# This output was generated with AUGUSTUS (version 3.4.0). # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de), # O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff. # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), # Using native and syntenically mapped cDNA alignments to improve de novo gene finding # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 # No extrinsic information on sequences given. # Sources of extrinsic information: M RM # Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ... # saccharomyces version. Using default transition matrix. # Looks like split/input_2/input_2.fa_chunk_0000009 is in fasta format. # We have hints for 0 sequences and for 0 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 59835, name = 4_related_000144F) ----- # # Predicted genes for sequence number 1 on both strands # start gene g1 4_related_000144F AUGUSTUS gene 871 1548 1 + . g1 4_related_000144F AUGUSTUS transcript 871 1548 1 + . g1.t1 4_related_000144F AUGUSTUS start_codon 871 873 . + 0 transcript_id "g1.t1"; gene_id "g1"; 4_related_000144F AUGUSTUS CDS 871 1202 1 + 0 transcript_id "g1.t1"; gene_id "g1"; 4_related_000144F AUGUSTUS CDS 1269 1548 1 + 1 transcript_id "g1.t1"; gene_id "g1"; 4_related_000144F AUGUSTUS stop_codon 1546 1548 . + 0 transcript_id "g1.t1"; gene_id "g1"; # protein sequence = [MQSEWDNITVIGAKEFEFPEVKRVTYSRSFEEIFSLNKDMTIPIFTTGGFVQFANELVTKALQESNLDKMSNNKQTPL # TVMGKDEDQDVVIALWHLDSILNWQMVDRRIDEVREILWAFHRANERLYHPEPENRVTNLKTNISKRAIRISEKDENHAFVRWVGREPYQDTTDVNGI # FLVERRSRNREDSEDEDAEGEEDEDEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1 ### # start gene g2 4_related_000144F AUGUSTUS gene 4224 4878 0.54 + . g2 4_related_000144F AUGUSTUS transcript 4224 4878 0.54 + . g2.t1 4_related_000144F AUGUSTUS start_codon 4224 4226 . + 0 transcript_id "g2.t1"; gene_id "g2"; 4_related_000144F AUGUSTUS CDS 4224 4681 0.56 + 0 transcript_id "g2.t1"; gene_id "g2"; 4_related_000144F AUGUSTUS CDS 4776 4878 0.57 + 1 transcript_id "g2.t1"; gene_id "g2"; 4_related_000144F AUGUSTUS stop_codon 4876 4878 . + 0 transcript_id "g2.t1"; gene_id "g2"; # protein sequence = [MLRAIRELNPSFVCISETKFHGVKIGNEISTQDREDRRTQLAIVNSEKGTLAKGFLYEEDRDKWEATAELKALEATSK # RTDVAAGTISDWPVPGARRFVILMKNVGGEDLFESNCYKKAAKDPKKLDKLNKQLYAKLHDVVYQFASGKQILHASLSCNIKSIALIDWGYPGIFTVE # RGLSREAFVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g2 ### # start gene g3 4_related_000144F AUGUSTUS gene 32260 35201 0.51 - . g3 4_related_000144F AUGUSTUS transcript 32260 35201 0.51 - . g3.t1 4_related_000144F AUGUSTUS stop_codon 32260 32262 . - 0 transcript_id "g3.t1"; gene_id "g3"; 4_related_000144F AUGUSTUS CDS 32260 34343 0.62 - 2 transcript_id "g3.t1"; gene_id "g3"; 4_related_000144F AUGUSTUS CDS 34478 35201 0.67 - 0 transcript_id "g3.t1"; gene_id "g3"; 4_related_000144F AUGUSTUS start_codon 35199 35201 . - 0 transcript_id "g3.t1"; gene_id "g3"; # protein sequence = [MTIILGWYPEGSSGAKRDEAPATHSASIPCSTSPSPQPQSIVKIEPSTPPPILQFLHSPDVEPEPLPSYGWKHPAELQ # YFTPEDWLPTKLIFYLIANAFSVPPRASVRGTPFFLLTRMNGETVTLPVGYRIPLLFLARFQWLSLKLVLTASSRETEWNEYKFSILHVSRLCTALLD # AAQEYVRVSSEEGISKGMDRKWRCATFDRALARYRLKWFISGPEQVEEFYQTVGEDEYSKDAVKFEQFLVGLKQKNVDWYWDTEDHPILNGIDAWSLR # ALASSVSPSASELPSTYSQTPPGSKPVEPVTVATTAVESVPTGNTPSSVRSLAYIASDFKLTNSIVSSSSSSPFSSQEHKNVSNSNFVPVPNSNGPVG # NSRPSHSTNKQIPSRQPTSSAPVKTNSSQKITSRKRPGSPLEKEMKTASKRVTSKDKTPSSTSTLANGKRAKGALGEKLSRCGSHSINGESGNNDSAS # SCPPDSIKTSIPSTTPNKSNNMTVDEPSPRVIIPRISGHQGSHQNGTTNGGVDITSDNAVPVPPPSSPACSSSQNVFLPPTPMTASSSSSLSYPLPGP # SGYPFVPYSSLLTHSSASPPIPILISIPTQIPLASDDPPPPDTTLPSKAPPASENLSSSTVIQIIDSIFSSFADSLSRFSDEIKQAKAEGVAEIREHL # TSTILGDGNKSESALVRDPDLEDAVRNIVQANVRDIVGNAVENVVQKNLQDMVTNEIQTVLQQEPSPAFLNTLTKDIQTMKDDILAATQIEVRDGVRI # LVATIRTEVVGSSNDVRIKGETVSRNGRQKRRAPAAQRDHTMNRRPVDMMDVDKDAYKVVSLHRIEHPLQHLLGEPAENKEDGLTEGLSNPDEYDEDH # EEAGLNADPHIREDMDDLYGGGGDSGQGVGGRVFSRTSLNRHDNKNGNECGNESPARVADDGLPFKSRRKFGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g3 ### # start gene g4 4_related_000144F AUGUSTUS gene 38201 38608 0.77 + . g4 4_related_000144F AUGUSTUS transcript 38201 38608 0.77 + . g4.t1 4_related_000144F AUGUSTUS start_codon 38201 38203 . + 0 transcript_id "g4.t1"; gene_id "g4"; 4_related_000144F AUGUSTUS CDS 38201 38608 0.77 + 0 transcript_id "g4.t1"; gene_id "g4"; 4_related_000144F AUGUSTUS stop_codon 38606 38608 . + 0 transcript_id "g4.t1"; gene_id "g4"; # protein sequence = [MRVSGLVVHGGFIGGYGFMGGYLGGAGHCGPKKGLGRLETRLGRLGTMLRSLWAMQFGARHDTVQVPGPSTEPPTPEN # REQPSVTPGDKANTLIRLCQEGGVELIYSPMAKAIPFEGEVKGSENICEWTYKDITC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g4 ### # start gene g5 4_related_000144F AUGUSTUS gene 41902 43772 0.38 + . g5 4_related_000144F AUGUSTUS transcript 41902 43772 0.38 + . g5.t1 4_related_000144F AUGUSTUS start_codon 41902 41904 . + 0 transcript_id "g5.t1"; gene_id "g5"; 4_related_000144F AUGUSTUS CDS 41902 41917 0.49 + 0 transcript_id "g5.t1"; gene_id "g5"; 4_related_000144F AUGUSTUS CDS 42922 43772 0.64 + 2 transcript_id "g5.t1"; gene_id "g5"; 4_related_000144F AUGUSTUS stop_codon 43770 43772 . + 0 transcript_id "g5.t1"; gene_id "g5"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIQPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDEVNRRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g5 ### # start gene g6 4_related_000144F AUGUSTUS gene 43829 44889 0.8 + . g6 4_related_000144F AUGUSTUS transcript 43829 44889 0.8 + . g6.t1 4_related_000144F AUGUSTUS start_codon 43829 43831 . + 0 transcript_id "g6.t1"; gene_id "g6"; 4_related_000144F AUGUSTUS CDS 43829 43995 0.83 + 0 transcript_id "g6.t1"; gene_id "g6"; 4_related_000144F AUGUSTUS CDS 44088 44889 0.97 + 1 transcript_id "g6.t1"; gene_id "g6"; 4_related_000144F AUGUSTUS stop_codon 44887 44889 . + 0 transcript_id "g6.t1"; gene_id "g6"; # protein sequence = [MITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKGHINLPFAADVPKTDRNYLQVL # KPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFE # RNTTPKSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKV # MDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g6 ### # start gene g7 4_related_000144F AUGUSTUS gene 44919 46962 0.43 + . g7 4_related_000144F AUGUSTUS transcript 44919 46962 0.43 + . g7.t1 4_related_000144F AUGUSTUS start_codon 44919 44921 . + 0 transcript_id "g7.t1"; gene_id "g7"; 4_related_000144F AUGUSTUS CDS 44919 46350 0.98 + 0 transcript_id "g7.t1"; gene_id "g7"; 4_related_000144F AUGUSTUS CDS 46424 46962 0.44 + 2 transcript_id "g7.t1"; gene_id "g7"; 4_related_000144F AUGUSTUS stop_codon 46960 46962 . + 0 transcript_id "g7.t1"; gene_id "g7"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKP # KPIRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRIVRYEILKEELNHSKDLNRVLRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g7 ### # start gene g8 4_related_000144F AUGUSTUS gene 47428 48012 0.2 + . g8 4_related_000144F AUGUSTUS transcript 47428 48012 0.2 + . g8.t1 4_related_000144F AUGUSTUS start_codon 47428 47430 . + 0 transcript_id "g8.t1"; gene_id "g8"; 4_related_000144F AUGUSTUS CDS 47428 48012 0.2 + 0 transcript_id "g8.t1"; gene_id "g8"; 4_related_000144F AUGUSTUS stop_codon 48010 48012 . + 0 transcript_id "g8.t1"; gene_id "g8"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY # ILRDEIPHVTFLTLMMYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g8 ### # start gene g9 4_related_000144F AUGUSTUS gene 48228 49118 0.62 + . g9 4_related_000144F AUGUSTUS