGUSTUS gene 2875129 2876025 0.73 + . g723 6 AUGUSTUS transcript 2875129 2876025 0.73 + . g723.t1 6 AUGUSTUS start_codon 2875129 2875131 . + 0 transcript_id "g723.t1"; gene_id "g723"; 6 AUGUSTUS CDS 2875129 2876025 0.73 + 0 transcript_id "g723.t1"; gene_id "g723"; 6 AUGUSTUS stop_codon 2876023 2876025 . + 0 transcript_id "g723.t1"; gene_id "g723"; # protein sequence = [MISGNRSSLADSEVKAHLLPSVLPNPIDARVQRVRRSESFYNPPYSASNDNHPFVASARTPPSTRQAFKRAPSYGALV # QEAREREKEKRSNGAVPHIYGSKSREEMNVSPCPSSDEEEKLRNNQAKKVKGPGGKASRSPAASLPPDSPSSDQGKAKKRTKAKDAVCSESKATSSRL # KSPPPASISAVVPTQPLGRPGPQMNLQHSSIFGEELPHLHIPAAPSRPIPSASSSSCNPRHTATPSQPAGPPRKTLRRVKRLAPSRKISFGSLVAPNG # NDTDVEEDDKGGQHPKLGSAFQLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g723 ### # start gene g724 6 AUGUSTUS gene 2880993 2881313 0.94 - . g724 6 AUGUSTUS transcript 2880993 2881313 0.94 - . g724.t1 6 AUGUSTUS stop_codon 2880993 2880995 . - 0 transcript_id "g724.t1"; gene_id "g724"; 6 AUGUSTUS CDS 2880993 2881313 0.94 - 0 transcript_id "g724.t1"; gene_id "g724"; 6 AUGUSTUS start_codon 2881311 2881313 . - 0 transcript_id "g724.t1"; gene_id "g724"; # protein sequence = [MSTSTSSNNAAAGPSSKASKGKRSPSPPTILDAELEKLLSREASAFQREVEVERILKAFKLKWVRYVQGTASIPNESS # RSPYDILDLDETATQDDIKKKYRQLSLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g724 ### # start gene g725 6 AUGUSTUS gene 2885994 2886443 0.44 + . g725 6 AUGUSTUS transcript 2885994 2886443 0.44 + . g725.t1 6 AUGUSTUS start_codon 2885994 2885996 . + 0 transcript_id "g725.t1"; gene_id "g725"; 6 AUGUSTUS CDS 2885994 2886443 0.44 + 0 transcript_id "g725.t1"; gene_id "g725"; 6 AUGUSTUS stop_codon 2886441 2886443 . + 0 transcript_id "g725.t1"; gene_id "g725"; # protein sequence = [MLSPAYPPDIHQVVSDLIKGIISMATPSPGAGLTTNGPAASNTAMSDGGGSGVSSNQFARELAREDSVSKLVAYMLQD # FSTSLSESESTLSPDSVRATHFESASSSSIHAMGVLTELIRKNNSDYFEPYLFHTLRNRLIGVQQAMIQQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g725 ### # start gene g726 6 AUGUSTUS gene 2887080 2888347 0.23 + . g726 6 AUGUSTUS transcript 2887080 2888347 0.23 + . g726.t1 6 AUGUSTUS start_codon 2887080 2887082 . + 0 transcript_id "g726.t1"; gene_id "g726"; 6 AUGUSTUS CDS 2887080 2887532 0.23 + 0 transcript_id "g726.t1"; gene_id "g726"; 6 AUGUSTUS CDS 2887637 2888347 0.95 + 0 transcript_id "g726.t1"; gene_id "g726"; 6 AUGUSTUS stop_codon 2888345 2888347 . + 0 transcript_id "g726.t1"; gene_id "g726"; # protein sequence = [MDTEIEPALELPISSASSTSNASSLLDSDEDEDMSASSEDDSMDMEEIAMYDEPQMQSTAEPPPLSPEVDMHAAEPTE # SNSVPPSVSAENIGPLRHGSVSSLPTRRNSRRSTLPSASAPSAEAPLVVGERLKKRFLELNVLGVLLVSGSISILTGQVDTSSHYREDIEKPSTQTDE # HDSERRSEGSRGYNRELILSLFRDAQLMHKIVEGQRRNDEESAKPRTPRLGYMGHLTLISEDVLTALDRYPASLRDEIMQYAPKGLDTEHGKGSWDEY # VTGRYRETKVRDTRLLGGGKPAVGLSGINSGGGMGDVATKWKVDEEEMGGIQATVGAASSPTLDNKPINNEMRGEFRRSVSSKPRREGSADFGVAPTT # MDDDDDDDFVAGHSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g726 ### # start gene g727 6 AUGUSTUS gene 2888628 2889167 0.96 + . g727 6 AUGUSTUS transcript 2888628 2889167 0.96 + . g727.t1 6 AUGUSTUS start_codon 2888628 2888630 . + 0 transcript_id "g727.t1"; gene_id "g727"; 6 AUGUSTUS CDS 2888628 2889167 0.96 + 0 transcript_id "g727.t1"; gene_id "g727"; 6 AUGUSTUS stop_codon 2889165 2889167 . + 0 transcript_id "g727.t1"; gene_id "g727"; # protein sequence = [MYFTIPFYLEYITYTNARFLSSSQDDFGPFTAPTASSSSIPSNSDDPFPSFSSSFTDEMALEGMDNLDDSAFDDNFGD # FGDFGEFQTGGTASDSSEPPSLNHPTVDVRGDGEESLDGELTPTAGSWISDLSASEGSLGSISSSIDSISSPEGVNAGLDLTGTGVETSESTEQSARE # AKH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g727 ### # start gene g728 6 AUGUSTUS gene 2892517 2893149 0.5 - . g728 6 AUGUSTUS transcript 2892517 2893149 0.5 - . g728.t1 6 AUGUSTUS stop_codon 2892517 2892519 . - 0 transcript_id "g728.t1"; gene_id "g728"; 6 AUGUSTUS CDS 2892517 2893149 0.5 - 0 transcript_id "g728.t1"; gene_id "g728"; 6 AUGUSTUS start_codon 2893147 2893149 . - 0 transcript_id "g728.t1"; gene_id "g728"; # protein sequence = [MVRVKDGKKYGVLNDWDLAMWLDERDGISISQFRTGTRPYMAHEQHSPDWEGPHRYRHDMEALFYVILLLATLFSNPS # EKDDEHSKKRQPYTKWFTEGDEFLRVKKISIIFVASWQPTLTHFFRPFHGWLKRLHDTMNDGFLALHAYIVRQRDAQRQILQFDDDTLNGHFSYDRLV # WIMHQFGEEKLETHGREWQGKLQELQQAEDENKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g728 ### # start gene g729 6 AUGUSTUS gene 2899220 2899852 0.42 - . g729 6 AUGUSTUS transcript 2899220 2899852 0.42 - . g729.t1 6 AUGUSTUS stop_codon 2899220 2899222 . - 0 transcript_id "g729.t1"; gene_id "g729"; 6 AUGUSTUS CDS 2899220 2899852 0.42 - 0 transcript_id "g729.t1"; gene_id "g729"; 6 AUGUSTUS start_codon 2899850 2899852 . - 0 transcript_id "g729.t1"; gene_id "g729"; # protein sequence = [MVRVKDGKKYGVLNDWDLAIWLDERDGNSTSQFRTGTRPYMAHEQHSPEWEGPHRYRHDMESLFYVILLLATLFSNPS # EKDDEHSKKRQPYTEWFTQDDEFLRLNKTDIIFRASWQPTPTLFFSAFHGWLKRLHDAMTDGFLASEAYDNRPNDQLRQISYFNNDTLDGHFSYDVFV # LIMHQFSEERLATHGCEWQRKLRGLQKDEDERKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g729 ### # start gene g730 6 AUGUSTUS gene 2903027 2904004 0.75 - . g730 6 AUGUSTUS transcript 2903027 2904004 0.75 - . g730.t1 6 AUGUSTUS stop_codon 2903027 2903029 . - 0 transcript_id "g730.t1"; gene_id "g730"; 6 AUGUSTUS CDS 2903027 2904004 0.75 - 0 transcript_id "g730.t1"; gene_id "g730"; 6 AUGUSTUS start_codon 2904002 2904004 . - 0 transcript_id "g730.t1"; gene_id "g730"; # protein sequence = [MYQCQHQHPKIIELPGHLSTASSGFRPEDNDTQAHLSSSSSTNLSIDAYLSDPEIVRGRSEKILPVPVTPERKAISDS # ALAKAQSTPFSHHSSSYSAPALSNDEQYKVEEANKYLMGDLANVRTLPVKEWASLSLNLDVDKDTYQLTENIKKTFQDYLKAVKNAKNERDKELYKSL # IALLNELRGNSENMVFYKQDAIPVRGSLVKQTPDIGAIFKELVESRDLLALPHASDEKIFWGLILIFVEVKHDYGKMIRDDCGLLHYKLDFFSYADIP # LQSVPMQTGVPTKEKPLRVPGADKSEYENQVCPDISLCSPLIQIFVIRFVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g730 ### # start gene g731 6 AUGUSTUS gene 2909310 2910326 0.79 + . g731 6 AUGUSTUS transcript 2909310 2910326 0.79 + . g731.t1 6 AUGUSTUS start_codon 2909310 2909312 . + 0 transcript_id "g731.t1"; gene_id "g731"; 6 AUGUSTUS CDS 2909310 2910326 0.79 + 0 transcript_id "g731.t1"; gene_id "g731"; 6 AUGUSTUS stop_codon 2910324 2910326 . + 0 transcript_id "g731.t1"; gene_id "g731"; # protein sequence = [MNTHILTDVDTETISDSTSPSTSSIRQLPSEASIISTFDFNAPETPASSSTIMISTDNTGTSFEQLDVRDVLDLSSLS # SLGSLQNLARMSSPVGPATAVDPPSDLGSVHPNNNPFLDPNSSPLTTVHASSPLNHSTYPTYPSYPTTQPNMWSSNPSISESNTSSPSMIPSLSLSYP # IPRADIEDGVVLLSPPSSDAYSSYSVPTSRAMSPAVSEAFTSLSGVSEVSRMSMPASASASVESLSEFSDFSVLESASDRSGPASRIASPLLSTGTNS # RPAQQAIQTMSITGGRPPSMSRLGGSSLSVGNDREERTPTGRYLSREEIQHLIDTHSTRRNREA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g731 ### # start gene g732 6 AUGUSTUS gene 2910787 2911779 0.54 - . g732 6 AUGUSTUS transcript 2910787 2911779 0.54 - . g732.t1 6 AUGUSTUS stop_codon 2910787 2910789 . - 0 transcript_id "g732.t1"; gene_id "g732"; 6 AUGUSTUS CDS 2910787 2911231 1 - 1 transcript_id "g732.t1"; gene_id "g732"; 6 AUGUSTUS CDS 2911307 2911779 0.54 - 0 transcript_id "g732.t1"; gene_id "g732"; 6 AUGUSTUS start_codon 2911777 2911779 . - 0 transcript_id "g732.t1"; gene_id "g732"; # protein sequence = [MNKGICIDSTSHSITPSRPQLLTMLDDSLATLKATSESWPIGNGAEPAGPRSSFLPDGTTPPPAAYPRNFSFYYDYRS # FLVGSFHLSTCTFLRGIPQVEGVLFRFPINLLAKESLVFRDMMEVPAPLQTEGLTDENPIHLDGVSNADFVQLLTILAPPQRFKDPTPKLTFDEWTSV # LKLSDMWCMDVVKEHAISTMNSLSGVDPVDKVVVARKYGITSWLTPTINVIIQRSEPWSERDVERLGLSTVLKLAEFRDRLQPRSQYGYGFDWELVTQ # RRETSVDFSGVIMAELPDFQGMLYPKRIPLY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g732 ### # start gene g733 6 AUGUSTUS gene 2912782 2913243 0.32 - . g733 6 AUGUSTUS transcript 2912782 2913243 0.32 - . g733.t1 6 AUGUSTUS stop_codon 2912782 2912784 . - 0 transcript_id "g733.t1"; gene_id "g733"; 6 AUGUSTUS CDS 2912782 2913243 0.32 - 0 transcript_id "g733.t1"; gene_id "g733"; 6 AUGUSTUS start_codon 2913241 2913243 . - 0 transcript_id "g733.t1"; gene_id "g733"; # protein sequence = [MWCMDVVKEHAISNMNNLADIDPIDKIVVARKYEIKAWLKPAFNDVLQRSKTFTEDDVERLGVSTLLQLVALRDRLQL # VKSYDETSYSLKPQRQAVSFDFTPAIELNLPDFKGMLCDFDSSSKTSRFLLHRFQLALPGIKEKPGNLLEEAKEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g733 ### # start gene g734 6 AUGUSTUS gene 2916958 2918369 0.29 + . g734 6 AUGUSTUS transcript 2916958 2918369 0.29 + . g734.t1 6 AUGUSTUS start_codon 2916958 2916960 . + 0 transcript_id "g734.t1"; gene_id "g734"; 6 AUGUSTUS CDS 2916958 2917659 0.57 + 0 transcript_id "g734.t1"; gene_id "g734"; 6 AUGUSTUS CDS 2917932 2918369 0.96 + 0 transcript_id "g734.t1"; gene_id "g734"; 6 AUGUSTUS stop_codon 2918367 2918369 . + 0 transcript_id "g734.t1"; gene_id "g734"; # protein sequence = [MEVYLNTLISDTAQYRSQLNATSRVIIVDESRMTMGIANAFKSTNEPLGVSVGLHPKDQSIIALSVFDAQNKCLVVEF # STQLGLRSNTTGQLGGRPSSPNFDASKVRAMIQEILCQPPGFYAFDLGPLALALYRELGIRVADGIDIQSVFPESRKTPADAISAIIGSDAGIRVDVD # RVVSVFEDLTYYQVDPKFTSRTALVQRAWISQFLAGFESAPEEFQAIRRIDTTTQSDNNLDLTVQNEHGTFIIPGNTGGVVGRRAPLNISRELGSSNQ # VVGKILSKGRDILTNADEKKAAAVLRMLQGEGDFGNIWVTNIWDPPNGTMSWPKSFTHSPPITVPEVPNRPLNSSQIFAIAKMLSLESDNHIILIRGP # PGSGKTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g734 ### # start gene g735 6 AUGUSTUS gene 2920907 2921404 0.42 - . g735 6 AUGUSTUS transcript 2920907 2921404 0.42 - . g735.t1 6 AUGUSTUS stop_codon 2920907 2920909 . - 0 transcript_id "g735.t1"; gene_id "g735"; 6 AUGUSTUS CDS 2920907 2921404 0.42 - 0 transcript_id "g735.t1"; gene_id "g735"; 6 AUGUSTUS start_codon 2921402 2921404 . - 0 transcript_id "g735.t1"; gene_id "g735"; # protein sequence = [MCLCLDRENHSIVLPSSSSSLPQPSSISQASLDSHLHAIRSVPSNVSNRFFDKPYSIIVDPSGRAGAMGEHSPADALV # PSIVGEYAVVQHVEMTQSYASAEHSATNGSWSRLEWVVDDESLEAIRAARARAEANIKNSDDSLLWFEEYGSDWIKSVGLFDFIYIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g735 ### # start gene g736 6 AUGUSTUS gene 2923050 2923316 0.5 + . g736 6 AUGUSTUS transcript 2923050 2923316 0.5 + . g736.t1 6 AUGUSTUS start_codon 2923050 2923052 . + 0 transcript_id "g736.t1"; gene_id "g736"; 6 AUGUSTUS CDS 2923050 2923316 0.5 + 0 transcript_id "g736.t1"; gene_id "g736"; 6 AUGUSTUS stop_codon 2923314 2923316 . + 0 transcript_id "g736.t1"; gene_id "g736"; # protein sequence = [MVHAKPKPTPNPSTQKISNKSSKSKPPKIQSDTSSNVKTSSYSQATANPNIHRERAKRWGTNPFMAEWFANAVEYMKA # PKAQFDFEDW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g736 ### # start gene g737 6 AUGUSTUS gene 2925319 2926017 0.53 + . g737 6 AUGUSTUS transcript 2925319 2926017 0.53 + . g737.t1 6 AUGUSTUS start_codon 2925319 2925321 . + 0 transcript_id "g737.t1"; gene_id "g737"; 6 AUGUSTUS CDS 2925319 2926017 0.53 + 0 transcript_id "g737.t1"; gene_id "g737"; 6 AUGUSTUS stop_codon 2926015 2926017 . + 0 transcript_id "g737.t1"; gene_id "g737"; # protein sequence = [MHHSPEYAGFRAQQRPGFDEGEEFNAFFDKTWYDADKWCWERAGELDPPNGRSADGSKEKGKGTVARMFGLYDVQDNT # RPSWWNFKTLMKIARELEDSSLVEKEKAESAAKPRSAVSMIPVATGPRDTAVYSGHAYAAGNVGTDATKDKVKTRPSVMVVDEPEGPEGGKGSKDPIS # GDEEGEEVEEYSVPEFLPKQFKLPKKVHKVHWIPSRMELWVSNRPFFVLLDISTHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g737 ### # start gene g738 6 AUGUSTUS gene 2927668 2931133 0.05 + . g738 6 AUGUSTUS transcript 2927668 2931133 0.05 + . g738.t1 6 AUGUSTUS start_codon 2927668 2927670 . + 0 transcript_id "g738.t1"; gene_id "g738"; 6 AUGUSTUS CDS 2927668 2928808 0.45 + 0 transcript_id "g738.t1"; gene_id "g738"; 6 AUGUSTUS CDS 2928891 2929025 0.95 + 2 transcript_id "g738.t1"; gene_id "g738"; 6 AUGUSTUS CDS 2929076 2929315 0.54 + 2 transcript_id "g738.t1"; gene_id "g738"; 6 AUGUSTUS CDS 2929416 2929664 0.18 + 2 transcript_id "g738.t1"; gene_id "g738"; 6 AUGUSTUS CDS 2929976 2930082 0.22 + 2 transcript_id "g738.t1"; gene_id "g738"; 6 AUGUSTUS CDS 2930162 2931133 0.63 + 0 transcript_id "g738.t1"; gene_id "g738"; 6 AUGUSTUS stop_codon 2931131 2931133 . + 0 transcript_id "g738.t1"; gene_id "g738"; # protein sequence = [MNNAGGVGVQSSSKWDSRRQSFISPTKLQEIRATTPTHHFTSKPSSPQEESGSGGSSSAASFDNINNTNTGVNRNAQQ # TMFAPSSDQAHPRPVNNASNSNSSQNHSRTSSFFSFRHKQQPSSTSSGVGDAGQRVGPVDDGKVMAASRPSTSSGPQQQQQPPDVDAPLHPPPQPSGV # PLPPNTGALASPALPNSPSQPPPPPPLHPEIRSVVGLTVAHAHKIYFSGPLIRRVEREPNGSKPHGPPIWEEVWAQLGGTTLSVWNMKEIQEASKLGK # EVPPSYINMTDAFVQVLGSVTIPATPAQPAQPAKPASGSNPAVPARPAVPAQAAQRYTNVLTLNTAGSNLILFACPHTQSLISWAAALRLSAWEKSRL # EEIYTAHLSRDIPTTLVRGRLEGWVRIRIAGQTDWKLVWMTVSAGSEGVAGMNGPDELGRISSNNANNLNNLNNPNSPNSNSSGNNTNANASITSPPS # SAGSTITGFTKKRMSALFSRDSSSQGGDQHHHGRPSNNSNANEPPMVSMYTSPKPKDRKKPILTLPIVSQVGDTHFLFFFTSFLCSYSTFYIQKSHQL # NNYRHSLSIPNVLNSFPVPPSFHDTFKLYGRPQAWSWDPRDPASLMFAYPVGPGKDLLFLDREHAESLDPRDDRTSSIRSRLIGILKERMELGGPPGS # AGSAGSGAPITPPGASTLGAGPSGAGDRTAQQSSSNNSQARPGSSGNSGPLSLPQLPPLSFDSSSAADDVREERALLTPITERSSVYTASVMRSGTIG # TIGSGFGPSGSTGGRNSGYGFQGPSPVLEESDREGTVSVSPKVPEKDFMGMRGMSFSSVGSGGGGRKSVDVPSNVNTTSSTTPASPPPPTRSISPTQG # NASGGGTGSPALGMLPHSSFESFSNAVNTALPKSKPMSPSLSPSLSPSSSTMSLLPISLILRILPLPLPLLILPIPHLPRPLTDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g738 ### # start gene g739 6 AUGUSTUS gene 2931457 2934645 0.3 + . g739 6 AUGUSTUS transcript 2931457 2934645 0.3 + . g739.t1 6 AUGUSTUS start_codon 2931457 2931459 . + 0 transcript_id "g739.t1"; gene_id "g739"; 6 AUGUSTUS CDS 2931457 2933599 0.3 + 0 transcript_id "g739.t1"; gene_id "g739"; 6 AUGUSTUS CDS 2933669 2934645 0.77 + 2 transcript_id "g739.t1"; gene_id "g739"; 6 AUGUSTUS stop_codon 2934643 2934645 . + 0 transcript_id "g739.t1"; gene_id "g739"; # protein sequence = [MNSPTTSVAPLGNPSSHPPSYTPSHSDPDVGPYYMDNKDNNNSTDVADYHRHHHRSTLQQQQQQYSQQQYAGDNTGNS # AGIRRIPTTIQETESADTSDGDIRDVRELRDFHDDNLQRHGGSNSRDEQGNGTVNAKSMLGSRTAGDNRGDYNGDTTSQPGSKSSSEDLRRRYEAANS # HQSQSQSQTVIPGMQASPVARKGTPMAFMGSSPIAPSIGSPGPENQMNANLATPRSIIGSPTFGSRPLSYSPAPLGSPSLNSPSHGSPLASPPNSSSS # AGSTAANRVVLGAERGLGRKPSGARAPQRQQHGFSMSAGHVALPPVGVPEGYDPAAANSNTASSQPRQAQFSSSSSLPPSHHVSGVSEVSEEQDELQE # QDDQERLETPEEGSSLEDNSVDYQQYQQQREERRQQQLQQTQIPPRHQAYRQQSSTTTATTASSYSAYSTDNNTYNTYNNAGFTAGNTSENNTNDNNV # ININNAKHAMASQSSSQLHAEDDDVFAVLSYLDVNDPGEEEASGITNAAKKVEPLSVHRSNANKANNGEEGLPTSNSNLSSSTSSSFQNTPNLSNSQT # TNIPGVPSQGSGPQYKSSFAPSKSAAERKAKAQAAQAAQAAAIHRPGGRAATAPGGFGGGKGGGTRKMRAVPNTNKPGSWSSEEEEEEEEEEEEDDDD # EGDVDSDEAPKVRGKAGSKAGSRENEDGQGQFSQLRPPRTLPQIPGRMGEGDQYPAQSGPPRSNYFDDQQLQPPPQLTQQMRSQSQYGLSPPISTPGM # GAPRQSMWSQVLDPNHNQGSVPENPHSAPHSFANPIAPTPLPSNTNNPATGRGGNDLFVQLEPASTHLTKAFTPQGLLSAGLSDRQDRSAKRQEEMAR # ESGASLINVPNKPPPPQTGLLGAITGYERERKRDGGVGAALTERERERRMVEERQRRWDEQQRMQMEGGMPGMGQMPMGQMGMGGPMSMYGGFPGMNP # MMSMYGMNPMMMGGMNPMMTGGMPGGGMMPMNPMMTGGQMGGGLSPMMTGGMNPMMMGGEQFTDFLRLSPQFGFLFTGY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g739 ### # start gene g740 6 AUGUSTUS gene 2934690 2935208 0.52 + . g740 6 AUGUSTUS transcript 2934690 2935208 0.52 + . g740.t1 6 AUGUSTUS start_codon 2934690 2934692 . + 0 transcript_id "g740.t1"; gene_id "g740"; 6 AUGUSTUS CDS 2934690 2935208 0.52 + 0 transcript_id "g740.t1"; gene_id "g740"; 6 AUGUSTUS stop_codon 2935206 2935208 . + 0 transcript_id "g740.t1"; gene_id "g740"; # protein sequence = [MFAAQQAAQAYQQAMMAFSVAGSQAGDDNNPSKNPAATPAAGSSPNLNPMMSGNFDPRMSMMSMGGGMGQGMPPGMGQ # GMGMMGQPTPTSQFDPRFSPSNTPPTNSPTNPESTGPFPPGGLGAGLGQGLGAGLGQRIGGRASNSSSPVRKSSPLARPDNSNNGDGAASKGTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g740 ### # start gene g741 6 AUGUSTUS gene 2936542 2937192 0.49 + . g741 6 AUGUSTUS transcript 2936542 2937192 0.49 + . g741.t1 6 AUGUSTUS start_codon 2936542 2936544 . + 0 transcript_id "g741.t1"; gene_id "g741"; 6 AUGUSTUS CDS 2936542 2937192 0.49 + 0 transcript_id "g741.t1"; gene_id "g741"; 6 AUGUSTUS stop_codon 2937190 2937192 . + 0 transcript_id "g741.t1"; gene_id "g741"; # protein sequence = [MTKQLSTQQGAYQNSADLVYHSKQTTLLLPQIVTRPLTSNWTCKLDDVDEGALFTFADKEGTAHMVRLKYMLFSSEGF # FSRFRGTIRVECACEVHCAYDDHCEWSGKKPVLKLSFLIETRTSEQTCMDCCEEKAQLAEHAWVLNHLSNIYWTFKMPVIDDTLKDESEEDINIENEM # LIIQGSIEEELIMSQNLETAEEYAQVFYDIAQCAFSVASF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g741 ### # start gene g742 6 AUGUSTUS gene 2940424 2941194 1 + . g742 6 AUGUSTUS transcript 2940424 2941194 1 + . g742.t1 6 AUGUSTUS start_codon 2940424 2940426 . + 0 transcript_id "g742.t1"; gene_id "g742"; 6 AUGUSTUS CDS 2940424 2941194 1 + 0 transcript_id "g742.t1"; gene_id "g742"; 6 AUGUSTUS stop_codon 2941192 2941194 . + 0 transcript_id "g742.t1"; gene_id "g742"; # protein sequence = [MYQCQDLHPKTIDFPGHLNTADSGFQREDNATPTQPSSGNDPNIQAYLSDTEITRGGSEKVPPVPVTPERKAVTDSTP # AKSTPHSNHSSSFSSTALLNDRQYKVDEANKYLIGDLANVRTLPVKEWSLLSLNLDLDKDTYQLSEQVKKKFQNYLNAETKAKRETDPELYNSLIALL # NELKGNSRNIVFYRQDVVPVRGSPVKQKPDIGAVFKELIGSRDPLVLAQASDEKIFWGLIILLIEVKHEKGKLIRDNCEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g742 ### # start gene g743 6 AUGUSTUS gene 2942619 2943323 0.88 + . g743 6 AUGUSTUS transcript 2942619 2943323 0.88 + . g743.t1 6 AUGUSTUS start_codon 2942619 2942621 . + 0 transcript_id "g743.t1"; gene_id "g743"; 6 AUGUSTUS CDS 2942619 2943323 0.88 + 0 transcript_id "g743.t1"; gene_id "g743"; 6 AUGUSTUS stop_codon 2943321 2943323 . + 0 transcript_id "g743.t1"; gene_id "g743"; # protein sequence = [MIRVKDGKKYGVLNDWDLAIWLNNRDGISTSQFRTGTRPYMAHEQHSPSWRGPHRYRHDLESLFYVILLLATLFSSPS # ERAYKSLDEDHDDEEDDDDEDDDNEKDAKPSETSYHYQTWFTQGDDFLHKDKAFIIFRASWQPIPTHFFSAFHGWLKRLHDTMNDGFLASEAYDNRPN # DQLRQIPYFNNDTLDGHFSYDIFVLIMHRFSEENLATHGCEWQRKLRGLQKDEDERKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g743 ### # start gene g744 6 AUGUSTUS gene 2944351 2945256 0.78 + . g744 6 AUGUSTUS transcript 2944351 2945256 0.78 + . g744.t1 6 AUGUSTUS start_codon 2944351 2944353 . + 0 transcript_id "g744.t1"; gene_id "g744"; 6 AUGUSTUS CDS 2944351 2945256 0.78 + 0 transcript_id "g744.t1"; gene_id "g744"; 6 AUGUSTUS stop_codon 2945254 2945256 . + 0 transcript_id "g744.t1"; gene_id "g744"; # protein sequence = [MCGHATIALGRFLVDTHDSEVFPRRSLLQVQKDDNGQTFTVLRLHAPCGVVTVNVPTTLEDKSDATKPVRFQSVTCFV # SSPKQGVTVEVPLEMAWPKLIKQNKRQIRMDISYGGAFYALVSSAELGFASLRGSNSEFKELAEAARILRILLNQNSQARRSFVHPNEPDIGFLYGIT # VIDSSISRNGASDQDENTVTWICFFADEQIDRSPTGSCVSAHVPLAVDQTQLRIGEWCTYQSFISVQFAGNAFRGRAVAHTEMGYVVEIEGFAHYTGT # ANFIPPQMMDAIGSGFALKLPPHDLIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g744 ### # start gene g745 6 AUGUSTUS gene 2948621 2950201 0.95 - . g745 6 AUGUSTUS transcript 2948621 2950201 0.95 - . g745.t1 6 AUGUSTUS stop_codon 2948621 2948623 . - 0 transcript_id "g745.t1"; gene_id "g745"; 6 AUGUSTUS CDS 2948621 2950201 0.95 - 0 transcript_id "g745.t1"; gene_id "g745"; 6 AUGUSTUS start_codon 2950199 2950201 . - 0 transcript_id "g745.t1"; gene_id "g745"; # protein sequence = [MTSPMESYANVYRWVHSPNVLLSCSPSSSSSSLSSLSADKSGSSICDNESELIPHGYRISRSPPLIVPSETNPRPRNL # VEISASSSFTYQTNSSQDVLPTLNNSAASSNPSTASRNGFSSPDAISKPSSSAYSLAAHYGIPQALPRPPRTSPRTLVSQEKPLPDFESLSRNYLSML # ANKPTDNTLSHAAPINNTMSPVHVPAEMPAVSQIEDEEAALKAVVDTLIGTPIPISSCTSADSLDDWFAASPQFQKTGSFNEYLSSPFSTPYDDFNTS # PMDDSPFAPDLSTPIMDAIDEEFGWSGMVGGMDEPIFTDAVSDLYDMLVVAEPAKQVAPVDSVAELLNSKHLYTIPPSTPALESVDSLYPSPRLPSVS # APAEPAPPPIPSSSRKVSYATGTRRNITPDALLPLDAPTQARRYVAPSSTSPKEVSTKKRSRSEAFADDDDEGHEDESKAPGPDATEKEKLEYKRRMS # TIAARKSRRRKLEHKLMLEAKVEALEKDTEKWKTRCKVLQEVLRSHAVDFRFEDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g745 ### # start gene g746 6 AUGUSTUS gene 2953095 2956573 0.59 + . g746 6 AUGUSTUS transcript 2953095 2956573 0.59 + . g746.t1 6 AUGUSTUS start_codon 2953095 2953097 . + 0 transcript_id "g746.t1"; gene_id "g746"; 6 AUGUSTUS CDS 2953095 2953283 0.59 + 0 transcript_id "g746.t1"; gene_id "g746"; 6 AUGUSTUS CDS 2953373 2956573 0.91 + 0 transcript_id "g746.t1"; gene_id "g746"; 6 AUGUSTUS stop_codon 2956571 2956573 . + 0 transcript_id "g746.t1"; gene_id "g746"; # protein sequence = [MTTFVTCSSSTTQHTPMHKIRRKPAPTLLSPITPITPLRAPNVTPAGLLPKATSNSAKPSVIPALVIHTRTASTSTSL # FTDHRYPPPDPSDPFAPLSVLRDRSRRCSTNAFLSSSYTFAAGSDDTGHLKGKKVGMASSDNLSVASSTKSSFMPVKGAKKPGVIRTFPNDFLKEKKR # SKHPQERISMCSVELHPDPLSSHVLDKKEDGVFGVLETPKKRSITPCPSHYESKVSPPTQFGTLGHYTPHSRQRTRSSFSALSSPSPTFKLSNRKQHV # LIPAPDAHPLPSLVRDRSESSVSGSSSSGIGYPNCGGKTGEPTSTPERVLPPASASTLSLGGPNASHLDISDSYALTMALLSSPQKHPYARSDAYTRS # QSSSSSRDSSPCRSDYGKGVKSEQTPKAARTKKIDTSDTERPTSPSGSMFKLARFFTGGKVVSRKNSIGSLKILDGITSPKIERKKANSPPSRGRARS # RKLSMSSMNISGPVAAPVSIPLGSDICHRVTDLPLIERSANRPRSQTTSGLPPSTLPNRLHSSPYHPETSFKSSASVSAIGITAADEFYIRDQGVEDE # VNKELNLSLLKPWTASIPRKRSSLSLSVLPASMSSEAGETCDAPSDIVSTLNLPDTSFATSEPRKNKGSSESAVSAGSMGSSYIHVVDSCGETVVKNE # PRYKREEDFTRTGPRRAPLPPRSKTEGLLKSTANHGIAGIKFPGFRRAQSSVQDPIQGTALPSTPGSVRGLKISSPMLQTTVSSNVKLDSPVTLPSSA # TLASPVMHSPAKGHERAISESSCTFFNHSSPVNPKIPENDDAALSPPLPTTSELQTLLALPLLDEHGQEVMFGDILNDPAAVNSDKAVIVLFIRHFWC # PLDQDYVQEVGDILRRLSKDKDGWQLATSDGELRIGEEGNKAGKKAIPEVIIISNGSHALIAKYKEIFDLEAEKGSNLKVKMYTDPTCRTYGILGMEN # VGEACISVVSTPSTLKHSSTISSPPDSLTSRRGRGGITPYKYDAEVPLARIDYRTPPRKNIQGSSPPSASANIDSRSCPDSPSPSAMLSVLETSEPAS # ARSVSPLSINSTHVSTSRSYVKHTSVIGGIATVVLRAIKVGMPVWEKGGAIKQLGGELVFRVMKEQSYDQE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g746 ### # start gene g747 6 AUGUSTUS gene 2956641 2957825 0.79 + . g747 6 AUGUSTUS transcript 2956641 2957825 0.79 + . g747.t1 6 AUGUSTUS start_codon 2956641 2956643 . + 0 transcript_id "g747.t1"; gene_id "g747"; 6 AUGUSTUS CDS 2956641 2957825 0.79 + 0 transcript_id "g747.t1"; gene_id "g747"; 6 AUGUSTUS stop_codon 2957823 2957825 . + 0 transcript_id "g747.t1"; gene_id "g747"; # protein sequence = [MQVACVFAHRMRNTQDHTPFGDVLKIALTSSPSNDFVSFCPSAARMTLSSINHSAYSLRRSSKAMHSPYECSTPPLRG # SQTASPAPCSPSKPSRRRTQTDVYTTHTSTEGTAWWVASTDEGEEVLSDEPPEDERVMHDSVLDTLKDGPVGTWGDKLHTLRTRVAQDGNRDVSDSIR # GIRVRDSICSSNGTATDTSIKAIRAKRVPRGPRMRMQSVSAESLTASRSRDTVKSFGSGMEGIESVMEYGESISSPDLSIFGQLAIATGGPSENRWRR # RRATDSTSTLNSSLYYDAHEGLLGITDNDEEELSRSVAVGVVPIVSRPASRLWCEENVASSECQDQTFDSLQSNDTSADRIDQLTSLCSETSDDDYEE # NAEKLRELLVIRASSSIRGRGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g747 ### # start gene g748 6 AUGUSTUS gene 2958310 2958903 0.76 - . g748 6 AUGUSTUS transcript 2958310 2958903 0.76 - . g748.t1 6 AUGUSTUS stop_codon 2958310 2958312 . - 0 transcript_id "g748.t1"; gene_id "g748"; 6 AUGUSTUS CDS 2958310 2958903 0.76 - 0 transcript_id "g748.t1"; gene_id "g748"; 6 AUGUSTUS start_codon 2958901 2958903 . - 0 transcript_id "g748.t1"; gene_id "g748"; # protein sequence = [MEARNTRRKLEYNTRAENATEGAVEAGSLQVKEKENVLPNAQMQITNRKNKQFYPKRRTTSDEKSSAIKKSSTMSSSK # LQSIGSNTKEKERKKVKKHNARVAKRAAKRDQTEESAAPDRKKTSTTRTYYPESKTVKSLEKLANCGFTNDEVVDLMEFGVNPWDEDAHVSGHAFFSQ # NIYIERQFFSSLSLHTSMTIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g748 ### # start gene g749 6 AUGUSTUS gene 2963031 2963558 0.61 + . g749 6 AUGUSTUS transcript 2963031 2963558 0.61 + . g749.t1 6 AUGUSTUS start_codon 2963031 2963033 . + 0 transcript_id "g749.t1"; gene_id "g749"; 6 AUGUSTUS CDS 2963031 2963558 0.61 + 0 transcript_id "g749.t1"; gene_id "g749"; 6 AUGUSTUS stop_codon 2963556 2963558 . + 0 transcript_id "g749.t1"; gene_id "g749"; # protein sequence = [MENNTSKVAWWTNPARIETVRQLIEKRDARRKKIHEQIERAKKRNIDNNKKSKKRDNNSDNKDSGDRLPDTNTTAGNR # PAYSSSSSNSNCDETLVIDWESDSESEGELQFEDVESPNMDLLSYGIKPWEHEEAKVSVLIHHTPGCSALISFDLGVSGCPRQSTHMILDILSFLYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g749 ### # start gene g750 6 AUGUSTUS gene 2963825 2965099 0.52 - . g750 6 AUGUSTUS transcript 2963825 2965099 0.52 - . g750.t1 6 AUGUSTUS stop_codon 2963825 2963827 . - 0 transcript_id "g750.t1"; gene_id "g750"; 6 AUGUSTUS CDS 2963825 2965099 0.52 - 0 transcript_id "g750.t1"; gene_id "g750"; 6 AUGUSTUS start_codon 2965097 2965099 . - 0 transcript_id "g750.t1"; gene_id "g750"; # protein sequence = [MPLLVRSPSSSVERSPYTPEGRARILESAKVPPEKHDPETTKILVVSFGGQVLKWPRTHSSVFPAQYQMEECNTPTNS # PKMGLGINWKNSKTPRPSQIEIPSPSASTRTRHPANSLGFKDHRDIDPQPISSPRLATPSHIWIPGAPPVVNPLSPTISPSSSWISSSSWDRLAGVDV # VHSPPYSGRPKEKENELPSSTSSSSGLNADSSSTFPLTDMVNIPASLREVSPGAIPQCKENSDKIYHDGVGSRLENMSLGGDGCNEMDHPQLLPESSW # IAIICGASDEQRLDTSSTLPENFYLAPKDVYMPDLTAVADVLLGKLGYGTVAECIDAGTPMVYVSRPLFVEELGLRVLLENEGVGVEMSRAEYESGRW # VERVKEAWEKARVAKEWKRRVEGVRRKISSMGMGQIESQKGKLRLGTWQEWL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g750 ### # start gene g751 6 AUGUSTUS gene 2973992 2974564 0.75 - . g751 6 AUGUSTUS transcript 2973992 2974564 0.75 - . g751.t1 6 AUGUSTUS stop_codon 2973992 2973994 . - 0 transcript_id "g751.t1"; gene_id "g751"; 6 AUGUSTUS CDS 2973992 2974564 0.75 - 0 transcript_id "g751.t1"; gene_id "g751"; 6 AUGUSTUS start_codon 2974562 2974564 . - 0 transcript_id "g751.t1"; gene_id "g751"; # protein sequence = [MPVVDDQEFANVNGIEYSLDQLLGSGTSTPSTPTDSSPNLPHKFGSQVDASVVESSRDFQETLAHDTSVAFEMGVKPT # LERSKSRTSVKPGNALFFTVIYLAPGDYHRFHSPTAWVVEKRRHFVGELFSVSPYIAKRLENLFVLNERVALLGKWRYGFFGMVPVGAINVGSIKINF # DQVIIFCDTPKVKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g751 ### # start gene g752 6 AUGUSTUS gene 2977073 2979397 0.91 + . g752 6 AUGUSTUS transcript 2977073 2979397 0.91 + . g752.t1 6 AUGUSTUS start_codon 2977073 2977075 . + 0 transcript_id "g752.t1"; gene_id "g752"; 6 AUGUSTUS CDS 2977073 2979397 0.91 + 0 transcript_id "g752.t1"; gene_id "g752"; 6 AUGUSTUS stop_codon 2979395 2979397 . + 0 transcript_id "g752.t1"; gene_id "g752"; # protein sequence = [MCAIARWVASRESPIVFHHVRAHSNNAHNDAADTLAKLGSTLPLPPPSSPLDFLSSRAPPVFTPATPSNIPKVSTSLP # ELPPQPAPQIPPNPSPHLPSSHRGRNHKCTCQDLIRTKLSAAASAGSATFWRYYKDIRRALPPTSRVSLQQLTDTFIPRMNPPDPVLSSFDPARIIAE # DACANAIPFPSPPASHPAFNEPLSLDDIASVKSYLKRTNHSNSTGIDLATYDLLIDIDNNHLLPLFQRAIEHRDIPSSWLTSTIIALAKPGKDSTKTS # NYRAIALESCVLKFASLLVHHKLCLALQQSNTIPPSQNGFREGFRTNNNAFILCTIIDKARSRNETIYAAFVDISNVFPSTNQSSLWNKLSDAGLTGK # YFDWLRSLYSQMSYTITHNGQLSEKFHAFSGVLMGDPSSPTLWNIFLSTFRLALDPKDMELLTIAISHLEHADDIVLISRGPLGLQQHLNTFNSWCRD # NALQISADKSWVMLFGPLPLTLPHFTLSGETLKFRDVVRYVGVFFQSTHQNIFASHYTEKRNCAVGSARAITGCDLLVGNCRMPPSITKQLYTALVDC # HLTHGCEIMPDTDPSLLRILEDIQLRFVRRMLGLSTNSVITPLYTETGIMPIRARRVFLTLRYLKYLIGLPNTHYASLALAENNNLHNSLCPCWLSDL # DYAINQLPGNHRLPHLRDLDGALIDKLIKSIELSTKTNLQSHIDTWLKLSLLRHRLEPKEEGQAKPQIIGLRHYLTQIPNHSHRRTITKLLCGDFTPH # FVLLPAPSAY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g752 ### # start gene g753 6 AUGUSTUS gene 2987632 2988195 0.97 + . g753 6 AUGUSTUS transcript 2987632 2988195 0.97 + . g753.t1 6 AUGUSTUS start_codon 2987632 2987634 . + 0 transcript_id "g753.t1"; gene_id "g753"; 6 AUGUSTUS CDS 2987632 2988195 0.97 + 0 transcript_id "g753.t1"; gene_id "g753"; 6 AUGUSTUS stop_codon 2988193 2988195 . + 0 transcript_id "g753.t1"; gene_id "g753"; # protein sequence = [MSQAEAHAQKEILVKWIKVQGHRGVLLSLASVADYASDIVGKAIGKNWLDRFHTRHPELSLKNTIPLKERYARALTPA # TISGFYDILDNTVSEYYIPPENIYNMDKKGIQLGIGACTAVLVDCNQKSVASIEIGNRDLVTIIEAVCADGTALHPLVIFEACRRDAHQGEENPANAR # SVIIILSSGLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g753 ### # start gene g754 6 AUGUSTUS gene 2988744 2989178 0.8 + . g754 6 AUGUSTUS transcript 2988744 2989178 0.8 + . g754.t1 6 AUGUSTUS start_codon 2988744 2988746 . + 0 transcript_id "g754.t1"; gene_id "g754"; 6 AUGUSTUS CDS 2988744 2989178 0.8 + 0 transcript_id "g754.t1"; gene_id "g754"; 6 AUGUSTUS stop_codon 2989176 2989178 . + 0 transcript_id "g754.t1"; gene_id "g754"; # protein sequence = [MPVSTHVPSLLVPINPLVSPSKTIPNQRPEQLYQIALPPSAPHTRHSVSHNLEQQNKLMHEQLESAGKLLNADFAHMW # LMEAKNAVMQQGIHKKNKEMDSSQYRDKSTFDWRGKYARATQVRDETSFRRVKAKIQDHQKGNQKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g754 ### # start gene g755 6 AUGUSTUS gene 3093619 3095696 0.11 + . g755 6 AUGUSTUS transcript 3093619 3095696 0.11 + . g755.t1 6 AUGUSTUS start_codon 3093619 3093621 . + 0 transcript_id "g755.t1"; gene_id "g755"; 6 AUGUSTUS CDS 3093619 3093678 0.97 + 0 transcript_id "g755.t1"; gene_id "g755"; 6 AUGUSTUS CDS 3093733 3093921 0.41 + 0 transcript_id "g755.t1"; gene_id "g755"; 6 AUGUSTUS CDS 3094083 3094394 0.47 + 0 transcript_id "g755.t1"; gene_id "g755"; 6 AUGUSTUS CDS 3094702 3094939 0.54 + 0 transcript_id "g755.t1"; gene_id "g755"; 6 AUGUSTUS CDS 3094996 3095696 0.48 + 2 transcript_id "g755.t1"; gene_id "g755"; 6 AUGUSTUS stop_codon 3095694 3095696 . + 0 transcript_id "g755.t1"; gene_id "g755"; # protein sequence = [MVIDSDHEEDEAYQASDSEVSLASSVSQTSTHTSKAFDVEEAKHNLPSASRVTCPDTGPGDLQHDPEYVKLIGRIQDS # TRRTPHAERVAAQTDEDSSDANFNMVHFLKLKERFEEKEPSKATLMGSDYNKDQLAQMCKFHGIPPFSTDSLVTPVIPSKLEMATKLILWVPSILLIN # TGTDYTVSAPGLLNLHETSSQIRQDYHSLILKYLRTVLVLFPDVSLKPNHHYAIHIAEDLELMGPVHAHNTPVFERTNHTLQELNSNKHLEVEATMLK # VYCQQGNLEMMLAHCPDDKDDIQEALDALLEIKRESHRGMFAGTDLSSWSSPDRKFKSSPIIMDSSTLDQIIELLCVEYQVPHSTWEGALTRDALLLA # GVAHDGVVFSPKTRENSIVFKKLDEGGYGAGTVQRIISHRHRHPARQTSEAVTYLEVLDMNSIDDIEDLYRRLKCGWLCSQLPGRRRLVPLPNVVSHF # VRTNLIIQDTPVTHVYPMPRVRASFGHGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g755 ### # start gene g756 6 AUGUSTUS gene 3110477 3111415 0.17 + . g756 6 AUGUSTUS transcript 3110477 3111415 0.17 + . g756.t1 6 AUGUSTUS start_codon 3110477 3110479 . + 0 transcript_id "g756.t1"; gene_id "g756"; 6 AUGUSTUS CDS 3110477 3110600 0.19 + 0 transcript_id "g756.t1"; gene_id "g756"; 6 AUGUSTUS CDS 3110705 3110748 0.26 + 2 transcript_id "g756.t1"; gene_id "g756"; 6 AUGUSTUS CDS 3110852 3111415 0.59 + 0 transcript_id "g756.t1"; gene_id "g756"; 6 AUGUSTUS stop_codon 3111413 3111415 . + 0 transcript_id "g756.t1"; gene_id "g756"; # protein sequence = [MDMTGDESPVDDGEPCTPPAQSAAFDPGATPTQKKPGEARVKLHQELQVDPKPLLLLEETLSKRMLTLEEKIIQANND # AMQKMAESNTRLLTEFKTIQTEAMEKSIQTAVVSGLSGLNQNVGRLTESLKTISKTQSITSQLLSRLEARLDGERSHSQARSSSHFRSMSTNAGHADD # TQAEGSNQSPASAKGKERMEVDDDDDYEDYEEAEYADGEDQVEEGNTLKKKQKATKTKRALELQVRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g756 ### # start gene g757 6 AUGUSTUS gene 3118003 3119862 0.54 + . g757 6 AUGUSTUS transcript 3118003 3119862 0.54 + . g757.t1 6 AUGUSTUS start_codon 3118003 3118005 . + 0 transcript_id "g757.t1"; gene_id "g757"; 6 AUGUSTUS CDS 3118003 3119862 0.54 + 0 transcript_id "g757.t1"; gene_id "g757"; 6 AUGUSTUS stop_codon 3119860 3119862 . + 0 transcript_id "g757.t1"; gene_id "g757"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPERSFGDETASNIRTPEGRRPEVQ # GPPPVESGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEI # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYRRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMR # HMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKH # SSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPELTCKRNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g757 ### # start gene g758 6 AUGUSTUS gene 3120366 3122158 0.34 + . g758 6 AUGUSTUS transcript 3120366 3122158 0.34 + . g758.t1 6 AUGUSTUS start_codon 3120366 3120368 . + 0 transcript_id "g758.t1"; gene_id "g758"; 6 AUGUSTUS CDS 3120366 3120524 0.34 + 0 transcript_id "g758.t1"; gene_id "g758"; 6 AUGUSTUS CDS 3120686 3122158 0.94 + 0 transcript_id "g758.t1"; gene_id "g758"; 6 AUGUSTUS stop_codon 3122156 3122158 . + 0 transcript_id "g758.t1"; gene_id "g758"; # protein sequence = [MREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGARDGNPQVEQAGQIPDTPSSIERSRTTSESRGTGSKRTGRKERG # RGTTSASSSSTTFRGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRIT # IESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADE # ARRRLAWMKQMPEESFANFFIHFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLHGEKVLQGWLS # RFPGLELAPEAPYKSPCGGKESQLSMDLQSETSCDRKVPKQAQLERGTQRASAAWGEGESYDSENREEDEDCCHCRDGGEWTEAVLRAGVTDTGRKWT # PEERAEKWRRRRQELCMRCGRKEHWAKDCPNPESLERPAEDQGSSEELPRPIQLEEEERPTKGEVVRTIQLVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g758 ### # start gene g759 6 AUGUSTUS gene 3122511 3122990 0.7 + . g759 6 AUGUSTUS transcript 3122511 3122990 0.7 + . g759.t1 6 AUGUSTUS start_codon 3122511 3122513 . + 0 transcript_id "g759.t1"; gene_id "g759"; 6 AUGUSTUS CDS 3122511 3122990 0.7 + 0 transcript_id "g759.t1"; gene_id "g759"; 6 AUGUSTUS stop_codon 3122988 3122990 . + 0 transcript_id "g759.t1"; gene_id "g759"; # protein sequence = [MRHPENLVNLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQRPPEAPQPPPEVPQQTPEAPLELQGRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g759 ### # start gene g760 6 AUGUSTUS gene 3131055 3133879 0.86 - . g760 6 AUGUSTUS transcript 3131055 3133879 0.86 - . g760.t1 6 AUGUSTUS stop_codon 3131055 3131057 . - 0 transcript_id "g760.t1"; gene_id "g760"; 6 AUGUSTUS CDS 3131055 3132373 0.96 - 2 transcript_id "g760.t1"; gene_id "g760"; 6 AUGUSTUS CDS 3132448 3133879 0.88 - 0 transcript_id "g760.t1"; gene_id "g760"; 6 AUGUSTUS start_codon 3133877 3133879 . - 0 transcript_id "g760.t1"; gene_id "g760"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVDKSDDEDTIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDSEKSTGEHDSK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKP # KLIRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKK # GKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHG # DPLLELPELSKHPKPFAPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIF # EDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # RM: 1 # end gene g760 ### # start gene g761 6 AUGUSTUS gene 3133909 3136894 0.3 - . g761 6 AUGUSTUS transcript 3133909 3136894 0.3 - . g761.t1 6 AUGUSTUS stop_codon 3133909 3133911 . - 0 transcript_id "g761.t1"; gene_id "g761"; 6 AUGUSTUS CDS 3133909 3135875 0.62 - 2 transcript_id "g761.t1"; gene_id "g761"; 6 AUGUSTUS CDS 3136879 3136894 0.4 - 0 transcript_id "g761.t1"; gene_id "g761"; 6 AUGUSTUS start_codon 3136892 3136894 . - 0 transcript_id "g761.t1"; gene_id "g761"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTSESSRPSSSQIPTEESRESSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLV # HQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPKVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDN # YYQTLSIASLSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQS # HFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRD # NARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g761 ### # start gene g762 6 AUGUSTUS gene 3143000 3143413 0.4 + . g762 6 AUGUSTUS transcript 3143000 3143413 0.4 + . g762.t1 6 AUGUSTUS start_codon 3143000 3143002 . + 0 transcript_id "g762.t1"; gene_id "g762"; 6 AUGUSTUS CDS 3143000 3143413 0.4 + 0 transcript_id "g762.t1"; gene_id "g762"; 6 AUGUSTUS stop_codon 3143411 3143413 . + 0 transcript_id "g762.t1"; gene_id "g762"; # protein sequence = [MPMSKSEIQRGTSWAKSGTLWVLSLQSADIHPSTPVLQTYPFGWEPDADGFRGQVFATPDNSTVIVSVKGTSAGLLGG # GGPTVKKDKLNDNLLFSCCCARVDWTWTTVCGCYRGGWKCDQGATTAVTSREIVNSELP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g762 ### # start gene g763 6 AUGUSTUS gene 3145609 3145971 0.99 - . g763 6 AUGUSTUS transcript 3145609 3145971 0.99 - . g763.t1 6 AUGUSTUS stop_codon 3145609 3145611 . - 0 transcript_id "g763.t1"; gene_id "g763"; 6 AUGUSTUS CDS 3145609 3145971 0.99 - 0 transcript_id "g763.t1"; gene_id "g763"; 6 AUGUSTUS start_codon 3145969 3145971 . - 0 transcript_id "g763.t1"; gene_id "g763"; # protein sequence = [MFDSGLPPGYDANDQDVDLPAYSSLSGVGREVPSNLTDLSDGASKEFTYNIPLKGNKSSASLVLYGNALISKHLPTFL # EDSKVDGLVKVDVESGESINAVVISVRVVTCTLLVHEEGLHM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g763 ### # start gene g764 6 AUGUSTUS gene 3163491 3163915 0.57 + . g764 6 AUGUSTUS transcript 3163491 3163915 0.57 + . g764.t1 6 AUGUSTUS start_codon 3163491 3163493 . + 0 transcript_id "g764.t1"; gene_id "g764"; 6 AUGUSTUS CDS 3163491 3163510 0.57 + 0 transcript_id "g764.t1"; gene_id "g764"; 6 AUGUSTUS CDS 3163561 3163915 0.57 + 1 transcript_id "g764.t1"; gene_id "g764"; 6 AUGUSTUS stop_codon 3163913 3163915 . + 0 transcript_id "g764.t1"; gene_id "g764"; # protein sequence = [MPQIPHGGSTTVNSLVVSTALYNLVDSPVGILPVTHVDAHKDQITEAWTSPNSSKRSVLMEQRLYTAANPMYNPIEMD # RMPVSVQIVGKKWEDEKVVAMMTIVDDILGPNRGFGPRGFVNHVTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g764 ### # start gene g765 6 AUGUSTUS gene 3169199 3170332 0.46 + . g765 6 AUGUSTUS transcript 3169199 3170332 0.46 + . g765.t1 6 AUGUSTUS start_codon 3169199 3169201 . + 0 transcript_id "g765.t1"; gene_id "g765"; 6 AUGUSTUS CDS 3169199 3170332 0.46 + 0 transcript_id "g765.t1"; gene_id "g765"; 6 AUGUSTUS stop_codon 3170330 3170332 . + 0 transcript_id "g765.t1"; gene_id "g765"; # protein sequence = [MRITPILRGDRSSVSSSESKLSTKSNVGYEAWRRWEDCLWFQDTLELEYSRLARMKRQRLLAGKGVKKDGFYLQDRAS # SWESLPPGPEPNSVARDIHDIIPKLTKKGTLFRASQATIEQRHSELTAFVEALFAEDVPTLLAELRADRMVTDFFGYWRRDYDLAMKNDQRSGNKQSK # PRSSITSSVLSSYFSNGDNNTDTESVQSRSSLSTSPSSPSFRASRISVSTEAYQYARAAKSKEKMKKEELPTRRHTTSSSTSSSGSSSNSRHSMDSIA # STIPGIREDVPLTFDHNPQVESQRDRFLQSLPEDAELPIHSDSESIPPSVRRPKKRSSKDTLYRRSARIFTAPPNINDIVDGLRTPTAAQCTYTLCAL # LIVPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g765 ### # start gene g766 6 AUGUSTUS gene 3170735 3171418 0.85 + . g766 6 AUGUSTUS transcript 3170735 3171418 0.85 + . g766.t1 6 AUGUSTUS start_codon 3170735 3170737 . + 0 transcript_id "g766.t1"; gene_id "g766"; 6 AUGUSTUS CDS 3170735 3171418 0.85 + 0 transcript_id "g766.t1"; gene_id "g766"; 6 AUGUSTUS stop_codon 3171416 3171418 . + 0 transcript_id "g766.t1"; gene_id "g766"; # protein sequence = [MPAHLFPFQENNKTEFHESRSASSGSRPETPLGHLPIIPTSPLHVEISDERLQSIPEDVQSVTSRLSSLSETCFTPVP # PSPTTSTTSTEFSSFTAASGISASTTLSTSTAVTSVLSGNLTIKAAHNQSIILLRTSRETEFAEVRQRIYDKFLAQEKITLTEAFAIAFVLQDPGEPR # SSKGKGRARSNSLGGGSSQMILVTNQNDWDRALATTESSKITVRVLDTFQE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g766 ### # start gene g767 6 AUGUSTUS gene 3171865 3173259 0.6 + . g767 6 AUGUSTUS transcript 3171865 3173259 0.6 + . g767.t1 6 AUGUSTUS start_codon 3171865 3171867 . + 0 transcript_id "g767.t1"; gene_id "g767"; 6 AUGUSTUS CDS 3171865 3172200 0.71 + 0 transcript_id "g767.t1"; gene_id "g767"; 6 AUGUSTUS CDS 3172289 3172328 0.72 + 0 transcript_id "g767.t1"; gene_id "g767"; 6 AUGUSTUS CDS 3172604 3173259 0.64 + 2 transcript_id "g767.t1"; gene_id "g767"; 6 AUGUSTUS stop_codon 3173257 3173259 . + 0 transcript_id "g767.t1"; gene_id "g767"; # protein sequence = [MSTVPETPRSKTSFNPSTPTTSRITGSHVQSSPHYTTTRRHSLYGVEDRIIIDPGSLIWKVGFSGEGRPREVFYAGGK # AAKGLWDLTRATDGAERQEEDKLLDIRLEQSLRAILKQGRSSSSKIHSGQRFLSHLRSLLLLFGTYVAPTSPGIANLPQASRSMRVPQEILTNEVLEE # IKTRCCFVGESLAPNASEPVDNGPTPDDSVVSSDMDVPPTSDPAQSESEFSFAGRESGVSSQHDSSEYSVISTPRMGGKPQDRPPGSENRLQVLADMY # MRHSTATDLQLRVEPPVSMASSSILGYGTIIIPGWIRERTAEVLFEGGDVDEGSLAEIILDALLKVCYK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g767 ### # start gene g768 6 AUGUSTUS gene 3175524 3176629 0.99 + . g768 6 AUGUSTUS transcript 3175524 3176629 0.99 + . g768.t1 6 AUGUSTUS start_codon 3175524 3175526 . + 0 transcript_id "g768.t1"; gene_id "g768"; 6 AUGUSTUS CDS 3175524 3175988 0.99 + 0 transcript_id "g768.t1"; gene_id "g768"; 6 AUGUSTUS CDS 3176042 3176629 1 + 0 transcript_id "g768.t1"; gene_id "g768"; 6 AUGUSTUS stop_codon 3176627 3176629 . + 0 transcript_id "g768.t1"; gene_id "g768"; # protein sequence = [MSASRTTTTTISATAGPSRSRPVPPPPPPPPSDSAAQEEEDLEDEDEDDIIRRAHARVERVRARKAAEAARKKAEEEA # ARAAAERERKAQEAREQARRAQQQQEEVTERRRLLAAAATARSQRGTSPSEVSASPRRPVVEIRRTKSKGKGKARAEPVGGDPDDGDEGDDDDDDDKE # PCERCRAKKISCQMQAGKRSSVICKPCHDAKVRCSYSGRPSTVKREGGSNPTGERLAVLESQVAQLLADNRQLRDGQVKANTYHRHMNRKLDWLVTDA # ARRRRTPPEMPQAGPSELPKKRRRVMDSDEEEDREREKEVEEMGMEEDGEGDEEEMVEEEPAPAKAQSEKGKERAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g768 ### # start gene g769 6 AUGUSTUS gene 3177004 3180567 1 - . g769 6 AUGUSTUS transcript 3177004 3180567 1 - . g769.t1 6 AUGUSTUS stop_codon 3177004 3177006 . - 0 transcript_id "g769.t1"; gene_id "g769"; 6 AUGUSTUS CDS 3177004 3180567 1 - 0 transcript_id "g769.t1"; gene_id "g769"; 6 AUGUSTUS start_codon 3180565 3180567 . - 0 transcript_id "g769.t1"; gene_id "g769"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSATNTVDAKVAV # PLPEPSPSVSPIILETPPGDSPRSRSRSRSRTSRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTAPTVPPLPPSIPAEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGFTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g769 ### # start gene g770 6 AUGUSTUS gene 3180900 3182591 1 - . g770 6 AUGUSTUS transcript 3180900 3182591 1 - . g770.t1 6 AUGUSTUS stop_codon 3180900 3180902 . - 0 transcript_id "g770.t1"; gene_id "g770"; 6 AUGUSTUS CDS 3180900 3182591 1 - 0 transcript_id "g770.t1"; gene_id "g770"; 6 AUGUSTUS start_codon 3182589 3182591 . - 0 transcript_id "g770.t1"; gene_id "g770"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g770 ### # start gene g771 6 AUGUSTUS gene 3185228 3185860 0.99 + . g771 6 AUGUSTUS transcript 3185228 3185860 0.99 + . g771.t1 6 AUGUSTUS start_codon 3185228 3185230 . + 0 transcript_id "g771.t1"; gene_id "g771"; 6 AUGUSTUS CDS 3185228 3185860 0.99 + 0 transcript_id "g771.t1"; gene_id "g771"; 6 AUGUSTUS stop_codon 3185858 3185860 . + 0 transcript_id "g771.t1"; gene_id "g771"; # protein sequence = [MAVNDYAVNSIAAAQASSPSILYSIIPFYSVPSTQETVLRTFVEAMGVLSTTIERLVIEAEVQLANLERLEERLSALH # ELVSREDSTISSAKSELLSELWTQLGGNKRTLSGYDDHLKLLNGLGEYRKQALVHVVSSLQTLRALSDDMEDIRERVSEPELASSHIPVEVHMNSIRT # GLQRLKHSRVKAREREEEAIKKVLGEEHFAALEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g771 ### # start gene g772 6 AUGUSTUS gene 3186269 3186619 0.99 + . g772 6 AUGUSTUS transcript 3186269 3186619 0.99 + . g772.t1 6 AUGUSTUS start_codon 3186269 3186271 . + 0 transcript_id "g772.t1"; gene_id "g772"; 6 AUGUSTUS CDS 3186269 3186619 0.99 + 0 transcript_id "g772.t1"; gene_id "g772"; 6 AUGUSTUS stop_codon 3186617 3186619 . + 0 transcript_id "g772.t1"; gene_id "g772"; # protein sequence = [MSEPQTDVSRPSALPSATLLQRAIPQAIIDQNSDEYLDSIEEEWNKKVDLEVETLVDGMVDLVGLASVGYHRLLLETL # RLELNVCIQINDKDKFRIAQESFQAQTRAESMVRLAMY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g772 ### # start gene g773 6 AUGUSTUS gene 3192187 3192744 0.69 + . g773 6 AUGUSTUS transcript 3192187 3192744 0.69 + . g773.t1 6 AUGUSTUS start_codon 3192187 3192189 . + 0 transcript_id "g773.t1"; gene_id "g773"; 6 AUGUSTUS CDS 3192187 3192744 0.69 + 0 transcript_id "g773.t1"; gene_id "g773"; 6 AUGUSTUS stop_codon 3192742 3192744 . + 0 transcript_id "g773.t1"; gene_id "g773"; # protein sequence = [MSAHHAAQRQHQYSIPLPPPPSSALNDDLRLPSIKDLAFKYERPRQEGLQSVGGAPQAMSEFSVSSNQDRSRGHSQSW # GRSSHPTPPAPTPISTHHLQQQHTPPLSAGHEPSSAKSSEYSPRHDNGGYLTPGMPLSAQMMPLPGSVSTGSVIRSDDHSQMQNKRSRPSSLTPIAAL # PRDSRPPHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g773 ### # start gene g774 6 AUGUSTUS gene 3192832 3193602 0.66 + . g774 6 AUGUSTUS transcript 3192832 3193602 0.66 + . g774.t1 6 AUGUSTUS start_codon 3192832 3192834 . + 0 transcript_id "g774.t1"; gene_id "g774"; 6 AUGUSTUS CDS 3192832 3193602 0.66 + 0 transcript_id "g774.t1"; gene_id "g774"; 6 AUGUSTUS stop_codon 3193600 3193602 . + 0 transcript_id "g774.t1"; gene_id "g774"; # protein sequence = [MPPPSPYHQMSPIAAPPSSMPHTSLPPSPHTQMQHQPSAPPTHPAYSYQQQQQQSYMPRSNTQHIASHPPSSHPSHNY # HPAPPQHPQSQAPQQIQAPPPSHSTLSQPHPHMPYPSPSPSVSQEHHWEPHHQSQPQHPQPVHPVQHHNVHHAPLPPPPTATPSSLSIQHNQYSHPPP # PPPPVVHHHHQQPQPQHTIYMQPMNPPSSTSSQTSQTSLARAAPPIVTNSIAAPEVDIRTPYPMNAKPSARENTMSEVLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g774 ### # start gene g775 6 AUGUSTUS gene 3194470 3194862 0.52 + . g775 6 AUGUSTUS transcript 3194470 3194862 0.52 + . g775.t1 6 AUGUSTUS start_codon 3194470 3194472 . + 0 transcript_id "g775.t1"; gene_id "g775"; 6 AUGUSTUS CDS 3194470 3194862 0.52 + 0 transcript_id "g775.t1"; gene_id "g775"; 6 AUGUSTUS stop_codon 3194860 3194862 . + 0 transcript_id "g775.t1"; gene_id "g775"; # protein sequence = [MRKQAKLQNGEPPPKIDLDTLKASTKAAEAERNAKADENTAPGSTPQHHQGSFQVMSVMSPVEAQNSPTTSSDPNRLP # AHHQTILPPPTGSGSMHPPPPPWAAANIPRAFTPSDQFQSQSFIRTNQVSPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g775 ### # start gene g776 6 AUGUSTUS gene 3197952 3198374 0.98 + . g776 6 AUGUSTUS transcript 3197952 3198374 0.98 + . g776.t1 6 AUGUSTUS start_codon 3197952 3197954 . + 0 transcript_id "g776.t1"; gene_id "g776"; 6 AUGUSTUS CDS 3197952 3198374 0.98 + 0 transcript_id "g776.t1"; gene_id "g776"; 6 AUGUSTUS stop_codon 3198372 3198374 . + 0 transcript_id "g776.t1"; gene_id "g776"; # protein sequence = [MSKLTSFAIIGSGNIGSFVISAFLGQAAPPSTLIVLSRNPESKNFPPEVQVIRVDDYGDINAVARILTAHKIDAVILT # VGFGGISAQKKMADAAKLAGVKLFAPSEFGSPTDGAPSEYRPLQERDEVAGEFLPLLDKWCY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g776 ### # start gene g777 6 AUGUSTUS gene 3201540 3202646 0.8 + . g777 6 AUGUSTUS transcript 3201540 3202646 0.8 + . g777.t1 6 AUGUSTUS start_codon 3201540 3201542 . + 0 transcript_id "g777.t1"; gene_id "g777"; 6 AUGUSTUS CDS 3201540 3202646 0.8 + 0 transcript_id "g777.t1"; gene_id "g777"; 6 AUGUSTUS stop_codon 3202644 3202646 . + 0 transcript_id "g777.t1"; gene_id "g777"; # protein sequence = [MSPASNANKGLKRDFRDGSYRSSHSPLGNGATAYESANRIRDVVLPLVLENFNLRGGAGENHLSKDVLGAAQCVLTDE # VCHSIEMQMVEAQKQLREARVPESHPRLEVPHETTDGSLPDALQLSVPERTSPPHLNGSGSGRLSSSNTIIQDGDGDYLDWRPSKRRRIDTISVSPSP # ISPRQSSVKRSHLPTYSLSGQTSPNAGKQHQQLSVSCSPKTPINRSPSAFPDSVHDHSMCSPKKLPSTNLFQPPYKETTSEAPSPLSLHSQLAHASAL # YAPVLLSSACKIHLHDFSSSDQVETSPSLPRQSLEVERPDNVDKLQTLPINNEDTSVPLKVPGIWGMGKSLANPGILEFIVDVDIKTAHAWCLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g777 ### # start gene g778 6 AUGUSTUS gene 3203540 3204007 0.87 - . g778 6 AUGUSTUS transcript 3203540 3204007 0.87 - . g778.t1 6 AUGUSTUS stop_codon 3203540 3203542 . - 0 transcript_id "g778.t1"; gene_id "g778"; 6 AUGUSTUS CDS 3203540 3204007 0.87 - 0 transcript_id "g778.t1"; gene_id "g778"; 6 AUGUSTUS start_codon 3204005 3204007 . - 0 transcript_id "g778.t1"; gene_id "g778"; # protein sequence = [MASYLRSWLTLPTVASTSSEAISTFQSSLEDEDEGSDTEKEDNDAPPAFPSLNSAQRMQSIPTILTDSQLMPPPPNPN # FRNRTIGVSTPGGLAVPPTTTKPPVKPSKKREKVALAPGHSPLDWAALKSSGKDLRVRYVLYLVIPIGSSLITLHRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g778 ### # start gene g779 6 AUGUSTUS gene 3207966 3209327 1 - . g779 6 AUGUSTUS transcript 3207966 3209327 1 - . g779.t1 6 AUGUSTUS stop_codon 3207966 3207968 . - 0 transcript_id "g779.t1"; gene_id "g779"; 6 AUGUSTUS CDS 3207966 3209327 1 - 0 transcript_id "g779.t1"; gene_id "g779"; 6 AUGUSTUS start_codon 3209325 3209327 . - 0 transcript_id "g779.t1"; gene_id "g779"; # protein sequence = [MPSPLRRGSLGPRPRTPANTGNVGASTSTATTESNTQTLFTSILAPPPSNQARTILNANDPPVAAPVRPAMSPKVRNV # NNDKAVKSIAESTRAHAKSRRQPDKRKDKRKSRKAVDADGDVDMEAAATLTSLLLHHRPSIAGSASSPRSSIDGSEAGTPYSQQPISARSSFSSIPPS # NTASNASISYRSNTPPRSSNTNVQQQQGQSTPRPAPTDNEAADLMLFLATSPSPARPTTSKDARDAAAFHALTHSDNGNMMRAKPRVLFPTQGDFADE # SGITHPSSAVGTRLLNSDGFTNSNISRTGTDVEPPVHHSTTDRSSSASQQHTAVQLQQQPASSTVHGTYLLPPPSLPSSQRPTPSSFPSSPSSLRNES # SPRPEHPIAGGQTDFNFSEYIHASPTRPGSGSGHPANSQKANLGLRADVGRKLFEEEQIRLQQKRRPEDRGLEAGIDLVRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g779 ### # start gene g780 6 AUGUSTUS gene 3211644 3212108 0.97 - . g780 6 AUGUSTUS transcript 3211644 3212108 0.97 - . g780.t1 6 AUGUSTUS stop_codon 3211644 3211646 . - 0 transcript_id "g780.t1"; gene_id "g780"; 6 AUGUSTUS CDS 3211644 3212108 0.97 - 0 transcript_id "g780.t1"; gene_id "g780"; 6 AUGUSTUS start_codon 3212106 3212108 . - 0 transcript_id "g780.t1"; gene_id "g780"; # protein sequence = [MSKRETSDVLNETEFAEGAPSKSKPRLNYRTLDLATASPISGIMKSVQFLPYPNLTFQTVPSKSIPFQQPMPLTSFSY # DSQHTQEFNDSALRYYRSPPPNAQLGYGYEHWIRRPEERSRVDSLLKAVDRVTEGQHKKMNLAEVGVVAWRGVVTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g780 ### # start gene g781 6 AUGUSTUS gene 3213315 3214157 0.57 + . g781 6 AUGUSTUS transcript 3213315 3214157 0.57 + . g781.t1 6 AUGUSTUS start_codon 3213315 3213317 . + 0 transcript_id "g781.t1"; gene_id "g781"; 6 AUGUSTUS CDS 3213315 3214157 0.57 + 0 transcript_id "g781.t1"; gene_id "g781"; 6 AUGUSTUS stop_codon 3214155 3214157 . + 0 transcript_id "g781.t1"; gene_id "g781"; # protein sequence = [MAIEADAQCRRAFEFQDRNRRKFHAIQASNERRSAERDFARYERENRTEVRREKWTERPGSPLERRPATKRPGSPVAR # PPLQTTLAIRHAPALTPLPTPTSTKRKGSKTPEPSSTIVYSFSTPNSSKSVPPRCISPKNVLMKCAALTKKTPERVYNPNTYNPNWAAETDHIARRAA # RTTDPATSARIHPPPRPRQHDPNLCSRNCPIHSRPKEPKASASHVPVPPTRPPVPVRPPRPPTISLSIHSKPSREEIPVAVVNDANYYAIKAQSQAKG # YMPHRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g781 ### # start gene g782 6 AUGUSTUS gene 3218337 3218963 0.6 - . g782 6 AUGUSTUS transcript 3218337 3218963 0.6 - . g782.t1 6 AUGUSTUS stop_codon 3218337 3218339 . - 0 transcript_id "g782.t1"; gene_id "g782"; 6 AUGUSTUS CDS 3218337 3218963 0.6 - 0 transcript_id "g782.t1"; gene_id "g782"; 6 AUGUSTUS start_codon 3218961 3218963 . - 0 transcript_id "g782.t1"; gene_id "g782"; # protein sequence = [MGLKREVVEAQYKEVGGLPEPIPRGWRESFVLQSERNLRRIRSSIYTGFGFFNSGAKYDVSSPTVPPVYSRAKFDRSE # LVALRTAFEVFASDVFPGVAPSHVESTHIPSPTMLKQSSKLLPVSQVLQVIRQVPGYQEMLASDLDKDLNYVIEEAGFKGRKEIGFEEFVEVRHYPSI # PFLILISVIPCPDLWRSQGNQFRTCSGCARSW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g782 ### # start gene g783 6 AUGUSTUS gene 3220347 3220864 0.26 - . g783 6 AUGUSTUS transcript 3220347 3220864 0.26 - . g783.t1 6 AUGUSTUS stop_codon 3220347 3220349 . - 0 transcript_id "g783.t1"; gene_id "g783"; 6 AUGUSTUS CDS 3220347 3220614 0.94 - 1 transcript_id "g783.t1"; gene_id "g783"; 6 AUGUSTUS CDS 3220664 3220798 0.44 - 1 transcript_id "g783.t1"; gene_id "g783"; 6 AUGUSTUS CDS 3220848 3220864 0.61 - 0 transcript_id "g783.t1"; gene_id "g783"; 6 AUGUSTUS start_codon 3220862 3220864 . - 0 transcript_id "g783.t1"; gene_id "g783"; # protein sequence = [MLPVYNVIQLPYYFAGCKMYDILAGSENMSSSYMMSKSKALETFPMLKQEGLVGAVVYYDGQHNDSRMNTALIMSAVK # HNAVVANYTEVLSFYKSNEKLSGARVRDELTGEEFVVHARVTLSQSFFEYGTMLTVPSRVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g783 ### # start gene g784 6 AUGUSTUS gene 3231182 3231628 0.69 - . g784 6 AUGUSTUS transcript 3231182 3231628 0.69 - . g784.t1 6 AUGUSTUS stop_codon 3231182 3231184 . - 0 transcript_id "g784.t1"; gene_id "g784"; 6 AUGUSTUS CDS 3231182 3231628 0.69 - 0 transcript_id "g784.t1"; gene_id "g784"; 6 AUGUSTUS start_codon 3231626 3231628 . - 0 transcript_id "g784.t1"; gene_id "g784"; # protein sequence = [MQQNHRSFSSHSPHLHPAANHNGEWSRRHPGATHAWARRSYQHPHEQKSNSAGPSNSSASGFAQQGFRGFTPHSGRST # FMDSSSIHANAATDGDKSMFRRRMESVHRDREKIEKVSGSVRAFQVLLVLVLISAVAAPSMRPSNMSTTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g784 ### # start gene g785 6 AUGUSTUS gene 3235230 3235580 0.77 - . g785 6 AUGUSTUS transcript 3235230 3235580 0.77 - . g785.t1 6 AUGUSTUS stop_codon 3235230 3235232 . - 0 transcript_id "g785.t1"; gene_id "g785"; 6 AUGUSTUS CDS 3235230 3235580 0.77 - 0 transcript_id "g785.t1"; gene_id "g785"; 6 AUGUSTUS start_codon 3235578 3235580 . - 0 transcript_id "g785.t1"; gene_id "g785"; # protein sequence = [MQLEVSLLIVRPQVAADLWPIEDTHLPKNSPQDTETREESEVSIEEQINAEVIAIKRPKSDQKFGEWQGGSVNFLDHK # SQQRVVRPILPAVSSFLLMTSKYISHDFSGVHIVQISC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g785 ### # start gene g786 6 AUGUSTUS gene 3237318 3238631 0.63 + . g786 6 AUGUSTUS transcript 3237318 3238631 0.63 + . g786.t1 6 AUGUSTUS start_codon 3237318 3237320 . + 0 transcript_id "g786.t1"; gene_id "g786"; 6 AUGUSTUS CDS 3237318 3238631 0.63 + 0 transcript_id "g786.t1"; gene_id "g786"; 6 AUGUSTUS stop_codon 3238629 3238631 . + 0 transcript_id "g786.t1"; gene_id "g786"; # protein sequence = [MSDLLTPSESQNFHTFLSSMDYNDESNDMRNVANIEWTSYNNDINGHSMPDVPQLQGREALAKATKDLMSLDAEGWNS # APVMHPYQQQHSYNFMDHQSSQYGYNLHNHRHSNVYQQNDAFPLLSKQRSHSPHPPFPHSHSAPSHSLNHGHLSQPISVSPPSTLGPSQDPRIGSNMR # SSFNSMGSPPTTTSSASFSVASSSRHGVPSTSTLSSPTLSSESLQRSGSPGGNTSNKRQLDALSYPSPNKRSRPSPPASSLPNKTTLLSPSQKKANHI # QSEQKRRANIRRGYEALCDTVPALREAIRLEEEAQLALDSNGNGKKPKRGKRAKVDDGTGEKIDGRAGPRSENIVLGKSELLRYHDYSVCSHNAHNVT # AIEYIKELLHDRQDLLARLERARSSIAPDHPSGKPLDPLPLWEREWKGGSGKEGDAEDEEEEDED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g786 ### # start gene g787 6 AUGUSTUS gene 3239744 3240205 0.61 - . g787 6 AUGUSTUS transcript 3239744 3240205 0.61 - . g787.t1 6 AUGUSTUS stop_codon 3239744 3239746 . - 0 transcript_id "g787.t1"; gene_id "g787"; 6 AUGUSTUS CDS 3239744 3240205 0.61 - 0 transcript_id "g787.t1"; gene_id "g787"; 6 AUGUSTUS start_codon 3240203 3240205 . - 0 transcript_id "g787.t1"; gene_id "g787"; # protein sequence = [MVSPTYLGSATTVQNVPVSRYHYWRNTDIDWTRTPFPLSLAAHSINNITRTPTVIGKRGKLVSPPGFDILLAILPSNS # PNSTGLSILSSTPEGHFQDWKILWEISSGCGWEPLFDRYRLNMEDGGDGVLSLYLINGTDVVVMDLDLQLKPMGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g787 ### # start gene g788 6 AUGUSTUS gene 3243651 3244013 0.99 + . g788 6 AUGUSTUS transcript 3243651 3244013 0.99 + . g788.t1 6 AUGUSTUS start_codon 3243651 3243653 . + 0 transcript_id "g788.t1"; gene_id "g788"; 6 AUGUSTUS CDS 3243651 3244013 0.99 + 0 transcript_id "g788.t1"; gene_id "g788"; 6 AUGUSTUS stop_codon 3244011 3244013 . + 0 transcript_id "g788.t1"; gene_id "g788"; # protein sequence = [MNPHTVSNDTLRGLGVLWERDEYETKQSRKEATYHDAGKMSIENPAVFVVSPVYLKKMSSEVLDDSFVVIGPFSKRGD # AEDRVNDIESIVLEAPNYFWTLSPLSNLARRRSVLSEKAKPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g788 ### # start gene g789 6 AUGUSTUS gene 3244750 3245735 0.34 - . g789 6 AUGUSTUS transcript 3244750 3245735 0.34 - . g789.t1 6 AUGUSTUS stop_codon 3244750 3244752 . - 0 transcript_id "g789.t1"; gene_id "g789"; 6 AUGUSTUS CDS 3244750 3245492 0.59 - 2 transcript_id "g789.t1"; gene_id "g789"; 6 AUGUSTUS CDS 3245573 3245735 0.34 - 0 transcript_id "g789.t1"; gene_id "g789"; 6 AUGUSTUS start_codon 3245733 3245735 . - 0 transcript_id "g789.t1"; gene_id "g789"; # protein sequence = [MRTPSIYSQDDPLTEALKPPESETELERRARLEEEAEAKRVSEQIDEELRLERETSVARSSGVWQEHSAATIPAYVIP # DLFMHFILLRTENDRYKPHSLEQERASWRTVIYFNVVRSIKHILNTLESWDDYIDDDMALDSPTSKYMGGSRSGTSSPVIMNPPLENSNAHSRSASPF # QGNAATSRSTIASLRRRLSPLVTTDTALADRLSGGITVSGSGKGGVFVRSGWQARTIENALGRKRGRVSDELSPKKPDEIQDVLVQDVSRMLDASKDD # IRELWAHPTVKGLIVRRRLKLDEWSEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g789 ### # start gene g790 6 AUGUSTUS gene 3249485 3250768 0.2 + . g790 6 AUGUSTUS transcript 3249485 3250768 0.2 + . g790.t1 6 AUGUSTUS start_codon 3249485 3249487 . + 0 transcript_id "g790.t1"; gene_id "g790"; 6 AUGUSTUS CDS 3249485 3249565 0.85 + 0 transcript_id "g790.t1"; gene_id "g790"; 6 AUGUSTUS CDS 3249738 3249952 0.27 + 0 transcript_id "g790.t1"; gene_id "g790"; 6 AUGUSTUS CDS 3250018 3250768 0.71 + 1 transcript_id "g790.t1"; gene_id "g790"; 6 AUGUSTUS stop_codon 3250766 3250768 . + 0 transcript_id "g790.t1"; gene_id "g790"; # protein sequence = [MGTDYYKLLGVDKDADDNAIKKAYKKMISEAFEVLSDKQKRTIYDQFGEEGLKGGGGPPPGAGTGAGPSGFSGFSGFP # GGSTFSFSSSGPSGFSSSGGSLLTLNFLRQIFGVGLNSAFGMGGMGGRPGMRMSDADDDMDGSYPSFGGGIPRSRPSRPARSNSYSKQSAAPSEITRP # FKVSLQDLYNGAVKHLKVGRRLLNGSTEDKVLDIQVHPGWKSGTKIRFARAGNEQASGEAQDLVFVVEEKPHDTFKREGNDLICNVSIPLLEALTHEG # GKKQVESLDGRKIQVDLPAGVIKPGQETTVHGEGMPIRKDGMVKKKGDLIVKWNVVFPDRLTSSQKAGLKKVLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g790 ### # start gene g791 6 AUGUSTUS gene 3250964 3251584 0.64 - . g791 6 AUGUSTUS transcript 3250964 3251584 0.64 - . g791.t1 6 AUGUSTUS stop_codon 3250964 3250966 . - 0 transcript_id "g791.t1"; gene_id "g791"; 6 AUGUSTUS CDS 3250964 3251584 0.64 - 0 transcript_id "g791.t1"; gene_id "g791"; 6 AUGUSTUS start_codon 3251582 3251584 . - 0 transcript_id "g791.t1"; gene_id "g791"; # protein sequence = [MTEGIGFQSNFSCSHSVVLPHPISEVFTTIGTTQGHERVCRLSKLCTNFELLNSDTVSLPIKAALSDSHVRTLPTSYS # RTAEAPNASEDTRTLPRQAFTMTETIPLVFGLFKNDVILNGTLTWDESAKLALYETESNNGVQVWKLRTFEEVDAKSTRVSERIEGVCPRWLRAIVQR # EASKGHVYVEFSTLCSCNAQDIVTVQCAYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g791 ### # start gene g792 6 AUGUSTUS gene 3252760 3253632 0.31 + . g792 6 AUGUSTUS transcript 3252760 3253632 0.31 + . g792.t1 6 AUGUSTUS start_codon 3252760 3252762 . + 0 transcript_id "g792.t1"; gene_id "g792"; 6 AUGUSTUS CDS 3252760 3252791 0.71 + 0 transcript_id "g792.t1"; gene_id "g792"; 6 AUGUSTUS CDS 3252908 3253173 0.52 + 1 transcript_id "g792.t1"; gene_id "g792"; 6 AUGUSTUS CDS 3253232 3253632 0.36 + 2 transcript_id "g792.t1"; gene_id "g792"; 6 AUGUSTUS stop_codon 3253630 3253632 . + 0 transcript_id "g792.t1"; gene_id "g792"; # protein sequence = [MNKSRTPLQRFDWEDSSEEEEAKPTPAVTAAPPKKKGTLKAKLAEKEAMKALRNDEDDSDAYDSDAVLDPREKARRLK # EKELNSDLNNAADLFGAAALGGTTSKELDSLLSFQPRTKEDFVKLSTMIIELVMKRHQNKPLYPAFVEHHVRELAGPLKDVEVRKAASGLTTLANEKQ # KEARDKASGKKKKAASKPTLGSAKVANKYVNPDLSGCLGVLLMFLSGLILAFMMRC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g792 ### # start gene g793 6 AUGUSTUS gene 3268620 3270065 0.86 - . g793 6 AUGUSTUS transcript 3268620 3270065 0.86 - . g793.t1 6 AUGUSTUS stop_codon 3268620 3268622 . - 0 transcript_id "g793.t1"; gene_id "g793"; 6 AUGUSTUS CDS 3268620 3270065 0.86 - 0 transcript_id "g793.t1"; gene_id "g793"; 6 AUGUSTUS start_codon 3270063 3270065 . - 0 transcript_id "g793.t1"; gene_id "g793"; # protein sequence = [MADVLKKNEMGIAWDETEKGRFREDYFPPLKIPMIAHTPWADRTLPIPPGIRNKVIQLVREKVASGLYEPSNSSYRSQ # WFVVAKSNGGLRIVHNLKKLNAITVRDSGQPPIIHLFIEQCGRRGIYSGIDVIAGFDHGTLHEDSQDPTTFDTPIGAFRLARIPQGWTGSVPVFHGHI # AFLLQDETEVSPNFIDDLPVLGPKTRYEKQGGDYEVLVENSGICRFVWEHALDFNCILHRLKHAGVTVSAKKLKVAVPELKIVGTVCTYEGRLPDNSK # VVKIQSWPACESITEVRGFLGTAGVLRVWIKDFARITRPLVDLTKKDVTFIWLPEHQQAMANTKDAMSKCEALVTIDYLSLLPVIMAVNSSYIACGII # LSQDNKDGRRHPSRFWSIAWNEREARYSQAKIKLYGLFRAFHAMKIYIIGVQKLIVEMDASCVKGMINNPDMHPNAAMNRWIAAIQLFDFDLKHVPGK # NFLGPDGVSRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g793 ### # start gene g794 6 AUGUSTUS gene 3270589 3271311 0.31 - . g794 6 AUGUSTUS transcript 3270589 3271311 0.31 - . g794.t1 6 AUGUSTUS stop_codon 3270589 3270591 . - 0 transcript_id "g794.t1"; gene_id "g794"; 6 AUGUSTUS CDS 3270589 3271311 0.31 - 0 transcript_id "g794.t1"; gene_id "g794"; 6 AUGUSTUS start_codon 3271309 3271311 . - 0 transcript_id "g794.t1"; gene_id "g794"; # protein sequence = [MEEIIDVDAIEEDGDTWMEPLELERVEENVGMAVTRSAGKRKQREEDMEDQPKAKETHKQPKIPVNPLTISGSKPAFT # YESKAEDPNAATKMFQRTLDVVVPDVTVRDLVSLSSDLQKQWIDHTKVQHISTTTDEPTVQATIRTKESLNLEYSTPVRMIEVMLFGRQKETALIDDG # AEIVIIRADVCKEMGFQINPEKMVTMETANGSRERMEGGTEYLEIVVDGLVTWAHAFIVTNSPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g794 ### # start gene g795 6 AUGUSTUS gene 3271533 3272669 0.31 - . g795 6 AUGUSTUS transcript 3271533 3272669 0.31 - . g795.t1 6 AUGUSTUS stop_codon 3271533 3271535 . - 0 transcript_id "g795.t1"; gene_id "g795"; 6 AUGUSTUS CDS 3271533 3272669 0.31 - 0 transcript_id "g795.t1"; gene_id "g795"; 6 AUGUSTUS start_codon 3272667 3272669 . - 0 transcript_id "g795.t1"; gene_id "g795"; # protein sequence = [MPAPGSIRALTKFRGKNAELREFLEEFDGHAKAQELTDEERVHAVLKYVDGQTKRYWKTLDGYGEKDWNKMKTELFDA # YPGSKKGHRYTVKGLMKLAEKNAKNRIDEEGDLIEYYRQFRVMSRPLKDDKKVSVDESNRYFWYGLHKHDRKEILGRIELKDSTFNRTTVPDMELAFK # MGREVFSDDVLGMESDDPIAEMFTKPKKKKGKVVVIESTSESEDDEDSDSSESEESEEEKPKRKKTVKQVVRMKIVEKPQTDSVEDLAKQLHALNVQD # VNYAGVYARLATISPVVAGAIAALPPIPQIVTTAAIPAVQMAPYPNRPLTPVTYPNSIEIQRNNYRRGNGIQRQAPGPLPADILCFFCKENHLIRDCT # HLPEYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g795 ### # start gene g796 6 AUGUSTUS gene 3276614 3277255 0.52 - . g796 6 AUGUSTUS transcript 3276614 3277255 0.52 - . g796.t1 6 AUGUSTUS stop_codon 3276614 3276616 . - 0 transcript_id "g796.t1"; gene_id "g796"; 6 AUGUSTUS CDS 3276614 3277255 0.52 - 0 transcript_id "g796.t1"; gene_id "g796"; 6 AUGUSTUS start_codon 3277253 3277255 . - 0 transcript_id "g796.t1"; gene_id "g796"; # protein sequence = [MLGTHPDISFAVTKLAQHAANPSQEHLNKALYICRYLLGTRSYALCYDGESGIGLGTWTDLDWASDPYTRRSQTGFFM # KLANGIFSWTSHAQKTIAHSSTEAEYMALSDCSRQVVWIRNLLEELGYKLDAIPIAGDNQGSIFMASNPVTSKHSKHIDIRYHYICEVVKRGLVQVFF # VDGSNNPADLFTKNLGRIKFELFRSMLGLEFYSSTNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g796 ### # start gene g797 6 AUGUSTUS gene 3278027 3278635 0.99 - . g797 6 AUGUSTUS transcript 3278027 3278635 0.99 - . g797.t1 6 AUGUSTUS stop_codon 3278027 3278029 . - 0 transcript_id "g797.t1"; gene_id "g797"; 6 AUGUSTUS CDS 3278027 3278635 0.99 - 0 transcript_id "g797.t1"; gene_id "g797"; 6 AUGUSTUS start_codon 3278633 3278635 . - 0 transcript_id "g797.t1"; gene_id "g797"; # protein sequence = [MRQDPEQDVAPPVPAEQPARDPSPPPQPRNEQPPAEEQLRHSGRVRRPPTRLTGDPRSSSKLPTEQQVERPMRDIQRR # AKAPQPGSSSAEQERPEPEQVPRPSTEHPTPENGEQPSVTPGDEANTLIRLCWEGGAELIYFLMAKAVSFEGELKSSENVREWTYKDITRLPKAEREE # WLKACQEELEALKRRGTFELMDRPAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g797 ### # start gene g798 6 AUGUSTUS gene 3280484 3281461 0.54 - . g798 6 AUGUSTUS transcript 3280484 3281461 0.54 - . g798.t1 6 AUGUSTUS stop_codon 3280484 3280486 . - 0 transcript_id "g798.t1"; gene_id "g798"; 6 AUGUSTUS CDS 3280484 3281461 0.54 - 0 transcript_id "g798.t1"; gene_id "g798"; 6 AUGUSTUS start_codon 3281459 3281461 . - 0 transcript_id "g798.t1"; gene_id "g798"; # protein sequence = [MHSARIAPVFYLKELSHRLIAQGHFLQDGKTIRGNADKVDFWDKDGLFLSFEPRTHSDTIYILKDYSPQPMAVNLVIH # SVDYTTMHRRMGHPSCEALTQLRKHAEGVPTFSIPHEEDLCEGCAKGKMTLRPFPPTNRRASRPFEIIHSDLKEWPTISYHKYKYTIFFIDDYTSHGF # YCHLKKKSGSLPVIKQFIATVKNLYETNVKEWMSDGGGEFRSNALDEFFKNEGIKAQWSSPHIHQQNGRAERFIQTIIEKSEPQRFQACIPDSWWEFS # VAHAVHVYNRTPMRCHKWKTLYEILYNKVPRIDHLCVFGCGAYVFLHEEVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g798 ### # start gene g799 6 AUGUSTUS gene 3281620 3283170 0.35 - . g799 6 AUGUSTUS transcript 3281620 3283170 0.35 - . g799.t1 6 AUGUSTUS stop_codon 3281620 3281622 . - 0 transcript_id "g799.t1"; gene_id "g799"; 6 AUGUSTUS CDS 3281620 3283170 0.35 - 0 transcript_id "g799.t1"; gene_id "g799"; 6 AUGUSTUS start_codon 3283168 3283170 . - 0 transcript_id "g799.t1"; gene_id "g799"; # protein sequence = [MSSALFTAVTTTLKGDNYDTWASEMEAFLQATGLESAITTDQPSEPSPLVAANAASVETWKNYEVAFKAWKEIDTKAI # GNIRLHISPSIRILSKDNSNIAKKLWKYLAKTYNVKSLGAVFNDFAAAMAIKIPYKQNPLSSMMEIGMHFTRMEEADIGLADHLEALILLSKLPSHYS # VVVQTMSQLETAELKKLTFAKVRIAVMNGFSGDTIGNSQPQNANKFSNVHRKGNDPKFSQQQHGNNSHQQQKGQNGNNDNKKKRKRGSGKNTKAKKNA # NTAQADADPMDFSPIGSTVDFGPVRTDLTPSVQDVRKHSIHLPYNPPPNATSLRLHKKTRMAIQRARDIGVRATAEVIRTLEPTGHISELDSDDEQGS # SDPPMKRTRVLPSEDDVEDGNKAPTPPPPSPPMDFEVPGTASFDPDELMNFDLDREILAIIGFMDTMGSVSSSDLDHTKCTNAPSSVAVTKTCKSAFE # PDLLSRLYNYRINVKYISNEQFCVHDVSYSVCKKCKGKRGTNPNGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g799 ### # start gene g800 6 AUGUSTUS gene 3284742 3289415 0.69 + . g800 6 AUGUSTUS transcript 3284742 3289415 0.69 + . g800.t1 6 AUGUSTUS start_codon 3284742 3284744 . + 0 transcript_id "g800.t1"; gene_id "g800"; 6 AUGUSTUS CDS 3284742 3289415 0.69 + 0 transcript_id "g800.t1"; gene_id "g800"; 6 AUGUSTUS stop_codon 3289413 3289415 . + 0 transcript_id "g800.t1"; gene_id "g800"; # protein sequence = [MAAPLTGTIASSPMIGNNKPENDNTVHVTNEIPHTSLSSQHLYKASEFALLTVLQKQQIFNVLIQSPSISCNELRKLA # TLHVDLTTWDSQHQQKNKMKLLSDFAQHFCSNHCLIRQVQAETVGITHIPSISQSEFLECAKALKLRNYNEASAYKHKYEHKHFSQKKMKISHTSTSA # ANDVHFTSPVVDSEIWPEILSLNEKQAILQESYDAGSNASIRMIECSFCGTLETGMNICSIPCTDLDISLLDTAVHEIRLKTQQATIEAFRHETINND # CYQLCIQCKREVRYKTSIDNSEGHGKSQRSFVRLPLRSYANGTWTGDLPNALKGLTFLEEQCIARARATKCMFKLELGPSGQYASRGNVCIFPQDPGP # LATCLPPPLSQLHDEICVILVGSPDTEITIETLTRTPLLVRRSRIINALQWLRLNNPLYYDLNLDAMLVNANQYPEHGIPIPLKSIICTSSNSEGSSY # TAQANSEQFNENVSSSGMLSSTVVDADHIDSTYQMRKLNALQQLKTGNSPFIKFPSGSIPLSTYKNPKVYAYLWPTLFPYGVGMMENDDVHCNSSVGF # RHIDMRTHIAYLLQSRPNFRFQTHLSFIFVIGNILQRRQTSFNAKLAVKRSWFPRVEMLLGKLSNDTILEFSEKLKKNPFVHPETEGEKAAKQLMKYI # NYIGENIPGSMSEVQNMREELFSLVHTNGLPHVFLTLNPSDTNNPIAQVLAGRNIDLDQIFHDLKLHSENLERSTCIAQNPIAAAQFFDISVRNLLDI # LLGTKRQNKKGVFGEVAVYYGVVEAQGRGSLHIHLLIWLKHGLSPNEIKFKCESDPKWAQHLIDWYDDVFSQSIPNHTQEYIQTEGMYKRQPVMSRPM # NPQISGYWYSFNQDLRNVLENAGMVHEHTDTCFKHLPIKLRSLRNDDKDCRFQLPRDKVEKTHFDEDGYLVLKCNNGNVNGHNTIITVAERCNTDAKP # IGSGSVAMAMFQYFGNYTIKNTMDTAFVFSALCAAIKMLSDNPPMDIDGNLDTYEHSRQFLIKTANKLIGKRELSSQQIASKLIGTPSCYTNCRYPIF # YWSAMLREIAPEVFDTADLHNDEESDINCNGNNIEDPETLQQNLPPREEFDCDSFVLLTEKTLKTGKFSSKSYTHNSLFNDIFFRPDVLFDICAWDLM # CEYSKEELPESKKQIKTYLRFKLGHPQYTTHCLKKIDADNYQRVPVLKGYPIPRSDKIECQDKYMIAMLALFKPWSHNEQSPLKAPQEAWNTAFNTWK # DTDLFKSHIRIINNMQLLYESKDAKLDYSAQRQKRLAELSHKLASEEDDGESYLYDPEWENAMQVQVPATIDNDILQEVDNYNVVSQEVLDVMEATVQ # RGFYKGELDSSSKKQLQNSYSNCTRVATLLDKVAVEDSINSIMKEKEDLVKRRLEFIRKPDSQLHHRLPTSCIPSPFATELNKEIEYAQKLFMKFHPN # SPAWDELKFHQKLAIALINKHKLNDQQILAFLLLADTVGHQSLTDKPVEPLRMLVTGPGGTGKSRIFAAWSDFHEGINCKDEFRLTAPTGVVASQIGG # CTIHSEAAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g800 ### # start gene g801 6 AUGUSTUS gene 3289527 3290756 0.97 + . g801 6 AUGUSTUS transcript 3289527 3290756 0.97 + . g801.t1 6 AUGUSTUS start_codon 3289527 3289529 . + 0 transcript_id "g801.t1"; gene_id "g801"; 6 AUGUSTUS CDS 3289527 3290756 0.97 + 0 transcript_id "g801.t1"; gene_id "g801"; 6 AUGUSTUS stop_codon 3290754 3290756 . + 0 transcript_id "g801.t1"; gene_id "g801"; # protein sequence = [MSPENISILSEYCSIAKGITEHPFGKLNIITCGDPAQLPPPRAKPLFDRELVKCYESTHLNALNSKTQYEVKGIQAWH # QIDKVVVLSEIMRQKGDDMLIDILSRLRTGTCTQVDKDILDKYVLSNDACSNETKSLIDITQWITNPERACPLITYTNAARDAHNFESAKAFARATGQ # EFHVYHSTDTRGRGKNKKVIKGVAAEAAWRIPVKDAQDLGGKVPYIPGMPVFGTENIATELGLSNGSLGTLVSLTYEIHDDRYYAVSATVDFPGYKSN # DPIHPNRVLLKPITQSIKFHLPNSEKLYTATRKQLPLIPAFAFTSHNAQGRSMDVACIDFASCRSIQSAYVMLSRVRSLKGLCILRPFSINKIRNHIS # EELRSELKRTENLASRTAEAAKNNLSWYYSKFPTQLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g801 ### # start gene g802 6 AUGUSTUS gene 3291276 3292146 0.59 + . g802 6 AUGUSTUS transcript 3291276 3292146 0.59 + . g802.t1 6 AUGUSTUS start_codon 3291276 3291278 . + 0 transcript_id "g802.t1"; gene_id "g802"; 6 AUGUSTUS CDS 3291276 3291533 0.59 + 0 transcript_id "g802.t1"; gene_id "g802"; 6 AUGUSTUS CDS 3291589 3292146 0.62 + 0 transcript_id "g802.t1"; gene_id "g802"; 6 AUGUSTUS stop_codon 3292144 3292146 . + 0 transcript_id "g802.t1"; gene_id "g802"; # protein sequence = [MFKSILPSKRITSSDFTMVTPLADGAPNGKENQPSSNFFTQSTRNTKGGSAGSDKGFTDKKKRGAAQEINQLEHGDDM # HEAFDQLLDELQIPSTLRPKLVGMDSSVKAAMLKSSRGMSLNIKSTFPVIPEMPLTPQPLTLRRTRSIDTLESPRPTKPTLDYDLRPPMAPFTLSDQS # SRSASSTGSPRKSSHSRGISLGTGIISRSQVNLLGNNSTLDLTATAKSGKEKGPGSSRIISPTKSVSILAGASSTELDVEQVKKLRLLLRNESAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g802 ### # start gene g803 6 AUGUSTUS gene 3295370 3299618 0.27 + . g803 6 AUGUSTUS transcript 3295370 3299618 0.27 + . g803.t1 6 AUGUSTUS start_codon 3295370 3295372 . + 0 transcript_id "g803.t1"; gene_id "g803"; 6 AUGUSTUS CDS 3295370 3298573 0.27 + 0 transcript_id "g803.t1"; gene_id "g803"; 6 AUGUSTUS CDS 3298647 3299618 1 + 0 transcript_id "g803.t1"; gene_id "g803"; 6 AUGUSTUS stop_codon 3299616 3299618 . + 0 transcript_id "g803.t1"; gene_id "g803"; # protein sequence = [MVLGMPAKNYLIFKVSIPVSTKADEWISAEILREEFTHEQSLIDAVGNTAELENQAEASLELAARFLGFIATRVHENS # ECTAARTALLLNVFKFFTSTYLYSKDIHSLASNYDTEVRKAVLTSYFSAFSVLSEQKAADIPRGPQSALFVAAAAGEASIYALFGGQGTNEVYLDELQ # SLYDIYKPFVASFISTMSEILVPLAEEKQFSSFYTHGLDVFSWLSGVVSRPSISYLASVPISFPLIGLTQLVQYLIVCKVTGLTPGELSDRMTGATGH # SQGIVSAVAAAASSSFESFTENAKKAIRWLFFCGFRGQEAFPIVSLEPGLIQDSIDGGEGMPTPMLSITGLSLKELEPHLVQTNNHLADNSQLQVTLH # NGPRALVVTGPSRALHGLVVNLRKIRAPSGADQSKIAFSQRKPVFSVRFLVVGVPFHSVYLGEATDKLLSEDLKGEELWEPEELRIPVFNTEDGTLYF # LLYLCLFFFGFAEYLCATGKDLRASKTSITRSLCNQIFTSPIHWTEATNFPKSATHALDFGPGGLSGIGPLTARNFDGRGVRVIVIGERGKGDAELYD # STAVQREDNWGEKYAPRLVKSGYVPFFLNHRISLTITVRDGTVHLDTPFSRLLGKPPIMVPGMTPSTVQAGFVSAILDAGYHVELAGGGHYNANALRA # KVVEIQGKIPQGAGITLNSIYINPAQFGFQFPLWQEMRKEGFPIEGFCIGAGVPSTEKAAEIIDGLRSSGIKHLGLKPGSVDGIRQVVNIAAANPDFP # IIMQWTGGRAGGHHSYEDFHQPMLSTYRSIRKHENIILVGGSGFGAAEDVWPYLTGEWSVAYGVQPMPYDGFLFGSRVMVAKEAHTSSSVKDLIVACA # GVEDQQWEGTYTKPSGGVLTVRSELGEPIHKVATRAVKLWKEFDDTVFKLPKEKRSTWLLEHRDEVIEKLNKHFSKPWFGWKKDGSVAELRDMTYEET # VLRMVRLMYVAHENRWVDISLRNLTGDWMRRIEERFAGVNGSGTKPSVLQSYNSLNDPLPCVETFFKAYPLASQQLLSADDSGYFLAISQRRGQKPVP # FIPVLDASFEDSLWAAEDVEAVFDQDPERVCILQGPVAVKHSVIKDEPIRDLLGNINSSLIQKVLQLRYNGDASTIPSIGYLAPPRRASRVPAGVKIT # TTDEQIVYQFGKSLPTNASWLACLAGSQLNWFGALIGSTSVVQGSSYISNPIRRLFYPRPHEKVVVSLSNGQPTSIVAYGGARSYGLHDPNFKATEII # FNSSTNLIDVTIFEERNKVAVPLTLQFEYKSAMGSAPIHEVVTGRNMRIKAFYWKLWYGDDQSLPELDIHDTFTGPDVTLKAEDIEKFCSVVGNNDES # FKSVRTTTISAPMDFAIVAGWQVRSSISKLLNYAFIPNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g803 ### # start gene g804 6 AUGUSTUS gene 3299700 