transcript 48228 49118 0.62 + . g9.t1 4_related_000144F AUGUSTUS start_codon 48228 48230 . + 0 transcript_id "g9.t1"; gene_id "g9"; 4_related_000144F AUGUSTUS CDS 48228 49118 0.62 + 0 transcript_id "g9.t1"; gene_id "g9"; 4_related_000144F AUGUSTUS stop_codon 49116 49118 . + 0 transcript_id "g9.t1"; gene_id "g9"; # protein sequence = [MPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNTC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g9 ### # start gene g10 4_related_000144F AUGUSTUS gene 49299 50228 0.29 + . g10 4_related_000144F AUGUSTUS transcript 49299 50228 0.29 + . g10.t1 4_related_000144F AUGUSTUS start_codon 49299 49301 . + 0 transcript_id "g10.t1"; gene_id "g10"; 4_related_000144F AUGUSTUS CDS 49299 49543 0.29 + 0 transcript_id "g10.t1"; gene_id "g10"; 4_related_000144F AUGUSTUS CDS 49853 50228 0.91 + 1 transcript_id "g10.t1"; gene_id "g10"; 4_related_000144F AUGUSTUS stop_codon 50226 50228 . + 0 transcript_id "g10.t1"; gene_id "g10"; # protein sequence = [MSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYK # DVECLVREKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDISKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPP # NRILTRDELIGYRAQALSKHNSFMRKYDVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g10 ### # # ----- prediction on sequence number 2 (length = 4962813, name = 5) ----- # # Predicted genes for sequence number 2 on both strands # start gene g11 5 AUGUSTUS gene 37214 39051 0.39 + . g11 5 AUGUSTUS transcript 37214 39051 0.39 + . g11.t1 5 AUGUSTUS start_codon 37214 37216 . + 0 transcript_id "g11.t1"; gene_id "g11"; 5 AUGUSTUS CDS 37214 37375 0.39 + 0 transcript_id "g11.t1"; gene_id "g11"; 5 AUGUSTUS CDS 37452 38019 0.91 + 0 transcript_id "g11.t1"; gene_id "g11"; 5 AUGUSTUS CDS 38072 39051 1 + 2 transcript_id "g11.t1"; gene_id "g11"; 5 AUGUSTUS stop_codon 39049 39051 . + 0 transcript_id "g11.t1"; gene_id "g11"; # protein sequence = [MASTSSSDVLILALGVALAALYLFRDSLFAASKPKVAPSTTRSLDDTDGNPRDFNKRLAIFYGSQTGTAEEYAIRLAK # EAKAKFGLTSLVCDPEEYDFETLDTVPEDCAVFFVMATYGEGEPTDNAVQLMQNLQDESFEFSKGAHDLSGLKYVVFGLGNKTYEHYNVISQYVDTAL # EKMGAIRMGIRGEGDDDKSMEEDYLEWKDGMWEAFATAMGVEEGQGGDTADFAVRELESHPEEKVYLGELSARALTKTKGIHDAKNPYPAPLTVAREL # FQDTKDRNCVHVELNIEGSGITYQHGDHVGVWPSNSELEVDRLLLALGLYDKKDKVINIDSLDPALAKVPFPVPTTYATVLRHYIDISALAGRQMLGT # FAKFAPNPEAEAAIKELNTNKEVYHEIVANGCLKAGEVLQLAAGNDIQAIPTPENTTAWPIPFDMIVSSIPRLQPRYYSISSSPKLHPNSIHVTCVVL # KYQSTPNERVPERSVYGVGSNFLLNLKYAANGEEAPLLGSTGVAGAVVPSYAIEGPRGAYKQENIYKAPIHVRRSTFRLPTNPKSPVIMVGPGTVSFC # L] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g11 ### # start gene g12 5 AUGUSTUS gene 48421 49794 0.4 - . g12 5 AUGUSTUS transcript 48421 49794 0.4 - . g12.t1 5 AUGUSTUS stop_codon 48421 48423 . - 0 transcript_id "g12.t1"; gene_id "g12"; 5 AUGUSTUS CDS 48421 49457 0.97 - 2 transcript_id "g12.t1"; gene_id "g12"; 5 AUGUSTUS CDS 49499 49721 0.6 - 0 transcript_id "g12.t1"; gene_id "g12"; 5 AUGUSTUS CDS 49771 49794 0.42 - 0 transcript_id "g12.t1"; gene_id "g12"; 5 AUGUSTUS start_codon 49792 49794 . - 0 transcript_id "g12.t1"; gene_id "g12"; # protein sequence = [MELETTKCGFEYSRSGNPNRDALERALASVESGGAHALAFASGSATTATMIQSLGPGAHVISVNDVYGGTFRYMARVS # DFWSSDTQGVETTFLNLEDLAEGSEGHLTLLNALRPNTKLIWVESPTNPTLRLIDISRLASIFDTHFASSPTSRPLLLVDNTFASPFYTSPLLLGADI # VLHSLTKYVNGHSDVVMGALILPPQHTIVLERLRFLQNAIGAVPSPYDCWLAQRGLKTLHLRMKAHGENALKAARALEQSPFVEEVIYPGYVPLKRGG # NDKAVERAKRRYEIAKLNLSPHARRWIENNPSPAYTSPSTNSDFEPTHPPFPYSGMISFRLRVPSLSTTPAQLASLSSELLSSLHLFTLAESLGGVES # LCELPALMTHASIPQEERENLGITEGLIRLSVGVEEGDDLVDDLRRGLEITFGKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g12 ### # start gene g13 5 AUGUSTUS gene 78019 78213 0.81 - . g13 5 AUGUSTUS transcript 78019 78213 0.81 - . g13.t1 5 AUGUSTUS stop_codon 78019 78021 . - 0 transcript_id "g13.t1"; gene_id "g13"; 5 AUGUSTUS CDS 78019 78213 0.81 - 0 transcript_id "g13.t1"; gene_id "g13"; 5 AUGUSTUS start_codon 78211 78213 . - 0 transcript_id "g13.t1"; gene_id "g13"; # protein sequence = [MTSAVKDPINEENPNLSPTSPAEDSDTTPLYPTSEPEPIPGLHGVPVRCKFCSLTSAIQSKSDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g13 ### # start gene g14 5 AUGUSTUS gene 85266 85828 0.73 - . g14 5 AUGUSTUS transcript 85266 85828 0.73 - . g14.t1 5 AUGUSTUS stop_codon 85266 85268 . - 0 transcript_id "g14.t1"; gene_id "g14"; 5 AUGUSTUS CDS 85266 85705 0.86 - 2 transcript_id "g14.t1"; gene_id "g14"; 5 AUGUSTUS CDS 85762 85828 0.73 - 0 transcript_id "g14.t1"; gene_id "g14"; 5 AUGUSTUS start_codon 85826 85828 . - 0 transcript_id "g14.t1"; gene_id "g14"; # protein sequence = [MQEEEDDDDIEDEKILNMNGDDEDVWDEDSAYLEMLASEVRHLPVNSRSIPHLSQGARLRAKSEKLASGEDADDDSDE # EEIEEELGYISPLDDVNPYTAFKQSLTGKLIVCPRLGRFSSYSNIFSLPVFQMRNPAGYQAATTALNVDEQTLLMEIMRIADQPTPLAAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g14 ### # start gene g15 5 AUGUSTUS gene 86597 87136 0.43 - . g15 5 AUGUSTUS transcript 86597 87136 0.43 - . g15.t1 5 AUGUSTUS stop_codon 86597 86599 . - 0 transcript_id "g15.t1"; gene_id "g15"; 5 AUGUSTUS CDS 86597 87136 0.43 - 0 transcript_id "g15.t1"; gene_id "g15"; 5 AUGUSTUS start_codon 87134 87136 . - 0 transcript_id "g15.t1"; gene_id "g15"; # protein sequence = [MLIEPQCESYLRLARESNNQETLDSNPNDLESIMADADDDKTYAAMGVAKTIWTVRERLTSCMKLVANTQPDLPLRFL # KIDIQIVTSVDSSPEILAQIQEIIIPIIVYTLEAKLLGQWFPFAVITLFQYTFYHPDLFDNVYDLIDSLTFKTRSVSPNMWPVFELTYKLFKNDAVDF # LEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g15 ### # start gene g16 5 AUGUSTUS gene 87571 89056 0.32 - . g16 5 AUGUSTUS transcript 87571 89056 0.32 - . g16.t1 5 AUGUSTUS stop_codon 87571 87573 . - 0 transcript_id "g16.t1"; gene_id "g16"; 5 AUGUSTUS CDS 87571 87862 0.32 - 1 transcript_id "g16.t1"; gene_id "g16"; 5 AUGUSTUS CDS 88531 88704 0.96 - 1 transcript_id "g16.t1"; gene_id "g16"; 5 AUGUSTUS CDS 88926 89056 0.95 - 0 transcript_id "g16.t1"; gene_id "g16"; 5 AUGUSTUS start_codon 89054 89056 . - 0 transcript_id "g16.t1"; gene_id "g16"; # protein sequence = [MVAHDFPDRWPGLLDEIKRLLGSGNIREVHAGCVAALEAVRAFSTHQQSAESLVPWGQLLFNVVNLAIPKEAVPEDEE # EREQSEWWIAKKWAYATLGRLFHSHPSSNSSPQQRFGALNMTAALGPWIMKHPEVATNMEQFIQQFVTPEFASPEPYLRGIVSAQPLIHFRVNKPPLS # CLFVCDRLAKLLVPLPNMGWNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g16 ### # start gene g17 5 AUGUSTUS gene 102014 102637 0.72 - . g17 5 AUGUSTUS transcript 102014 102637 0.72 - . g17.t1 5 AUGUSTUS stop_codon 102014 102016 . - 0 transcript_id "g17.t1"; gene_id "g17"; 5 AUGUSTUS CDS 102014 102637 0.72 - 0 transcript_id "g17.t1"; gene_id "g17"; 5 AUGUSTUS start_codon 102635 102637 . - 0 transcript_id "g17.t1"; gene_id "g17"; # protein sequence = [MTFLFRYIVFPQDLTYGYYSLHKKHGDPKKPLDWAIVEATSINSDGHIVPGASVGASPEILQSAEKIIIEVNTRIPNL # EGLHDINSSFLPPHRQPYLITHPSDRIGSTAIPIDPDRVVAIIESDKPDNTGLNAPENDESRAIAKHLIEFLEKEVKEGRLPKSLLPLQSGIGNVANS # IIGGLAEGPFDNVQVWTEVLQGKLLLHCAFN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g17 ### # start gene g18 5 AUGUSTUS gene 108920 110887 0.51 - . g18 5 AUGUSTUS transcript 108920 110887 0.51 - . g18.t1 5 AUGUSTUS stop_codon 108920 108922 . - 0 transcript_id "g18.t1"; gene_id "g18"; 5 AUGUSTUS CDS 108920 110887 0.51 - 0 transcript_id "g18.t1"; gene_id "g18"; 5 AUGUSTUS start_codon 110885 110887 . - 0 transcript_id "g18.t1"; gene_id "g18"; # protein sequence = [MGRPPKVSLFGFSLPLYGSLTSLPSCFQVVKDEVWVVATEGNPVGIDRRQDEGGLPPPAPVSGSDASSSAHRALMQQI # QNFRQTPQGQKFSSNLREGVTKRSPVKSADTPNNAATGDPSQLSRRQDLSKLPMSFYSGPSKKKPSAQSLEWTRIQIANPGWQKDMDESGGDWEKFLQ # TKTGKDVAAENYPALVTFVKQALKQHTNPNNPRSHQSSSEGTTPTSAAGASATSAPGSGASSSSSTLNRRSGSSASGSSSSSIAGSSPNESPMGSPTS # STGPGFGATGSGATSSTGTTSSGTSDALGSTSGSAASASPSGAATTTSAGYSSAHKQLKEQHREEWKKFKEANPTIKEDLKSAKGNVQAFLQTPSGQA # LAKENKAFQKFVETHVVEHHKKHGQNHHHQSASSQQPASPDGSSSASSSPSSPASANGANSAPVGRSVLAARMGFGGGHGWSPSALPGNPHHGGHRHH # IRSVPGEAGDASGTPSQTSALPIQSSSSTPNGPGMGAVNGAPSPFSGTPSSGALSGPSTFGLPPSAPPNGNGQGGLPQSHRHGGFQSFDQSGVPRPSI # DVLHHLGGIRLEHLTPPGTNLFGSSPRPPPHDNTGSVPGTPPNPASGASSPPPSGATSQGMPGAPTRRALQRVRRSTPYGDFGADLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g18 ### # start gene g19 5 AUGUSTUS gene 111047 111709 0.52 - . g19 5 AUGUSTUS transcript 111047 111709 0.52 - . g19.t1 5 AUGUSTUS stop_codon 111047 111049 . - 0 transcript_id "g19.t1"; gene_id "g19"; 5 AUGUSTUS CDS 111047 111709 0.52 - 0 transcript_id "g19.t1"; gene_id "g19"; 5 AUGUSTUS start_codon 111707 111709 . - 0 transcript_id "g19.t1"; gene_id "g19"; # protein sequence = [MVHSHTVLTAVIAVGVATSALAAPINPVPSRPTTVTTVTGAHPQNVPTRPHTISRQVTSDPQLPPVVPGKSLNAREFD # VIVEEDSHPHHPHPHHHHEGFEVEVEEHHGEEFKLDFEEEHRYPHHPHHYHHHGGEDFEVDVEFDEHHPHHPHPHHHHGEDFEVDVELEEHRPHRHHG # EETFEIEVEEHHHHHHHHHHHGGEHFEHKHHAVSPINIYESISV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g19 ### # start gene g20 5 AUGUSTUS gene 115227 116522 0.75 + . g20 5 AUGUSTUS transcript 115227 116522 0.75 + . g20.t1 5 AUGUSTUS start_codon 115227 115229 . + 0 transcript_id "g20.t1"; gene_id "g20"; 5 AUGUSTUS CDS 115227 116522 0.75 + 0 transcript_id "g20.t1"; gene_id "g20"; 5 AUGUSTUS stop_codon 116520 116522 . + 0 transcript_id "g20.t1"; gene_id "g20"; # protein sequence = [MRLIPSSRLLVCLYRLYTVPIQLGPTLTSVHLDTGSSDLWVTTDACTTASCGKLTTPSYPMTSFNASGSSVTMNYGDS # TTGTKASGPIGFDSATLAGIAIQGQTFAAVNFTTNTVVQDGAAGIFGLGFPAGSDIQAAVVEAQSGPLKPTDDFVQDTYKYGPLLARIAATNALEDDV # FSISLQRSEIDVGIDNGTLTIGKLPDGVDNSSLTWVPVRLYSPSEGGLSPPTFASAEVSLVPDFLLAAFSFRFVRCILCMFKLKDFFRCKLVIMLVMI # FTAVGKLKSTMSIWTAKFSQIRLSLLPVEWTIPEFLPSLTLYVHVLLFHFLSDFCLDVQGNSLIRGPSDVVNSILTTVSPNFNPASTNSLPVLDCTAA # HTLAFQIGGKMFPVDPRDFISDTKATNTKTCEADNVVATDPPGVGALFRWSLGDPFLKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g20 ### # start gene g21 5 AUGUSTUS gene 122979 124184 1 + . g21 5 AUGUSTUS transcript 122979 124184 1 + . g21.t1 5 AUGUSTUS start_codon 122979 122981 . + 0 transcript_id "g21.t1"; gene_id "g21"; 5 AUGUSTUS CDS 122979 124184 1 + 0 transcript_id "g21.t1"; gene_id "g21"; 5 AUGUSTUS stop_codon 124182 124184 . + 0 transcript_id "g21.t1"; gene_id "g21"; # protein sequence = [MSSHAGSARSLRKKTSSSSIGTEASISKKGQAQGDTASLSSRTSRKRAGLGFGQHPERSPSDGNYSPQTPSRSATSSL # RRLAVPPSSFIPKGIHNSNLEPPREKGRTQDIFDDANLVTSTDIKREIAAVEAEGRRLVDAFNGLEVTTLAKRQRRHMGHHRVESRPATIVGLPGDGP # LSIEIGTEEDSGGKGSSGVGVGSTWTLIPDNKLHFRATPTQTPTSAYLDTDVTSIRSGTSAHTSHTGRSIPRSIHRDASRTLPSKPSSGSASGSGAGS # LHRKNSSSSLGSSIAAGKKRGGGLSPVPPLPISVPPLPSGLSGLSNLALASGSSLNLTRSTGHLPMSSVPEDEDIDLLGLNGREEMDEEIREIQKKKD # DVSKRYAERLEYLRAKLKGAQLHEKLMKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g21 ### # start gene g22 5 AUGUSTUS gene 128496 129773 0.75 + . g22 5 AUGUSTUS transcript 128496 129773 0.75 + . g22.t1 5 AUGUSTUS start_codon 128496 128498 . + 0 transcript_id "g22.t1"; gene_id "g22"; 5 AUGUSTUS CDS 128496 129773 0.75 + 0 transcript_id "g22.t1"; gene_id "g22"; 5 AUGUSTUS stop_codon 129771 129773 . + 0 transcript_id "g22.t1"; gene_id "g22"; # protein sequence = [MVNLLVYSGPEVLPAALRTTLSHLARILLPNYTIQPISVPVLLNQPWTANCQVLIFPALKTITGSAGIVAGIPPRLNG # AINDFLEGGGNILCLNAAGRITRGLRGRGLGGIGGMGAVAQHLHGSSGSNASDLESEDFAFVDRTTGLTISPISLPESSQKKDPSTRRIRGEGGPSGG # EPVEGIVEGNMPQFEFESSGGAGLTNKMEILAESMEQDGSHIAALRCQIGSGFVTFWAPNLENLSEEGSSAPTNLSSSSSSSQLILLRYVLSRIGLKP # PHPTAGHVSRPLPQLLLSTPDKPGLVEAVVRGLLGSVPGAGSVKFQDTNDTFEFHGYDEGLAILRQMRKQGHIESADDGHPHKPSNISHIAICPNGIV # PSVEDTPLFDLRTYFNLLKEARTREECRRDVSGFGETLIYGQVIGSTQTLFDK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g22 ### # start gene g23 5 AUGUSTUS gene 131385 132374 0.76 - . g23 5 AUGUSTUS transcript 131385 132374 0.76 - . g23.t1 5 AUGUSTUS stop_codon 131385 131387 . - 0 transcript_id "g23.t1"; gene_id "g23"; 5 AUGUSTUS CDS 131385 132374 0.76 - 0 transcript_id "g23.t1"; gene_id "g23"; 5 AUGUSTUS start_codon 132372 132374 . - 0 transcript_id "g23.t1"; gene_id "g23"; # protein sequence = [MKFPFIALVWTSALFLALHVEARPHPRHVGLTSTLLLNGIGYQPHGDGEVSISIESFAHLGEPKSMSPLTHLLNETLH # KLHVDVDHIGDHMATAVERLRLFAAVGIPLDKLELTIIGCEKKTVSLPRTGFTNLGIVQASVAVGKCPSALLTAKTHNSETATIYSSPPTGLGVISDI # DDTIKITDVLDPDKMIENTMYKDPVPVAGMPVLYASLAKSLTTQSIPPQFIYLSGSPFELFPFLSSFLKSQFSASLGPLLLQSLSITNPAEIFKSLGD # GKSGQGKIDYKVGQIKRINGYYPQKSFLTIGDSGEKDPEVYGKASVYLLPPSTDY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g23 ### # start gene g24 5 AUGUSTUS gene 133350 134200 0.45 + . g24 5 AUGUSTUS transcript 133350 134200 0.45 + . g24.t1 5 AUGUSTUS start_codon 133350 133352 . + 0 transcript_id "g24.t1"; gene_id "g24"; 5 AUGUSTUS CDS 133350 133485 0.49 + 0 transcript_id "g24.t1"; gene_id "g24"; 5 AUGUSTUS CDS 133542 134200 0.76 + 2 transcript_id "g24.t1"; gene_id "g24"; 5 AUGUSTUS stop_codon 134198 134200 . + 0 transcript_id "g24.t1"; gene_id "g24"; # protein sequence = [MLHKVTSSIYQTLFIFILLSDGIATIMALPLLPVSWSALQLERRVDREKNSALHFKIGRIVPDSDGKTCTWILSSSPS # RLFGEESLAFCIGGKDCFAVWPTTKAALLPLSAFKVNVPIYPSGWINYDKLSSLGGKVYFKSSYPKYNHLPEKSTTLELLEDINEIAKQTKFSITDDI # SYVSASLALLKNKGVLDDPDQMQKDWDEYKGQVEQDRKKQHEKGQHEKEQHEKEQHEKEQHEKEQHEKEQEAKAARQGNMGLNFILHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g24 ### # start gene g25 5 AUGUSTUS gene 134964 137096 0.86 + . g25 5 AUGUSTUS transcript 134964 137096 0.86 + . g25.t1 5 AUGUSTUS start_codon 134964 134966 . + 0 transcript_id "g25.t1"; gene_id "g25"; 5 AUGUSTUS CDS 134964 137096 0.86 + 0 transcript_id "g25.t1"; gene_id "g25"; 5 AUGUSTUS stop_codon 137094 137096 . + 0 transcript_id "g25.t1"; gene_id "g25"; # protein sequence = [MSANLNIPSPASEPDEPGFGEQPSSLSSTPTPSSHVHRSISQSGSQAFSNQFWSAADTPSHHYQGTSYFSAPRSPSSS # RQAPPPPILMRSSSAHSTHSMRRGVRSTSVSSTARGGFRDDEAFSEADEYEGDDGEGTRKQRRGGGGSKAVSVDDEPHEDSDEQPLSEQDSTGKSDDE # PDPITLKERQSLINVEHPFGLPIWKPALYKKSRSVTRYADEALHSVPSAQAERHLLPGNLLWVIIFGWWLALVCWIVSVFLYIVPKGGKRYANLVFGL # GWYIAWPFGKYVEGVADDLDQEDNEENEHDDEPDADATPVTNEDSDAHERRSSGSSNTVRGVSAEIRHHPNPSWIPTEHTSLISTTSAPLPAKSYGAL # SATPSSSTSSIGLSKQAAAPDDHFLAKAAFWTSFVCIIAPLMLVVCLICWFFVFTIPMAKLTWALIKHIFEQPQTIRFCAAPLTVVVDTIPASSPELD # QLHEQAHASSESAPAPDSRLSVKHTIKPTRLTKGQRAPSGSPCTAVLLCTYRALGLKYYKYTVGGVNIMFVNLLAVVFFAIFDWAVLLAWVEELEEHG # RVVPSFLAAVANQGVIFVLSLLSVIPLSYFIGMAVASISAQSSIGMGAVINATFGSIIEILLYSIALSSGKGRLVEGSIVGSLLAGVLLMPGMSMMSS # ALRRKEVKFNAKSAGVTSMMLIMAIVGALTPTLFYQVYGTVSAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g25 ### # start gene g26 5 AUGUSTUS gene 143492 144088 1 + . g26 5 AUGUSTUS transcript 143492 144088 1 + . g26.t1 5 AUGUSTUS start_codon 143492 143494 . + 0 transcript_id "g26.t1"; gene_id "g26"; 5 AUGUSTUS CDS 143492 144088 1 + 0 transcript_id "g26.t1"; gene_id "g26"; 5 AUGUSTUS stop_codon 144086 144088 . + 0 transcript_id "g26.t1"; gene_id "g26"; # protein sequence = [MSFARFALWLASTSLVLAQSASNSTIATSSTAATDIGSLSTSLLSTLSISFPLSTIPSSTASILSSIASTETATVLSS # SVSGSAASTSTANVSISSISGSATSSLSASATSVSITTAATTSSATSEPLTESRVTVPISSYTFSSFPVPSETAIPNVFPVTDPMDPPPVGAAVVPDF # EAAWAAAYQKAEALVSIAILRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g26 ### # start gene g27 5 AUGUSTUS gene 150173 157408 0.76 + . g27 5 AUGUSTUS transcript 150173 157408 0.76 + . g27.t1 5 AUGUSTUS start_codon 150173 150175 . + 0 transcript_id "g27.t1"; gene_id "g27"; 5 AUGUSTUS CDS 150173 157408 0.76 + 