3300464 0.7 + . g804 6 AUGUSTUS transcript 3299700 3300464 0.7 + . g804.t1 6 AUGUSTUS start_codon 3299700 3299702 . + 0 transcript_id "g804.t1"; gene_id "g804"; 6 AUGUSTUS CDS 3299700 3300464 0.7 + 0 transcript_id "g804.t1"; gene_id "g804"; 6 AUGUSTUS stop_codon 3300462 3300464 . + 0 transcript_id "g804.t1"; gene_id "g804"; # protein sequence = [MKGARPFQAGDICRSEAKIVSVVNSGPGKVVKVKGHVYRDAKPVVEVVSAFLYRGVFTDYENTFETTEEPDYIVTLAT # DADVSVLQSKEWFDWEDDTRPLSPGIPLIFRVQSEVSFMDRTSYRELSVSGEIFVRDQLKNLQKVGSVEFQADDAHGNPVVAYLQRHGIAQGLSVPLA # NEGYQLTTTEGSTSFFSPLTNEPYSGISGDFNPIHINPYFSCYAGLPGTITHGLWSSAATRKYVENVVAKGHPDRVLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g804 ### # start gene g805 6 AUGUSTUS gene 3300583 3301458 0.71 + . g805 6 AUGUSTUS transcript 3300583 3301458 0.71 + . g805.t1 6 AUGUSTUS start_codon 3300583 3300585 . + 0 transcript_id "g805.t1"; gene_id "g805"; 6 AUGUSTUS CDS 3300583 3301458 0.71 + 0 transcript_id "g805.t1"; gene_id "g805"; 6 AUGUSTUS stop_codon 3301456 3301458 . + 0 transcript_id "g805.t1"; gene_id "g805"; # protein sequence = [MRDGNIVVKIETVNVLGEKVLEGSAEVSQPTTAYVFTGQGSQEPGMGMDLYNSSPAARAVWDGADEHLRAVYGFSILE # IVKENPKEKTVHFGGIKGQAIRQRYMDMSYDTTDKDGHIKTLPLFADIDIRTPKYTFSHPNGLLFATQFAQIALVVTEKAAFEDMRSKGFVQTDCAFA # GHSLGEYSALASIADVLAISALVDVVFYRGITMQRAVERDSENRSNYAMCAVNPSRISKSFSDAALREVVDTISVGTGSLLEIVNYNVEVRFSFSLQL # FVSDDFHRDNNMCALES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g805 ### # start gene g806 6 AUGUSTUS gene 3301526 3304571 0.34 + . g806 6 AUGUSTUS transcript 3301526 3304571 0.34 + . g806.t1 6 AUGUSTUS start_codon 3301526 3301528 . + 0 transcript_id "g806.t1"; gene_id "g806"; 6 AUGUSTUS CDS 3301526 3301772 0.34 + 0 transcript_id "g806.t1"; gene_id "g806"; 6 AUGUSTUS CDS 3301819 3304571 0.89 + 2 transcript_id "g806.t1"; gene_id "g806"; 6 AUGUSTUS stop_codon 3304569 3304571 . + 0 transcript_id "g806.t1"; gene_id "g806"; # protein sequence = [MSVRLEFRNGLIFFQLTETFSVEKVKEMLGDIVKECHGRALDQKKAEGHILLERGFATIPLPGIDVPFHSRYLWAGVM # PFRTYLSKKIDPTHINPDVLIGKYIPNLIAQPFDVSRAYAQIIYDQTSSPRLDKVLKNWDEENWGSAAQRQNLTYIILVELLAYQFASPVRWIQTQDL # LFSHFNFERLIELGPSPTLTGMATRTLKAKYELQDDCVSLKREILCHAKHSKEIYYLFEDEAVGESVPVEVTESVAAPVTATVTAATAVPLPVAVPTG # PAVSIEDVPVKSSDILLAIVAQKLKKQISDISTSKSIKDLVGGKSTLQNEILGDLQQEFSSAPEKGEELPLDELGPALGSGHSGTLGKYTTGLVSRLV # GGKLPGGFNSSAVKAHLSKTWGLGPQRADGVLLLGTTMEPAKRLGSEAEAKTWLDGVVSAYAQRSGISLASPGAGGGGGGGGSGGAVINSEEFTKFQA # EQERFAAQHIELYMRYLKRDSRSGEIAFDAEKANSMALQAKLDSIAKEHGDLYIDGIMPVFDPLKARRFDSSWNWVRQDALTMYYDIIFGRLTTVDRE # ITARCIHLLNRADPEMLAYMQYNIDQCDPSKGDTYKLAKEFGQQLIDNTHQFIGQPPVYKDGMSSMLFFHSLSDVLLVTFPTAPHTEVSSKGDIVYTE # VMRENVRKLEAYVEEMARSDTVSGPVNIQKVQDDVLKLWTIVKSQPEISQEQKNRIKALYEGVVRSLRNKGSEPRPRTPRNRRSSSQFLRPQISGIAT # VSADKVPLLHLKRKVGTNWEYSSNLTSVYLDILHEIATAGTTFKDKNALLTGVGKGSIGVEVVKGLLSGGAHVVITTSRYSRSTVEYYQSIFQTFGSR # GSALTVVPFNQGSKQDVEALVDYIYSTLGMDLDFILPFAGIPENGREIDGIDDKSELAHRIMLTNLLRILGAVKNKKASRHFVTRPTQVILPLSPNHG # LFGNDGLYSESKISLETLFQRWASESWGEYLCLAGAVIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g806 ### # start gene g807 6 AUGUSTUS gene 3304641 3305940 0.41 + . g807 6 AUGUSTUS transcript 3304641 3305940 0.41 + . g807.t1 6 AUGUSTUS start_codon 3304641 3304643 . + 0 transcript_id "g807.t1"; gene_id "g807"; 6 AUGUSTUS CDS 3304641 3305218 0.53 + 0 transcript_id "g807.t1"; gene_id "g807"; 6 AUGUSTUS CDS 3305352 3305940 0.46 + 1 transcript_id "g807.t1"; gene_id "g807"; 6 AUGUSTUS stop_codon 3305938 3305940 . + 0 transcript_id "g807.t1"; gene_id "g807"; # protein sequence = [MGPTNIVAHELESFGVRTFSAKEMAFNILGLMHPLLFSITQVEPIWADLNGGMDRLPDLADITTRIRTSLTKKSDMRR # AIARDNAADFKILNGVDAERLIQTVDVLPRANFRFDFPALESQDSLVDVTKLRGMLDLDKVMVITGSAEVGPWGSARTRWEMEARGEFTIEGAIEMAW # MMGYIKHFDGRLKDGTFLLLMTVTEPELFRGYDPNKKIFNQEVELIHDLEPIEVTADEASKFKLQHGDKCDIWAGEGGQWFFKLKKGACVFVPKSFSF # SRKVASQIPTGWYAGRYGLPEDIIAQTDQVTLWNLVSTAEALNMSGITDPYELYQHVHPSEVGTSLGSGMGGQVSLAKMFTDRRDEKEVQNDILQETW # VIFLHFLHRCLNFVKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g807 ### # start gene g808 6 AUGUSTUS gene 3307477 3308198 0.37 + . g808 6 AUGUSTUS transcript 3307477 3308198 0.37 + . g808.t1 6 AUGUSTUS start_codon 3307477 3307479 . + 0 transcript_id "g808.t1"; gene_id "g808"; 6 AUGUSTUS CDS 3307477 3307747 0.38 + 0 transcript_id "g808.t1"; gene_id "g808"; 6 AUGUSTUS CDS 3307803 3308107 1 + 2 transcript_id "g808.t1"; gene_id "g808"; 6 AUGUSTUS CDS 3308163 3308198 0.96 + 0 transcript_id "g808.t1"; gene_id "g808"; 6 AUGUSTUS stop_codon 3308196 3308198 . + 0 transcript_id "g808.t1"; gene_id "g808"; # protein sequence = [MSEMMIKNNLVQIKELPPYPLALEDKVLMNSMARARPDAKSGSFAYTTKMEAPIHVDTANFKTVSEVLAADALKKSAS # CSEEFVGVGVDQELISSVPSHNPNFVSRNFTDAEIAYCSAQPSPASSFAARWVGKEAVFKSLGVKSKGAAAPMKDIEIVNDKDGVPTVVLHGEAKTKA # SEKGVSKVLLSLSHSENVAIAFAQAST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g808 ### # start gene g809 6 AUGUSTUS gene 3308700 3311819 0.95 + . g809 6 AUGUSTUS transcript 3308700 3311819 0.95 + . g809.t1 6 AUGUSTUS start_codon 3308700 3308702 . + 0 transcript_id "g809.t1"; gene_id "g809"; 6 AUGUSTUS CDS 3308700 3309637 0.95 + 0 transcript_id "g809.t1"; gene_id "g809"; 6 AUGUSTUS CDS 3309791 3311819 0.96 + 1 transcript_id "g809.t1"; gene_id "g809"; 6 AUGUSTUS stop_codon 3311817 3311819 . + 0 transcript_id "g809.t1"; gene_id "g809"; # protein sequence = [MFYRWGQATAIINDALFVQGGRTDQYNAYSYTTAPIDDDLLYLSLSTSFNPSSPPWQLISSSSNSSTSSGPAVAWHTI # SATNTSEIFLFGGVPAINSPTVLTVQADSAWLLNVYNRLVPSWIQEAMSWANEPIRRIRHSAVTSIEGVVFIVGGEKADGSGIAFSDHYAFDPAVPSF # TQLPTSGPPGITGHASIILPNGTMFVFGGYEPSSSSMVDFSTIWALDTTASSFEWTVVTAEGTIPGSRRAFAAVLIDGGKILIQGGSDATFQTTYSDG # WALDLTSDPPTWSEVSALSQVGQRRDHFAVSYGSDVIFGAPSPTSVSITQTIPGATQITTGTGSQSTGTDNQSGTGVTGTGQPTSTGDPNKPGNGDPG # TNDSDSNNGKTEGVVLGTALGILAFLVAGVIVVYYVRRRRNNAAEENHFSLLNENDPEAGLPAVRSSGEKGPYSERWNVLKNLKVGGALTAVPGGVVG # LSETHPTAARRDMLADEDTRDFGPWYGRRKRDHTGDSSWSLMSFMKLRGREGSSSSYASLATPFREKSDPFSDGAALMGDDETGFVGAAARGYSGSIG # RPSHNRGISYTSTLSAVSDLEQDIAPYSGGTTYHDPFSNPFSDDNAIAELPAVSTSSRRAFPRPNQPLQIQTMLPLEVHSLSPVTEASRATHSQSDHT # SSVSEHEHEHSVSPFNSISQVTSRTSFSPRPSSLLDANNPMPDSYSVRRSNSWWSRFSRTSLLDRGPSGSKQLGGMPDIRDPNPPPRLGGLVAIEESQ # HSGSPEHDSPNSNRSNSAGSIKRALSRGSGSKVYKGKHGKSLSSLRTADTEAIERMAGEVDVVQRERTGSHGTHDSTGSYDSNSTGWLPEDGRGIVHG # VDMSAFDVASPVEMTFQKSIIFPELPVLPSKVASPEITPPVSQPTTATSSNTSINTGARPIRAPTGSTVAARIREYEKRMSQDQSIPSPTNTRKHEER # SNKRKTLVNYGLTTRPSLFVANPDHRQD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g809 ### # start gene g810 6 AUGUSTUS gene 3319161 3319604 0.56 + . g810 6 AUGUSTUS transcript 3319161 3319604 0.56 + . g810.t1 6 AUGUSTUS start_codon 3319161 3319163 . + 0 transcript_id "g810.t1"; gene_id "g810"; 6 AUGUSTUS CDS 3319161 3319604 0.56 + 0 transcript_id "g810.t1"; gene_id "g810"; 6 AUGUSTUS stop_codon 3319602 3319604 . + 0 transcript_id "g810.t1"; gene_id "g810"; # protein sequence = [MAAEDAGEPLDDGEMEFEDEEADEEVHAEPSPPINLSNNAPSASRNRKKYAKLTKRSRAKRAAEAVERVVTRGVKPFV # VELAKGALPLELEDFDSSSLPVSSSGWNANPRKRLSPGLQRVWKNLEALSSLSGLKLLRWDGECVQHIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g810 ### # start gene g811 6 AUGUSTUS gene 3326669 3328292 0.55 + . g811 6 AUGUSTUS transcript 3326669 3328292 0.55 + . g811.t1 6 AUGUSTUS start_codon 3326669 3326671 . + 0 transcript_id "g811.t1"; gene_id "g811"; 6 AUGUSTUS CDS 3326669 3326749 0.8 + 0 transcript_id "g811.t1"; gene_id "g811"; 6 AUGUSTUS CDS 3326808 3327128 0.57 + 0 transcript_id "g811.t1"; gene_id "g811"; 6 AUGUSTUS CDS 3327181 3327795 0.9 + 0 transcript_id "g811.t1"; gene_id "g811"; 6 AUGUSTUS CDS 3327858 3328292 1 + 0 transcript_id "g811.t1"; gene_id "g811"; 6 AUGUSTUS stop_codon 3328290 3328292 . + 0 transcript_id "g811.t1"; gene_id "g811"; # protein sequence = [MSPSAAPPSPQEVHRKLSISSVARNSKPPPPVTVPTVSGNESDSDSIPTPDWNISPSGMISGASGTILPGSLQQQPLS # SIAERRSGSGEDSEDDDDEGEGGWKTAQVGEGHAQGSIDESVIKTGYLWKKGERRKTWKKRWFVLRPAHLAYYKTAAEYQLLRLLELSDVHSCTQVSL # KKHENAFGLISPVRTFYLQAKTPAEVQEWVTAIEEARQALHASSTQTSTSAPIPIPRASNHPSTPLPITPSPPSFVSHNATSSDSEDASPSAQSAQRT # YSTSSQTRPVIGFSPSKSQPSASPKDPSKVVLTGYLMKCGSKRRNWRKRWFVMSGEKLIYSASHMDTKPHRQFPFSDILDALEYDVVSNRPHYPPSVS # SPPNFEGGGSEGPSTAHTFKIITTKRTLLLCAPTEEDEIKWLGAVRALIARRSLSGDTAKAPPSGGASNPDTSPHSSGFTTSGGIKGKVRRLSASGGS # GTNREEVSSTGQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g811 ### # start gene g812 6 AUGUSTUS gene 3330423 3331808 0.87 + . g812 6 AUGUSTUS transcript 3330423 3331808 0.87 + . g812.t1 6 AUGUSTUS start_codon 3330423 3330425 . + 0 transcript_id "g812.t1"; gene_id "g812"; 6 AUGUSTUS CDS 3330423 3331808 0.87 + 0 transcript_id "g812.t1"; gene_id "g812"; 6 AUGUSTUS stop_codon 3331806 3331808 . + 0 transcript_id "g812.t1"; gene_id "g812"; # protein sequence = [MIQHPPYAISQHHFMIVPPPLQPPQSQLRPNVPPTIVSRFGSSYTAVFLDDPTDQNYPSQQTHPTRPLTADGDLDELA # NHYMNTVAALQYQLADKYFLPQIFKNVIEKEGVARNAARILALVHVQRSQAPMAQALEDVQTRKRYDELLQMFSFAKEQFDDDDALAALNIISTFLFD # GGNGDWERWLHVASVYSNSILNDRSRFLDYRDALMNSTDKERFIIKTTFWFDVLASVTTMKKPNFVEVIHELYNPSNQSGLSEISDDSDSLSMLSVMG # CENRIVWALAKISELHVWKEHRAKSGSLSIVELSRRAEDIEMHLAPSVTPLRPRTQDDVPRLLASEVFRTSAIVYLRTIVSGDHPLVREISEAVDDAV # VSLERVAAESKVNVKHVVVRSTVFAFFVCAALTTKPTKRAFLLKQLKDEGEVGNCRGILDLLQNLHVGSQKPKEVPWRSILRESRMLLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g812 ### # start gene g813 6 AUGUSTUS gene 3337878 3340972 0.2 + . g813 6 AUGUSTUS transcript 3337878 3340972 0.2 + . g813.t1 6 AUGUSTUS start_codon 3337878 3337880 . + 0 transcript_id "g813.t1"; gene_id "g813"; 6 AUGUSTUS CDS 3337878 3337886 0.65 + 0 transcript_id "g813.t1"; gene_id "g813"; 6 AUGUSTUS CDS 3337986 3338087 0.83 + 0 transcript_id "g813.t1"; gene_id "g813"; 6 AUGUSTUS CDS 3338147 3338556 0.86 + 0 transcript_id "g813.t1"; gene_id "g813"; 6 AUGUSTUS CDS 3339426 3339559 0.51 + 1 transcript_id "g813.t1"; gene_id "g813"; 6 AUGUSTUS CDS 3340215 3340972 0.77 + 2 transcript_id "g813.t1"; gene_id "g813"; 6 AUGUSTUS stop_codon 3340970 3340972 . + 0 transcript_id "g813.t1"; gene_id "g813"; # protein sequence = [MAPDRTTSHSWDDKDEREFTERLEAELDKIHNFQRAKTSELSRRITDAERDVKQLVSGALEEEQLDQSGHTRSRQDPE # AQQRESHHVLDEGSDDEDESDGGETDDESFDALENRFHLLEEEVANLVADVHDLALYTKLNITGFMKILKVLHSFIKVILIDWIRSLLETRRELFLGE # YTVDEDFQQLVAKGKKTQQDVDSMIQLANEVQYAVLTKKLVPVDTDILKPDTGYLTVIERPVHLSKGSSAASGSGSASRDLSPHAEKYTEPVSEDEDD # SDMLRAPARDEDKRTGLTETQVAEAVAYRENMLRERRQTEVADGKKPNPGCYGSVPNNADENAVEDTDETADERTPFLVKTKDRSLSQTRSALNALPI # NPLAPSSAFDETFRNQLQDEANDGAIRDADGEEDELTSSAENRLLSRDWRAPVGKHISIPVRIEPKVYFAAERTFLVRFHNFPVLRQISSSREHNRNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g813 ### # start gene g814 6 AUGUSTUS gene 3346378 3347388 0.88 + . g814 6 AUGUSTUS transcript 3346378 3347388 0.88 + . g814.t1 6 AUGUSTUS start_codon 3346378 3346380 . + 0 transcript_id "g814.t1"; gene_id "g814"; 6 AUGUSTUS CDS 3346378 3347388 0.88 + 0 transcript_id "g814.t1"; gene_id "g814"; 6 AUGUSTUS stop_codon 3347386 3347388 . + 0 transcript_id "g814.t1"; gene_id "g814"; # protein sequence = [MALNSSSLQHLRPGSIYPTFEIIWGSHPLWPTPLLNDALPSAPDRIRILVLDSSFNPPTLAHLALAKSNRPEGDYDAK # LLLLSVRNADKELKPGDATHVQRLEMMMELAEDLRDANAHESNNNVAVAIIDEPTFVGKSKLLRALLKEKLRAMSLMPEVELTFILGFDTLERLFDTK # YYESSEEKMFKALQGFFAPPPNPGSSTTNDESGDGSSIVCARRNPSSYPHPSHPAPNPNSSPPSSAEVPVNSHHQTISTFLTSVALPSSCVSMIDIGK # DVWSISSSEVRKSVKMESDPGTKSMEEEEGIQGSEVDKRSRQWSEMVTGRVRRYIIDNRLYK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g814 ### # start gene g815 6 AUGUSTUS gene 3347697 3348425 1 - . g815 6 AUGUSTUS transcript 3347697 3348425 1 - . g815.t1 6 AUGUSTUS stop_codon 3347697 3347699 . - 0 transcript_id "g815.t1"; gene_id "g815"; 6 AUGUSTUS CDS 3347697 3348425 1 - 0 transcript_id "g815.t1"; gene_id "g815"; 6 AUGUSTUS start_codon 3348423 3348425 . - 0 transcript_id "g815.t1"; gene_id "g815"; # protein sequence = [MIFTTSRLFVLFCLWTSFFAVGALPAHSRERRTGSGVGTSHTSGTKGELFNSEPCLSFKYKYSILLLCLAPSTDTKSG # DEKVPVQLWVNHEGQSDEHWVLVIDKVYGFHAIAPEEKPAKPGQLEFKSGLDPQAKLKPQQLAYRPEKADKFMNLDCDATFKDQADMTKVFGELVTKI # DMSKPADEVGGNCMDYVKMALEFLQKGDYITSVPKIFTTYYNKNYNAVRKEVYLGGSSDESTEESE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g815 ### # start gene g816 6 AUGUSTUS gene 3356271 3357339 0.28 - . g816 6 AUGUSTUS transcript 3356271 3357339 0.28 - . g816.t1 6 AUGUSTUS stop_codon 3356271 3356273 . - 0 transcript_id "g816.t1"; gene_id "g816"; 6 AUGUSTUS CDS 3356271 3356510 0.48 - 0 transcript_id "g816.t1"; gene_id "g816"; 6 AUGUSTUS CDS 3356560 3356570 0.59 - 2 transcript_id "g816.t1"; gene_id "g816"; 6 AUGUSTUS CDS 3356631 3357339 0.52 - 0 transcript_id "g816.t1"; gene_id "g816"; 6 AUGUSTUS start_codon 3357337 3357339 . - 0 transcript_id "g816.t1"; gene_id "g816"; # protein sequence = [MPPRESNHLASLQGGLAAPLPYPAHGSPIPPQESNRLTPLQGGLASSLLYSVHGSEGFERGNFDREGYRGGFTPSTIN # SGTGDNMGYGGHSERSYGGGKGDYFEGRGAYGGNRADTYGDYRYDESTRVGGNYQRDRDIRGGEGNTGYQDYHQDSDMRYSEYRQEQDRYSWNGFTYD # GNAGATWDRGMENGNMASMGSGKLEGHWQYQCSLIHGKIEGPPQYARVVPQEQERIAQSQERKMQQEYDQDLLPTRKHAPKPPDSEALKVHARSQKTP # SDDEMEEAERAEFEHDPEANEDEEDDSPNYTEDLPITSRQRKIHF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g816 ### # start gene g817 6 AUGUSTUS gene 3362002 3363612 0.42 + . g817 6 AUGUSTUS transcript 3362002 3363612 0.42 + . g817.t1 6 AUGUSTUS start_codon 3362002 3362004 . + 0 transcript_id "g817.t1"; gene_id "g817"; 6 AUGUSTUS CDS 3362002 3363612 0.42 + 0 transcript_id "g817.t1"; gene_id "g817"; 6 AUGUSTUS stop_codon 3363610 3363612 . + 0 transcript_id "g817.t1"; gene_id "g817"; # protein sequence = [MMSDPLGQLRVCFTPLASAVVDTPEATLIACVGGSAKTSPFTLAMYKDYGDSFRHPPRLSSATLDTIDSIQARNIFPQ # DLPAYQRASVAVRTNGVVHPFWRDWALAEPCEFLTPEPLHHWHKMFWDHDAKWAIQAVRGIQIDFLFSIHQSAVGYRHFKEGISALKQVTGRTQRDIQ # RYLIPLISGAVSSKFVAALRSLTDFRYAGQAPRFSKTSSLRVQKALEEFHANKSEILNLKARVNPKGVLIDNWEIPKLEFLQSVEPSICASGPVMQWT # ADVTEHAHIYLVKDPACSGNNHDMEVFICRSLDRQARVRRFDLMTAMKDAQVDFRLGDVEGDEGGDGEHIQEGGNEEEITYISTTEELVTQLNPVSHK # LFGSFRPKQNFFLKARLLRQTLSAPLPHRVFTDEISGNIAAFSLVRDPDLKTMSIEDTSQLYLIQDFQGAISDFIDRFKAGIQTFVVGGRRNGNSQLI # IPFTKVKLWSRIRIQSKTYFNWDLLADPHTIFAAPPGPSWEFGRSNAAIINIDPKFHWPRSSLEGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g817 ### # start gene g818 6 AUGUSTUS gene 3365459 3366364 0.81 - . g818 6 AUGUSTUS transcript 3365459 3366364 0.81 - . g818.t1 6 AUGUSTUS stop_codon 3365459 3365461 . - 0 transcript_id "g818.t1"; gene_id "g818"; 6 AUGUSTUS CDS 3365459 3366364 0.81 - 0 transcript_id "g818.t1"; gene_id "g818"; 6 AUGUSTUS start_codon 3366362 3366364 . - 0 transcript_id "g818.t1"; gene_id "g818"; # protein sequence = [MTIQSWAKRVMNIVLIGETGVGKTAMLNLLANVCAGVPMEEFEEKNELNNEEGGSTAGSQTNKPRFYSITSANGHKVN # ILDTPGLADTRGIDKDKEHQAAIAEAIKTNFDVIDAVIILANGTLPRLGAATEYTLTTISGMFPNSIVDNIAFVLTMVSNPSSNNFTRTSLPKQLQNS # RIWPVDNPFAQWLKYQKELLKDPPISEDDLQEMLGSARRGYNKTLKMLSELFQYLDKCRVQPTHSIFDLYIMSTDIEVRISNVIAGMTQTEDKRMKLK # KLQEDYQTLVSFFSPSVEQALMISFEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g818 ### # start gene g819 6 AUGUSTUS gene 3368369 3369309 0.27 + . g819 6 AUGUSTUS transcript 3368369 3369309 0.27 + . g819.t1 6 AUGUSTUS start_codon 3368369 3368371 . + 0 transcript_id "g819.t1"; gene_id "g819"; 6 AUGUSTUS CDS 3368369 3368867 0.42 + 0 transcript_id "g819.t1"; gene_id "g819"; 6 AUGUSTUS CDS 3368993 3369309 0.63 + 2 transcript_id "g819.t1"; gene_id "g819"; 6 AUGUSTUS stop_codon 3369307 3369309 . + 0 transcript_id "g819.t1"; gene_id "g819"; # protein sequence = [MRKRTIRTSFHLLIRKQRNSSRRWKTVSGLYSVTIDPVDSGNSQLSSDDKETLDLWKRFRDLSIVEYEKLYRRLNVRF # DVYGGESLVKEDLIMDSLEKLRSKNLLTKKTERESRIGAAALAAETISDGQDIGDDDQAPDALALDFDQYNLGKPVVQKGGSCFSYPFCDQQDLHVRQ # FFKALSLMEEPFADELEHVNFGKIHGMSSRKGEVKFLSDILDASKEAMLDQMKKNDEKMKDVTDPEYTSDEVGMTCVKIQDMSAKRSVTFSPLFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g819 ### # start gene g820 6 AUGUSTUS gene 3371665 3372225 0.4 - . g820 6 AUGUSTUS transcript 3371665 3372225 0.4 - . g820.t1 6 AUGUSTUS stop_codon 3371665 3371667 . - 0 transcript_id "g820.t1"; gene_id "g820"; 6 AUGUSTUS CDS 3371665 3371851 0.44 - 1 transcript_id "g820.t1"; gene_id "g820"; 6 AUGUSTUS CDS 3371990 3372225 0.4 - 0 transcript_id "g820.t1"; gene_id "g820"; 6 AUGUSTUS start_codon 3372223 3372225 . - 0 transcript_id "g820.t1"; gene_id "g820"; # protein sequence = [MGAGTEVTEFREDRLPSAEIEPYSLDDETKPASMIKLVSPVVTRCHMIVVPVTGIPDDDVEDEYECGREEGCNEVAPE # GDDVEAETEDVSIDDVDFPDTPVDFLDGVGCADVSEGDITDVNDSPLTLDADGGGVAGMSES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g820 ### # start gene g821 6 AUGUSTUS gene 3376328 3376858 0.44 - . g821 6 AUGUSTUS transcript 3376328 3376858 0.44 - . g821.t1 6 AUGUSTUS stop_codon 3376328 3376330 . - 0 transcript_id "g821.t1"; gene_id "g821"; 6 AUGUSTUS CDS 3376328 3376673 0.89 - 1 transcript_id "g821.t1"; gene_id "g821"; 6 AUGUSTUS CDS 3376722 3376858 0.44 - 0 transcript_id "g821.t1"; gene_id "g821"; 6 AUGUSTUS start_codon 3376856 3376858 . - 0 transcript_id "g821.t1"; gene_id "g821"; # protein sequence = [MRRAAHAVLNVRASAQYQPVQIEEAVIFAHKLLYDTSSPLSTKIARSASTMISVIYGKQLLESSEKPKQSDALPENHS # SETFGSSPLDPLQALTDTVHTFTNALAPGAHLVDFLPILDYLPTAMAKWKRNAKRTFQQTTNLYENYYNTTVSTNTWFSGEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g821 ### # start gene g822 6 AUGUSTUS gene 3381410 3383149 1 + . g822 6 AUGUSTUS transcript 3381410 3383149 1 + . g822.t1 6 AUGUSTUS start_codon 3381410 3381412 . + 0 transcript_id "g822.t1"; gene_id "g822"; 6 AUGUSTUS CDS 3381410 3383149 1 + 0 transcript_id "g822.t1"; gene_id "g822"; 6 AUGUSTUS stop_codon 3383147 3383149 . + 0 transcript_id "g822.t1"; gene_id "g822"; # protein sequence = [MASADPPIPFEPRVNVDTPELNERLRSCYGLADTQLSEIKEMLRSSQMDIADYDSEIKRVKLAYDTETSRIHAEYNMN # AAVLRVRYEAEVGHAQTAHSAKMHRIRLRCQGLKKYTEKLTTLLSPIRRIPSEILLRILVHFCDQNDLTSYEPGDASALTISAVCTRWRQLAISQPAL # WANLKVKFDDQCEDDEEKTQALLVSRVELHLARSQNHPLTLSLFPLSSKNHPALILVARESRRWRRLSYGGDDFGSNWNSCLQSLPLPMLEAVRFEET # EYCDGQSPPIEAFSQAPNIKELNLRCIFIDQHVTATFDGAWEMLTDLSYHFTEDLEGFLSILDCCPKLRRLTLEGENSDLIPVHPIRSHPIASLKILN # LVNPPNDHDSMLECILTSLLLPDLTELVLLHIGDVEEPFLMPYRILEHFFQRSRCPLSTLTLGQICMTDTDMIALLAHLPFLRELTCEDPDDGDSFIT # RSFIRSLHTWERDSLHRSIEPLVPKLRSLTLKAHRKEFDAPTFVETITSRWLPDEASATQLGASCLRSVELHLEGVVDADAYEPLKRFDRAGMRVVVK # SKALNGLVNLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g822 ### # start gene g823 6 AUGUSTUS gene 3390722 3391561 0.67 - . g823 6 AUGUSTUS transcript 3390722 3391561 0.67 - . g823.t1 6 AUGUSTUS stop_codon 3390722 3390724 . - 0 transcript_id "g823.t1"; gene_id "g823"; 6 AUGUSTUS CDS 3390722 3391561 0.67 - 0 transcript_id "g823.t1"; gene_id "g823"; 6 AUGUSTUS start_codon 3391559 3391561 . - 0 transcript_id "g823.t1"; gene_id "g823"; # protein sequence = [MVSSSSITTTTHKHRSRFAVTSAKTRIRTHMIIAMFLLLSSSTLMDISGGYASPIPTSPDIDLAPSSVTTGTITDPRS # IPIPIPGPNATTLITNRDINQCISAPNSPDVVAVSVARNMGIVVGGAAGAAGDDDDDEMTAHSNFERSGHPLRNFHLLRRLFGPPKLEPLPMKSELEL # LTDETTHVLLGFSYATQVGVFSEASRLCVGYPFSTPTHSLSIFYLTSLPQVHGNQYIRQEFPLREFFLPDSTLNDKPGGDMILLPKSGMEIEDSKVCM # YCQCM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g823 ### # start gene g824 6 AUGUSTUS gene 3458360 3458725 0.26 + . g824 6 AUGUSTUS transcript 3458360 3458725 0.26 + . g824.t1 6 AUGUSTUS start_codon 3458360 3458362 . + 0 transcript_id "g824.t1"; gene_id "g824"; 6 AUGUSTUS CDS 3458360 3458725 0.26 + 0 transcript_id "g824.t1"; gene_id "g824"; 6 AUGUSTUS stop_codon 3458723 3458725 . + 0 transcript_id "g824.t1"; gene_id "g824"; # protein sequence = [MLGPVLEYVTRRREVNKLLISRINATYNLPGFTGTPHPGESINPVHATYPHTPSASEMHEPDTSPPTSPGHNAGSSNV # PHSTPDDRQPQFEDDNSEDEGPLEDDDEFVDDMGKVIDFIAGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g824 ### # start gene g825 6 AUGUSTUS gene 3461894 3462124 0.68 + . g825 6 AUGUSTUS transcript 3461894 3462124 0.68 + . g825.t1 6 AUGUSTUS start_codon 3461894 3461896 . + 0 transcript_id "g825.t1"; gene_id "g825"; 6 AUGUSTUS CDS 3461894 3462124 0.68 + 0 transcript_id "g825.t1"; gene_id "g825"; 6 AUGUSTUS stop_codon 3462122 3462124 . + 0 transcript_id "g825.t1"; gene_id "g825"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g825 ### # start gene g826 6 AUGUSTUS gene 3463545 3464897 0.81 + . g826 6 AUGUSTUS transcript 3463545 3464897 0.81 + . g826.t1 6 AUGUSTUS start_codon 3463545 3463547 . + 0 transcript_id "g826.t1"; gene_id "g826"; 6 AUGUSTUS CDS 3463545 3464897 0.81 + 0 transcript_id "g826.t1"; gene_id "g826"; 6 AUGUSTUS stop_codon 3464895 3464897 . + 0 transcript_id "g826.t1"; gene_id "g826"; # protein sequence = [MPVNRRSTSRSSSPLLPAVTSLGEVVSPVPQSDGEVEQDQLAFTIEAPSRPQLQLFETIFNTGKLLSAYCEDDPLWSL # LAAVASPCTNCLKSPSKCQVPANSPRCTNCSSKKTCSLGKILRYHYFARRCSQDLAYSRRFLELHGTPAQRVTWGIPLDVWRRYDAVLHDRTSSTSTL # LELNMLDEQDEVTADQQELQKFLALQQDEASVAAKRKRVRSPLPVAGPSTKKVRLEVSKKRSRRRAPGIEVDTEPPRRVLLVVPPSRSSVTSTIAPVP # PPALSSPMEVSIRDVPVQGSSGLVQLATIAEAHSGLARRPASPPVPQVPIKGGESDLLSSNMPPLPRSTLVPRVLTAHPYRAENQRLAAQVRLLESQL # ADSRRENSSLTTALRDTSHALEARQREVEQLRSSSQEFVRNKAEYRRIIDQFLALDRALHGSPDQVSCRVTFPLLPLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g826 ### # start gene g827 6 AUGUSTUS gene 3464933 3466021 0.4 + . g827 6 AUGUSTUS transcript 3464933 3466021 0.4 + . g827.t1 6 AUGUSTUS start_codon 3464933 3464935 . + 0 transcript_id "g827.t1"; gene_id "g827"; 6 AUGUSTUS CDS 3464933 3466021 0.4 + 0 transcript_id "g827.t1"; gene_id "g827"; 6 AUGUSTUS stop_codon 3466019 3466021 . + 0 transcript_id "g827.t1"; gene_id "g827"; # protein sequence = [MVEEELRIAKKDRDAAAEQLSTSSRKIAELTTTLLYQQGIVDESNALATRQRVRLEELQEEVHRSRGRAAFVEQMIQE # YPDEGFYEVVLPPLSELEGELVSIRADLRRVATLAHRLYRSDPATVLHHHDRYIGAIIEAVVAFLRRGLDSDDPNVAAHNFRLALDYMQSARGIHGDL # YMRSISSIQWFFHNAVDQDEGLYRLVLEHSRFDNDGSFLTASQHAGFVAPPPDSLEPPLHRRMLALSTALPHREGAGRWDDIVPAIPSDDQLTIDWEQ # LMLRYIHHITDTPLPAQPSPSPWWLNPRSIHRTRLLTDLSRKLGLSPLLAPPFKFCCSCLSRNPLPLPLLPPLLRVYLPFLVPSPPYP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g827 ### # start gene g828 6 AUGUSTUS gene 3466367 3467344 0.86 - . g828 6 AUGUSTUS transcript 3466367 3467344 0.86 - . g828.t1 6 AUGUSTUS stop_codon 3466367 3466369 . - 0 transcript_id "g828.t1"; gene_id "g828"; 6 AUGUSTUS CDS 3466367 3467344 0.86 - 0 transcript_id "g828.t1"; gene_id "g828"; 6 AUGUSTUS start_codon 3467342 3467344 . - 0 transcript_id "g828.t1"; gene_id "g828"; # protein sequence = [MPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNN # TPNTTTGVSPFFANKGYHPRLSITLEQVQGAEVNEYASNLKGLHAYLQERIRVANEVYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKW # TGPYTILSKVGSHAYRLDLPGNLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPVFIKGKTEHFVESILDSKPIQGRPEEIEYLVKWEGYGDEFNSWVEW # EGMAGSTDLLRSWHKTHSRKRRPLQTHWDLLEREAQEDEEDTLEEGRGYRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g828 ### # start gene g829 6 AUGUSTUS gene 3467668 3469245 0.99 - . g829 6 AUGUSTUS transcript 3467668 3469245 0.99 - . g829.t1 6 AUGUSTUS stop_codon 3467668 3467670 . - 0 transcript_id "g829.t1"; gene_id "g829"; 6 AUGUSTUS CDS 3467668 3469245 0.99 - 0 transcript_id "g829.t1"; gene_id "g829"; 6 AUGUSTUS start_codon 3469243 3469245 . - 0 transcript_id "g829.t1"; gene_id "g829"; # protein sequence = [MSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKI # FTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEESHVEHVRKVLERLRANHLH # AKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWSWTPQCSSAFELLKSAF # SEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFT # TTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDTLTRRSDVYPKKGASRDQALAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALRR # IARNEEESIVWEDGLIKRGGRIYVPDVGTLRREVLQSYHDHKLRDIRGRNAPRSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g829 ### # start gene g830 6 AUGUSTUS gene 3469891 3473490 0.97 - . g830 6 AUGUSTUS transcript 3469891 3473490 0.97 - . g830.t1 6 AUGUSTUS stop_codon 3469891 3469893 . - 0 transcript_id "g830.t1"; gene_id "g830"; 6 AUGUSTUS CDS 3469891 3473490 0.97 - 0 transcript_id "g830.t1"; gene_id "g830"; 6 AUGUSTUS start_codon 3473488 3473490 . - 0 transcript_id "g830.t1"; gene_id "g830"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESALNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEV # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMR # HMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLLEELSGSNLERALEFRRRLVADNRGTSYMVQCEPESVGEFPPEQFDQKGQLHGSDGRFLAQKH # SSPRSIEVPEFFNPGNTATRSPQLRSGTSPTVHALAQNSTPPPRVNLQTKPVTPVSTQRYQFGEVRMDGAQHSSWIYGQDLTARLVPNPVHVPPRRSN # PSVIPYQGSVSMQSHAVGAESQRDPNQRRTLVVHEEAVPPQGAPLGTPFVTGAQTNRPGMVVDSAHSQESVAMIQQQARVIETLQEQLREVKKGFTAG # EVPTGGPPSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEY # GRPEGGAYALENEGEGKGGFNPPPRVPPPHFSSQSRDRERPPSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEDSDEGEQNQSGRNGGRRE # EDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWLLSLERMFGVRPTIYA # REKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTY # LKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRSKVEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g830 ### # start gene g831 6 AUGUSTUS gene 3475786 3479184 0.89 + . g831 6 AUGUSTUS transcript 3475786 3479184 0.89 + . g831.t1 6 AUGUSTUS start_codon 3475786 3475788 . + 0 transcript_id "g831.t1"; gene_id "g831"; 6 AUGUSTUS CDS 3475786 3479184 0.89 + 0 transcript_id "g831.t1"; gene_id "g831"; 6 AUGUSTUS stop_codon 3479182 3479184 . + 0 transcript_id "g831.t1"; gene_id "g831"; # protein sequence = [MDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPELEPPAENP # HIEVPLEATLELSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLP # AHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRL # QGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRRMVREVLTRL # EKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFD # TLREAFISAPILALWTPDRPTRIEVDASGFAMGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSN # LEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLK # TVKEHGLQRLANGIAKWEEDNGLVYYRGQVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRA # VTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIK # SDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDA # GAALHLGKKQQKEGYKRGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEI # PTPPEPVYLEDEDEPEYKVEEILDSRVQWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g831 ### # start gene g832 6 AUGUSTUS gene 3479669 3480578 0.89 - . g832 6 AUGUSTUS transcript 3479669 3480578 0.89 - . g832.t1 6 AUGUSTUS stop_codon 3479669 3479671 . - 0 transcript_id "g832.t1"; gene_id "g832"; 6 AUGUSTUS CDS 3479669 3480230 0.97 - 1 transcript_id "g832.t1"; gene_id "g832"; 6 AUGUSTUS CDS 3480460 3480578 0.9 - 0 transcript_id "g832.t1"; gene_id "g832"; 6 AUGUSTUS start_codon 3480576 3480578 . - 0 transcript_id "g832.t1"; gene_id "g832"; # protein sequence = [MQDETDQVNITWVATFISSTPHRQGARVQSDENQAQAANCFSQAILQAIWTEATQDQLDDNETSEPTVPGSPLSSLPS # SPSSSPLSSPPASPKHIEDPPAGATVQPPNQPSPGLTNTKKRKISCAKASSKAARKQKRKEAPPKTADEIPVKPAAQRKHVYPSTPVHPQFSMEEDAP # VASSAYVGKRSECQEGDSVAWSLEDMVGPNSKLKFSLFKWDACHEAAEAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g832 ### # start gene g833 6 AUGUSTUS gene 3483918 3484316 0.49 + . g833 6 AUGUSTUS transcript 3483918 3484316 0.49 + . g833.t1 6 AUGUSTUS start_codon 3483918 3483920 . + 0 transcript_id "g833.t1"; gene_id "g833"; 6 AUGUSTUS CDS 3483918 3484316 0.49 + 0 transcript_id "g833.t1"; gene_id "g833"; 6 AUGUSTUS stop_codon 3484314 3484316 . + 0 transcript_id "g833.t1"; gene_id "g833"; # protein sequence = [MSLLEWEEWSSTHTGAVQHMQEVRDQPRDESPPTAPQPPGDDEGNTPPTDSPLNPPINRPPAHPLPSPARTPPLTAST # EPSSSGGSFVNSFAVTGANGMAIQTAGRTQKKRSNAGKPRKWRQTERLGERTEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g833 ### # start gene g834 6 AUGUSTUS gene 3485966 3487507 0.72 - . g834 6 AUGUSTUS transcript 3485966 3487507 0.72 - . g834.t1 6 AUGUSTUS stop_codon 3485966 3485968 . - 0 transcript_id "g834.t1"; gene_id "g834"; 6 AUGUSTUS CDS 3485966 3487507 0.72 - 0 transcript_id "g834.t1"; gene_id "g834"; 6 AUGUSTUS start_codon 3487505 3487507 . - 0 transcript_id "g834.t1"; gene_id "g834"; # protein sequence = [MSSALFTAVTTTLKGDNYDTWTPEIEAFLQATGLGSAITSDPPVEPSPLDTEDLDSVKAWKEYDDALKSWKEIDTKAV # GNICLCLSPSIRILAKDQSNMAKELWEFLQKTYKVKGLGAVFNDFAAAMAVKVPYKGNPLTAMTDIGMFFSRMDDADIGIPAHLKALILLSKLPSCYS # VVVQTMSQLSTEELKKLTLTKVRIAVMNTFSGDTIGNSQPQNANKFSNVHCKGNDPKFSQQQHGNGSNQQQKGQNGNDDSNKKKRKHGSGKNKKAKKN # ANTAQADADSMIFSPIGSTVDFGPVRTDLTPSVQDVRKHSIHPPYNPPPNATSLRLHKKTRMAINRARNIGIRATAEVIRTLEPTEHISELDSDDELD # PPTKRTCAMSPVDDVENGSKASMPPPPSPPMDFEVPGTASFDPDELMNFDLDREILAITGFMDTMESVPSSDLDHTICTNAPLSVAVAKTCKSAFEPD # LLSRLYNYCIDAKYISNEYFCVHDISYSVCKKRKGKQRNQPKW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g834 ### # start gene g835 6 AUGUSTUS gene 3489355 3490844 0.31 + . g835 6 AUGUSTUS transcript 3489355 3490844 0.31 + . g835.t1 6 AUGUSTUS start_codon 3489355 3489357 . + 0 transcript_id "g835.t1"; gene_id "g835"; 6 AUGUSTUS CDS 3489355 3489966 0.31 + 0 transcript_id "g835.t1"; gene_id "g835"; 6 AUGUSTUS CDS 3490083 3490844 1 + 0 transcript_id "g835.t1"; gene_id "g835"; 6 AUGUSTUS stop_codon 3490842 3490844 . + 0 transcript_id "g835.t1"; gene_id "g835"; # protein sequence = [MLELKEQVPEVPLSWYFKYILPPLPDGIDTKKIVASLKKSKAIKNNSWAGIPEHPRDDSRHEDDVYAGLENVFERIVD # AAKTQIPGLEQKSALKLTPHAKATSERDSTTMPDGHFTSIDEAVRLSRSGEEPSLYQVWNSHEFKKGNERVRDIMNQVRIPYPTSPISVLIMDLLVCF # SGCLRHATNHGLGPVSAVYVWDVDHESLEPEKLVHVFLAFAFASRTDAGWDPSMSFILPASPTEKRQYRIRVGDKTYITVKMLSDHAADSPIGRGTRV # WLVIDEAGPPDCYYVLKDVWVDNGRETEDEIRSNLLKDVELKCGSDACATVKKHLLTPIAFEKLLIGTNVDDTSQVIMRGGSLPKTLQHLKLFVPQQS # RSTTRSQVSTRQNPVDAVFSGTSARYLPVGDPVQNGPQVTSRYHYRIVFQEYATTMYDEKNLGNALRALADVTDGLSSANDLYYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g835 ### # start gene g836 6 AUGUSTUS gene 3491105 3491674 0.98 + . g836 6 AUGUSTUS transcript 3491105 3491674 0.98 + . g836.t1 6 AUGUSTUS start_codon 3491105 3491107 . + 0 transcript_id "g836.t1"; gene_id "g836"; 6 AUGUSTUS CDS 3491105 3491674 0.98 + 0 transcript_id "g836.t1"; gene_id "g836"; 6 AUGUSTUS stop_codon 3491672 3491674 . + 0 transcript_id "g836.t1"; gene_id "g836"; # protein sequence = [MASEVITGRYLFLPAEDSYGGPEQIPTSSIDQPPFAFNPLHDIESIWWILVYLLYFNDDKEHIADLELATARAQKALV # LFTQILDRAMFLQTSRQLTVEGTSLSPSFRFVINTLRAIAIKLHTAFRDSEAKISVIEETAFDIHEYVVQALRLPCNNPQVNSIELVGVSRPQKRKID # EAESGHEDSSNKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g836 ### # start gene g837 6 AUGUSTUS gene 3492430 3492906 0.61 - . g837 6 AUGUSTUS transcript 3492430 3492906 0.61 - . g837.t1 6 AUGUSTUS stop_codon 3492430 3492432 . - 0 transcript_id "g837.t1"; gene_id "g837"; 6 AUGUSTUS CDS 3492430 3492906 0.61 - 0 transcript_id "g837.t1"; gene_id "g837"; 6 AUGUSTUS start_codon 3492904 3492906 . - 0 transcript_id "g837.t1"; gene_id "g837"; # protein sequence = [MQSPSTSWIPASSGHVGYVASILDPHLQNPERDQSLKTHEEFANIHSHGQMEPSTTHRQPSPSPPFHHFPSSSYSSLS # GWAGKEEENGLMESANSDSYPLRGEAIGEPVMTLRAPPSLYGFSSNSETIAGSQWKPRREDANWIMNTATDANSGQSSTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g837 ### # start gene g838 6 AUGUSTUS gene 3492954 3494360 0.34 - . g838 6 AUGUSTUS transcript 3492954 3494360 0.34 - . g838.t1 6 AUGUSTUS stop_codon 3492954 3492956 . - 0 transcript_id "g838.t1"; gene_id "g838"; 6 AUGUSTUS CDS 3492954 3494360 0.34 - 0 transcript_id "g838.t1"; gene_id "g838"; 6 AUGUSTUS start_codon 3494358 3494360 . - 0 transcript_id "g838.t1"; gene_id "g838"; # protein sequence = [MNPLNSTSVPLTRLFLKRSLSEPAAPRPTRPRLQLTPEDGIVDRDGEASLYDEKGNHGGNGGYDLGQLFAEAIPPSMS # TMYSYSSSPSSSSVSPGGGYLPRRHHANSYPIPGSNSVRGRSGYPISHPYPIHSSEPSWVTPRIQINDVSSGLGDAVDEHLSSISTSPTSPQPSSASG # TPSSDLSSLATMSFMVPSYSSFSYSLPAPEDTGNYDNENSNRNNMTGQRSGSISPIRSQRSSAPLSAPLPYPYPRTHSDGMPQRRRAWSTRSTLTLNN # TLIETSPKYHWPTGSLNSNATDVSLSPTHKDTHLRPASRASLPPSSPASPVGGELRSGRRNAFLNQSHRRTSTWGEHWSYFTSTNTDSSPSPSPSASP # HREPISNNPNSAQTSLTWQQVESERRRGFATEFMEEEGDTVARMADKGKGIGVAQMVSTDKMGWEQARFPLSSRSFGLVVSDVRNRCFPCGQHMVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g838 ### # start gene g839 6 AUGUSTUS gene 3494505 3496637 0.72 - . g839 6 AUGUSTUS transcript 3494505 3496637 0.72 - . g839.t1 6 AUGUSTUS stop_codon 3494505 3494507 . - 0 transcript_id "g839.t1"; gene_id "g839"; 6 AUGUSTUS CDS 3494505 3496637 0.72 - 0 transcript_id "g839.t1"; gene_id "g839"; 6 AUGUSTUS start_codon 3496635 3496637 . - 0 transcript_id "g839.t1"; gene_id "g839"; # protein sequence = [MDATHSYNPSSTREDENNSTPENQYHRHQYPTTTRFLPPIDAFDESLDEEEDDDMPPGIMVDELSPLPPRLFIHDDAD # EDMPPSGIVNNDTLDTQPRNRKEGKVGDDPPPLVLPPATLSRGGSGLTSDGGNPSRTINTRNKPARTGPLTFNYTFLPDMSLATASDGSPGARITEVA # SDLGGLNPENTTYSSFPTVSGVEYDPGAIHSVAYPTYPTSYPPTSYHHIPRPPNAFILFRSAFIRSRKISSEIEGNHSTLSKIIGRVWRSLPPPERAE # WEARARIAQEEHRLRYPDWRFSPAGGGSGGGGKSRSKGNRGKGRGRGRGRGRLKAGQGGDSVTSSAGNEASADMVEESGQDKANEEPQEPNEGGLRRI # QLVPRASSSTSKPVSFRTVDTLSNPKDPATTSTQTLSASSAGSAVVVDDPSEISTRNLITSNLQREVVTADVFRTLSATDSNSNMLSTGIDESQSSER # ESDQPREQGGSETVAIDSLSSASTWYPSATAIVKNETDARVDAIADMLAQGFEGRALEVAVREWEVADEKQKERKRKDRERKERREGRERGMKEREKR # KGNAKEMDIVGMAAQKSHEWVEEANTRVRGSANASITRQAREMDVDQHQQSQDPGEDRREDETESRRSEQTLYAHVPEFGVEEGFLHGDFGNHSWLTS # YSPEERAEVVGEVPSEFIHAYRVFISGLIICISSYRLFKVKLQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g839 ### # start gene g840 6 AUGUSTUS gene 3500724 3501880 0.07 - . g840 6 AUGUSTUS transcript 3500724 3501880 0.07 - . g840.t1 6 AUGUSTUS stop_codon 3500724 3500726 . - 0 transcript_id "g840.t1"; gene_id "g840"; 6 AUGUSTUS CDS 3500724 3501136 0.26 - 2 transcript_id "g840.t1"; gene_id "g840"; 6 AUGUSTUS CDS 3501520 3501880 0.7 - 0 transcript_id "g840.t1"; gene_id "g840"; 6 AUGUSTUS start_codon 3501878 3501880 . - 0 transcript_id "g840.t1"; gene_id "g840"; # protein sequence = [MSSLSNFPKLPTSVGGQPIPDFLKFKVRGPVTRQPVSDKFNFAITASPQFGTQEGSTFDEGKLWHPIQSLEFTSNNES # TGGGLMSFRGNYQARSTRLVGKEASSKSVVKLDSGEYVKGISAALAADDPTPVLNASLSSQWLDANTQNAWANNDMSTVENLKIQASQDLLPIYSNIA # TNGDSAWTEVEGDDGEIYYLSWTTNGVIWSYTPTASNSVNKASGTTTATTDTIVSIGSYSTTANFLGISMYTWSNIPVCSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g840 ### # start gene g841 6 AUGUSTUS gene 3503026 3503706 0.67 - . g841 6 AUGUSTUS transcript 3503026 3503706 0.67 - . g841.t1 6 AUGUSTUS stop_codon 3503026 3503028 . - 0 transcript_id "g841.t1"; gene_id "g841"; 6 AUGUSTUS CDS 3503026 3503706 0.67 - 0 transcript_id "g841.t1"; gene_id "g841"; 6 AUGUSTUS start_codon 3503704 3503706 . - 0 transcript_id "g841.t1"; gene_id "g841"; # protein sequence = [MYLMSGGLSPDAPNISNATSATTNALVQHVEEDDHGHIHDDPYPIKGKLFVHPSLFEVGTPPELRDVMKNAIESMLEP # IIPEILAVYEQNRPDLKLQEPPTRIPLIRIFKNPAITDMYDFRLTFSKNRRTYFGHIDKKCLILEKEDNNKVSFEFQPELLTGKMGEDARLKNRLLVS # FMDGKTVVSSILFFSTTVHSFVLITQDVTRNNGLLSHFKSKTKGKNQGSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g841 ### # start gene g842 6 AUGUSTUS gene 3504671 3505297 1 - . g842 6 AUGUSTUS transcript 3504671 3505297 1 - . g842.t1 6 AUGUSTUS stop_codon 3504671 3504673 . - 0 transcript_id "g842.t1"; gene_id "g842"; 6 AUGUSTUS CDS 3504671 3505297 1 - 0 transcript_id "g842.t1"; gene_id "g842"; 6 AUGUSTUS start_codon 3505295 3505297 . - 0 transcript_id "g842.t1"; gene_id "g842"; # protein sequence = [MSGGLSASNPDLPGHSTSVDRNAYDQVLHAKDANTGQNPIIEARLWIDPHIFDADLHYRTAMGFAVEHMMKPIRSTIL # KDIKTNVKPNIPSLEFPSTTPVAVYRLTGKDFANQGDFEISFSGVTRRDRTRFRNWWFAMPGSLDPSYFGRVDLKCLVPTRKGSYVVKKELVTGKISR # RYPEQNEEVLISFKDGKPLFKNGEVRYLVSIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g842 ### # start gene g843 6 AUGUSTUS gene 3506012 3507181 1 + . g843 6 AUGUSTUS transcript 3506012 3507181 1 + . g843.t1 6 AUGUSTUS start_codon 3506012 3506014 . + 0 transcript_id "g843.t1"; gene_id "g843"; 6 AUGUSTUS CDS 3506012 3507181 1 + 0 transcript_id "g843.t1"; gene_id "g843"; 6 AUGUSTUS stop_codon 3507179 3507181 . + 0 transcript_id "g843.t1"; gene_id "g843"; # protein sequence = [MSQPENEKQSQSRSRPASRASNPDVESKPNQSRPTSQASNRSHSQAEPTQQDEPRTQDEDQSRSASQDEPKQQTKSRP # ASQASNKPPSRPASQASHGSKPPSKAASRTSSPSVSRDSRPPRTPRGRSRTPRSLSSASGGSDEENRAPTPTADNPEPELPDVDEEDGEGDNAVYNNA # KGTTQTREPESIDDDGNGEKDGKGEKEKKKRRRRGKKGTKGFGVDKWPHGDKPGRLEPPHGVNDWPHEDEEGEGVGTSGRVLQRPKGVRDFSPAYAAS # DAGSNVSTASSVSGLSLGDWSRSSSSLAGVDTWPYGDNPGIMVKPLDHWGKPITNPDGTLVQKENWTGLPSYDELRGMDLDTHDDHVIKLKLELDLDV # AVEINARIHGDLTLALL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g843 ### # start gene g844 6 AUGUSTUS gene 3507771 3508972 0.94 + . g844 6 AUGUSTUS transcript 3507771 3508972 0.94 + . g844.t1 6 AUGUSTUS start_codon 3507771 3507773 . + 0 transcript_id "g844.t1"; gene_id "g844"; 6 AUGUSTUS CDS 3507771 3508121 0.94 + 0 transcript_id "g844.t1"; gene_id "g844"; 6 AUGUSTUS CDS 3508268 3508972 0.97 + 0 transcript_id "g844.t1"; gene_id "g844"; 6 AUGUSTUS stop_codon 3508970 3508972 . + 0 transcript_id "g844.t1"; gene_id "g844"; # protein sequence = [MFKRIERKRKRQEEEEALGLDEEVKEALGMGGVDSDSEESDDEESGSEENGDENEESEEVEEEEEGDSSDVGEEETED # VDMKIKDDSESEEEKPPTISKRALKKVSSNYNSSSLIDIQARQQKIQKIRERHAIWKKEKLQVASKVSSTLKTTPSTTPRRQQRTVTTTTTTSSKSSP # TIKDPVAASRVDAVDSAQNNNTGGLEKENGARPKSQTQSKSKSKPDAAVTHVKGKAALKSPSLSSAGKSVAGDADVGAEGKKKQAATRRSESNVIVKK # KKKKKENNGKRDIVLSNEGDINGYEREGAIAKFKPQKSSPTRTNTTVASAIPPKPKRPKHQHTPKDIDTKLTKKKKQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g844 ### # start gene g845 6 AUGUSTUS gene 3511975 3512738 0.32 - . g845 6 AUGUSTUS transcript 3511975 3512738 0.32 - . g845.t1 6 AUGUSTUS stop_codon 3511975 3511977 . - 0 transcript_id "g845.t1"; gene_id "g845"; 6 AUGUSTUS CDS 3511975 3512640 0.49 - 0 transcript_id "g845.t1"; gene_id "g845"; 6 AUGUSTUS CDS 3512679 3512738 0.53 - 0 transcript_id "g845.t1"; gene_id "g845"; 6 AUGUSTUS start_codon 3512736 3512738 . - 0 transcript_id "g845.t1"; gene_id "g845"; # protein sequence = [MRFNLACFALGLFTAVSAIPKLTEFQVQNNNGAVEARAPSSNNEFDLRELGGAIGVNVYHARGTQIFNSRGEEIDARE # TFGFTSADLESREAFAAAISSISSRAPNKVTIKVTFTNDLSSDSNNPDRAKAQSDAKAAVQSLLNAAAKELSLEGKTLDVIFLNDYHSSRGETTEHVT # FTFDETICAGTCTGHAFGSGKGEIFKHDHSKIFSKKVRLCLSYCLDVVSLMAALLFLPAVNILVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g845 ### # start gene g846 6 AUGUSTUS gene 3515431 3515949 0.65 - . g846 6 AUGUSTUS transcript 3515431 3515949 0.65 - . g846.t1 6 AUGUSTUS stop_codon 3515431 3515433 . - 0 transcript_id "g846.t1"; gene_id "g846"; 6 AUGUSTUS CDS 3515431 3515949 0.65 - 0 transcript_id "g846.t1"; gene_id "g846"; 6 AUGUSTUS start_codon 3515947 3515949 . - 0 transcript_id "g846.t1"; gene_id "g846"; # protein sequence = [MIKLFKGTCEAVRAMHEWRPAKGAKKGNTTNEARSNAHQNVSSSNQGQGRSNGNAPQVQSNNSQSRAQTNADGDDEDD # DHRFPEPEGDAEGGYSYGPSSRGTGKPSRSGSGSVPLIDRDRGEEEGLMGSQADDRGGEALFDGDEDVAGIDGEGGAGERGEIVPYAHRDIKPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g846 ### # start gene g847 6 AUGUSTUS gene 3517418 3518158 0.91 - . g847 6 AUGUSTUS transcript 3517418 3518158 0.91 - . g847.t1 6 AUGUSTUS stop_codon 3517418 3517420 . - 0 transcript_id "g847.t1"; gene_id "g847"; 6 AUGUSTUS CDS 3517418 3518158 0.91 - 0 transcript_id "g847.t1"; gene_id "g847"; 6 AUGUSTUS start_codon 3518156 3518158 . - 0 transcript_id "g847.t1"; gene_id "g847"; # protein sequence = [MLSGSSSSLSRLPWACLFLVYLLNIAAIASPVNSPVSSHDPISIIEEGMNIHDFSLDNEADQVSATYTEVKLWVIRDK # ASRKTKKAYIYIGEQGFGLGDVPPLSDSVPPKKKFNIGKPPQDPTELLGPAFFANTQDRDRTLDELRTLNQNYGKIEGRYYVYLTEILRRLAWHQTGL # LDPMFSFDDELLQKWNDRADKIAKKINEKNEKKEKKRKDAQAKKINEKKEKKRKDAQAQGKSNRTKRTRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g847 ### # start gene g848 6 AUGUSTUS gene 3524331 3527114 0.13 + . g848 6 AUGUSTUS transcript 3524331 3527114 0.13 + . g848.t1 6 AUGUSTUS start_codon 3524331 3524333 . + 0 transcript_id "g848.t1"; gene_id "g848"; 6 AUGUSTUS CDS 3524331 3524391 0.56 + 0 transcript_id "g848.t1"; gene_id "g848"; 6 AUGUSTUS CDS 3524530 3524764 0.89 + 2 transcript_id "g848.t1"; gene_id "g848"; 6 AUGUSTUS CDS 3524814 3525204 0.36 + 1 transcript_id "g848.t1"; gene_id "g848"; 6 AUGUSTUS CDS 3526341 3527114 0.78 + 0 transcript_id "g848.t1"; gene_id "g848"; 6 AUGUSTUS stop_codon 3527112 3527114 . + 0 transcript_id "g848.t1"; gene_id "g848"; # protein sequence = [MIGQSQSGTGKTAAFVLTMLIIAMGKFTSVQTEYAIKENLPRNATRITAQIIVGTPGTMIDLLRRKVIDASGVRVFVL # DEADNMLDQDGLGDQTLRVKNLLPKSQVQIILFSATFPDHVRAFASKFAPNANKIELQREELSVDSIRQFYMDCRDEEHKYDILVTLYTLLTIGQSII # FCQHRHTADRISARMTAEGHHVASLHGAKDATERDQIIDRFREGKEKVCISDIRVLQNDTAADGGVQWPWYLGLYGNYTIWNYAVGGAVCSNNLTPLY # GEPDVSSGQQAWFIQDHIDAGNASQQKLLLDPSSFVVVQFIGTNDVGIGSFLTADQAANVSLPDVVDCQLDSIRTMHLLGARNFILNSLIPLQLTGLY # SNSSAPTIYYPEVHDGDAWNKGMYNLVHSLNRMLSDGINVLNAEWAGDGRVEWFNTYEFFEKMYNNPTQYFNGSIPANVTGHCHQCPDPDDYTKCGMY # VSNIVLSYPLRHINDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g848 ### # start gene g849 6 AUGUSTUS gene 3532033 3532677 0.93 - . g849 6 AUGUSTUS transcript 3532033 3532677 0.93 - . g849.t1 6 AUGUSTUS stop_codon 3532033 3532035 . - 0 transcript_id "g849.t1"; gene_id "g849"; 6 AUGUSTUS CDS 3532033 3532677 0.93 - 0 transcript_id "g849.t1"; gene_id "g849"; 6 AUGUSTUS start_codon 3532675 3532677 . - 0 transcript_id "g849.t1"; gene_id "g849"; # protein sequence = [MVAIGVYYLGAEPSASTHSFRPQSMSQASHSTSSLAARTNRASLPAPARKSPTSPNMPATPETHSAFVNQPNTLGSPI # PEEDASSNAESTSPSSRESSASSSQDDSGTSTTTATKRKSRSGTMNRDFRFPPSNATEAAEIVPARKSPPPALPVQQQGLTDDEGEQTAKMITPSAIE # VPPPPPVEKERSTGSLGSHQSNDEGDDEVGDTVEVDLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g849 ### # start gene g850 6 AUGUSTUS gene 3537083 3538387 0.86 + . g850 6 AUGUSTUS transcript 3537083 3538387 0.86 + . g850.t1 6 AUGUSTUS start_codon 3537083 3537085 . + 0 transcript_id "g850.t1"; gene_id "g850"; 6 AUGUSTUS CDS 3537083 3538387 0.86 + 0 transcript_id "g850.t1"; gene_id "g850"; 6 AUGUSTUS stop_codon 3538385 3538387 . + 0 transcript_id "g850.t1"; gene_id "g850"; # protein sequence = [MYDEIIADSEGEDELFGPIAPGAIYIMYGISQLRYSFFSYLLAPVIGPKITTPSAASTSANVSTISEFSTSKATAIDS # ISNFSSTASHAHAASTIITTATATTSRPRPKPKPLTRNIGHTSAISSGNSSNNASTGNASHIEMFDMTLSIADRAKMRKRNKDGNHTSSSSGALAQLD # ILEISSDDELALLPANKPKKSKKTAEKNTTKKSSSLTTAATTSNHMRYDSPDPDPNHSSSFSLPVVATSPALARNGIRASSIMLPPSDPPQSTPSEDF # DIPAIETLPNPPSSASASAVSESFVLRAHRDLTDSNIPPTPAPFFADPSSSPFPIDNNPNIPDKNFNNTNSIEIHTTRVMDSVLMPPPPGPSPIVQPE # AKNSRTKKKKVNDDEDEYMIDGEEWTGTEPKGKGKKSKSKAKVNDKVDTFIDAHLLIFHYFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g850 ### # start gene g851 6 AUGUSTUS gene 3538532 3539726 0.57 + . g851 6 AUGUSTUS transcript 3538532 3539726 0.57 + . g851.t1 6 AUGUSTUS start_codon 3538532 3538534 . + 0 transcript_id "g851.t1"; gene_id "g851"; 6 AUGUSTUS CDS 3538532 3539071 0.57 + 0 transcript_id "g851.t1"; gene_id "g851"; 6 AUGUSTUS CDS 3539124 3539726 0.99 + 0 transcript_id "g851.t1"; gene_id "g851"; 6 AUGUSTUS stop_codon 3539724 3539726 . + 0 transcript_id "g851.t1"; gene_id "g851"; # protein sequence = [MSTITVPPRNTSIGSSPAPQTYVQPQRSSPGGKRARDASDGQGYDFDDVNEVLGQGTRKKMRKSDDKDEARDAFGAAD # GVVDLSGGLDLDVDIGQSTSSRSSLRKGKKGKKGRVVMSEDEDEDAVSDMYMEDQGRNAFDMVSITTTKPKTKPKSNAKKRVVSGDEEEGHVTAAEDI # GSLKENILPSRPDIPQTPISRTHMASGSSIQATPDTLAPDQKDLKYPSLTSRYTIAPKSARKSTPMSDLIRRVNSMPNSQFKSPMPKGGNRSGGGNNT # PISLTAYSPYLKSSRSFLSRIAPLHPNRRTPPPLPPAPPPRKKTRKEIEWEKKDKEEREEMEERWEEELVERVGGMGEWLGMTEDMRKMMKRAKRDRE # LGLGGWEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g851 ### # start gene g852 6 AUGUSTUS gene 3542560 3543612 0.85 - . g852 6 AUGUSTUS transcript 3542560 3543612 0.85 - . g852.t1 6 AUGUSTUS stop_codon 3542560 3542562 . - 0 transcript_id "g852.t1"; gene_id "g852"; 6 AUGUSTUS CDS 3542560 3543612 0.85 - 0 transcript_id "g852.t1"; gene_id "g852"; 6 AUGUSTUS start_codon 3543610 3543612 . - 0 transcript_id "g852.t1"; gene_id "g852"; # protein sequence = [MSLPKRESDLGYRECLFSNLPSRYSQAISILYFPKTRPSDPPLADIPKPLSDRDPHFESPSVNISEHVDTFPLSPRWS # AASSHAKHPLTDLEASKHSIFVCQFLSRNLHFLTQTRTFSKFSLPAPQSFASGEPIPFFLSLVFPDSPAQAALYTKTITVTLMKQLTVRSAKSPLRKL # FSRSKSRVSSPKSSKTSTPLHSRSASPIPFEDDSDDVSSHSDSSSSSTANLDAYGPPVIRRWKLTSGHLETRSEYSEGVYLLRGWISAGELGRGCSWR # VGQIARLQYFLVVEIASPAWMEDHIPAFHLEKEIEITTDCWETMNRELQSMGGVPTPALGLERCLLERESDYYEVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g852 ### # start gene g853 6 AUGUSTUS gene 3543919 3544239 0.64 - . g853 6 AUGUSTUS transcript 3543919 3544239 0.64 - . g853.t1 6 AUGUSTUS stop_codon 3543919 3543921 . - 0 transcript_id "g853.t1"; gene_id "g853"; 6 AUGUSTUS CDS 3543919 3544239 0.64 - 0 transcript_id "g853.t1"; gene_id "g853"; 6 AUGUSTUS start_codon 3544237 3544239 . - 0 transcript_id "g853.t1"; gene_id "g853"; # protein sequence = [MLNFPAEPDSLDFDTIGSTALSTPAYSPVPSRTEISLDAKRLSPHGPSWVYKTKHMSIDLGRRLWGTSSPAYGLHDKI # EGSIRLSGPHPELIEDISVTVSSDCYSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g853 ### # start gene g854 6 AUGUSTUS gene 3552963 3554061 0.49 + . g854 6 AUGUSTUS transcript 3552963 3554061 0.49 + . g854.t1 6 AUGUSTUS start_codon 3552963 3552965 . + 0 transcript_id "g854.t1"; gene_id "g854"; 6 AUGUSTUS CDS 3552963 3553376 0.49 + 0 transcript_id "g854.t1"; gene_id "g854"; 6 AUGUSTUS CDS 3553477 3554061 1 + 0 transcript_id "g854.t1"; gene_id "g854"; 6 AUGUSTUS stop_codon 3554059 3554061 . + 0 transcript_id "g854.t1"; gene_id "g854"; # protein sequence = [MSASRTTTTTISATAGPSRSRPVPPPPPPPPSDSAAQEEEDLEDEDEDDIIRRAHARVERVRARKAAEAARKKAEEEA # ARAAAERKRKAQEAREQARQTQQQQEEVTERRRLLAAAATARSQRGTSPSEVSVSPRRPVPVDEDPDDGDDGDDDDDEKEPCERCRTKKISCQMQAGK # RSSIICKPCHDAKVRCSYSGRPSTGKREGGSNPTGERLAVLESQVAQLLADNRQLRDGQVKANTYHRHMNRKLDWLVTDAARRRRTPPEMPQAGPSEL # PKKRRRVMDSDEEEDREKEREVEEQGMEEDGEGDEEEMVEEEPAPAKAQSEKGKERAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g854 ### # start gene g855 6 AUGUSTUS gene 3554435 3555904 1 - . g855 6 AUGUSTUS transcript 3554435 3555904 1 - . g855.t1 6 AUGUSTUS stop_codon 3554435 3554437 . - 0 transcript_id "g855.t1"; gene_id "g855"; 6 AUGUSTUS CDS 3554435 3555904 1 - 0 transcript_id "g855.t1"; gene_id "g855"; 6 AUGUSTUS start_codon 3555902 3555904 . - 0 transcript_id "g855.t1"; gene_id "g855"; # protein sequence = [MDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNR # TLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLA # ELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGI # TPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVI # SRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADEL # HADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g855 ### # start gene g856 6 AUGUSTUS gene 3556003 3557997 1 - . g856 6 AUGUSTUS transcript 3556003 3557997 1 - . g856.t1 6 AUGUSTUS stop_codon 3556003 3556005 . - 0 transcript_id "g856.t1"; gene_id "g856"; 6 AUGUSTUS CDS 3556003 3557997 1 - 0 transcript_id "g856.t1"; gene_id "g856"; 6 AUGUSTUS start_codon 3557995 3557997 . - 0 transcript_id "g856.t1"; gene_id "g856"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWVSRNITFRNTSHPDSPQTSVPSAINPVVAKVAV # PLPELSPSVSPTILETPPGDSPHSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLEIPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGTSPPLGRIYPLSEKELVTLKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFWTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHIKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRHFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGISATPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g856 ### # start gene g857 6 AUGUSTUS gene 3558330 3560002 0.45 - . g857 6 AUGUSTUS transcript 3558330 3560002 0.45 - . g857.t1 6 AUGUSTUS stop_codon 3558330 3558332 . - 0 transcript_id "g857.t1"; gene_id "g857"; 6 AUGUSTUS CDS 3558330 3559140 0.99 - 1 transcript_id "g857.t1"; gene_id "g857"; 6 AUGUSTUS CDS 3559281 3560002 0.45 - 0 transcript_id "g857.t1"; gene_id "g857"; 6 AUGUSTUS start_codon 3560000 3560002 . - 0 transcript_id "g857.t1"; gene_id "g857"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDELDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPRSPNSPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPLTALNLRASGSAKEWFVPDILDPDLDSLPAWTSSFKALVKEL # QDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKRE # AGKPFVVRNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCG # GKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g857 ### # start gene g858 6 AUGUSTUS gene 3561951 3563279 0.92 + . g858 6 AUGUSTUS transcript 3561951 3563279 0.92 + . g858.t1 6 AUGUSTUS start_codon 3561951 3561953 . + 0 transcript_id "g858.t1"; gene_id "g858"; 6 AUGUSTUS CDS 3561951 3563279 0.92 + 0 transcript_id "g858.t1"; gene_id "g858"; 6 AUGUSTUS stop_codon 3563277 3563279 . + 0 transcript_id "g858.t1"; gene_id "g858"; # protein sequence = [MVSTPSTSNASVAYAPHYALAASTSACGFDWSDEPCGIEVQRIEEVEDEDALTTHITIEDCPNEIEESLAYVTIAQPT # SGAPLDSGATDHFFRHQEAFTDYREIPIRYGHAAQAGDGFPIVGRGSVTRNVVTNGKWACVTFKNVLHAPSLASDLLSVSQLDKAGCKTVFGLNQAVV # SKDNHPLFGASIRDGMYVVEMEPLPAAFLLTNSPVSLCQWHRRLAHGSPDTICIMSDKDLVDGLTITLREVPGKCVDCILARQTTRPYDKPSNPNVDP # LELVAIDLWGPSRVPTAAGNKYMMVISDSGSGTHGGEFLKDKGDATTIPAFDEYRIRAEAESGKKIRTVISDNSFNTKAWRRYFNSHNIQHVTTTPYS # SAQNGLAERAIRQITEDMRANLRDSGLPTPYWAHAADHAIYTRNLMPSRRHPNQIPQEILTGKRQDVSHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g858 ### # start gene g859 6 AUGUSTUS gene 3574011 3574726 0.22 + . g859 6 AUGUSTUS transcript 3574011 3574726 0.22 + . g859.t1 6 AUGUSTUS start_codon 3574011 3574013 . + 0 transcript_id "g859.t1"; gene_id "g859"; 6 AUGUSTUS CDS 3574011 3574278 0.51 + 0 transcript_id "g859.t1"; gene_id "g859"; 6 AUGUSTUS CDS 3574367 3574390 0.66 + 2 transcript_id "g859.t1"; gene_id "g859"; 6 AUGUSTUS CDS 3574452 3574726 0.69 + 2 transcript_id "g859.t1"; gene_id "g859"; 6 AUGUSTUS stop_codon 3574724 3574726 . + 0 transcript_id "g859.t1"; gene_id "g859"; # protein sequence = [MGGYAREGFQGVQEESKGIYGGSYLGNDDSGRAFGGGCKRYEGAFVGNQRGTDSNNAGGRGSYIPSSSEEPIQLSSHV # DKGDGVPKPWGKIDTTNSVNTEILKKQKRYFPKPPNPEILKRHGQSQWDKVEENWEEEERAEFEHDPEADNDDNNANDEDDEDDKKDEEDEATTNSRE # YKREPFFILIMF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g859 ### # start gene g860 6 AUGUSTUS gene 3577635 3578969 0.97 + . g860 6 AUGUSTUS transcript 3577635 3578969 0.97 + . g860.t1 6 AUGUSTUS start_codon 3577635 3577637 . + 0 transcript_id "g860.t1"; gene_id "g860"; 6 AUGUSTUS CDS 3577635 3578969 0.97 + 0 transcript_id "g860.t1"; gene_id "g860"; 6 AUGUSTUS stop_codon 3578967 3578969 . + 0 transcript_id "g860.t1"; gene_id "g860"; # protein sequence = [MKEGFAYTVDLARRLEFPSLRDVPVHEYEDLLKASPFVFRVHDELAHVKHTLSNDFIAREYVGESSRSIVDNRLNREL # PLDFDAPQVKYAITAHIRNFFKVQNPHTNCPWISTTPLWTWAIGEAIKRSSTMKDVKLTVIDLRKLLKFDRSLPGNASDRKMVFYGMELLHLTNQTRD # AYASEWTNHPQEILVYGVIPASTIVNTISFESLGVPVAFAPESGLLESPLPPWYFRGFTNEDGVIWEYSHTAEWYSGSKGVRASLLRNFKCWAETKHD # GDAWGLMDEIASTAFRFAEFLVLREGQFREAIESARKEARGWEIDAEDDLVERLQRTNLRDRAPSVDGLSALGDSDEFPHKKILKNVRELWERVMGMT # WIIAIWGLEDLDDTHWDILQTQIMHHGREYALEKASLELEVKRCKVTYNHHRSQQKTLWLKTSSLRPKMLVW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g860 ### # start gene g861 6 AUGUSTUS gene 3580860 3581804 0.89 + . g861 6 AUGUSTUS transcript 3580860 3581804 0.89 + . g861.t1 6 AUGUSTUS start_codon 3580860 3580862 . + 0 transcript_id "g861.t1"; gene_id "g861"; 6 AUGUSTUS CDS 3580860 3581804 0.89 + 0 transcript_id "g861.t1"; gene_id "g861"; 6 AUGUSTUS stop_codon 3581802 3581804 . + 0 transcript_id "g861.t1"; gene_id "g861"; # protein sequence = [MPLLTTKIEGKGNGIKTVIPNMADVARALSRPPAYPTKFFGCELGAQTSFDEKNERYIVNGAHDANRLRELLDGFIDK # FVLCKSCKNPETELIILKQGRSEDIIRDCKACGERTGVDMRHKLTTFILKNPPVKVKKGKKKTGTGDAAAGVGGGGGDSPDAEASPAENGEESDDELT # KKIKAEAKDLNNETTLAKEDWSADTSPEAVKQRIKALEGGMSGVSLGGDDEGSDDDANSPYGQLGKWVEENRDSHEGDTKTFLVAVYKKAEDLGIEKK # HKSVLVLAQALFTDDVLNEIPKYGPLFAKVRYYQIHVSNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g861 ### # start gene g862 6 AUGUSTUS gene 3586276 3587449 0.8 - . g862 6 AUGUSTUS transcript 3586276 3587449 0.8 - . g862.t1 6 AUGUSTUS stop_codon 3586276 3586278 . - 0 transcript_id "g862.t1"; gene_id "g862"; 6 AUGUSTUS CDS 3586276 3587101 0.9 - 1 transcript_id "g862.t1"; gene_id "g862"; 6 AUGUSTUS CDS 3587151 3587449 0.89 - 0 transcript_id "g862.t1"; gene_id "g862"; 6 AUGUSTUS start_codon 3587447 3587449 . - 0 transcript_id "g862.t1"; gene_id "g862"; # protein sequence = [MASSSFVKGLSLDIDPSHNIPAYFVNLLDVSGQDTTSNIELRFDEIAKEILHHLLLVLRNANGTVTTFEVLELEFYFW # MAEVHEDPFTHGAPEQARSGNWYFHRAPQKSNDPGKSSAIVTGGYRGGTRKGLDITFGPSLDITSPYFSPPPLKETSIPSNRGGILLRTLRNTSTGRV # ISGPSLVVDEILKFSWVTSISDLVTKQWRGDISAFRKNAHSAPNTSVLRFEEKDEAEIQAVRIYQSPRIGLGLSHPSVSSSFDNPRIVFLSKPYRYFI # HPELLTSNGRPQTFLGILSSLKAASPDKPEPKKLIDDIRDKSGMKTHTVAKYLEYYSSGHGCSNLKSFIGSASRDSPSNYLRLMGILWDERSRSVKNT # VD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g862 ### # start gene g863 6 AUGUSTUS gene 3590815 3591975 0.99 + . g863 6 AUGUSTUS transcript 3590815 3591975 0.99 + . g863.t1 6 AUGUSTUS start_codon 3590815 3590817 . + 0 transcript_id "g863.t1"; gene_id "g863"; 6 AUGUSTUS CDS 3590815 3591975 0.99 + 0 transcript_id "g863.t1"; gene_id "g863"; 6 AUGUSTUS stop_codon 3591973 3591975 . + 0 transcript_id "g863.t1"; gene_id "g863"; # protein sequence = [MSTPIPPATPAPPASAEDLMTQLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS # QAKLIKSALGFFTESAGDWATRHLLHFNAEHPPFGGNWEEFLKEFVQRFESVDPGMEARSKIKNLKQSKGQTVAEFAQKFKDIGDRTGMSDIDLRERF # FTALLPEIRQNLIIVNIAQGLAPTLKEAIKRAISVDVYMHDSTMTGRNPGHTPTHAAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQG # HVKQNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQISATGPTPFSLFPNESVQIASSTPTSAPATVPATPSPPNQDFSNQIGQIRELLDRA # NAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g863 ### # start gene g864 6 AUGUSTUS gene 3593711 3594886 0.7 + . g864 6 AUGUSTUS transcript 3593711 3594886 0.7 + . g864.t1 6 AUGUSTUS start_codon 3593711 3593713 . + 0 transcript_id "g864.t1"; gene_id "g864"; 6 AUGUSTUS CDS 3593711 3594886 0.7 + 0 transcript_id "g864.t1"; gene_id "g864"; 6 AUGUSTUS stop_codon 3594884 3594886 . + 0 transcript_id "g864.t1"; gene_id "g864"; # protein sequence = [MDTQQQAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVTFRSASMQPAERNYEIYDREM # LAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQACWALYLSRFDFHMIHRPGRINTQADALSRMAAHQVLDNEDNRQQIVLKPNHFTK # IAASILRNPLEDRIRKASQREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNDLRTEVLRQCHDHPTAGHPGLHGTLNLVSTHFW # WPTLCSFVEKYVEGCETCARKKIQRHPRAVTQPLDVPLGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHALPCTSSITAEGVADIYYKEIFRLH # GLPLHFKSDRGPQFAAKLM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g864 ### # start gene g865 6 AUGUSTUS gene 3596322 3597071 0.72 + . g865 6 AUGUSTUS transcript 3596322 3597071 0.72 + . g865.t1 6 AUGUSTUS start_codon 3596322 3596324 . + 0 transcript_id "g865.t1"; gene_id "g865"; 6 AUGUSTUS CDS 3596322 3597071 0.72 + 0 transcript_id "g865.t1"; gene_id "g865"; 6 AUGUSTUS stop_codon 3597069 3597071 . + 0 transcript_id "g865.t1"; gene_id "g865"; # protein sequence = [MDFTSRLGRPRLLVQTDRYRTPGSSAPSTSSSIERNITSFIPAYIPPNYSMSNPTPAPTTTTSNIHGKSLLREPSIFD # GDKAQFKEWRRTLFAYIRDPRNRIVTDSERIDIAVLYMQGPKVSSWVQNYTDDNFNDDEEEWKVTWKGFKDALNASFLDKGLTENAQEKLEHLRQGPN # ERAEDFFKEFEVIMRDAGYAKDAPYVIRLIEMNIKPKLIDQVYDTSNERIEKFDELKQKIISIDDMWWRREEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g865 ### # start gene g866 6 AUGUSTUS gene 3599530 3601146 0.77 + . g866 6 AUGUSTUS transcript 3599530 3601146 0.77 + . g866.t1 6 AUGUSTUS start_codon 3599530 3599532 . + 0 transcript_id "g866.t1"; gene_id "g866"; 6 AUGUSTUS CDS 3599530 3600147 0.79 + 0 transcript_id "g866.t1"; gene_id "g866"; 6 AUGUSTUS CDS 3600214 3601146 0.84 + 0 transcript_id "g866.t1"; gene_id "g866"; 6 AUGUSTUS stop_codon 3601144 3601146 . + 0 transcript_id "g866.t1"; gene_id "g866"; # protein sequence = [MPVYNADGTLNKNGSIEGYVQVRMVIGDHAERIDMAVTNLGIDWLRYHNPSIDWKESTLTFERCPDKCRYLPHYESPE # DDGTEEKLVDGERIFWFDWDGYLSDQGHIKVQTATTDAATPYLAEYADVFSKKDFDQMPERHPWDHAIELTPGSKPVDCKVYPLSPPEQKALDEFLEE # NLRSGRIRPSRSPMASPFFFVKKKDGTLWPELIDKLKNSKIFTKMDVRWGFNNIRIKEGDEWKAAFRTNRGLFEPTVMFFGLTNSPATFQAFMNHILR # ELIDQGHVIVYMDDILIFTDNIEEHRIIVRKVFDILKANKLYLKPEKCTFEAREVEYIGIIVGNGQIRMDPKKVEAVRTWQPPQKKRELQSFLGFCNF # FRRFIRDFSKIAKTLTRLTGNATWEWTSLEQDAFNQLKDRIIEDVTLIIPRETGKFRIEADSSDYANGAVLSQNIDGKWRPVAFRSRSLNEVERNYEI # YDKEMMAIMDSLSDWRQYLLGAKEPVEVFTDHQNLQYFRKPQKLNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g866 ### # start gene g867 6 AUGUSTUS gene 3601621 3602430 0.85 + . g867 6 AUGUSTUS transcript 3601621 3602430 0.85 + . g867.t1 6 AUGUSTUS start_codon 3601621 3601623 . + 0 transcript_id "g867.t1"; gene_id "g867"; 6 AUGUSTUS CDS 3601621 3602430 0.85 + 0 transcript_id "g867.t1"; gene_id "g867"; 6 AUGUSTUS stop_codon 3602428 3602430 . + 0 transcript_id "g867.t1"; gene_id "g867"; # protein sequence = [MEGCEKCQATKTHRTKPVGPLHPHDVPSKPWEIIGTDMIGELPESGGYNAISMFVDHFTKRLRLFATHTTITSEGMAC # VYRDKVFPIHGMPRKIVHDRGPQYHARFMKELYKLLGIESNYTTAYHPQTNGQTERINQEIEHYIRLFVNHHQSDMMEFAYNDRVHSAMKVSPFYADN # GRHPYKGTTPKMTSQNPTAQEFADSMKRIREEVGSALKKAAEDMKRQYDKLLRSCTPCNRAKATRCLSAEDEWDSSEVINNTAVTPLVPGDRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g867 ### # start gene g868 6 AUGUSTUS gene 3602911 3603471 0.76 + . g868 6 AUGUSTUS transcript 3602911 3603471 0.76 + . g868.t1 6 AUGUSTUS start_codon 3602911 3602913 . + 0 transcript_id "g868.t1"; gene_id "g868"; 6 AUGUSTUS CDS 3602911 3603471 0.76 + 0 transcript_id "g868.t1"; gene_id "g868"; 6 AUGUSTUS stop_codon 3603469 3603471 . + 0 transcript_id "g868.t1"; gene_id "g868"; # protein sequence = [MTDRPMKKLGDKQFGPFKVLEKIGSSSYKLDIPRTWKRVHNVFNETHLSPYHEPQFPTQPRNTKPPPEVVGEEEEYEV # EEVVDACKYRNGIQYKVKWRGYGPHEMTWEPAANMTNAKEAVQDFHKKYPNKPRPRTLKQIEIPIAQFPTELFRQIPTPDIEPVPSTMPSEALVNQLA # RHGIRALKGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g868 ### # start gene g869 6 AUGUSTUS gene 3608788 3612100 0.15 + . g869 6 AUGUSTUS transcript 3608788 3612100 0.15 + . g869.t1 6 AUGUSTUS start_codon 3608788 3608790 . + 0 transcript_id "g869.t1"; gene_id "g869"; 6 AUGUSTUS CDS 3608788 3609749 0.39 + 0 transcript_id "g869.t1"; gene_id "g869"; 6 AUGUSTUS CDS 3609816 3609949 0.39 + 1 transcript_id "g869.t1"; gene_id "g869"; 6 AUGUSTUS CDS 3610869 3611123 0.89 + 2 transcript_id "g869.t1"; gene_id "g869"; 6 AUGUSTUS CDS 3611194 3611431 0.59 + 2 transcript_id "g869.t1"; gene_id "g869"; 6 AUGUSTUS CDS 3611491 3612100 0.43 + 1 transcript_id "g869.t1"; gene_id "g869"; 6 AUGUSTUS stop_codon 3612098 3612100 . + 0 transcript_id "g869.t1"; gene_id "g869"; # protein sequence = [MLSAALVTLLLSLSTTQANSSWGHPTNADPFSYDPGFDIEAVATIAKALPSHSWEYGTATEALLELYNSSYSVFGSAP # FPVPFLVPDGVPSLSYAAQNIVLGSGANGLSDGDGAVGDPASLGVGAIMLGKTNASFAQGANEEFAYITGQAPRWYNGAISQRTDVPELWADWMYMAP # PFLAYYAADTYNTSLLRLAVDQCGLYRQALKSNLTSSVAYDGLWEHIVGPQSADFGLWGTGNGWASAGMTRVLATVINAPSSTTYGWKDNAVRNLTSW # IQEIVDGAMGAPMTDGLLRNYLNDTSSDGLGFGDISSSSLIASVAYRMAVLQPQTFGSTYIQWAEGIRTTLGGNDSAGNPHVTSNGTVTPAVQGRQLD # ITAYDDNDGGSGADSEDEYQEKQPSTSSRKTKKTGKSKQRDESEEGKTKKRKRTSTVKKTKKKSAYEDVDLSQLPPEQANKIRLDRQIEAILKTKKSS # RPKKRKNNDEVLDSFADDEVARLRETMNNAAEEDMKANQEKLPATAKLRFLAEAMETLRKASLAQSIIDNNLLDAVKRWLEPLPDRSLPALNIQRELF # VTLRKMEFIDSSVIKESGLGPLVLFYTKCQRVQPDVKRVANELVSIWSRPIIKRSASYRDRVVPTMNNMDVDDGAPGSQSLSQSQSQYRPEKLNAILA # RAREEDKNKIRKNAVSIPQSSLGTYTVAPKNNAGLAKMNASVDNDVERRKKNAERLRSLTRKVAGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g869 ### # start gene g870 6 AUGUSTUS gene 3616866 3618337 0.65 - . g870 6 AUGUSTUS transcript 3616866 3618337 0.65 - . g870.t1 6 AUGUSTUS stop_codon 3616866 3616868 . - 0 transcript_id "g870.t1"; gene_id "g870"; 6 AUGUSTUS CDS 3616866 3617880 0.76 - 1 transcript_id "g870.t1"; gene_id "g870"; 6 AUGUSTUS CDS 3618003 3618337 0.65 - 0 transcript_id "g870.t1"; gene_id "g870"; 6 AUGUSTUS start_codon 3618335 3618337 . - 0 transcript_id "g870.t1"; gene_id "g870"; # protein sequence = [MSTDTAPSTVFDEALSRSRQSGAGSLASIWAPQPQPLDTTWPKALDSFSRAAESETQLATRPELQNHSGPMITREDVF # GPSPPKDMPSVGAIGDGRKKVTPDFEPHTVCIFLFETSPGTPDFSPVSISSALLTPTDLSPTRPCSDINLKQQLQMPYEMMAAGTRGPAFFTHPALLF # EPGSPTRLSNSPPYLSSQASISTANSGGNNYSIISNASSSPIFRTYNHEQSSPTSPSLGSYPSYPSAPQGNFTSNHQLYAALSAQNLSQTNVAHRADV # HAATGALRSSIHGTIGSSLSSGDWHIPQQVLPAHQLLSQSTCNQPQQFQQLPLNGEWLRTEDASLLAHNSLVPSAPSSCLGSTTPNVFGLGLTLDATP # NYVSGVSNGGSGLEDSIHAPPSLRSSTSSSGISSQLHQQSHAHVDERHHRNQSSTGNAGHVREPSSPTHGAHEVSRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g870 ### # start gene g871 6 AUGUSTUS gene 3622182 3624750 0.3 - . g871 6 AUGUSTUS transcript 3622182 3624750 0.3 - . g871.t1 6 AUGUSTUS stop_codon 3622182 3622184 . - 0 transcript_id "g871.t1"; gene_id "g871"; 6 AUGUSTUS CDS 3622182 3623952 0.64 - 1 transcript_id "g871.t1"; gene_id "g871"; 6 AUGUSTUS CDS 3624422 3624750 0.3 - 0 transcript_id "g871.t1"; gene_id "g871"; 6 AUGUSTUS start_codon 3624748 3624750 . - 0 transcript_id "g871.t1"; gene_id "g871"; # protein sequence = [MSRIPQTARAKTPTPTPLKARAAPSPVPARARTKSATGRSTPSKSAVKDDSPPAVPTLSVKEAIALKRAEAKKAQERA # LNASLNDLSSLEDAIPSISGAVVEEEDALGRXLTTLDLSHNSLTSLPSNIFTFPELSVLNISHNHFTSLPCNAPFVSSSAKKQNNSSGGFFGPVIARS # SVPLPKLVSLDASHNKITAEAIDPEIPTALVKINLSFNPLGNSAAFMNNLSRLSNLQELRMEQADIGDESFPEDINSSSKPSFPRLRILDLGETRVTT # DTIKAAVQNFRPQREISLDLTTENPPEGVILVLVGKKVVREAWEIEAERKAKARAAKFAQEEGIEWGNSPRRPVNKSSGSSSGVVEKEAWEIEAEQGL # LTEGGKRRAKAQAAAAAGTSGSTSASTAKRPVSKAEIVKEAWEIEAEQGLLTEGGRRRARAAALAAEAKEKEKAALSTSSPAPSLANSQYYTRATNAL # ALPASTPPSKAISHGRAFSFNPSSSAFTGSPSPNDFAVPLPSAPLAEIAAQPFALTLRVLTLNNRRADRSFTLPASYGSALLPNLEELDLEGCNFADN # VSVARIHSSPEGSSPNRSSEPLVPLLASLFPSLRVLNLSYNTLTSACLTTDTLSALILEAPHRKGLKQLILRGNKLTELDGFQGLAEMFKGNRDVPGW # KLDELDLRDNDIGRLPAELGMLPLDVFLVDGNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g871 ### # start gene g872 6 AUGUSTUS gene 3625745 3627316 0.9 - . g872 6 AUGUSTUS transcript 3625745 3627316 0.9 - . g872.t1 6 AUGUSTUS stop_codon 3625745 3625747 . - 0 transcript_id "g872.t1"; gene_id "g872"; 6 AUGUSTUS CDS 3625745 3626908 1 - 0 transcript_id "g872.t1"; gene_id "g872"; 6 AUGUSTUS CDS 3626980 3627144 0.95 - 0 transcript_id "g872.t1"; gene_id "g872"; 6 AUGUSTUS CDS 3627224 3627316 0.93 - 0 transcript_id "g872.t1"; gene_id "g872"; 6 AUGUSTUS start_codon 3627314 3627316 . - 0 transcript_id "g872.t1"; gene_id "g872"; # protein sequence = [MPAFTKSIPVALLVGASALASPIAPQNMTGQDLCITPCILSTGHQICALPYNDINTDDPATFTKFCPSNIDISTFEKS # VKECKIALNGNYVNGNASLNSSSTSNSNSTLQSNAAQSTVLNAATPQNGSAPGVMENGSVGLQTNGPARTSVSGPAENTRVGLAQTNGPARVSESASE # SGSPSSTLGNSLAADLSASSTNSDLSTFGVDTGAGSSLSPGTITGLSASPSLPSHSGVDLSTLTGLANGLGLSYGVPSVNTGSTTASAFQHLSADVQP # DSISSPARNGVTNTTNGHSTGTGTSVTRPNQVTNSVSHQSSSVSPPDVSESANGQIGTSPSSRVAVADPVNKNTAGGPSGRVGITRPAQPSTPSIPSI # SGPLDVSQSTGSQTGSSTGVEVSGSAKPGNASGTSAHVNVASSGAAQSSPSSSDRLDIPSADEQVGSSVSNNLETSVSNGANIGQTATQKASLAVSED # CCT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g872 ### # start gene g873 6 AUGUSTUS gene 3628965 3629540 0.96 - . g873 6 AUGUSTUS transcript 3628965 3629540 0.96 - . g873.t1 6 AUGUSTUS stop_codon 3628965 3628967 . - 0 transcript_id "g873.t1"; gene_id "g873"; 6 AUGUSTUS CDS 3628965 3629540 0.96 - 0 transcript_id "g873.t1"; gene_id "g873"; 6 AUGUSTUS start_codon 3629538 3629540 . - 0 transcript_id "g873.t1"; gene_id "g873"; # protein sequence = [MTGFLYIRDALDGTSLGYVSSAFNSFGEYGPMASPGQRLEVSINTDTMGPISIVTTVNTLFRIFVEAGLIPLDQNGPD # PDLPFMVGITGFANDASGLRPGKYKCARKLFAVFANLERRSSYVYLGAGNRTAVDVSPRSGDNSFSRATGNPEGIESTIVRLLRRMKKIDADSVVDPV # FSSTDSRCHAVLDQW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g873 ### # start gene g874 6 AUGUSTUS gene 3636558 3637673 0.97 + . g874 6 AUGUSTUS transcript 3636558 3637673 0.97 + . g874.t1 6 AUGUSTUS start_codon 3636558 3636560 . + 0 transcript_id "g874.t1"; gene_id "g874"; 6 AUGUSTUS CDS 3636558 3637673 0.97 + 0 transcript_id "g874.t1"; gene_id "g874"; 6 AUGUSTUS stop_codon 3637671 3637673 . + 0 transcript_id "g874.t1"; gene_id "g874"; # protein sequence = [MSLASRTYLINAQECIPHICEQQTDSHINNAALGWFLPPTFLAVEDSAIHTPDLDIPSKFKNSAEDILLQSTEPFFSE # ASSGPSVSGVSRSSTPALSFASSRSSSRSPPTKLHHGPCLCNEDSGIESFNCLAELNGTPSEASTTFANAGSITTVGNDNASWDSPVGHPISGMYPNY # SPPYPEFGMSYPSPPSKSSEAAPLHESNECFDDGHLNNKETLAPPPSPPLRRLKRKVRSHRREDSDDEYEEPEDTGDDETYDPASSAGHGNLTTGKKR # KAASNETTEERTCKKCGLVFTRSADIGRHCASAHSEMSEEMKQECTCVLCLKRLARPDAMKRHLEARTKKCLLEAKRRKERGELDPVIYRLHLQSSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g874 ### # start gene g875 6 AUGUSTUS gene 3639922 3642289 0.47 - . g875 6 AUGUSTUS transcript 3639922 3642289 0.47 - . g875.t1 6 AUGUSTUS stop_codon 3639922 3639924 . - 0 transcript_id "g875.t1"; gene_id "g875"; 6 AUGUSTUS CDS 3639922 3641381 0.65 - 2 transcript_id "g875.t1"; gene_id "g875"; 6 AUGUSTUS CDS 3641434 3642289 0.7 - 0 transcript_id "g875.t1"; gene_id "g875"; 6 AUGUSTUS start_codon 3642287 3642289 . - 0 transcript_id "g875.t1"; gene_id "g875"; # protein sequence = [MDVRSGGSPFINDLVDFNNPPASPPVTFEVIPDNNEPFIHNNGGSQSPSFTGAELDISSYNNSPFSGHSELSFDDDLD # YPPSAGFGLFSAENHHSAARYDPSEYDNPTGNSLLMFNDNDYLSSYQGSYGDYSSPGSSNGSGNEGIRSRASSVSSNHQQPLSHLSPNLQAQHLPRSP # HMAVAQSFEGMSFHSPAWGNEPLPEHSPRQAQFQSDVHPRSLSPQRAAGKPQSPPRLLMPDDEVPTINAPDDGDGAAGPALRIVPATPVSGGGAVTNQ # VGEPGNMPFRRDNNLAPFSGNQSQSWNSRHTPSPHPPDPDTRMDTSGQYQNFNSTSSQTQAGSSRLSNSNTFLFPGNTLPRTRSKSDGSLEQPAWDSS # GLNSFDDSAIADDGTVNMTDVSPPNSSNPNSGRLNSSFSFGGSPTSPQNNTGNAFLAVEASSLRRSKSDSYGRGGGHVRGSRSEDLRFGNVPGINIAD # SGTGQQSNIGSGQGNGLLFPPSAHGDFIQHQQEQQRSHTPQYLLPRGHSHSYSYSGSGLSNNYEIGSLGLGSALPNLGAGMGLSSHNMGPSQRQGSPM # SHIRRTSSGSRSERGISSWGLSNSGFDTGLGVNLGPGSTGGSNAGSISGSLRASPYPSPNVSPRGRYTELPPHDTLDFGLLNGGNPVAGFSSSSRGGT # PNMPTMGLPSLPPLPSPGNSGKSMPSVVTVGGANVPLVVSKPTVTTGRTKAASHNRRKQEATFVCPVPGCGSTFTRSFNLKGEQLLLIQSYQSVNSVV # GRSHSIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g875 ### # start gene g876 6 AUGUSTUS gene 3647062 3647763 0.86 - . g876 6 AUGUSTUS transcript 3647062 3647763 0.86 - . g876.t1 6 AUGUSTUS stop_codon 3647062 3647064 . - 0 transcript_id "g876.t1"; gene_id "g876"; 6 AUGUSTUS CDS 3647062 3647763 0.86 - 0 transcript_id "g876.t1"; gene_id "g876"; 6 AUGUSTUS start_codon 3647761 3647763 . - 0 transcript_id "g876.t1"; gene_id "g876"; # protein sequence = [MNHLQSFLTGARYSALDSQIPSWAALYDVDDTATFSHYSYTRLRANRSLREADLVKRLGILDRRTCELIADSGESPLT # TSLASKNPSKGIVTHGLGDNEQDAKEWFGKGVEILRSNQGWARTRIFKCIDNLRTGVSVPPSPEAQTVPRFFAVHGAPNWDALRVAISLMSFLAEFTT # FTTSDIASESFIQVGADSLLSLRSSDVPLSDLRKWGLYKAYPGIAQGNIKGLTDHSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g876 ### # start gene g877 6 AUGUSTUS gene 3650037 3650441 0.7 - . g877 6 AUGUSTUS transcript 3650037 3650441 0.7 - . g877.t1 6 AUGUSTUS stop_codon 3650037 3650039 . - 0 transcript_id "g877.t1"; gene_id "g877"; 6 AUGUSTUS CDS 3650037 3650441 0.7 - 0 transcript_id "g877.t1"; gene_id "g877"; 6 AUGUSTUS start_codon 3650439 3650441 . - 0 transcript_id "g877.t1"; gene_id "g877"; # protein sequence = [MCRNVWPGDMGISTHTELVSTFDLESSANSLLVMYSTQDPTTGALQYSGPPINAVGSDTYICWSLIGTHSVYMYTGDL # DFVEKIWANYTNALAFLQSQVDETRLMNVPNSFANDWGRADGQGHNVAANALLYEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g877 ### # start gene g878 6 AUGUSTUS gene 3650556 3651377 0.33 - . g878 6 AUGUSTUS transcript 3650556 3651377 0.33 - . g878.t1 6 AUGUSTUS stop_codon 3650556 3650558 . - 0 transcript_id "g878.t1"; gene_id "g878"; 6 AUGUSTUS CDS 3650556 3651095 0.84 - 0 transcript_id "g878.t1"; gene_id "g878"; 6 AUGUSTUS CDS 3651180 3651377 0.38 - 0 transcript_id "g878.t1"; gene_id "g878"; 6 AUGUSTUS start_codon 3651375 3651377 . - 0 transcript_id "g878.t1"; gene_id "g878"; # protein sequence = [MNGILPLATIFLFASATAKAPAGPWDAFNFAPATRSFVPKSVYTTVGLVAGAENLLGNSSSTEGAIHDLVRKVGGRLS # FQVDSTTSPAISLSFTESAMFISPTESDDSCTVSPDHDLDGVLSVPLPLAANKTFTQTVGDQRGGFRFLTIVSDGDAPVTISNVTVNATFMPQMDDLS # AYTGYFYAQDSDFHDQDFLTKLWYGGAYTVQMNTIDSHEARQQPCPVPSGKVSLMIVLAITLEFCMYAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g878 ### # start gene g879 6 AUGUSTUS gene 3653969 3654475 0.96 - . g879 6 AUGUSTUS transcript 3653969 3654475 0.96 - . g879.t1 6 AUGUSTUS stop_codon 3653969 3653971 . - 0 transcript_id "g879.t1"; gene_id "g879"; 6 AUGUSTUS CDS 3653969 3654475 0.96 - 0 transcript_id "g879.t1"; gene_id "g879"; 6 AUGUSTUS start_codon 3654473 3654475 . - 0 transcript_id "g879.t1"; gene_id "g879"; # protein sequence = [MSSPSKPVGIPKRGSQSQSVTPAGTPDLRALRAQVISGTPPVGLSIPPPNIPPRTSSPVPLGQLVEGTPASSSTARIQ # LAGPSRTDSPLNLPLDLDDLPDEEKAKILRRHLVSKGERERERRENPEVTSLSEPVSQTRRSSGSGRIAREESEPFPVPYAAPGADVTCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g879 ### # start gene g880 6 AUGUSTUS gene 3655294 3657258 0.97 + . g880 6 AUGUSTUS transcript 3655294 3657258 0.97 + . g880.t1 6 AUGUSTUS start_codon 3655294 3655296 . + 0 transcript_id "g880.t1"; gene_id "g880"; 6 AUGUSTUS CDS 3655294 3657258 0.97 + 0 transcript_id "g880.t1"; gene_id "g880"; 6 AUGUSTUS stop_codon 3657256 3657258 . + 0 transcript_id "g880.t1"; gene_id "g880"; # protein sequence = [MSDRTGGPTSSNYAHRRRPENYEEDDEAGSDGEAVLALKARREPQDDEEARLHAQDLQLARSLRLRAEGLEKVINSML # VQPPPVHLHFEDDFFVDPNQHILPNGVRLRLALGTLVNDFFARQAPPPPFRHKKFAAASISASSPMTTNTSDSSTISAGLLPPALNPLVPISAYGERK # AAKRARRQLKRESASASAHTSHPSQHSHTMSNTQYPSLLSKLSSRTRSLYLAGTDPETANSPPAFRCPRHLHTGCEICVEAKEEFSVKGAAGKGKGRD # RAGSTSTFAAPSWPSTSSSMGLGIPSNQKVTPVGIAPDGGGVSGYQDPSIAGGCSVGVGEGLLKPSMNGSVLRRRTASPYTRRSSRGGGGESEADSTG # SGYTKLSELLPRFLRLSALVSTELGREVREGREGKDSDELRSSTSSGSTGGGTTKQGVGGTFATLAPSREWYHLLAGILTRAALQGYLTAGWRGVNAV # ECLMGVGLGIDLPGVRSTFGAEMRTGVGESVTDPPREASPSSSAEEVDADGNFEAETDIFAEDEDLFKEFDPDELPSLQQAVAILFPSLGLIGNAESE # DRWSDGDFRNHGELTKTYTTRRTRQPNAAEIEFATGMNERMRSVRILSLIYTLHTHCCLSFSKYQTQHLTFQHIWRTLLGHILQNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g880 ### # start gene g881 6 AUGUSTUS gene 3657454 3658212 0.72 + . g881 6 AUGUSTUS transcript 3657454 3658212 0.72 + . g881.t1 6 AUGUSTUS start_codon 3657454 3657456 . + 0 transcript_id "g881.t1"; gene_id "g881"; 6 AUGUSTUS CDS 3657454 3658212 0.72 + 0 transcript_id "g881.t1"; gene_id "g881"; 6 AUGUSTUS stop_codon 3658210 3658212 . + 0 transcript_id "g881.t1"; gene_id "g881"; # protein sequence = [MASTSLTMDSLVHSNPTTPTLSHPIPPRSTSQDHPQSTSSKKPSIDLYFIHPSVNPSFSFGTGSADNAVNTVSRENYN # NVYNHVTNLTSAQSLPRSDTRQNPREQSFSAPISTPIYSTSLPTSHPQSRSNSFPQSYVGSSTQYQGRPSVTPRSTSNPIPTHVPTHHNILPASSPQY # PYYSQNIISSQTMSPSSAGTAQQQQIPVWNAATGAWMPTATSQDMNQASSTEVASGKRTRSPERGQGAGPNAKRPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g881 ### # start gene g882 6 AUGUSTUS gene 3663924 3664457 0.6 + . g882 6 AUGUSTUS transcript 3663924 3664457 0.6 + . g882.t1 6 AUGUSTUS start_codon 3663924 3663926 . + 0 transcript_id "g882.t1"; gene_id "g882"; 6 AUGUSTUS CDS 3663924 3664457 0.6 + 0 transcript_id "g882.t1"; gene_id "g882"; 6 AUGUSTUS stop_codon 3664455 3664457 . + 0 transcript_id "g882.t1"; gene_id "g882"; # protein sequence = [MGMGTGTSPGTVNMGGNDPDLGIDNMALSAGDMAPGMAAHSQILDNIPQSMASPPGPPVLMHLSALQQAQDHHYLQEV # HLPQAPSRQQAFMLGDEHRLPTETRMRTGSSYGRPFLSLETSLEVDPSKLRIGAEISTGYDYSNVDHNARKMGDIRGLGSSREDDPPVRVDTREPPAY # S] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g882 ### # start gene g883 6 AUGUSTUS gene 3668491 3669216 0.43 - . g883 6 AUGUSTUS transcript 3668491 3669216 0.43 - . g883.t1 6 AUGUSTUS stop_codon 3668491 3668493 . - 0 transcript_id "g883.t1"; gene_id "g883"; 6 AUGUSTUS CDS 3668491 3669216 0.43 - 0 transcript_id "g883.t1"; gene_id "g883"; 6 AUGUSTUS start_codon 3669214 3669216 . - 0 transcript_id "g883.t1"; gene_id "g883"; # protein sequence = [MLPSTSSPQSDFLSPTSTSSNSPQSPSSHVDFFSATTSPHSLVGAVDPFFSPGISSSSGSSQLSLPITIQGHDSEPEL # IPVQYSGGVARRHSFAGSRSPSGSRSASPLPESSSNASDRLHRAISDPIGQNRRRRAPTVPRKYPGLLKPAKEVDEAGPSYPDSSMMINVPIEGVHSA # PAPAEFKTVVGSNKIVEASKARRKNEAKFKCDICNHRFTAKHNLQSKSNPSFNKTYLQFDFFKII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g883 ### # start gene g884 6 AUGUSTUS gene 3671101 3672540 0.79 - . g884 6 AUGUSTUS transcript 3671101 3672540 0.79 - . g884.t1 6 AUGUSTUS stop_codon 3671101 3671103 . - 0 transcript_id "g884.t1"; gene_id "g884"; 6 AUGUSTUS CDS 3671101 3672540 0.79 - 0 transcript_id "g884.t1"; gene_id "g884"; 6 AUGUSTUS start_codon 3672538 3672540 . - 0 transcript_id "g884.t1"; gene_id "g884"; # protein sequence = [MRTPREATAVEGEPADAGIGQLLTFPPVSEPTSMVQAGLFGPAIPYPAQTVPEVTSFAISATPTILPWDTNLLFQGSY # HLPISLNMDSSFDSVRVSGESDSLLSFSDARKQLLTSDALTNSSQFNPTLFTANSPHFDSVVSHGDLSYVAHSAVASSNTDHQSPLTNSSPTYQFEPP # NLRNTATTQCPSEIPSANRWSGYSSPTSVPSSVSESPTVYTPSLLPYARYGLPFPEPSVAYNVSTPSPASADVEAVYPVQRSANTDTEFFPSTHERQR # THFRRLSPADRREQRKSHNVSRFSNRSSSTHIHDQSRSPEIVEWSNTALYVAQQKDYGLRRAFSGPQETIQSSAASSGSSFLPRPRPQIHHGGRFSDS # HITVAPPTHDDSGILAISKAKMWTLAQDTPTFDVDDDVFDGSEAVSPKKQVASDALVTAATGRRKNEAAFHCEFPGCEATFTAKHNLHSTCILFMFVP # QAIFKNICQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g884 ### # start gene g885 6 AUGUSTUS gene 3674551 3676012 0.69 - . g885 6 AUGUSTUS transcript 3674551 3676012 0.69 - . g885.t1 6 AUGUSTUS stop_codon 3674551 3674553 . - 0 transcript_id "g885.t1"; gene_id "g885"; 6 AUGUSTUS CDS 3674551 3675544 1 - 1 transcript_id "g885.t1"; gene_id "g885"; 6 AUGUSTUS CDS 3675716 3675857 0.81 - 2 transcript_id "g885.t1"; gene_id "g885"; 6 AUGUSTUS CDS 3675994 3676012 0.86 - 0 transcript_id "g885.t1"; gene_id "g885"; 6 AUGUSTUS start_codon 3676010 3676012 . - 0 transcript_id "g885.t1"; gene_id "g885"; # protein sequence = [MPRSMLGGVAFGELKSSVKSSCDALCSKFRFWKDQTWKFGRVRSFYIALHMYKRYCIIVQGPDPVSEDLLSVHSHDPR # AEDCLLCPVNNVQEASAEYRTIVTQNFLGSELTNSQFGIRRDDTRPVSTESAFFFYDSLSGPVVSSSDENISISATFDNLKLNDPLANAVNLPSSNPP # APPLLQLPTSPWRSRPSSPSSTYSFEKSPLWTMDGEVSPCSPVPGFARGPDTLDDNERWPVSRGRGRSLSSSAAYTTWRRRSPSVSSFASEGYFIDPD # RGRGSSVVSDASESSSEHIDPRFLGPDIQSSTICGLPFCFNSQGSEGDEGRIRHTQVATKKTRMASEKRRKKGARFHCKVPGCHGSFTAKHNLISELD # ELYIHTRYQGYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g885 ### # start gene g886 6 AUGUSTUS gene 3678367 3678714 1 + . g886 6 AUGUSTUS transcript 3678367 3678714 1 + . g886.t1 6 AUGUSTUS start_codon 3678367 3678369 . + 0 transcript_id "g886.t1"; gene_id "g886"; 6 AUGUSTUS CDS 3678367 3678714 1 + 0 transcript_id "g886.t1"; gene_id "g886"; 6 AUGUSTUS stop_codon 3678712 3678714 . + 0 transcript_id "g886.t1"; gene_id "g886"; # protein sequence = [MVADLIRDSTVGQFINFISNGRFLPYEDQRPDFNIPTHFLTKQLATSDASTLCGDANENKKTSGAVTPSTVFTRENTF # VVGEKLAEIDMKLDEKNDTSDPNVVGWYGDDDPDNPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g886 ### # start gene g887 6 AUGUSTUS gene 3682707 3683066 0.67 - . g887 6 AUGUSTUS transcript 3682707 3683066 0.67 - . g887.t1 6 AUGUSTUS stop_codon 3682707 3682709 . - 0 transcript_id "g887.t1"; gene_id "g887"; 6 AUGUSTUS CDS 3682707 3683066 0.67 - 0 transcript_id "g887.t1"; gene_id "g887"; 6 AUGUSTUS start_codon 3683064 3683066 . - 0 transcript_id "g887.t1"; gene_id "g887"; # protein sequence = [MIQRHPTYWFNDGDTILHQKFLSNHDDNDIVYRIHHSKFSWPESPKFLPSSSSRLVSGLGSEISDNDDDLNTLRTMAE # IDLDEELLDGLNGCKYVVLEHEQAIDANDLVVLLDHFYGKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g887 ### # start gene g888 6 AUGUSTUS gene 3683405 3683818 0.87 - . g888 6 AUGUSTUS transcript 3683405 3683818 0.87 - . g888.t1 6 AUGUSTUS stop_codon 3683405 3683407 . - 0 transcript_id "g888.t1"; gene_id "g888"; 6 AUGUSTUS CDS 3683405 3683818 0.87 - 0 transcript_id "g888.t1"; gene_id "g888"; 6 AUGUSTUS start_codon 3683816 3683818 . - 0 transcript_id "g888.t1"; gene_id "g888"; # protein sequence = [MKRNQPDLNDAERIEAAAYAKMSVLLLLDAASSELGLSGIPYNVRFTENTPFPCSKADAEAKGFSLNIAGIPTFQDAV # GQAPMGCVAVAAKSQGTAVIERITPELREFYTGQLIPHQESLFWTRMRQFADYLKDWDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g888 ### # start gene g889 6 AUGUSTUS gene 3690062 3690640 0.49 + . g889 6 AUGUSTUS transcript 3690062 3690640 0.49 + . g889.t1 6 AUGUSTUS start_codon 3690062 3690064 . + 0 transcript_id "g889.t1"; gene_id "g889"; 6 AUGUSTUS CDS 3690062 3690640 0.49 + 0 transcript_id "g889.t1"; gene_id "g889"; 6 AUGUSTUS stop_codon 3690638 3690640 . + 0 transcript_id "g889.t1"; gene_id "g889"; # protein sequence = [MRSNHLSWSPITAMNSVQPRILIVGAGWAGFILSQQLDDSKYDITIIAPHQTFAYTPLLASAATGLFFSRLAEEPIRR # AHRRMTYYRALATAADLDQKSVTCIPSILQPGGRDIPDANHPFTVEYDILIIAPGCVNQTFNTPGATEHCFFLKTVPDAEAIKAKLLSLLEVASLPTT # SPERAKELLHIAVVGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g889 ### # start gene g890 6 AUGUSTUS gene 3690749 3691183 0.54 + . g890 6 AUGUSTUS transcript 3690749 3691183 0.54 + . g890.t1 6 AUGUSTUS start_codon 3690749 3690751 . + 0 transcript_id "g890.t1"; gene_id "g890"; 6 AUGUSTUS CDS 3690749 3691183 0.54 + 0 transcript_id "g890.t1"; gene_id "g890"; 6 AUGUSTUS stop_codon 3691181 3691183 . + 0 transcript_id "g890.t1"; gene_id "g890"; # protein sequence = [MSKTYPHLAGLPSITIHDVAPEILGVFHQKLKAYALRSFKKHGVEVKTNSHIEKIEEDALYTKEDGRIPAGMVAWATG # NKQCDFVESLHGLSKATRLGRILTDQRLRALKEDQSVLENVYALGDAADIFGNGLPTTAEGMLHAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g890 ### # start gene g891 6 AUGUSTUS gene 3693580 3695132 0.4 + . g891 6 AUGUSTUS transcript 3693580 3695132 0.4 + . g891.t1 6 AUGUSTUS start_codon 3693580 3693582 . + 0 transcript_id "g891.t1"; gene_id "g891"; 6 AUGUSTUS CDS 3693580 3693690 0.97 + 0 transcript_id "g891.t1"; gene_id "g891"; 6 AUGUSTUS CDS 3693810 3694244 0.45 + 0 transcript_id "g891.t1"; gene_id "g891"; 6 AUGUSTUS CDS 3694437 3695132 0.83 + 0 transcript_id "g891.t1"; gene_id "g891"; 6 AUGUSTUS stop_codon 3695130 3695132 . + 0 transcript_id "g891.t1"; gene_id "g891"; # protein sequence = [MDAPARPRHILVIGGGVCGLVTLRNLVERGSFDKVELKPRWPSPAYPGLIGNVLPEFLSFSGAPFPQPPSTPQQPFPT # LKETHDYLRDFANRYLEQGKIHLNTEVVRVEELQDGKGWNVVTRDWSADGKGQISSQVWDGVVICTGWYDDPLWPGTEGIDILKEKGLALHAKWYRGP # QKYAGKDVVPVKRFTLQGDGKITAELQDDTTIQDIDVVFVGSGYFPNPAFLYVRDPNSSTGSLAPLMSQVSRDAPQSRRIPSLHRHILYAYNPSLAFI # GSVMCFTPFTIADVSSTWLALAWTNEVAYPSTPEELLQFEKDRIVDVEKRRGIEAQETGREASSLFTYSALGTSEEDYAAGLKREIVAARPELKDSLP # EWSDERRTWRQSMYPVKYQSLQWLKTQRERIVDNGVINDNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g891 ### # start gene g892 6 AUGUSTUS gene 3695355 3696134 0.98 + . g892 6 AUGUSTUS transcript 3695355 3696134 0.98 + . g892.t1 6 AUGUSTUS start_codon 3695355 3695357 . + 0 transcript_id "g892.t1"; gene_id "g892"; 6 AUGUSTUS CDS 3695355 3696134 0.98 + 0 transcript_id "g892.t1"; gene_id "g892"; 6 AUGUSTUS stop_codon 3696132 3696134 . + 0 transcript_id "g892.t1"; gene_id "g892"; # protein sequence = [MTPLPPVITLEEHYASPNLLAIRPLNEFSYVLPKLIDLDEERITDMDAGAVTLQVLSHVATAVPSPDLARSTNDELYA # AIQKHPERLAAFAILPMADPSDAAAELSRVTKDLHFVGALIDNHLDGRFYDDVFFWPVFERAQELDVPIYIHPTFPAENTKQQYQGNYPESTAYMLGI # AGWGWHADTGLHILRLFASGLFDKFPRLKIIIGHMGELLPFQLDRIVPISERWGNQRGLRQVGLIRCLLSIAIKIADAFDSFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g892 ### # start gene g893 6 AUGUSTUS gene 3701727 3702746 0.48 + . g893 6 AUGUSTUS transcript 3701727 3702746 0.48 + . g893.t1 6 AUGUSTUS start_codon 3701727 3701729 . + 0 transcript_id "g893.t1"; gene_id "g893"; 6 AUGUSTUS CDS 3701727 3702746 0.48 + 0 transcript_id "g893.t1"; gene_id "g893"; 6 AUGUSTUS stop_codon 3702744 3702746 . + 0 transcript_id "g893.t1"; gene_id "g893"; # protein sequence = [MTVGDLVMINQLIFQLSLPLNFLGTIYRELQQNLLDMEVLFNLRENNPPIEDKPGAQPLALPVDAGKSISFENVQFAY # HPSRPIFTDLSFTIPAGKRVAFVGPSGCGKSTILRLLFRFYEPSSGRILIGDQDISQVQLGSLRKSIGIVPQDTPLFHADVMHNVRYGNLDKDEFDAI # EAAKQAHVHEAIMRLPDGYRTKVGERGLMISGGEKQRLAVARVLLKDPPILFFDEAVSRPPAFFLYRIHTDTHVQTSALDAHTEAELMKNISSTLFHK # SRTSIFIAHRLRTVIEADLIVVLQEGRVAEQGTHEELLKRGGLYHRMWQQQQAAAELLQEEEPVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g893 ### # start gene g894 6 AUGUSTUS gene 3703860 3705361 0.15 + . g894 6 AUGUSTUS transcript 3703860 3705361 0.15 + . g894.t1 6 AUGUSTUS start_codon 3703860 3703862 . + 0 transcript_id "g894.t1"; gene_id "g894"; 6 AUGUSTUS CDS 3703860 3704204 0.39 + 0 transcript_id "g894.t1"; gene_id "g894"; 6 AUGUSTUS CDS 3704417 3705361 0.32 + 0 transcript_id "g894.t1"; gene_id "g894"; 6 AUGUSTUS stop_codon 3705359 3705361 . + 0 transcript_id "g894.t1"; gene_id "g894"; # protein sequence = [MPPPDRNLLSHFSSSLAASFSTSFSRDGTKYAVASQEGVVCVWDVRSTKPLKVYQTDKSESWNGAGNGLASGYLSDDP # YEWTRGLSKAPGWSARNVKFGNGGVDGCGKEIMTFTETRSRPSYVRPYQRPASSARALAASIVNPHPRSNIPFSIPVSATSHTSGSSTRRDTSQSPYV # VLALEDTFRIPTRVSDSAEELYASASGSWRRGDNFERDSEEDLVVIPPLGDREVEDDVRALLGSHGIRSRRLGGVGVGVSDHADENYDRNRDERMEID # DELDELGMEPEWDCISSHVPSRSSSPGPSLSPPPSNNRWTPWSRVEALSRIGARVLDRTSSGDGADMDDDNAEGDGADHDEDVDLNTEYQGGSFGLDG # MDTLGSTLKYDPDLDIAGTCFDPTGGYIYAATTEGVVEWNVRGWDKRWWSDSGDVWC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g894 ### # start gene g895 6 AUGUSTUS gene 3708836 3709271 0.62 + . g895 6 AUGUSTUS transcript 3708836 3709271 0.62 + . g895.t1 6 AUGUSTUS start_codon 3708836 3708838 . + 0 transcript_id "g895.t1"; gene_id "g895"; 6 AUGUSTUS CDS 3708836 3708849 0.62 + 0 transcript_id "g895.t1"; gene_id "g895"; 6 AUGUSTUS CDS 3708950 3709271 0.71 + 1 transcript_id "g895.t1"; gene_id "g895"; 6 AUGUSTUS stop_codon 3709269 3709271 . + 0 transcript_id "g895.t1"; gene_id "g895"; # protein sequence = [MTLNVVEEFRRTQRNQYQAISTENRHMINIERRLQIIDSATRSKLRTTSCCIAPGDMFRLPSPEDGPDSGMNAGSDLM # FPRFEFESFQSLLYKHDYQAITRIRSTQTRPEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g895 ### # start gene g896 6 AUGUSTUS gene 3729604 3730311 0.77 + . g896 6 AUGUSTUS transcript 3729604 3730311 0.77 + . g896.t1 6 AUGUSTUS start_codon 3729604 3729606 . + 0 transcript_id "g896.t1"; gene_id "g896"; 6 AUGUSTUS CDS 3729604 3729891 0.79 + 0 transcript_id "g896.t1"; gene_id "g896"; 6 AUGUSTUS CDS 3729940 3730311 0.95 + 0 transcript_id "g896.t1"; gene_id "g896"; 6 AUGUSTUS stop_codon 3730309 3730311 . + 0 transcript_id "g896.t1"; gene_id "g896"; # protein sequence = [MLEKAVSEVLRNAIRVWRKKKATRKKKRRRAIPKASEDEESRTNTEETSSDDEELLEHDPSLQFLDELVPHEKRPKHR # TGALGVLGKKVDTIEWCRDEIVKLNSTITSTRSQKQDGKFLGSVFILCNLQIGAHILAQCVSYHQVLQMNDKFIETHPDDIVWHNLDDDALKTRSKVS # LSWLATTALIVLWSFPVAAIGGLSNIYAVCRKAEWLGWICRGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g896 ### # start gene g897 6 AUGUSTUS gene 3732027 3732497 0.6 + . g897 6 AUGUSTUS transcript 3732027 3732497 0.6 + . g897.t1 6 AUGUSTUS start_codon 3732027 3732029 . + 0 transcript_id "g897.t1"; gene_id "g897"; 6 AUGUSTUS CDS 3732027 3732497 0.6 + 0 transcript_id "g897.t1"; gene_id "g897"; 6 AUGUSTUS stop_codon 3732495 3732497 . + 0 transcript_id "g897.t1"; gene_id "g897"; # protein sequence = [MGKQPDRKQFDTFATRMRNDLDFSTPHGGDLEAGNNNSYVTSTTAPNTTAAQSTSDNSTASRRSETLPTNVNKAESQG # DNNPTSSEDSLDEHAFDHPSTYVAQPCVWIPRDPLGLSTVLVEYLEEAGVRASDEGAIMDAKGAVMVMKPPPESTSTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g897 ### # start gene g898 6 AUGUSTUS gene 3735809 3739643 0.3 + . g898 6 AUGUSTUS transcript 3735809 3739643 0.3 + . g898.t1 6 AUGUSTUS start_codon 3735809 3735811 . + 0 transcript_id "g898.t1"; gene_id "g898"; 6 AUGUSTUS CDS 3735809 3736740 0.92 + 0 transcript_id "g898.t1"; gene_id "g898"; 6 AUGUSTUS CDS 3736955 3737123 0.62 + 1 transcript_id "g898.t1"; gene_id "g898"; 6 AUGUSTUS CDS 3737246 3737396 0.36 + 0 transcript_id "g898.t1"; gene_id "g898"; 6 AUGUSTUS CDS 3737458 3739643 0.33 + 2 transcript_id "g898.t1"; gene_id "g898"; 6 AUGUSTUS stop_codon 3739641 3739643 . + 0 transcript_id "g898.t1"; gene_id "g898"; # protein sequence = [MSEIYGLDYDKAFLDSLPTAGHPVNNASSLPSSINAGEMMSSRLAPAIHTLTVSQFKDLHYQHILSHPPDSVLFPFLH # GIEGDNEAQNLFFATQGQQAVVYNRRNDNEQPIHPQVNRARVPKYRGMMWVICEDDLENPDKDLRILVHRPSNLSSYASSEHYDDSSDSYFDDEDELD # DNFDDSSSDSFGELMSPDSTATYTKEPVVRPVSASQMDLDIQYNDGGDDVDDLHHNPGVVEIVEIGADDKHMHPVQHRALHPLPTPIRTTDLPNSHHS # KSPTTTTTTASGFSSSPLTDNGTEPSTALTEPESDDSDLLRPVCGSETSSHSKPHEYTRSGANHAAGGAQTEADCANDQKKLSQEDDDGEWEFPILAS # VSDIIIYTPNATGAAQSANALRLARRFKQAVERKRRERVGCKADNAAPSDTSAAHSTESSGASNDSNTPLDYNVFLLDANADEIKREMPHLVVKLCPE # GEVPGSLGAALAGPSKSNHVSLFHHDEDGDVVMVENCGASISEPPVSNTSTRVKTVPNTVDFAQREKDEMRDLTRASEIVSMFPEGHTLAYLNPDPLH # PPVYVQPSSHQIPTSNGDEVDLSNTKTFWNPHVGQVYLGNANDVPLPVNGMGEFGELDPRWDGHDSVEKDVYPPGNSPRHGYGYDICIECHDLAPFPT # LAHLKASEEKVAALEQRWKDQVELSRKEKGETQANYSLPPRPPPHPNAIIHLPMPSSPPITAGTMSALMPVVRFLQKCIVPTDAVEIVNEPPISPATE # TSLQNGSAEPLAENMKSRRWSSVSSLIPSFPGFPMHSNNPPPQPSLSPSSSTTSTSRHRSMTSPAPPAHLRQRSQTSSMHSRHTSLSYLASSSNASPF # PWSRPLKILLYSADGYTESSVPALCLLMAMKGLSLPHAYLELQVAKRRSFFVYHADLGVLRKVESFVDDERRTWKEEIQKEEKRLRLERERMERLKNS # KDQRAGEVSLSLFGGSTGALGFDFPTHMNPYRTWGSGDSSSNSLSDSSRLPLQPNRMRPMAKSVSFTRSPFIASPKGGGDSSMGTVTAIPTQQDLASR # SVGTGGLKGSATLPMSSSAPSSSMTSLDGIGETSSASAAGRTRRPRASTSPWLPSLFGGDHQSWFNDPRFDGSFPSRVLPFLYLGNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g898 ### # start gene g899 6 AUGUSTUS gene 3740911 3741279 0.58 - . g899 6 AUGUSTUS transcript 3740911 3741279 0.58 - . g899.t1 6 AUGUSTUS stop_codon 3740911 3740913 . - 0 transcript_id "g899.t1"; gene_id "g899"; 6 AUGUSTUS CDS 3740911 3741279 0.58 - 0 transcript_id "g899.t1"; gene_id "g899"; 6 AUGUSTUS start_codon 3741277 3741279 . - 0 transcript_id "g899.t1"; gene_id "g899"; # protein sequence = [MLESETMAPEHDEDSKEANKQIVQFLHYPDIWEVLNLSKYEKLDSEGPHSNDALNIRIHGHPHPEHDKHELHFTITGP # ERCGSETSGCRVKFLRELPGSSYTVTNQRPGEVAMILAEEPNCG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g899 ### # start gene g900 6 AUGUSTUS gene 3743828 3745120 1 + . g900 6 AUGUSTUS transcript 3743828 3745120 1 + . g900.t1 6 AUGUSTUS start_codon 3743828 3743830 . + 0 transcript_id "g900.t1"; gene_id "g900"; 6 AUGUSTUS CDS 3743828 3745120 1 + 0 transcript_id "g900.t1"; gene_id "g900"; 6 AUGUSTUS stop_codon 3745118 3745120 . + 0 transcript_id "g900.t1"; gene_id "g900"; # protein sequence = [MLKAKGIASTDKPRAKTTTGPESKLHVVAGTRFSVKTEDALSKYAINSAPSRGISVSDWDTLLPSSDVDIKPEAQDEM # GVIKVQGSASSVPGPSSLPGLVSLPEGLRSTLGPGSFVPSPSYISNLAESELPSLSGFFKCDDDGLEEQNTTRTENLARDDDELETVIVQQISPGTKG # DDICGPTVQSGTEVSMAGTTAINPIVVDDDDDDWIKTENSNNSSIRATSSFSFATSATSPPISPSSSDRAPMIDTRSVISALELLGPCKKRKRSSTPS # TIHMPQWKWRKAESNPSNDTQEVKGNNFSDDTRHSTTSVSTEPQQAPEIVIVKSDVGALDSTQIIDLDDDEEDRMLASEMETLQVCDLCFPFFILEGP # LTIFLPIQRQTRLRILQAQRVERRQANLNRRQVDNQRKEGRSHAVVKQDDTLKEEGMI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g900 ### # start gene g901 6 AUGUSTUS gene 3746031 3746348 0.98 + . g901 6 AUGUSTUS transcript 3746031 3746348 0.98 + . g901.t1 6 AUGUSTUS start_codon 3746031 3746033 . + 0 transcript_id "g901.t1"; gene_id "g901"; 6 AUGUSTUS CDS 3746031 3746348 0.98 + 0 transcript_id "g901.t1"; gene_id "g901"; 6 AUGUSTUS stop_codon 3746346 3746348 . + 0 transcript_id "g901.t1"; gene_id "g901"; # protein sequence = [MSPPALVETLMMIVFLLGFGSVEFEGGSGDEEFEGVVLLDDVDDDEVKTEGMLPDDDEVKLDANNVDDGFGLKPCVVV # VVGKLPVMEGSFHKADYHGSLGEYSQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g901 ### # start gene g902 6 AUGUSTUS gene 3750867 3751426 0.95 - . g902 6 AUGUSTUS transcript 3750867 3751426 0.95 - . g902.t1 6 AUGUSTUS stop_codon 3750867 3750869 . - 0 transcript_id "g902.t1"; gene_id "g902"; 6 AUGUSTUS CDS 3750867 3751344 0.95 - 1 transcript_id "g902.t1"; gene_id "g902"; 6 AUGUSTUS CDS 3751395 3751426 0.95 - 0 transcript_id "g902.t1"; gene_id "g902"; 6 AUGUSTUS start_codon 3751424 3751426 . - 0 transcript_id "g902.t1"; gene_id "g902"; # protein sequence = [MIFEELNLGHWKYHNQSPVNHARQYMHSPKRSIALVGAGVIGMPILRALLSSPNHPNVIVLTRPGSKNKDLLNDLPPV # SPIVIPVDYTDTSALTALFKKLSIEIVISALASTGYNAQYNLADAAKASGSVKLFVPSEWGSPTEGAKDKGEDNIFAIKDRVAGKLVSFPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g902 ### # start gene g903 6 AUGUSTUS gene 3752660 3753377 0.63 - . g903 6 AUGUSTUS transcript 3752660 3753377 0.63 - . g903.t1 6 AUGUSTUS stop_codon 3752660 3752662 . - 0 transcript_id "g903.t1"; gene_id "g903"; 6 AUGUSTUS CDS 3752660 3752809 0.63 - 0 transcript_id "g903.t1"; gene_id "g903"; 6 AUGUSTUS CDS 3752961 3753377 0.66 - 0 transcript_id "g903.t1"; gene_id "g903"; 6 AUGUSTUS start_codon 3753375 3753377 . - 0 transcript_id "g903.t1"; gene_id "g903"; # protein sequence = [MPTSLQRSIALVGAGSLGQHILRALLTSPSHPNLVVLTRPESKNDLPGDLSSATIIPVDYTNVAALTTLFKEHSIEVV # ISVVPPPAYTTVQHALADAAKASGTVKLFVPSEWGLPTEGAKEKGEKNLFAVKDEVAGEYVTGMFMAYVPWLVGIDVDGRVHIQGKGETPFTLTSQED # IGGKAFECSKNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g903 ### # start gene g904 6 AUGUSTUS gene 3757971 3759005 1 - . g904 6 AUGUSTUS transcript 3757971 3759005 1 - . g904.t1 6 AUGUSTUS stop_codon 3757971 3757973 . - 0 transcript_id "g904.t1"; gene_id "g904"; 6 AUGUSTUS CDS 3757971 3759005 1 - 0 transcript_id "g904.t1"; gene_id "g904"; 6 AUGUSTUS start_codon 3759003 3759005 . - 0 transcript_id "g904.t1"; gene_id "g904"; # protein sequence = [MLQETLHEEGVRSVTLEAFKLWLDSGPVPSPRGQLVSLSSKVDSNRPGTVNFTDNNNRLITFVDNDPLTLQDPRLPGC # FGDRFSALILNDFTPVAIYPSPVVNKSLKKQPVGEEFISILGREDIRNASRFPALGGISPKNEPEVLMLDWGMRHPVYSQPFKGPITYSPLLERLATT # LSSPSSPYLTIHWRMESVSPDVLPDCAHDLVDTISNLLHSPDLSEGIQKVWFSGDYPVPLVEHLYPTSDRAQTRATIQNKSGTFRDFGEKHTEAVNIL # VDAFREGAELDRWTITDLTAELARMEKDNELHDVHPEFLADSGALGILDKMVGMDAAIFVGGSKRCGRTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g904 ### # start gene g905 6 AUGUSTUS gene 3774682 3775677 0.56 - . g905 6 AUGUSTUS transcript 3774682 3775677 0.56 - . g905.t1 6 AUGUSTUS stop_codon 3774682 3774684 . - 0 transcript_id "g905.t1"; gene_id "g905"; 6 AUGUSTUS CDS 3774682 3775677 0.56 - 0 transcript_id "g905.t1"; gene_id "g905"; 6 AUGUSTUS start_codon 3775675 3775677 . - 0 transcript_id "g905.t1"; gene_id "g905"; # protein sequence = [MEYNIGAPKPPRPLVRKEPKVAKSDRNSTLDNYSPSLSMSSSFASSSSSFATSSTSSTKSRPSSAISFLRLFSKRKAS # TAPPTIFEPLGTPVQPYFRSPESEVLANTTPLGKPIQSVDEPSSVKLTDHNEILEVLRETHPGHVSSQTYSRRASLTLPPTHSHNGAPEQLPVLSHGT # EYSHLPHRPNRNPKRPKTAPSSQSNRRPLPHIPMNRTPSIATLNPEVISPSKQTTVPGPSRTENLDTRRIESPSLSLTRSKSISHSMMMVAPRPDSPF # IDCHVSGPMQSYFATALGTNQLGASSTAGTNERPQGWTGEWNIDDIQDVIQKLRELR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g905 ### # start gene g906 6 AUGUSTUS gene 3779054 3779881 0.98 + . g906 6 AUGUSTUS transcript 3779054 3779881 0.98 + . g906.t1 6 AUGUSTUS start_codon 3779054 3779056 . + 0 transcript_id "g906.t1"; gene_id "g906"; 6 AUGUSTUS CDS 3779054 3779881 0.98 + 0 transcript_id "g906.t1"; gene_id "g906"; 6 AUGUSTUS stop_codon 3779879 3779881 . + 0 transcript_id "g906.t1"; gene_id "g906"; # protein sequence = [MTEYDYSPEGYQRYLDTQRRISKWVQNTNAHASEFRSPFGTFNPIRVSEESSSSRTRTSTVSSKPHGDRKIVERGRGM # DDRERRHSMSATTFRQGASGASNVDFHTQRSPAHTSQVRHSYPYSPAPQESYTATRTAYADPTQSRRAQSLSSPPSQPQSRHRTHHHHNTPSQSAAHA # SRPHKLDSPRRSTTPPDSHRRHITHRPSSSHRSNHHHQHHSRSQSTPRPSSKLGSPLAVSPAYAVAGGRAYVSNPGGYLVIPPKGKKLSVVVSNSPRT # P] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g906 ### # start gene g907 6 AUGUSTUS gene 3781511 3781825 0.72 - . g907 6 AUGUSTUS transcript 3781511 3781825 0.72 - . g907.t1 6 AUGUSTUS stop_codon 3781511 3781513 . - 0 transcript_id "g907.t1"; gene_id "g907"; 6 AUGUSTUS CDS 3781511 3781825 0.72 - 0 transcript_id "g907.t1"; gene_id "g907"; 6 AUGUSTUS start_codon 3781823 3781825 . - 0 transcript_id "g907.t1"; gene_id "g907"; # protein sequence = [MIQAQYGPDTKVDFAKNRHAEYYTCPFKLEVSEQNAFWRPVSKVTGYFEMKEVQNPKSIKVTGWLKQDGKTISEYEYP # VRALLYPCTYSYPNTLHQPSESSSSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g907 ### # start gene g908 6 AUGUSTUS gene 3786323 3787099 0.99 - . g908 6 AUGUSTUS transcript 3786323 3787099 0.99 - . g908.t1 6 AUGUSTUS stop_codon 3786323 3786325 . - 0 transcript_id "g908.t1"; gene_id "g908"; 6 AUGUSTUS CDS 3786323 3787099 0.99 - 0 transcript_id "g908.t1"; gene_id "g908"; 6 AUGUSTUS start_codon 3787097 3787099 . - 0 transcript_id "g908.t1"; gene_id "g908"; # protein sequence = [MTEYDYSPAAYQRFMETQNRIAKWVDNTEAHHEAFRAPFGPRSDVDDDDLDGMSDADEAIPSGASAGGWYEEKRRTGG # RKNVAAPPPPIFYHSQPAAPAPMYPGAIASAPVNSNYPPQGGYMSPPGTPQIIIQTVPKHRSHRHHDSKRSAKSKTRTYVLPSPGSAAPPIPMQMQSP # YGYPGAHPPPGSFSYAPQPAGPYSANPAYAPPPPPFSPPVSSHSMMSPSPSPSPYYPQPGGYVIIPPKGQHVRVMVCNPTFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g908 ### # start gene g909 6 AUGUSTUS gene 3789982 3791119 0.28 - . g909 6 AUGUSTUS transcript 3789982 3791119 0.28 - . g909.t1 6 AUGUSTUS stop_codon 3789982 3789984 . - 0 transcript_id "g909.t1"; gene_id "g909"; 6 AUGUSTUS CDS 3789982 3790776 0.75 - 0 transcript_id "g909.t1"; gene_id "g909"; 6 AUGUSTUS CDS 3790868 3791119 0.28 - 0 transcript_id "g909.t1"; gene_id "g909"; 6 AUGUSTUS start_codon 3791117 3791119 . - 0 transcript_id "g909.t1"; gene_id "g909"; # protein sequence = [MDNLMFKHAAKEGAVAFDETKIESIEFEGNGDPKTARPVAAQWTNKQGQSGRIAFDWLVDASGRAGVMSTQYLKNRVM # RESFRNINTVHNLKTYLDKKGWAWFIPLNDGTTSVGFVTHQNTSTERRSKVGPDGKKPTVTEHYLDMFQYAPHVKDFLKEGEMIPGTTHSASDYSYWA # GGYAGDHYRLVGDAASEDEFFRFIIDLEVTPNTLSDFVDPFFSTGIHISMSGGLSAAASICSSIRGDVDEMTARKWHDLKVGMLHVRSVIVHTPAVDT # FVHPLGFLCRFLLAVMGAYRQMDLEQQNFDYASELLCQGKEYFNHAFIGFRERKLHVLYLCPLLIDVFEKRYKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g909 ### # start gene g910 6 AUGUSTUS gene 3794986 3797679 0.95 - . g910 6 AUGUSTUS transcript 3794986 3797679 0.95 - . g910.t1 6 AUGUSTUS stop_codon 3794986 3794988 . - 0 transcript_id "g910.t1"; gene_id "g910"; 6 AUGUSTUS CDS 3794986 3797679 0.95 - 0 transcript_id "g910.t1"; gene_id "g910"; 6 AUGUSTUS start_codon 3797677 3797679 . - 0 transcript_id "g910.t1"; gene_id "g910"; # protein sequence = [MFSFAILPLLAYSTLLAIFGFISVRITRWRRGHRPAALTLDDDDVELLPTNTSTLSPEFKAFPVPPPLPSLVPSHARS # RSFSNLQHAVVVHDMPERERPKSPLHFGLSTPGSRLKSKQRSHSAGSISSPLSPKRRLHNNNRRPFISDPESDADTVVPPRHAIASTPNTPFAPQTQF # GTLVDLSVPPVPAPSPLNPIFPNMAGSAHLWALHSYTRSSTVPAEELNLIDLHTPDPEQRASRNFEPVSVPLLQESKGSNAKEQGNTSSDLDGYEPDV # EGEAGEQTTGLGKDKEIDIGLEWGFESVSGSSMRVSSIPQAHQVSEERDLVDGNSMPSSPVEFLATQLHSIPITASSSLSEGYLRLDTEEVLAGKSED # SLPLSSSSSSAILSSSSSLPSPPRHLVELDAGHRPIDVVIVENTGVKDEDELDLNLDNETLPSISRDDTSLDLDLIHRVYNDDDENAAGQLELGPGMF # VARDREDDELYDLYENNDRVESDEYAEGAKAEEVMDQGMRSGVNIMSLTQDENIVVLTYTDNSSTNPESQEAIQDSLTPPPSHEKFSTLVSRAHPDND # VGLELRMFEDGLNDEPQANEGDVNVIEDDDEHIEETEGEFPDPDLLPLPELDIPLLLANITSPDPSLIAKEEEPSSSAATTASVSPTSQIPTPPASPP # QQRRPLPRPLPAWSIRAADAPPLGLASRSPVLRHKSSFSLSVIEGSDARVVKEAESQLKTEIEIREKNEEGISSLSDEIIESEDVRPSTKTPVPSAAI # LPGAFPVDVHPLSDLMVPDDEEEDEEEAETTTKETESSSTQDESVPGSSAEAPSTSTSTSISVTKPVKRHPARSPIDIALAMQLRPGLGLGADPAWMV # RFLMAMFGWFVVLISGSAGDGYGRTPYVGIRRSEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g910 ### # start gene g911 6 AUGUSTUS gene 3799316 3800488 0.96 + . g911 6 AUGUSTUS transcript 3799316 3800488 0.96 + . g911.t1 6 AUGUSTUS start_codon 3799316 3799318 . + 0 transcript_id "g911.t1"; gene_id "g911"; 6 AUGUSTUS CDS 3799316 3800488 0.96 + 0 transcript_id "g911.t1"; gene_id "g911"; 6 AUGUSTUS stop_codon 3800486 3800488 . + 0 transcript_id "g911.t1"; gene_id "g911"; # protein sequence = [MKNANILAFDQEETRSSDIFVERGNGPHTNIQHDDLISSAWRHPYPSSWLEMSISDEEEELDWDDEDDRSVQGSDRGS # TTRINGFVDTNKSLPRTPLKSPNTISFRTQEIGATPTIRRTRSQTVPQHALEAYASPLPSPSTTTSKRVEYLHLADRPRPPLDNPFLSRISEKSEETV # EEPRQSEATVNVQFRSKDTHVVVPWHRSSFPSKVTFLPTLKRSSSSMRSLEHFWEQKFGRNDPEPETKYRRRDRFFRSKKRLEPLQEECASEHTPEPI # DVPPFSVDGIPSAAETAQATYIRVLNEDGTSISFGKILSGGDSGDVGDKVKTIVCFIRHFLCPMCQDYMYSIGRNIDPVALERAGLRLVIVGNGGWQM # IKSYRRQFSLNVVQISAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g911 ### # start gene g912 6 AUGUSTUS gene 3800779 3801408 0.37 + . g912 6 AUGUSTUS transcript 3800779 3801408 0.37 + . g912.t1 6 AUGUSTUS start_codon 3800779 3800781 . + 0 transcript_id "g912.t1"; gene_id "g912"; 6 AUGUSTUS CDS 3800779 3801408 0.37 + 0 transcript_id "g912.t1"; gene_id "g912"; 6 AUGUSTUS stop_codon 3801406 3801408 . + 0 transcript_id "g912.t1"; gene_id "g912"; # protein sequence = [MGDKALLGGEFVFEKVPGKDISCVWAHRMRYTTAHEEIKSVVGEAQASSVDVGSCSGTDCSTSFMTAMSSLSRISSSF # DQASLAREMGFVDASSSDLCSTDLSLRDYESMTSRPVSSIYSTIASQTSSTSSWRKFRHKELWLSKEKSRWNKMIGMLDQRLVAGSSGDNSSDSSTEG # SELGHHLEVEIPEVVDDTRDEEEVFQRWFSTAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g912 ### # start gene g913 6 AUGUSTUS gene 3807862 3809575 0.51 + . g913 6 AUGUSTUS transcript 3807862 3809575 0.51 + . g913.t1 6 AUGUSTUS start_codon 3807862 3807864 . + 0 transcript_id "g913.t1"; gene_id "g913"; 6 AUGUSTUS CDS 3807862 3807885 0.51 + 0 transcript_id "g913.t1"; gene_id "g913"; 6 AUGUSTUS CDS 3807980 3809575 1 + 0 transcript_id "g913.t1"; gene_id "g913"; 6 AUGUSTUS stop_codon 3809573 3809575 . + 0 transcript_id "g913.t1"; gene_id "g913"; # protein sequence = [MLNNPPRPGCGLISEPVFSKCQFSLNEGRRLENISWRLWSQQIAGKSLKYRPLTPDSPSEGVLTHGSGTLLSGPFLSV # YVNLTFGIGTITPLLSTFSPRRQPIGKILCDFIPNLQQTIQPLYPKLRLPSRLTKAEHEVRLASVLPTPAAELLSISIIPPTHSNDEAAARNIPSIVA # SASTSPASGNSSSKSISPTSGSHALPGALASPFPLVVVVNPTPNPTPHPTPPATPVLPVVLASDAVRHTHVPLPPRMSPDSPTLSRDRRQLNLTLATT # LDLMPAFQTRSSAQPSIFGSCSPVSNNLLPPSPSANTSSSITSTSSANSNSSHLTASSSTSIHSNDTRSPNATLKPHDARKFFLKLDEHSSGSSDEPS # PIRPDIATFTTSKVDAASSRAHGSPVAAFALGSYSTGMQNSNGDEGHSNQPPGLAFQSSVGQSSTSASGSWGESDVSGRRRRGPPLAKSSKGSSGRAS # GSSDGRSRSRSHGQAHDGLMMRKKAQASVATGRRGPRSGANVVPPQTHGHTRGQGPVASGDSLQLGTCG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g913 ### # start gene g914 6 AUGUSTUS gene 3809608 3811728 0.73 + . g914 6 AUGUSTUS transcript 3809608 3811728 0.73 + . g914.t1 6 AUGUSTUS start_codon 3809608 3809610 . + 0 transcript_id "g914.t1"; gene_id "g914"; 6 AUGUSTUS CDS 3809608 3811728 0.73 + 0 transcript_id "g914.t1"; gene_id "g914"; 6 AUGUSTUS stop_codon 3811726 3811728 . + 0 transcript_id "g914.t1"; gene_id "g914"; # protein sequence = [MLLPSGTTFSSAHEHNRTEEKPTQVQRTHLVTPSPGHPVQVPPPMHSTTPARRTTFNIGSQSPSGSPSNTDLSTSSQA # HTRSPPPSNAGPSISCPPLVSPDRMRLQGHLPVTEARAGPLLRSPPPNVPFVVSSRQPRGLPHAASNLSAAEAVIQAPRTKRVVLADDDDDDWDETET # DLDSDFEDDRKSDIDAEKGGTLVEPGIIGGGDHNDDGDWVSEEDEPESSQANLPAKQNPHPAPPQAPTQNNIKRPTGVSRHQSQPDIPNTAMVSRQKD # LEQGQRLDQPRLHQRSQHPVVQSRTSHRSERDQAHALNDAKLRDAALEAQRQREMFAKVPKRSYSNLSTRSQSGLLSQLMNPDPNIFPGDHPYRRGYS # DVAVGGRTGNGLARLGMQPMTNLTANAGVRNHKSNLTTGAPGPSATQRGSTSAAESSTSVAASSVSKVAPLGPTKSAVALPIANSVTASSYKGDLQTI # AGFPKGKQRQIEPDSNAGAYRPKGRPQDEEMEMEEESEDDRDQAYHISKSVAEQKLAAIADRRTAKKGSSSAQAGPPAALPLHPHPYPAPQPHRSKSQ # YIANTHERISTPPVQVPLPLGFPYNLPPAAPPSSPHTTRQLMLRKEMPESLRQNLLWSRKISNQELNGPRRNSSSALSPTLQPLTAIPTVVHVTKKRR # PEPGESIPQEVEDARSDEDIMEPIRPVVMQRNRSWAGGGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g914 ### # start gene g915 6 AUGUSTUS gene 3813341 3813745 0.52 + . g915 6 AUGUSTUS transcript 3813341 3813745 0.52 + . g915.t1 6 AUGUSTUS start_codon 3813341 3813343 . + 0 transcript_id "g915.t1"; gene_id "g915"; 6 AUGUSTUS CDS 3813341 3813745 0.52 + 0 transcript_id "g915.t1"; gene_id "g915"; 6 AUGUSTUS stop_codon 3813743 3813745 . + 0 transcript_id "g915.t1"; gene_id "g915"; # protein sequence = [MPDLDLAKELESNLSGKRNNSWQRPNAHSPPSRNSTTEAAISAIRRWDISPESSSQQNAEDGEHIELADNIKSLQVDS # REYRFFGKSSGAMLIKTAIDLKQEFTGRKTDMKPVVLGERRPEFWQPLPVRPTLAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g915 ### # start gene g916 6 AUGUSTUS gene 3815473 3816243 0.41 + . g916 6 AUGUSTUS transcript 3815473 3816243 0.41 + . g916.t1 6 AUGUSTUS start_codon 3815473 3815475 . + 0 transcript_id "g916.t1"; gene_id "g916"; 6 AUGUSTUS CDS 3815473 3816243 0.41 + 0 transcript_id "g916.t1"; gene_id "g916"; 6 AUGUSTUS stop_codon 3816241 3816243 . + 0 transcript_id "g916.t1"; gene_id "g916"; # protein sequence = [MMLIRDILYELASVGELPLPNASPTATNKRERGAESPMSSAETSEGSPCLSLSDAPVSPDSRSIAGSRRVSAATSGNF # DFLKPTATATSSLHHTVVGESALSTDSSPGMQLFSLPVYSNELGRLPLYGQVNFSARPHPNSQPLDWCPPHRAGSSSSNVPEIVTHSQYIPPEYYNYG # HNESGVAPPTNSAVHDSMLYHNGPLNDTAGPGLSSVAAYSGDSPLHPSDGLLSSRNGVNMPMSLDSDTFAMWSNAPSGFE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g916 ### # start gene g917 6 AUGUSTUS gene 3824873 3825280 0.97 - . g917 6 AUGUSTUS transcript 3824873 3825280 0.97 - . g917.t1 6 AUGUSTUS stop_codon 3824873 3824875 . - 0 transcript_id "g917.t1"; gene_id "g917"; 6 AUGUSTUS CDS 3824873 3825280 0.97 - 0 transcript_id "g917.t1"; gene_id "g917"; 6 AUGUSTUS start_codon 3825278 3825280 . - 0 transcript_id "g917.t1"; gene_id "g917"; # protein sequence = [MKFFVDSDEDARSDSSSLDLDDDNMSLFSDEGEYRRVRHIPSWNQEGGRHPAELDSLEPEQLSPTSPISFSPYPSHGG # SDYEYRYDHRYNLGPSSSIAFAPRRRGWDAVSDGDIVDVMSNLDISDDEGSKTDDIE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g917 ### # start gene g918 6 AUGUSTUS gene 3826679 3827095 1 - . g918 6 AUGUSTUS transcript 3826679 3827095 1 - . g918.t1 6 AUGUSTUS stop_codon 3826679 3826681 . - 0 transcript_id "g918.t1"; gene_id "g918"; 6 AUGUSTUS CDS 3826679 3827095 1 - 0 transcript_id "g918.t1"; gene_id "g918"; 6 AUGUSTUS start_codon 3827093 3827095 . - 0 transcript_id "g918.t1"; gene_id "g918"; # protein sequence = [MTSPNDSTCPSTPTGITSSPPVPFKTPATSFSDTTSLTDSTASVTHPDAIFPGPSNYPTPPSSSARANSTSGISGTSA # SGFIVQHTAADEEDPITQFAPIEKIEVTDKERDAAMSAVKFRWRRQGASGRRRRRAEEVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g918 ### # start gene g919 6 AUGUSTUS gene 3827172 3829463 0.27 - . g919 6 AUGUSTUS transcript 3827172 3829463 0.27 - . g919.t1 6 AUGUSTUS stop_codon 3827172 3827174 . - 0 transcript_id "g919.t1"; gene_id "g919"; 6 AUGUSTUS CDS 3827172 3827928 1 - 1 transcript_id "g919.t1"; gene_id "g919"; 6 AUGUSTUS CDS 3828754 3829463 0.34 - 0 transcript_id "g919.t1"; gene_id "g919"; 6 AUGUSTUS start_codon 3829461 3829463 . - 0 transcript_id "g919.t1"; gene_id "g919"; # protein sequence = [MSSFPEASSSCDSQVSIQSYPTLVSNPPPTTAQPAVVTTSLVQTTRLADGKKMINQYVMDAKVGSGQHGNVWRCYENK # YYYSYYDGQDPEERERIERQRNSKVLAMKIVKRDNPKARRDRQYKMLRMRGGLGAAGAGANNSGSSAGNAAGASSASGSANGLGTSRPRSTPTVVDGI # RTAEQEIRKEIAIMKKCRHPHVVRLYEVIDDRKNEMVFMGKFVCHPIRVPYFSVAFEFHVPYAQRLAAAKASNLPIIDDNEEDPLLLNDADLAKRAGS # PAFLAPEIVWEFVEWPQAEKFYPTYTPLLPTTPEGSSPSEPVSADVVPVPAPPRPPVTKSIDIWALGVTLYCLLFGKTPFRPPGDEGDRITEWAGYYW # VCNRDWRAEDKMGWDGVLTGGQKAREGQWNGWGWLMNGVTTTETDTKTREYSEGGDSAAKEEGQKGKPEGSKEGALVMHLLDHFLQKDLERRITLEEV # KVHSVSPTSLMFHLTQFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g919 ### # start gene g920 6 AUGUSTUS gene 3837808 3838272 0.54 - . g920 6 AUGUSTUS transcript 3837808 3838272 0.54 - . g920.t1 6 AUGUSTUS stop_codon 3837808 3837810 . - 0 transcript_id "g920.t1"; gene_id "g920"; 6 AUGUSTUS CDS 3837808 3838272 0.54 - 0 transcript_id "g920.t1"; gene_id "g920"; 6 AUGUSTUS start_codon 3838270 3838272 . - 0 transcript_id "g920.t1"; gene_id "g920"; # protein sequence = [MSSSVSSSNIEDGYPFPIFSAAHSDAQDLAIHSWSNSIERSHGRSDHFNEFETAVHRLGVFQKGVGDVSSKNNSADNG # NVQWPHWRSSHLGFSSKFKGELADLVTEVKEGNEETTNGVQKEKEVDKVAKKTISNQRRVEEFQEIAWRESHRETR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g920 ### # start gene g921 6 AUGUSTUS gene 3849985 3850551 0.71 - . g921 6 AUGUSTUS transcript 3849985 3850551 0.71 - . g921.t1 6 AUGUSTUS stop_codon 3849985 3849987 . - 0 transcript_id "g921.t1"; gene_id "g921"; 6 AUGUSTUS CDS 3849985 3850551 0.71 - 0 transcript_id "g921.t1"; gene_id "g921"; 6 AUGUSTUS start_codon 3850549 3850551 . - 0 transcript_id "g921.t1"; gene_id "g921"; # protein sequence = [MALPRPEAPHLPTAPIASMEGASFMHPTYGLLQPCYIEPGSNQSYRSPHSECTRIVTDEVTQEIIKSPLSHNSTLEDT # LAIPTLIIPYNGFFVTHIMLRHFCGNLFNGSIIWSNWVVREKEGYHQNNENVGKDIIIGFDNRFEVEWVHETKSARGGLAFKGGFWGKGKKAKAPMGT # GKESAEVWFGKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g921 ### # start gene g922 6 AUGUSTUS gene 3851517 3852077 0.87 - . g922 6 AUGUSTUS transcript 3851517 3852077 0.87 - . g922.t1 6 AUGUSTUS stop_codon 3851517 3851519 . - 0 transcript_id "g922.t1"; gene_id "g922"; 6 AUGUSTUS CDS 3851517 3852077 0.87 - 0 transcript_id "g922.t1"; gene_id "g922"; 6 AUGUSTUS start_codon 3852075 3852077 . - 0 transcript_id "g922.t1"; gene_id "g922"; # protein sequence = [MIVILSLSVLCFAGCSLAAQISFSTPSHQDDTHNVFITPEINNFIEGILEEYNSPGLSLALVRRNETSSTGWLMEFGS # YGTAKADGSPVTPDSLFAIASNSKLFLSLSVGLLIENQTLADQTGRELSWSSRAIDVIPQWGLMDEDMERIVNIQDMLSHRTGMPRHDLSGRPLQGGV # AEMVILHLTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g922 ### # start gene g923 6 AUGUSTUS gene 3853434 3854453 0.98 + . g923 6 AUGUSTUS transcript 3853434 3854453 0.98 + . g923.t1 6 AUGUSTUS start_codon 3853434 3853436 . + 0 transcript_id "g923.t1"; gene_id "g923"; 6 AUGUSTUS CDS 3853434 3854453 0.98 + 0 transcript_id "g923.t1"; gene_id "g923"; 6 AUGUSTUS stop_codon 3854451 3854453 . + 0 transcript_id "g923.t1"; gene_id "g923"; # protein sequence = [MDAANYANPLTELATILYSGIETLLSEYNHQGVAFPLLSQPFTPSPLDTNSVVNESTCLIIAAAHQIIATVRAPAESI # QEHATGAYTATALNLCVDVHVADILQGAGAQASDIWALFYECVELFPPYRVYTPESLEQKPILLPSTCVKSLMSHHIPKFPTNLDSTARILRYLSTRH # IFQEIEPDVFANNRISSLLIKSRSLNEIEAKLDHSPFLISDTHLLMHVSHQVLTLSSKGQHLLDLSGMRMSEFLFNFRSSYGYFAHATFRTDECLKAS # VSIVPWLKDKSTQFPSPFNMSIGSSISLFEWFVAPENTRRLRRATAAMTGGGERFPATIFTNGKH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g923 ### # start gene g924 6 AUGUSTUS gene 3862385 3863627 0.65 - . g924 6 AUGUSTUS transcript 3862385 3863627 0.65 - . g924.t1 6 AUGUSTUS stop_codon 3862385 3862387 . - 0 transcript_id "g924.t1"; gene_id "g924"; 6 AUGUSTUS CDS 3862385 3862799 0.98 - 1 transcript_id "g924.t1"; gene_id "g924"; 6 AUGUSTUS CDS 3862949 3863403 0.81 - 0 transcript_id "g924.t1"; gene_id "g924"; 6 AUGUSTUS CDS 3863463 3863627 0.67 - 0 transcript_id "g924.t1"; gene_id "g924"; 6 AUGUSTUS start_codon 3863625 3863627 . - 0 transcript_id "g924.t1"; gene_id "g924"; # protein sequence = [MSVRSAPSTEVTQATDTVIKTIVDLVQHTGAEKLKLVDAKLIPLVQWAKDYAGYRFRHKEIIRILRDEGQLNDLSDQL # RKLAEDSLQAGDAFVLARAEADWEGDWVHPRWKKAAMVRAQAAEKQRKEDLLVAERRRVDVYTRLRDVCNTNIEDLPFNYSEDSDSEDEILQAASVGA # PGPSSSSNSTAHNPANRTSSSIDTMRRTGPLSYAFLYTLSIIYTSDPIPDSTVRAALPMNPGVPVPSVPAQHPLLPFNFRGLSKEAQQISNFKQYERT # HSGDIVQTLNVHFNGSTNLLANEAYVREISQTLVCAYSSINYPFELTITGYIAAIVHRLHQEKHKMCMDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g924 ### # start gene g925 6 AUGUSTUS gene 3864601 3865944 0.35 - . g925 6 AUGUSTUS transcript 3864601 3865944 0.35 - . g925.t1 6 AUGUSTUS stop_codon 3864601 3864603 . - 0 transcript_id "g925.t1"; gene_id "g925"; 6 AUGUSTUS CDS 3864601 3865944 0.35 - 0 transcript_id "g925.t1"; gene_id "g925"; 6 AUGUSTUS start_codon 3865942 3865944 . - 0 transcript_id "g925.t1"; gene_id "g925"; # protein sequence = [MPRCLQSPAKVIITTKSPAMAFVQPESSNSLRRLSSSMTNSSSRPYSPTPVSGFESSSLAARGLASKASLVTLSSPPP # LRFNSDFTGWLLPDGVDTSIPDDNSELPDLTHCSFAFASASNPNLSTSTISSDSEDIPPTPGRGVGLGFGLGFGCGARVFCHDNEIAATSLKETALTF # DAASVSNEIIGSLDVRGRSGGGSRFIASGYDEALGLPTTSCFEGNVEKELDSTPKVPSETISNFKDNIPCFSFSSTPRNRTSSSSASQCPSSTSPSLR # SHSRSQAPGFTDVSSSKRPEGCSNENSVGKPTTSKPAAAKRGSIRRTISLHRRGGPDVTLATISSSLKRSTPSGSSSPTITVPTANRLFSRVPSRILG # RGPREAVADLKKAKECPAVTVHPRYTPQKQAKAENGPRHVRPSQELVAHVEERQEHRGRQRSLNAPSLERKLSWR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g925 ### # start gene g926 6 AUGUSTUS gene 3871558 3872226 1 + . g926 6 AUGUSTUS transcript 3871558 3872226 1 + . g926.t1 6 AUGUSTUS start_codon 3871558 3871560 . + 0 transcript_id "g926.t1"; gene_id "g926"; 6 AUGUSTUS CDS 3871558 3872226 1 + 0 transcript_id "g926.t1"; gene_id "g926"; 6 AUGUSTUS stop_codon 3872224 3872226 . + 0 transcript_id "g926.t1"; gene_id "g926"; # protein sequence = [MLVRRDKESRRNLVQTSPVTEHEYWTLILDLKLNSIETYFGYRTRFETNQEGTRGSWVNEAKTHTNTGNIFVVAREPK # GIILGSFSASQAARRKIYLRLTKAPVKPNLWYIDQILAMLETYLPNELGISMDLDLTPHGIWVPLVTKMVNAGCTGARKLVVGNHEANLSGGPPKQSS # KPQFGVGPSVSEKLPTYANLTDVEFARLLQEETRRLNDQEKADKHH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g926 ### # start gene g927 6 AUGUSTUS gene 3873760 3874089 0.62 + . g927 6 AUGUSTUS transcript 3873760 3874089 0.62 + . g927.t1 6 AUGUSTUS start_codon 3873760 3873762 . + 0 transcript_id "g927.t1"; gene_id "g927"; 6 AUGUSTUS CDS 3873760 3874089 0.62 + 0 transcript_id "g927.t1"; gene_id "g927"; 6 AUGUSTUS stop_codon 3874087 3874089 . + 0 transcript_id "g927.t1"; gene_id "g927"; # protein sequence = [MKSASVIAYATLVGTAAAFVVPQARDSSMNSTTIDDTSLLNYVLTLKNLENAFYAGALNSFTQDDFVNDSLPTWSRAR # FEQIAEHQQAHVDLLNNAIGSGAAQACNYTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g927 ### # start gene g928 6 AUGUSTUS gene 3874130 3874717 0.85 + . g928 6 AUGUSTUS transcript 3874130 3874717 0.85 + . g928.t1 6 AUGUSTUS start_codon 3874130 3874132 . + 0 transcript_id "g928.t1"; gene_id "g928"; 6 AUGUSTUS CDS 3874130 3874717 0.85 + 0 transcript_id "g928.t1"; gene_id "g928"; 6 AUGUSTUS stop_codon 3874715 3874717 . + 0 transcript_id "g928.t1"; gene_id "g928"; # protein sequence = [MSCSPYTSPSTFAALAEVISGVCVSAFVGAAQYITSSDYLTTAAAVLSTEARHAAWIAGPVNHQNAWSGALDTPLSLD # AAYTLASQYISGCPSSNPTLPVTAFSSLTIANASLGQASTVTANNVTVEGQYVAFLSGVTPTFVQVVGGQVVVPTTIMGTSYAVLTSSNVSVDDSTIT # AGVVVLQFPYNSNGALEIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g928 ### # start gene g929 6 AUGUSTUS gene 3877239 3877538 0.91 - . g929 6 AUGUSTUS transcript 3877239 3877538 0.91 - . g929.t1 6 AUGUSTUS stop_codon 3877239 3877241 . - 0 transcript_id "g929.t1"; gene_id "g929"; 6 AUGUSTUS CDS 3877239 3877538 0.91 - 0 transcript_id "g929.t1"; gene_id "g929"; 6 AUGUSTUS start_codon 3877536 3877538 . - 0 transcript_id "g929.t1"; gene_id "g929"; # protein sequence = [MIIVRIGLGIDVLATSQPYSTIGDVEVQAAGPIIIEDHPEQSCTQTGTANTDNIQPFELKYEDPEMQAVVSTATYNHP # EQSCMLAGTTHTNNSQFNPLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g929 ### # start gene g930 6 AUGUSTUS gene 3889521 3890932 0.42 + . g930 6 AUGUSTUS transcript 3889521 3890932 0.42 + . g930.t1 6 AUGUSTUS start_codon 3889521 3889523 . + 0 transcript_id "g930.t1"; gene_id "g930"; 6 AUGUSTUS CDS 3889521 3889698 0.5 + 0 transcript_id "g930.t1"; gene_id "g930"; 6 AUGUSTUS CDS 3889779 3890932 0.74 + 2 transcript_id "g930.t1"; gene_id "g930"; 6 AUGUSTUS stop_codon 3890930 3890932 . + 0 transcript_id "g930.t1"; gene_id "g930"; # protein sequence = [MSSSRSPTHTRTRSGTQLSEEHIQNSFHSYLKSSLTQAKVERLLDADLLSSAEGDLMITALRSTTNPPSVPLPRHNKT # SDPTELSSENCPPPFAPFLRVWAQTVPSIQALAPEHQHDLARIICDLEPVASPLNSNIHGIAADLRAVAIEISQRRSFQDRYAADLQAALDSGNEPSS # PRAKKASFVPPPSYEMSPPSSVQSSPNTQNLPLPPPSPTYSAGHQADIHDLASQSSSHLFPYTPSAGSGWPSRSSSPSILTPDSPAIEFIRETLYAAL # GDVLESHSSLREMLKLDPSRAYFAAVAYAILDVATTSLTPEGAIVGVLGTPLTLDDCPPPLRRFMLELAAIGRQAAEIQEADDARATKYASQGKCIPT # PRMERVQQMLVEGIGCSTQHSDGEEGRRSVEGKAVAFANRINGLSLALTHLKTFKDRQDQVFKVLAGIGSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g930 ### # start gene g931 6 AUGUSTUS gene 3892828 3893123 0.47 + . g931 6 AUGUSTUS transcript 3892828 3893123 0.47 + . g931.t1 6 AUGUSTUS start_codon 3892828 3892830 . + 0 transcript_id "g931.t1"; gene_id "g931"; 6 AUGUSTUS CDS 3892828 3892852 0.47 + 0 transcript_id "g931.t1"; gene_id "g931"; 6 AUGUSTUS CDS 3892915 3893123 0.49 + 2 transcript_id "g931.t1"; gene_id "g931"; 6 AUGUSTUS stop_codon 3893121 3893123 . + 0 transcript_id "g931.t1"; gene_id "g931"; # protein sequence = [MSLRYKGLPDQVVESSMNSEGSPSEVGSDIRGVFSSKLGGVLGGSEVSEVEELEDMEEMLGEFEIDEEALSDSKRGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g931 ### # start gene g932 6 AUGUSTUS gene 3900360 3900653 0.56 + . g932 6 AUGUSTUS transcript 3900360 3900653 0.56 + . g932.t1 6 AUGUSTUS start_codon 3900360 3900362 . + 0 transcript_id "g932.t1"; gene_id "g932"; 6 AUGUSTUS CDS 3900360 3900653 0.56 + 0 transcript_id "g932.t1"; gene_id "g932"; 6 AUGUSTUS stop_codon 3900651 3900653 . + 0 transcript_id "g932.t1"; gene_id "g932"; # protein sequence = [MRDNFDSGQVGGDYERALAGISRAIEEERAVGRYDHRNDEDRDNVEEQHSDENTFCGLGDVTTRTLSLGGSSSDGFDT # RIRIGSIGEGRPKTQKSTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g932 ### # start gene g933 6 AUGUSTUS gene 3901457 3901579 0.85 - . g933 6 AUGUSTUS transcript 3901457 3901579 0.85 - . g933.t1 6 AUGUSTUS stop_codon 3901457 3901459 . - 0 transcript_id "g933.t1"; gene_id "g933"; 6 AUGUSTUS CDS 3901457 3901579 0.85 - 0 transcript_id "g933.t1"; gene_id "g933"; 6 AUGUSTUS start_codon 3901577 3901579 . - 0 transcript_id "g933.t1"; gene_id "g933"; # protein sequence = [MSFNDEKDKNIYDGKLDAESGSTGPIGDDEQVFEEERELK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g933 ### # start gene g934 6 AUGUSTUS gene 3908883 3912365 0.84 - . g934 6 AUGUSTUS transcript 3908883 3912365 0.84 - . g934.t1 6 AUGUSTUS stop_codon 3908883 3908885 . - 0 transcript_id "g934.t1"; gene_id "g934"; 6 AUGUSTUS CDS 3908883 3912365 0.84 - 0 transcript_id "g934.t1"; gene_id "g934"; 6 AUGUSTUS start_codon 3912363 3912365 . - 0 transcript_id "g934.t1"; gene_id "g934"; # protein sequence = [MSDFFRALSPAIQSFAGSSSATTASDKRLSGAFHLLASAANVNEVLATLPDTYRDVLTGPLQGVRATANRLCSARKSL # ASLEAHKASGTIPPSIPKTSLDLQLTAEFKTSADGLTVTKAVSDLSAEFRQNLFAQQILAKSTEIKVLESKITPDKLLRELSPIITSNYASLKERMKR # AVFEDVQISNDRGQPSGQTELRFVRWEESPELEPQYRDLLSNCVQYAFRIIQLVEAMFAKQEGKRKEKRELKAAADVEMADLTQPGPSLQSTIDKAVA # AQVRAALKGKKRDSSSTSTVRFDSMNTDFSAHRFFKEENIGTSREEKRSQIVRRSSSRSDSLRLPQSAASASRQKVHQKGNARWKDRGEKTGSDEQGI # FIEQGQRKEVVSLSSTPHFDWSKYDSYPDELLTMPYPDAIRTILLQVPSDILDAAAYRSSVHIGPGVFLPLEYQMDLSVGQNYMFHSPRNSRLLIEAW # KDFEYRIKWRIFFTFKDGRQDADNYDPDYEVPRERTSKVPQLPQYIEYGLNIGQVYITKMMALMPKDQEGSAFKSLAPDPKRIRQYLIDNDYVVTNTD # KNLGIAVSQRTWIEEKSLALLNNPSDYERLTPAECKRILDKQCTQMELLCTLVDEAEPALEKQLKRFFRHKVTSPSGSHHIPTFYCIPKIHKEPVKGR # PIIPCHSAIQNPAAKYVSKKLKPLIEAAPSIIHGSKDLAIKLSKFKRDPRRRLFIVTGDVVAFYPNIPLQRCFDVVDELFCEFYHIEVDDLGVPISDE # WKHKVLLLERAMMYGCSDLVTQFFDSTIKDFIYFKQKRGLAMGVACSPDLANLFGFWFESRKQIWKRPEFGFYGRYIDDCLALVYAHSADEALALCEN # NINFDGCTIEWNVSEHFQHFLDMTLYLDEKGDLQHMPFRKAMSHQERIPWISHHPLDVKRGSFIGEMSRLATLSSTQSHYLVAIKDLASLYVKRGYPS # KAVYHWLNNNKKERWDNRLSLNNQHDGLSATEDVLVLKSTFNSAWDYFSASELGKRITRYWKEWLIHAEKGDYSSKYPKYRFGEDSLKDTVGSLRSVI # NSGAPAGVLTAPVTVPDIRLTGLADARWLVSRKRTRNLFDLANLWKKEVFQRMDVDTATNIAQGIPSDNYLDDVEMEDIQTKGDRPVPGDLEYIHYGH # AMES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g934 ### # command line: # augustus --species=saccharomyces split/input_2/input_2.fa_chunk_0000010