0 transcript_id "g27.t1"; gene_id "g27"; 5 AUGUSTUS stop_codon 157406 157408 . + 0 transcript_id "g27.t1"; gene_id "g27"; # protein sequence = [MDSFQVALNSQSMLVPHWVLPENVVACESDFQKLSLRLFPHHLQSLKKDVAVAELIQSLIEFSHRLFEVTDYVCSSLY # SVVHNTCISLFGADIPEVLYYNYHKYNGASERVDDVIAHGDVLSTACNVFEQLSTEDLKSLKSSLRITERHHKSGQIFCCLPKYGQPQLKSVHLFKLI # ARCFQRDYLYFYEMADDYLADSYLYYYHIPCSQLLSIREVVCCVLTCLGYSLDALKNIVKLTAAMDVEYSPQKKYNEQRKDARRKSRIQRGNEEYDLL # HKSSEFWPQLVPFAVSMSCIAKYRQSIQYIVPSICACCGSEDRKFTGCYLPQSQWPVMSFLTVEDPFILSHTPQARFTYICQDLDGLLLDPRGIHALD # FDCTVFEMYLCHECLVSMHRSIMPRLALKNHLYRGELPEDLQNVTWVEEMACSIYRTSAHVTRIFGSSSECDPFQLHGNTCAHPLNICYTARRLPWSP # ADLNDLISIIFVGPKKLAKEDLQKLTPFFVRRSVIRMLLLYLQKHNRLYIELPPIDEQVLAMYPDNNLLPGLQDRFIYDHDTSVADVFGIESDGFDDH # PADLLSHQSEVLLERSGVYDSESQDVPARFMTASSIHNIAQALPSTGFGTSDFIIRYGKDPIDEYNNPDLFPGMFPTLYPLGIGGFEDHRQCPAISFE # AHVQHLLDQSLRNFRYHHFFSFVALNVIQRRKAHLHTSLSISSNKYHYIASELLAVTPNILSNLANKLKNESDNSSFTEDEQHAFRLLKEVNIIAAKI # PGSQASKTKIRQEIRSYFAYFGLPHLFVTLNPSAVHSPVFQVMYGDQNVNLSQRFPAVVQPRSERAYRVAHDPVAAADFFDFMYHVIFQDLFGWDFKN # GKSTQQGGLFGHLRAFYGCAELTERGCFHGHYLLFLRGGLNPSEVHKKMHHIEEYQKQFFSFFEDIIHHHLPGTDYNCAPQYESRSEMPPDVPELDSE # SDVSSELLSAWQKLFTDEHKKIGEQLQRHRCRPVCHKGKSANSDCRFGYPHDVVEHSSFDSNHNSIILSRKESDVNGHNPFLLVYTRHNHDVKCILSG # KAAKAAMFYISDYITKVPLNTEALLSTLSKAVASITSEDIDKTPVMNAKRLLHRCLTHFGRKQQIHSQQCARYLRGLTDSMSSHSTIPLPSASLMMFV # QNEYRHLLDKYLDQDCSENLDIQVHFSFREGKLVHCNQVIDYWYRDLSLSDMCFYDFIKYISLQTQSKTKTVHNSDTRTGVLRRHKLLSGHPLQSTHE # LIQHTNFKQGDVGREFVPMMIGAVPPRRTDKLYALFVLAHFKEFSILNPLISSNDVDGEFHSFQLHTDHQQILNNWEEIHECADQRDAERLRKKASEL # AKSSQLVTGMESVLDDDEYADYNFVLPKGVKNIESKVFSDMQQMQLLKTDLCSAAWLSSPPSALRLSIKKSAVVSPMLPLLTIQKVDKWIKEGKSEAE # RLANIRYKHSNISNQSSSDIHNSDAEVPQFSVSYSFQGIDNSLNPTSKVLTASQLKDKIANEFSLNNKQQFAFDIIASFMIFREIFKLPEWCAKEPMV # MLLTGPGGTGKTHIVQAVQKVMEYYRMDHGYRALAPTGNAASLINGRTIHSGLKIRVREHKNGKSHRPLGELNENIVVSASVKKNNNLRIEWKDVCLL # LIDEISMVDSILLAEVDASLRYAKEKPNDFFGGINVIFCGDPFQYPPVGTPLYAPIRSVSIQTDEEMMRRLGRIAWKSINTVIELDEQKRMQDDPEYA # AAVGRLRTRECVQSDVELFNTRAIRTLSNPQGVMFTTEQQYMASIIVSKNSVRQALNDFKTTAICGGQEGPELIDVVAHDQLQYKKHTNANLNGKKVY # PSLAQQQQLLAMDTSSGKLKDGLPGILKLYIGMPIIMKHENLNTELGVNNGSRGFLRKLDLSVDNNGFTYCKYALVEFPDSKVHLPGLPLHFFPVKAR # SWKCSTFIFNENGEKILISVTRTQLPFEPLFALTGQGAQGHTLGAILCMLHLGGFGAYVAASRPRSRDGLFITRKVTLDDLNKPGIPYDLWFETQRFH # VMAHNTMVIWGFCKGELKEVPDAECEKRGNFSKIQYQFGDDRHDMQHNMSLNTESDHINEDQLIDGPRKNECSFQSQLPYSAQFGPLWDHVNWSCAFD # SAFVVLYNCFVSMTLQNQLIWQNQSRSKHIFTLFSSLSQIHADFTNQSLWNDMRNQWRDILFKEHGSTCERYGPVLLSVSTLLEWHVPLYHAVLTTFC # SSHQTLHQHKSYIRCSNLIFPHSKPLVSQNNINMSVQCYVDSFNDFTDDSITSCVTHCNPSCHSIASITNDISQVIIFELNGVTTIVPSLELIVPFHN # TDIQLKYKLSGIIYFGSSHFTVRIFNESGIWKYDGQVNNGHYQHDYVISDIDLMELSGRHAHVLLYTFLSSHTNVNANM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g27 ### # start gene g28 5 AUGUSTUS gene 161816 163363 0.1 + . g28 5 AUGUSTUS transcript 161816 163363 0.1 + . g28.t1 5 AUGUSTUS start_codon 161816 161818 . + 0 transcript_id "g28.t1"; gene_id "g28"; 5 AUGUSTUS CDS 161816 162004 0.52 + 0 transcript_id "g28.t1"; gene_id "g28"; 5 AUGUSTUS CDS 162077 162119 0.41 + 0 transcript_id "g28.t1"; gene_id "g28"; 5 AUGUSTUS CDS 162216 162340 0.44 + 2 transcript_id "g28.t1"; gene_id "g28"; 5 AUGUSTUS CDS 162501 162543 0.32 + 0 transcript_id "g28.t1"; gene_id "g28"; 5 AUGUSTUS CDS 162614 162661 0.97 + 2 transcript_id "g28.t1"; gene_id "g28"; 5 AUGUSTUS CDS 162717 163363 1 + 2 transcript_id "g28.t1"; gene_id "g28"; 5 AUGUSTUS stop_codon 163361 163363 . + 0 transcript_id "g28.t1"; gene_id "g28"; # protein sequence = [MIAENAKILDPLSSFMQYYKDVFMVSPIPTPSNVSLQRVSALSEYGGLWMVNESREVVRIGLVVRQKSHCIHIIMIKK # IYNAHKTRFNDVLNLLQHCATQYIDQASATDGKIYVALDCFHSSMSTIRGNLPDPQKERNLNALKTSASIDAVDIWHRQLGHWPDSEGYIHDLAEKHD # LSNVKFHIPSIYDAQGSLVHPMDYENVLVPGCFVMVELDFHLLVYHIPSNALFDEINNIPRWDITKSTDGKAINRPSRIFSNMINCLHVLSDDVDDLG # LLLHTEALNRANKIKQDIEHKRQAEEAREIAKREEVMRIQQTMTRAKALSDMKKKRLEELRGQSTLDSMKQGKILSENTLCVFIEKKFRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g28 ### # start gene g29 5 AUGUSTUS gene 171041 171745 0.96 - . g29 5 AUGUSTUS transcript 171041 171745 0.96 - . g29.t1 5 AUGUSTUS stop_codon 171041 171043 . - 0 transcript_id "g29.t1"; gene_id "g29"; 5 AUGUSTUS CDS 171041 171745 0.96 - 0 transcript_id "g29.t1"; gene_id "g29"; 5 AUGUSTUS start_codon 171743 171745 . - 0 transcript_id "g29.t1"; gene_id "g29"; # protein sequence = [MFYLRENISHVPDLELSWYKEFNIQQSNSVQIKGSSNANAQEEASQSFWEQDELSRTAGLLLETVKTKKNPKFQNSIF # LNLMTQLCNQKVAVRGNEMMENNGTGTAGQDSRVDVKGKGKEKASDLLFIPYAGWVTMLGQTIGNNATMAGISPYNEQNDIQEDVNNAYFRQENKDHT # RYCNGMDAQKSQRQTVEVSYTNDGCQLEAYEATREWVWRNNDHRDILHSIRMRYAIPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g29 ### # start gene g30 5 AUGUSTUS gene 178848 179726 0.7 - . g30 5 AUGUSTUS transcript 178848 179726 0.7 - . g30.t1 5 AUGUSTUS stop_codon 178848 178850 . - 0 transcript_id "g30.t1"; gene_id "g30"; 5 AUGUSTUS CDS 178848 179081 0.8 - 0 transcript_id "g30.t1"; gene_id "g30"; 5 AUGUSTUS CDS 179136 179726 0.76 - 0 transcript_id "g30.t1"; gene_id "g30"; 5 AUGUSTUS start_codon 179724 179726 . - 0 transcript_id "g30.t1"; gene_id "g30"; # protein sequence = [MIHNFNLAGVDDSSIGDSLIMLACSNPSLQILQLSLHSNSAFQGVFDNPVFSFPMLHSFSYTSPNGSIHIHKFLRRHE # QLRSFTYKVDEYAMSESSDIMDFVMLPNLSTFTGSPSSAYVICNSHFCMTDNLCLEIEDDQDPYLEKLLEILNHLQAVRKLILNIKRECATDIIYKFL # NACPFLTFIGCKVVPLSNITEDSFFQMKFLYQALFESSPGMKSVKFWIQQLNDDIVEHNYLLLHKKAFDSIPALLKSTVDVDIQIHTGVVTSELSNYF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g30 ### # start gene g31 5 AUGUSTUS gene 189509 190054 0.35 + . g31 5 AUGUSTUS transcript 189509 190054 0.35 + . g31.t1 5 AUGUSTUS start_codon 189509 189511 . + 0 transcript_id "g31.t1"; gene_id "g31"; 5 AUGUSTUS CDS 189509 190054 0.35 + 0 transcript_id "g31.t1"; gene_id "g31"; 5 AUGUSTUS stop_codon 190052 190054 . + 0 transcript_id "g31.t1"; gene_id "g31"; # protein sequence = [MREARTAYHEGRTKYHGAGTGLILNSLVMTHFLRTLTVLVHASENTPEWLGFLAPDSLELALTLGTKLISIADSSTED # TGIAEKGTKEASVLASALELALIVLDGCIQLDGGRSLGLDQATLLMSVSEWASVVFSRLEDGIKLKDGGGEQGANLRRAASGVILKADEIISKYRRPE # HLFTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g31 ### # start gene g32 5 AUGUSTUS gene 191893 192360 0.89 + . g32 5 AUGUSTUS transcript 191893 192360 0.89 + . g32.t1 5 AUGUSTUS start_codon 191893 191895 . + 0 transcript_id "g32.t1"; gene_id "g32"; 5 AUGUSTUS CDS 191893 192360 0.89 + 0 transcript_id "g32.t1"; gene_id "g32"; 5 AUGUSTUS stop_codon 192358 192360 . + 0 transcript_id "g32.t1"; gene_id "g32"; # protein sequence = [MSTAVPPALHKPPSVPQPPRQPSPQLAYNPFAPAIVPPPPPRPPGSFVLDERARMAAAIAAKLGAIQPPQPTESAPPP # VEEQLKRFATYNDFTLLFTDTIYLIADPTLMDLPLVSWPSGGAKKDKGCALMDLALSMPSQLNRSKEARVLEPLATG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g32 ### # start gene g33 5 AUGUSTUS gene 194020 195237 0.93 - . g33 5 AUGUSTUS transcript 194020 195237 0.93 - . g33.t1 5 AUGUSTUS stop_codon 194020 194022 . - 0 transcript_id "g33.t1"; gene_id "g33"; 5 AUGUSTUS CDS 194020 195237 0.93 - 0 transcript_id "g33.t1"; gene_id "g33"; 5 AUGUSTUS start_codon 195235 195237 . - 0 transcript_id "g33.t1"; gene_id "g33"; # protein sequence = [MIGVGGNNGTTLCATILANRHNIVWHTKQGIRQPNYIGSLLRASTVRIGTEASTGKDVHVPVSDVLPMVHPNDLVLGG # WDISRVPLEKAMQRAQVLDYDLQRQVAPHMALLGKPLPSIYYPDFIAANQEMRADNLISGQDKQVHLEHICADIRKFKKNNGLDRTVVFWTANTERYS # DIIPGVNDTAENLLSSIKSSHPEVSPSTLFAVAAILEDEPFINGAPQNTFVPGVIALAELHKCFIGGDDLKSGETKLKSVLAEFLVNAGIKPLSISSY # NHLGNNDGRNLSAEKQFRSKEISKSSVVDDMVDANRVLYKAPEVGEKGVPVGKGEHPDHIVVIKYVPAVGDSKRAIDEYYSEIFCGGRNTISIFNECE # VYFTSCSTFTELTPVDIGLPPRYPIHSRPYHSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g33 ### # start gene g34 5 AUGUSTUS gene 200226 200669 0.15 + . g34 5 AUGUSTUS transcript 200226 200669 0.15 + . g34.t1 5 AUGUSTUS start_codon 200226 200228 . + 0 transcript_id "g34.t1"; gene_id "g34"; 5 AUGUSTUS CDS 200226 200669 0.15 + 0 transcript_id "g34.t1"; gene_id "g34"; 5 AUGUSTUS stop_codon 200667 200669 . + 0 transcript_id "g34.t1"; gene_id "g34"; # protein sequence = [MFLLLMKVSGKSNCIVITNDKGCLMKEEIEGMVSEADKYKAENEAAAWIAAKNGLESYPYNLRHPLTDKNLADNFSPE # DKAKLTTHVDKTIKWLDESLDALKEDHKQKQKELEAIANPIMRKLYGAAGGPDVGGFPGAGVEEGPSVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g34 ### # start gene g35 5 AUGUSTUS gene 201165 201977 0.49 + . g35 5 AUGUSTUS transcript 201165 201977 0.49 + . g35.t1 5 AUGUSTUS start_codon 201165 201167 . + 0 transcript_id "g35.t1"; gene_id "g35"; 5 AUGUSTUS CDS 201165 201977 0.49 + 0 transcript_id "g35.t1"; gene_id "g35"; 5 AUGUSTUS stop_codon 201975 201977 . + 0 transcript_id "g35.t1"; gene_id "g35"; # protein sequence = [MEAITLNRPSQLPKLYFTLESTANQDRLSMEFLTKTLSITCEVNRKTHRRACEKILRRIRVHKLLLLFKPWQALLDQF # HTVFSPTLEELHIHAEYLPENLYDVEEDNSDDMTVGNNFPSSVQRLHVIFELTEGASRIAGRIDFAHLRNLTHIWLTFDDSDAQSPGDDFRVTEVLPL # PDIGDWINHYCPDDLQVLILEKDGGVESPLEDEEYRKYVDLPLVCLVNDGSIDLKYLADEEKPYAEQLTFDAEGFTAEQIWEHSLAMVAQKNSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g35 ### # start gene g36 5 AUGUSTUS gene 203081 203689 0.65 + . g36 5 AUGUSTUS transcript 203081 203689 0.65 + . g36.t1 5 AUGUSTUS start_codon 203081 203083 . + 0 transcript_id "g36.t1"; gene_id "g36"; 5 AUGUSTUS CDS 203081 203689 0.65 + 0 transcript_id "g36.t1"; gene_id "g36"; 5 AUGUSTUS stop_codon 203687 203689 . + 0 transcript_id "g36.t1"; gene_id "g36"; # protein sequence = [MTPTRRAYHDVGGAQGPMAIQHWYEVTPEFGNLLSSVFKQEWPDKWEEAMKRFKAGKWQAANPGPWVGKAIVYKLTSS # IHLDEEDAEECPTVTVPVGHFVGGHIQFLDIHARLQYSPGHIVIGLTSILFHRVEDWTIAAPSMEQLEEWKQWRLTPGRIGIVSFFPRNSYNLLNNKE # ALWGADTQYGRREGLLPKSKRRKIIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g36 ### # start gene g37 5 AUGUSTUS gene 204449 205405 0.94 + . g37 5 AUGUSTUS transcript 204449 205405 0.94 + . g37.t1 5 AUGUSTUS start_codon 204449 204451 . + 0 transcript_id "g37.t1"; gene_id "g37"; 5 AUGUSTUS CDS 204449 205405 0.94 + 0 transcript_id "g37.t1"; gene_id "g37"; 5 AUGUSTUS stop_codon 205403 205405 . + 0 transcript_id "g37.t1"; gene_id "g37"; # protein sequence = [MLIEPPPGESNPGVRERLVIEPAKPVGLITEGNGEETDRENKDINEGKKELVLRQVNEGKEEEERDVMVPKKDDRIAG # VDGWKFKARNSLMFPPDADCAPYHPKPQALVSVLSGEEKFISYGSTRLSEQEVSTDANKSLSEPPTPTTNRIIAAITGTPCSCIMKAYMSLLTKKCRS # SQRPFIIGVIFSSPISVLADTQTTWSSSCKTSHDLGNIECDTTNYIFFRRSNSRHSDSKDSIQPPCSVFVRNSFTQTHWAKAELCGPWGHDTWHKIFI # ASIKDINSHLDSDCCTSKGAFGLVRCVSVDVTISKFLTQRATLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g37 ### # start gene g38 5 AUGUSTUS gene 209164 209679 0.87 + . g38 5 AUGUSTUS transcript 209164 209679 0.87 + . g38.t1 5 AUGUSTUS start_codon 209164 209166 . + 0 transcript_id "g38.t1"; gene_id "g38"; 5 AUGUSTUS CDS 209164 209679 0.87 + 0 transcript_id "g38.t1"; gene_id "g38"; 5 AUGUSTUS stop_codon 209677 209679 . + 0 transcript_id "g38.t1"; gene_id "g38"; # protein sequence = [MPLVSHEDSIFGRNGAEDNEFELPEDITPFLEGKDLENDLTADGIALWWAPEPYSRRSGHMRRAQDIPLVKNWYLEHC # PPNTAVKVHVSYQKLLKCYVLNELRTRPEKAMAKKNLFHQLKATKFFQTTKLDWVEAGLQVCRQGYNMLNLLIHRKNLNYLHLDYNMNLKPVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g38 ### # start gene g39 5 AUGUSTUS gene 214914 215402 0.87 - . g39 5 AUGUSTUS transcript 214914 215402 0.87 - . g39.t1 5 AUGUSTUS stop_codon 214914 214916 . - 0 transcript_id "g39.t1"; gene_id "g39"; 5 AUGUSTUS CDS 214914 215402 0.87 - 0 transcript_id "g39.t1"; gene_id "g39"; 5 AUGUSTUS start_codon 215400 215402 . - 0 transcript_id "g39.t1"; gene_id "g39"; # protein sequence = [MWRKPTTTTGKIELEYSVGLDTTSRSPPPEPEPKPVSQVKKGEEVLAESEDTSVAPMHSRSQPKMPAGSGVAFYRNAH # LSTELGLKSSVSLFATNELEVPSNTSLEHSQSILIAQDLHPNAVSTANTQPSPSSSSTVNSSPVTSSPSTSQYGIAVWSAFIDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g39 ### # start gene g40 5 AUGUSTUS gene 215972 216301 0.86 - . g40 5 AUGUSTUS transcript 215972 216301 0.86 - . g40.t1 5 AUGUSTUS stop_codon 215972 215974 . - 0 transcript_id "g40.t1"; gene_id "g40"; 5 AUGUSTUS CDS 215972 216301 0.86 - 0 transcript_id "g40.t1"; gene_id "g40"; 5 AUGUSTUS start_codon 216299 216301 . - 0 transcript_id "g40.t1"; gene_id "g40"; # protein sequence = [MSFATPPPSALDHVESLTDLKVVDYSDLAEFMGVPEKIEEEQSKDLQVTHSETVSPSKSRRPVGSDFFDEESPSFIVS # STSTGRSDAGAWETNNEVPAVISVVDEKCSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g40 ### # start gene g41 5 AUGUSTUS gene 217238 217810 0.96 - . g41 5 AUGUSTUS transcript 217238 217810 0.96 - . g41.t1 5 AUGUSTUS stop_codon 217238 217240 . - 0 transcript_id "g41.t1"; gene_id "g41"; 5 AUGUSTUS CDS 217238 217810 0.96 - 0 transcript_id "g41.t1"; gene_id "g41"; 5 AUGUSTUS start_codon 217808 217810 . - 0 transcript_id "g41.t1"; gene_id "g41"; # protein sequence = [MEEDDDHFLDGVIEFGDGRQYKADTTEGPMPSACPPEVNTREPTTSSEEHPEAVRKEDRFADNFDRSWPRTKDVSTLT # SDFAHLPASRAPHNISPSTSQSAHSPVEASRVLFNERSNRLEPYNNSRELGRSTQRSDSGFVRSPASATFNVSSNNIQLLRKLAPGEGSYRVWGYNDT # NEKQREHEIPRREM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g41 ### # start gene g42 5 AUGUSTUS gene 225483 226548 0.84 + . g42 5 AUGUSTUS transcript 225483 226548 0.84 + . g42.t1 5 AUGUSTUS start_codon 225483 225485 . + 0 transcript_id "g42.t1"; gene_id "g42"; 5 AUGUSTUS CDS 225483 226071 0.85 + 0 transcript_id "g42.t1"; gene_id "g42"; 5 AUGUSTUS CDS 226181 226548 0.9 + 2 transcript_id "g42.t1"; gene_id "g42"; 5 AUGUSTUS stop_codon 226546 226548 . + 0 transcript_id "g42.t1"; gene_id "g42"; # protein sequence = [MSSSDFSHHFRPNIDDRQSHGSTDDSDDGSGSDTDTESNVGDSKSGNGLEHTDTEIIGDVSASGAGYSGSQSSLMSVP # SQLIPDTMDEVLAKPNDGKNDEEGKDGTGKLRGSLELSGHEEYEAQCISIDEDRDTNSDTETERGIGHGCAYTSFPTVSSISPTSSTSGLSSSSQSSS # SFVGSSANNHPHLTFLLTTRPNWRLLTYIYPENANRKQTFTLPSLFVYDMARISPTSSTSDLSSSSQSSSSFESDNPPPAPPAISSVAGPTTTTHPKQ # PPAPPSPQTGLPDIPVLWSERDAAAELPKNHNLISITQRYVSYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g42 ### # start gene g43 5 AUGUSTUS gene 230345 230755 0.82 + . g43 5 AUGUSTUS transcript 230345 230755 0.82 + . g43.t1 5 AUGUSTUS start_codon 230345 230347 . + 0 transcript_id "g43.t1"; gene_id "g43"; 5 AUGUSTUS CDS 230345 230755 0.82 + 0 transcript_id "g43.t1"; gene_id "g43"; 5 AUGUSTUS stop_codon 230753 230755 . + 0 transcript_id "g43.t1"; gene_id "g43"; # protein sequence = [MIRPSTHTLTPSIFVDGGEDYSRMTLSPSSYSDSLSFSLLSLIPDFIDLPLIRVPPPLILPETPLRERRGFEAFITIT # PRADVHGKTSAKGQLEPTAGGLPRRRRIVKSINLKGSVVNHASDFDSDSDSYDSEDDM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g43 ### # start gene g44 5 AUGUSTUS gene 233037 237467 0.97 + . g44 5 AUGUSTUS transcript 233037 237467 0.97 + . g44.t1 5 AUGUSTUS start_codon 233037 233039 . + 0 transcript_id "g44.t1"; gene_id "g44"; 5 AUGUSTUS CDS 233037 237467 0.97 + 0 transcript_id "g44.t1"; gene_id "g44"; 5 AUGUSTUS stop_codon 237465 237467 . + 0 transcript_id "g44.t1"; gene_id "g44"; # protein sequence = [MSFGNSPNIPRLPEEKQLAGEENWRPYKREILFAVQSKGLTGYIDGTIPRPNVYPGPIYPSTQPPTPLFSPTPCLEEW # ESRDRLVAGAIVSNITDPVGLGVDETKRASEIWLTLIKRFEKRDEQRIHLADTNLRQEKYDPSEDTMEDHEKRMRNLLKKVHDLGGAATDAQFRRIII # SSMPPEWRQDVRSVPGTSSADAFSYLHTLWYEKEEERKEAERDTKRVKALMATHTQAQRPQPRGSSKPPITCHNCSKPGHIAKKCWAKGGGMEGQWPK # QGQADKRTGTSANQADTDKTDTSSPMATYVMSAEATNKPSRSPHVQKPKLTADPAIRQDYPILKGAGQRDAGMEDVDRDLDSSTTVAKDKCLACRGNT # SLYSLPVPTTRTFIDSGASEHCWVRKADFVEYTEVYGQGGSSAISGEAGRFRILGVGTVQITTRIGESERVIQLQGVKHTPAFSHNLISLSTLDARGM # QGEWGQGILTVKAANGETILEGYGRDKMYEVEVLELGKITVNYSRARDRPIDILTWHRRLGHVAIRRILRMANRKLVDGLHITNREIRGMCEDCLYGK # ATKHPFDEVLTHESEVLERVHIDLFGPSRTQTRGGASYLMLCTDGRSSFRVPNYLTNKRKETGLKALHEYRVMAENQTGKTLRTIRIDGGGELNNSLV # DAYCAEHGITIEKVPHDSSAANGVAERSFRTVMEGTRTLLEDAGLPYSFWGEASSTFIYTNNFVPSSRFPDTIPVEAWTRKRQDVSHLRPFGCECWAT # LPRRRTDGKLGRQAVKGRLLGYMGRRGYRIWIPETKKVEESHDVTFEEGIPHRTRKPETNDEVDNEEISQGPAPSEPIGPTSDPINSANRDICDTQPR # ETHEPAHPPEDTHRDIPQRQPIPEPSRRSERGHIPSRRLIDSEEYEEREREAQQRGEEWSTNLPVAGGHLTLIAQTPFSFAATTGDLWVPQSFKQAMK # RADLWKEPMNREFDTLMEKGCWELVTLPPNANLTGGRWTYAIKFDSSGNLLKRKARYVAQGYTQVQGQDYDKTYGGVARMESVRIVLAIIAVLKLLIF # QVDFTAAFLNSPITHDVYMKQPEGFITPGTEHLVCKLKKSIYGTMQGSHDWQETLAKGYHADGYTTSRADPCIRYKRTGGEYTITSTYGDDVCGGSSS # TKGRDRAVSDLGKRWEANEVTTEVLLGMTIRQDPQTKTVTISQKAYFQRMLTHFGLENVRRRSTPLQPNIKLHESPDPLPEEDRAFMEHRPYRAVVGS # ILWGQVCTRPDLAFAGSLLARYQLNPGPTHWECVEWVAGYIRDTLDFSITYRAPTTPTPGPGSGLKPYAYVDSDHAGCRDTYRSTSGYVFFMAGAPVS # WSSKRQATVALSTTESEYIGLSRATQQAVWLSSFLSEVDLAQPGPVSMLGDNFGSICLTENSKRHALVKHIEMRHHYVREKVTSGEVAIQRIRSGENV # ADIFTKALNGPTHSKLLLLLGLHRTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g44 ### # start gene g45 5 AUGUSTUS gene 240202 240588 0.91 + . g45 5 AUGUSTUS transcript 240202 240588 0.91 + . g45.t1 5 AUGUSTUS start_codon 240202 240204 . + 0 transcript_id "g45.t1"; gene_id "g45"; 5 AUGUSTUS CDS 240202 240588 0.91 + 0 transcript_id "g45.t1"; gene_id "g45"; 5 AUGUSTUS stop_codon 240586 240588 . + 0 transcript_id "g45.t1"; gene_id "g45"; # protein sequence = [MLWTVFEESSEDGDDHYDRPPPGDLESYYDLASQQSHTQEMVELTSSGSQDVNSKKEATEKQVVEAMVVPAEDEFEEE # DHQQEDIEANSQQQSSNFPDGGSRAWLVVLGVCGSHSSSFHCPNLTIVFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g45 ### # start gene g46 5 AUGUSTUS gene 244626 245390 0.83 + . g46 5 AUGUSTUS transcript 244626 245390 0.83 + . g46.t1 5 AUGUSTUS start_codon 244626 244628 . + 0 transcript_id "g46.t1"; gene_id "g46"; 5 AUGUSTUS CDS 244626 245390 0.83 + 0 transcript_id "g46.t1"; gene_id "g46"; 5 AUGUSTUS stop_codon 245388 245390 . + 0 transcript_id "g46.t1"; gene_id "g46"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPARGRSTARIDSPILQAIARRMGKQPQRRAASESPRDPPPHFDL # DAGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRP # SDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g46 ### # start gene g47 5 AUGUSTUS gene 245894 247033 0.75 + . g47 5 AUGUSTUS transcript 245894 247033 0.75 + . g47.t1 5 AUGUSTUS start_codon 245894 245896 . + 0 transcript_id "g47.t1"; gene_id "g47"; 5 AUGUSTUS CDS 245894 247033 0.75 + 0 transcript_id "g47.t1"; gene_id "g47"; 5 AUGUSTUS stop_codon 247031 247033 . + 0 transcript_id "g47.t1"; gene_id "g47"; # protein sequence = [MATQQPLTRFSGDPDDPVQPATFLQDFEVRMTELMTPRADLAGRIKPYLERDSRAWEWYTEDLTATDRTGTWEAFEAK # FHARFPSQKKEKKLAKSYLTSLEGERITHELIMKTSEDTNQPYHQWWADRLLHLAKGAEVEKTKQSIGTVWKHLPYALKKVIDEEHDNWAEFTSAIKA # VKWSVLKVEAEHEASKAVPMVVPETPRTKLASSFATARISAPPSPSPIRMKPAYTTSTGNRKPRRTFTALDEGRKGVLRRGIAAKAQHPNTPEGLAAW # KTELLEWASRYGVDGALSEVTIVPLKPGTEAVCSGECFRCGGPRHGFEIPCPRPGTIPAVESDWRAYCQRELGGRTPRVNAVQVLGPEAIFEGMVESG # NGEGSAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g47 ### # start gene g48 5 AUGUSTUS gene 247315 251793 0.36 + . g48 5 AUGUSTUS transcript 247315 251793 0.36 + . g48.t1 5 AUGUSTUS start_codon 247315 247317 . + 0 transcript_id "g48.t1"; gene_id "g48"; 5 AUGUSTUS CDS 247315 251793 0.36 + 0 transcript_id "g48.t1"; gene_id "g48"; 5 AUGUSTUS stop_codon 251791 251793 . + 0 transcript_id "g48.t1"; gene_id "g48"; # protein sequence = [MANGSVVPGMARWKGRISVKGVETDGGFEVFDSGGSWRFLFGKPLLERFSAVHDYQKDAIVFREGREKWQEVFNKGLG # VALTPNSTTVLEERGQQEAPSSSAQADDVLKDREGPSGGVIVQALTPLSREVADLSHVQKEYATNETSQCLPQASPRRRCQKPQIEEVQDEDQGDRNP # QRERYQDSLESDFNAIEEEWMVTESELEEWFRAERQRRRNETVKLQNKLELRQRERQAALEREEVQRETEWKEWLRKRRAEPGLRKWFFWRNRLRKPH # PPPKLSVDTSGGSSASPSREVPVEHASGDEHNIDPIITEPRSCPEMRPPTEVTPKKAGVTLEGVEETAVEEKAGTLPEGPRVDSVGGFVPPSRGVSID # NPGVNIQSADRENTVPIQMLQRETLVESDPLGPDFFPDALDQSDNVNLFTRNDGEQGAFQPERVREILRKVKIGPQLSVNQRAQVEQLLSEYADCFAL # SVGEVRPVKNAIHKLNIPEGATFPKKVRQKSLTPPQREYLHAKVDELLEAGVIERCNPEDVKCVSPLTLAQKAHEGAGLTVEELMHKLNDECVAAGLP # ASFDLPTRPVKPPSPTERPELTRPAKWRICQNFMAVNKLTEIAPMPQGNIQSKQQSLSGHNYICLFDFASGFYACEMEKESRPYTAFYVEGKGYFWCA # KLPFGLTGAPSTFANMTALHLDDLIADGTIELFVDDGGSADDDFESMLRKLTRILNRVRERNLSLSAAKSEFFMSEGIFAGGKISKEGVTVDPAKLTA # IVEWKQPADALNLASFVGLTGHFRDLIRNYARIEGPLRNLIKSVPLPQHYTKSTYRRAMESFKLDGKWTLDHTKAFLALKKALVTEPVLKAPRWDGSS # FIITTDGCKEGFAAVVAQRFEVVHPNGTTTYKMHPVGFASKRTSASEQNYKPFLLEFAALKFGLDKFSDMIWGFPVEIETDCQALRDVIANDKLKAAH # CRWRDGVLAHHIVDVRHIPGKLNVVADGMSRMWEGQDRVVGDGSEWTVSEDWEAVTGLVNDVFGVDVSGETLRNEELTDWKAMSERFQNEPVFTEVVE # ALRVLESSASDKVKQKASHKAARYMVDGNRLWKVGGNEGIRDRARVECVTRREAVALAKTQHGEAGHWGRDSVKLALMDRIWSPKLDESIMEAITGCP # ECKNFGSTHLHALLNPITRRHPFELLVGDYLSMSKGKGGYKTIGLYLDTYSQRVWAFKFKVAGSGATTTTSLDSLFGGYLPPEMFMTDNGTHFANKEV # AALCAKWGTKQHFTPAYSPWVNGLVEGTNKILLHVLKRLCAPKLGEDSEEFMSMNWETLPDKWPEYLDEAVRIINNRILPSVRFSPNELLLGAVVNTR # RTPVAEAASVLPIQDVAVQAAYVAQQQLDGYNAFVNHALKRKSASDCKVLKKGGKEVVFRKGDLVQVYRSDLDYTFKTIKKIIPKWSRPYRIVERDVN # SYTLETTGDNSSRGSSLQHEGYGSSSRDWERSLPWSSRRSSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g48 ### # start gene g49 5 AUGUSTUS gene 252127 252645 0.55 + . g49 5 AUGUSTUS transcript 252127 252645 0.55 + . g49.t1 5 AUGUSTUS start_codon 252127 252129 . + 0 transcript_id "g49.t1"; gene_id "g49"; 5 AUGUSTUS CDS 252127 252645 0.55 + 0 transcript_id "g49.t1"; gene_id "g49"; 5 AUGUSTUS stop_codon 252643 252645 . + 0 transcript_id "g49.t1"; gene_id "g49"; # protein sequence = [MKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKCEETRKREA # GKPFVARNPKKGSSDFKTGSANQHNNSQPSGSTAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERSVKFMPNH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g49 ### # start gene g50 5 AUGUSTUS gene 254229 256442 0.86 - . g50 5 AUGUSTUS transcript 254229 256442 0.86 - . g50.t1 5 AUGUSTUS stop_codon 254229 254231 . - 0 transcript_id "g50.t1"; gene_id "g50"; 5 AUGUSTUS CDS 254229 256442 0.86 - 0 transcript_id "g50.t1"; gene_id "g50"; 5 AUGUSTUS start_codon 256440 256442 . - 0 transcript_id "g50.t1"; gene_id "g50"; # protein sequence = [MVDCGATALFLNQDFATRNHVTCAPLHKPINVFNIDGTPNRAGQITHFARLALTVDNQERWMDFLITNLGGEDIILGL # PWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLNEGSQREPNHTKADLEENEIITATEESPIHRIRANHKTRRAWVKAG # ILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEE # NLRKGYIVPSKSPISSPVFFVKKKDGKLHFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDIRWGYNNVRIKKGHEWKGAFATTRGLFEPK # VMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAA # VRDWPVPTNLRELRGFLGFANFYRRFIQNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQ # DDGQWHPVAFRLASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQAD # ALSHMAVHHVSDSDDNQQQTVLKPGHFTKIAASILWNPLEDRIRKASEREAQVLEGLETVKKHGLQRLANG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g50 ### # start gene g51 5 AUGUSTUS gene 256628 257785 0.95 - . g51 5 AUGUSTUS transcript 256628 257785 0.95 - . g51.t1 5 AUGUSTUS stop_codon 256628 256630 . - 0 transcript_id "g51.t1"; gene_id "g51"; 5 AUGUSTUS CDS 256628 257785 0.95 - 0 transcript_id "g51.t1"; gene_id "g51"; 5 AUGUSTUS start_codon 257783 257785 . - 0 transcript_id "g51.t1"; gene_id "g51"; # protein sequence = [MLTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKQAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPCRQQISATAAPFTLFPNESVQIAASIPTPVAGPATPSPANQDFSTQIGQIRELLDRAN # AMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g51 ### # start gene g52 5 AUGUSTUS gene 260760 261587 1 - . g52 5 AUGUSTUS transcript 260760 261587 1 - . g52.t1 5 AUGUSTUS stop_codon 260760 260762 . - 0 transcript_id "g52.t1"; gene_id "g52"; 5 AUGUSTUS CDS 260760 261587 1 - 0 transcript_id "g52.t1"; gene_id "g52"; 5 AUGUSTUS start_codon 261585 261587 . - 0 transcript_id "g52.t1"; gene_id "g52"; # protein sequence = [MELHYTSGYHPEADGQTKRVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPE # VDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADGKRISHPEFPISSEVFVLAKHIRSTCPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRQ # IHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYKGTNNEFSWVATDELHTDELVPAFHARYPHKPG # P] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g52 ### # start gene g53 5 AUGUSTUS gene 261761 264310 0.97 - . g53 5 AUGUSTUS transcript 261761 264310 0.97 - . g53.t1 5 AUGUSTUS stop_codon 261761 261763 . - 0 transcript_id "g53.t1"; gene_id "g53"; 5 AUGUSTUS CDS 261761 264310 0.97 - 0 transcript_id "g53.t1"; gene_id "g53"; 5 AUGUSTUS start_codon 264308 264310 . - 0 transcript_id "g53.t1"; gene_id "g53"; # protein sequence = [MANITVRFPSSELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHFDSPQTSVPSAINPVVAKVAV # PLPELSPLVSPTILETPPGDSLRSCSRTSRAKPLSSKFPFEPIYSYPTVSQFAAQLEIPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAARAAD # RSSIAPTVPPLPPSIPAEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGCIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKK # DGKLRLCVNFRGLNRITKKDRYPLPLISDLLDTPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTHYGSYEWKVMPFGLMNAPAAFQRFVNDIFSDM # LDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRHHRLYTNPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPGKVKDIQSFLGFANFYRR # FIYNYSDIVVPMTRLTRKGAPWIWDSSCQEALENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTH # NKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIHFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNF # RPIFTNEQLTASLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHSDLRLQVLRYFHDHPL # SGHFSQNRTLEAVRRQYTWPKVRDFIRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g53 ### # start gene g54 5 AUGUSTUS gene 264643 266299 0.42 - . g54 5 AUGUSTUS transcript 264643 266299 0.42 - . g54.t1 5 AUGUSTUS stop_codon 264643 264645 . - 0 transcript_id "g54.t1"; gene_id "g54"; 5 AUGUSTUS CDS 264643 265937 0.69 - 2 transcript_id "g54.t1"; gene_id "g54"; 5 AUGUSTUS CDS 266041 266299 0.6 - 0 transcript_id "g54.t1"; gene_id "g54"; 5 AUGUSTUS start_codon 266297 266299 . - 0 transcript_id "g54.t1"; gene_id "g54"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFTESISAIGQLRRHNRGFGPATIPTTSTLPEGMEEEQQSEYSTLFTSDGQP # VQVLTPRRESPRDPPPHFDLDTGDHNDQDPPVDPDDPGADNNLDDLDDDSGGLPRDPSGPGGPGGPGGPGGPGGPRSPNTPDIPNEQCAMLDLLSGFK # GSIETLGTVLAALSRPPDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDHPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSF # TALVKELQDNFGIYDAQGKAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSATLKWAYGRGLAECIKDEMARLPKPATLAAYRLEVLRIDNRYWKR # EETKKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEWERRMKN # NLCLFCGGKHQIADCNKRKARESKGHAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g54 ### # start gene g55 5 AUGUSTUS gene 267577 268962 0.88 - . g55 5 AUGUSTUS transcript 267577 268962 0.88 - . g55.t1 5 AUGUSTUS stop_codon 267577 267579 . - 0 transcript_id "g55.t1"; gene_id "g55"; 5 AUGUSTUS CDS 267577 268962 0.88 - 0 transcript_id "g55.t1"; gene_id "g55"; 5 AUGUSTUS start_codon 268960 268962 . - 0 transcript_id "g55.t1"; gene_id "g55"; # protein sequence = [MQDTMLIQMSSRFTKIYFITADTEESIQACLFDIAIDNGLMNPQDWRNGIHWLNTHEENWLIIMDNADNPKLPLRRYL # PSCEHGNIIITSRNAELQNAVSQSLELWDMSPSEGLQLLVKHAVKGPLNKVQHKHAAQIAKELHYFPLALVQAGAYILQQNCLLTYSSRLRSQRRQLM # ERKLTQFRDKYQLSVYATWNLSWNMLSEKSQKLLEICSHLHHEKIPRQLFEKAITRINNAFLPLGPSKAVDEARALLKNFVQHDMQWDDIHFDEIVFE # ATFYSLLQIHSDELYTIHPLVYQWLVDSLHQRQIQGTQGILAVAVQNATWKDYQFLQHLSPHCKALGYLGHSNYFIKLAIGGMWELLGNYTQALQLWK # PLLCVMRKSLGHRHKDTLGHIENVVRVYMELRMYHEASELQRSLYERAVLGGESQYHAWNRRPGEPTIHLALQSGPVGGARHTSGETVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g55 ### # start gene g56 5 AUGUSTUS gene 274605 275246 1 - . g56 5 AUGUSTUS transcript 274605 275246 1 - . g56.t1 5 AUGUSTUS stop_codon 274605 274607 . - 0 transcript_id "g56.t1"; gene_id "g56"; 5 AUGUSTUS CDS 274605 275246 1 - 0 transcript_id "g56.t1"; gene_id "g56"; 5 AUGUSTUS start_codon 275244 275246 . - 0 transcript_id "g56.t1"; gene_id "g56"; # protein sequence = [MFSQNARSPRSFFVLFCLWSAVVVLSVFASPLPTGGDSNRPTGSAQVPSPPAPTLSSQNGEIIRSIRFAYRYTVGKHP # VFRFTSVKNVHAFYLGIGDIALSAHPPDISIGPVSKALDTPLVPTKESYTYDDLLVHYYLEDKGTLGMAKFNDEKEEDKFIQEVLKMELPPSKECDSF # EFIERVMDKMAGGRHIDEQTHGNWLAIYHNMQMMGKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g56 ### # start gene g57 5 AUGUSTUS gene 279748 280224 0.62 - . g57 5 AUGUSTUS transcript 279748 280224 0.62 - . g57.t1 5 AUGUSTUS stop_codon 279748 279750 . - 0 transcript_id "g57.t1"; gene_id "g57"; 5 AUGUSTUS CDS 279748 280224 0.62 - 0 transcript_id "g57.t1"; gene_id "g57"; 5 AUGUSTUS start_codon 280222 280224 . - 0 transcript_id "g57.t1"; gene_id "g57"; # protein sequence = [MPGSILRNASAPMVTTLTSLNQPQYQNQAQYNQAQYQTQYQNQAQVQYNQIPKVRTTGSVGAQNVQGFSERNQYGQYP # SDFEPGYGAIGSSANASEGEDTLSGGFDDFDEDDEDEDDVLVRGSDDRKFSFAARINTNNRFLPPSTNTQNQGFQPSHPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g57 ### # start gene g58 5 AUGUSTUS gene 280632 282696 0.57 - . g58 5 AUGUSTUS transcript 280632 282696 0.57 - . g58.t1 5 AUGUSTUS stop_codon 280632 280634 . - 0 transcript_id "g58.t1"; gene_id "g58"; 5 AUGUSTUS CDS 280632 282442 1 - 2 transcript_id "g58.t1"; gene_id "g58"; 5 AUGUSTUS CDS 282525 282696 0.57 - 0 transcript_id "g58.t1"; gene_id "g58"; 5 AUGUSTUS start_codon 282694 282696 . - 0 transcript_id "g58.t1"; gene_id "g58"; # protein sequence = [MPGSGRAGSWTGFGFVAEDDLDEYEDQDIESEVAERKKVNGNSKKANGVGGSNATDTDLSDFSEFSERESEGEGSEVS # DFSEVDSGVDIEFGDSSNSDASSVVVRRSRPRRAPRGGRGKKRKRSPGHGSGVGVGSHSSNQAPEVNLQSNQNNPNSSHPTKSGNHSSSHLAKKKNMP # TRPPMKPLSPDLVSDIAASVTRLDAFLGVLDIAVVQQQQHSPAERNNTNATDQQYEYIQRAQRIHQVQRFAKDVIGQVQTVLELVDDVDVAESVVLDT # PIPHDTTLSQSVDGPLNSLAEEKKKVVISNSNGEGSKDEREGGRTALSSHHSSHSLSTVETTETVDTVDTRMSSVFTHGTGSSFNGFSSSSHTSHTSH # SQNSTPILDDNSHSSFISKHSPSFARTQDVSFTPRTDLSQTLPTARALLRMLEAGVQALYDDAAALWGHVQVLRVEGSDYPYSHSSSSSSNINSSSEF # LSSSSYHSSDGSFSNQTDPAMILSVVNVLSTAIKANAAVVLQILDKLLALGVEQRTIVEGVLEEEDSATSSVGVAGGDMMNTRGTNGVRRWEESVRWS # KRVSRDVDRDVSKRMSHQRSSMVRVRPASILPASVGPDAQGGGGYGGGVPTALQPGYNMLRYGGYEGQTHEVYDEYGRGTSPSILKNFIPNH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g58 ### # start gene g59 5 AUGUSTUS gene 283063 285454 0.83 - . g59 5 AUGUSTUS transcript 283063 285454 0.83 - . g59.t1 5 AUGUSTUS stop_codon 283063 283065 . - 0 transcript_id "g59.t1"; gene_id "g59"; 5 AUGUSTUS CDS 283063 284574 0.83 - 0 transcript_id "g59.t1"; gene_id "g59"; 5 AUGUSTUS CDS 284642 285454 0.83 - 0 transcript_id "g59.t1"; gene_id "g59"; 5 AUGUSTUS start_codon 285452 285454 . - 0 transcript_id "g59.t1"; gene_id "g59"; # protein sequence = [MYHATQQPQQYNNTVTTTTGYFSTTATGYSSASDTDTSYDDHHHTSTSHFISHHQYLPSSSQYASDSEHSEHSSRSFS # SEDPNNYASRSSPSSADDPSPTDSSNLTDFPALFCRAKYDYTAQDASALSFVTGDIIEVLTQQPSGWWDGLLGEERGWFPSNYVIVISEEEAEREWEG # REIMQAGDNQMQMQMTGGQGQSHRHTQSTSSVVDMGQALMGGSSSSTDEWLANTIAESRSMGIDDDQGLGGPSRGRGRGGAESDFWMPQVASNGQIFY # INTKTGEQSRDLPQEAEDDIDLSMTDDAPLALAQSSSSSRAGPGVLGYATSSGPYTDLDPSSAPYASGSSNSQFQSQPGFGLPRRTDTPEPWIRRLAD # DGLSYYYLNQVDGRVQWTRPESLTSRGSGLPETPTTAVPLPLHGRARSDSVNNLTGGGHGVYSDSSDVDVSLADEVDDAKGKGKQRLRGHAHSGSITT # IGTTGTTETAIASGSGHSHLTTSSGGTFTGTLANSNAHNLPLSSTHSPNFSQGPDPSHKQLTPDSSFLRHQPTSISESSDSQQALLLAAQLQSALYPP # PPEDPLDMVHRARDAVERVIVRLNLGGLGILGETSPNQGTSTGSMGGGREENASAMADLDTLIEDVVASVRGLLYVCGAGPSTTGGSVGGSRENGVIT # AGGGGGGLEALVPKIMVGITPTVAFTSISASAASPSESSPLRLHTRTDSRSQSNPLKPSQRKLTATLSRLVLSARAIRYVRLSLSFISPWVSFFVLYL # FHLSFPSFFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g59 ### # start gene g60 5 AUGUSTUS gene 313926 315536 0.99 - . g60 5 AUGUSTUS transcript 313926 315536 0.99 - . g60.t1 5 AUGUSTUS stop_codon 313926 313928 . - 0 transcript_id "g60.t1"; gene_id "g60"; 5 AUGUSTUS CDS 313926 315536 0.99 - 0 transcript_id "g60.t1"; gene_id "g60"; 5 AUGUSTUS start_codon 315534 315536 . - 0 transcript_id "g60.t1"; gene_id "g60"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAVGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSSNSSQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g60 ### # start gene g61 5 AUGUSTUS gene 319798 320600 0.63 - . g61 5 AUGUSTUS transcript 319798 320600 0.63 - . g61.t1 5 AUGUSTUS stop_codon 319798 319800 . - 0 transcript_id "g61.t1"; gene_id "g61"; 5 AUGUSTUS CDS 319798 320187 0.88 - 0 transcript_id "g61.t1"; gene_id "g61"; 5 AUGUSTUS CDS 320241 320600 0.63 - 0 transcript_id "g61.t1"; gene_id "g61"; 5 AUGUSTUS start_codon 320598 320600 . - 0 transcript_id "g61.t1"; gene_id "g61"; # protein sequence = [MRDIKKHRAQRPSQPSAPQQPSRHSPPADTMGRLKLSGAPEPEADPFGRQQPSLPATPPSGYPQAPYYPQQQQQQQPP # LSGPPPGARPPSAGVKAPPAYTQEPQRPQTGPYEQLQPGAYPGTRPPGPPSPVQTKIGLPSSPMQQQRPPDRSSTVLPTAQTPPQQPQIQIQQQQQQR # QPVRQQTQRRKVGLDDFNFLAVLGKGNFGKVMLAEEKKTNGLYAIKVLKKEFIIDNDEVERLANVDALHGSLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g61 ### # start gene g62 5 AUGUSTUS gene 321175 322088 0.43 - . g62 5 AUGUSTUS transcript 321175 322088 0.43 - . g62.t1 5 AUGUSTUS stop_codon 321175 321177 . - 0 transcript_id "g62.t1"; gene_id "g62"; 5 AUGUSTUS CDS 321175 321803 0.93 - 2 transcript_id "g62.t1"; gene_id "g62"; 5 AUGUSTUS CDS 321956 322088 0.47 - 0 transcript_id "g62.t1"; gene_id "g62"; 5 AUGUSTUS start_codon 322086 322088 . - 0 transcript_id "g62.t1"; gene_id "g62"; # protein sequence = [MLHQLEFKLQVEMQYKRGIDKMAKLYQADGDKKSRQDAESKKVENGTGIEGERKENLRAKPLSGILSVTVRGARELDH # APIVTRFRSSKNQVVETSVSLKVEGTQLARSHPSRTDRWNEDFEITVDKANEVEIAVYDKQVGETHAVPIGLLWIRISDLVEALRRQKVFMESGQGGW # VTAGAMHGDAGHPNSADLNAPLSFGAAPPGGFGPQGGMGDGIPQQPSEGIEAWFAVEPAGAILLHLNFGESVANISC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g62 ### # start gene g63 5 AUGUSTUS gene 323934 325568 1 + . g63 5 AUGUSTUS transcript 323934 325568 1 + . g63.t1 5 AUGUSTUS start_codon 323934 323936 . + 0 transcript_id "g63.t1"; gene_id "g63"; 5 AUGUSTUS CDS 323934 325568 1 + 0 transcript_id "g63.t1"; gene_id "g63"; 5 AUGUSTUS stop_codon 325566 325568 . + 0 transcript_id "g63.t1"; gene_id "g63"; # protein sequence = [MTNTDTHDDEELSRDYSAESSYTNDAEPAEFVGYDEGDHTSSIPGRNYDEAFDLFRQGFLDRDWAADDSLATSPTPAV # STTHSDMIFDSDANDSAYDGSKAIVDADDEMVCLSSDPGLPRPHRSLEALANEHCNHLECHTSIFSESEAGNVPSASRAFFASSFVPDVEMDFNMDRD # SDLILDMDDYLDLLPHAAPQAVPRPHHILEYEIDISKHPFSDVLDIDSDVDAGPLCPLHYSGDVLDIDSGSELRDSQKCVDHLLSDDDMKGMDICAAN # GSSSSVSFAPLAHFTASHSESGSDRFKEPPSLDFGSDNSDQEQEHILISFPLIHEAIKNHAIDSEVLGGDILSDNDDDDRPFSGKQNCVSFTTLSSSQ # SSSQTTQSSLASSALHTLLSSQSGPSSSSALPVSPISFYLSQNEHKNGNCNHNDNVNESRCSRTPHGPDSAIKFFNYHKAHTSITFKDSDNVASNTFL # DADMLMSAMDVKFDFDLGADADADALPLHPQLHNSSGLTTIMSQGNKYRAEDNGTIGKSDWELDFAEDILDLEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g63 ### # start gene g64 5 AUGUSTUS gene 336544 337068 0.63 - . g64 5 AUGUSTUS transcript 336544 337068 0.63 - . g64.t1 5 AUGUSTUS stop_codon 336544 336546 . - 0 transcript_id "g64.t1"; gene_id "g64"; 5 AUGUSTUS CDS 336544 337068 0.63 - 0 transcript_id "g64.t1"; gene_id "g64"; 5 AUGUSTUS start_codon 337066 337068 . - 0 transcript_id "g64.t1"; gene_id "g64"; # protein sequence = [MSSDTLILPTPEIFSAFPYTPPYNIQAQLMRHLYEAIENRKVTVIESPTGTGKTSSLLCAGLTWLHDEKNRARKGKLN # NAATGDDWVSTQTRDRLRRQLEAEELEYEQRLADARQKEAQLKSRARVWKKPKPDDKPQQPFIDADASFLPEDDGTPGDDDMNLSPAVKALMARCA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g64 ### # start gene g65 5 AUGUSTUS gene 339382 340611 0.4 - . g65 5 AUGUSTUS transcript 339382 340611 0.4 - . g65.t1 5 AUGUSTUS stop_codon 339382 339384 . - 0 transcript_id "g65.t1"; gene_id "g65"; 5 AUGUSTUS CDS 339382 340611 0.4 - 0 transcript_id "g65.t1"; gene_id "g65"; 5 AUGUSTUS start_codon 340609 340611 . - 0 transcript_id "g65.t1"; gene_id "g65"; # protein sequence = [MGSSKHKHHDKEKSMKKRHHHNEEQSEKHHKRKRTEVRVDDEDMWVEKNIDTDAKVSSDAVMAPPDVPSTSSLKREEW # MLGPSSSSAAESSDFFSSLGIETHRKAKDKQKEKAQEVDRAMEIEKSLEIQDEQSIDPSTASDSAPKRPFTPGGPGSQWRMTRLKRVYETAEEEGRDV # LEVALERFDSAEAWELAQEERRILDERDGRRGRPQDRFEIGDRGGGGEKGFMFSGSSTRSSSFRRPGGSGPSTPSAGGPPVNRRLDSLRLPSQASSPL # QQSHTPIPSVLTPPPSQSSSRRALSPSSLNKLQAKVLRAKLVGAPNAEKLEREYEDAQRVANGFGDASPRTSGKQNVKVEVLPTLDGRGRLYDIGSGS # NGKDEEGDPARAGNRRKKEKVCDNCLIFFLVLNANFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g65 ### # start gene g66 5 AUGUSTUS gene 345794 346447 0.24 - . g66 5 AUGUSTUS transcript 345794 346447 0.24 - . g66.t1 5 AUGUSTUS stop_codon 345794 345796 . - 0 transcript_id "g66.t1"; gene_id "g66"; 5 AUGUSTUS CDS 345794 346200 0.4 - 2 transcript_id "g66.t1"; gene_id "g66"; 5 AUGUSTUS CDS 346366 346447 0.4 - 0 transcript_id "g66.t1"; gene_id "g66"; 5 AUGUSTUS start_codon 346445 346447 . - 0 transcript_id "g66.t1"; gene_id "g66"; # protein sequence = [MTCVAVAASPLLTGHNSQAVERRGPELVDPSVDPGHLSVQGGFESWNPHDFHPVAKEIHLGNAVFRDEHEQWEVIKNM # LYTKDPLKLVVPRLAEGTTQVLQMPIPVKEKGGNCMDFLKRAVEYMAEGHGLDGNAEAKRKFLEAFNARYHDVAKVAFNVDIQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g66 ### # start gene g67 5 AUGUSTUS gene 372869 374482 0.96 + . g67 5 AUGUSTUS transcript 372869 374482 0.96 + . g67.t1 5 AUGUSTUS start_codon 372869 372871 . + 0 transcript_id "g67.t1"; gene_id "g67"; 5 AUGUSTUS CDS 372869 374482 0.96 + 0 transcript_id "g67.t1"; gene_id "g67"; 5 AUGUSTUS stop_codon 374480 374482 . + 0 transcript_id "g67.t1"; gene_id "g67"; # protein sequence = [MVLKAGGLQPLYTLATSATSGAHFAASSDILPTLSNVIAYQFSLTDMDRLPYSVDLITTNTLLEVPNINEGLLQALIL # HLVPGGSIVLKMLITPLYEKDFNSLLEQLMVLNFEPRFVPVVAENVGILEARRPFIVPIIPPEISLPFFELPLIIEYGIGREMILQQHLKTIKEEDLS # PIWIVTSEGPDADAFSGLFRTLIREFPNFNLRGASFSPCYYSSSIRQFIIHKYLPPVGPENEFYIGENLHISVPRIIPMTGLSARTSSQSYLPCSADV # MIEVSASSPFYDGLWGVVGTVTEGHRSSLEGARVVGIALCEPSGGRVSLIDGFFTRSGVDFDSFLLARIAPIAMIVGLAVGINALNDPTHFRARIIVT # HSDTFTGTVAVELLKIFGLAQFIKCLPSLITPITLFNAQIQCEDIVISGLELHNELLESYLPEETQVTYWTTTKHLLTHLRRHSHFAGYMLELLTRSL # SEASLPLQFPDSNLDLKMAQPYDIENTKLENTKLNLDPNKIYLLIGGLGSFGPFAALWMYEVCISYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g67 ### # start gene g68 5 AUGUSTUS gene 375181 376823 0.72 + . g68 5 AUGUSTUS transcript 375181 376823 0.72 + . g68.t1 5 AUGUSTUS start_codon 375181 375183 . + 0 transcript_id "g68.t1"; gene_id "g68"; 5 AUGUSTUS CDS 375181 376232 0.72 + 0 transcript_id "g68.t1"; gene_id "g68"; 5 AUGUSTUS CDS 376286 376823 0.72 + 1 transcript_id "g68.t1"; gene_id "g68"; 5 AUGUSTUS stop_codon 376821 376823 . + 0 transcript_id "g68.t1"; gene_id "g68"; # protein sequence = [MTELCNWIEDGILKLAEKHFDVYVPPYNFDTVSKTIGPSNIYAHLCSLNTLPKESTFQVVDIHDLIRSLVTQFIDIPS # DELSNEVPLTSYGLSSIEAGRLAYGLKPYLVVSQMQLLSDMTVADLIARAQLMETSKQSIHKSDEQPHTRNTEEAAQEMDVLISKYSLGFDPNGLKLS # GPFIHDSVVLITGTTGALGSYILVQLVKSAGVKKIYAFNRPSDALTIRERQHAVFSNHNLDLTLLDAPKLVFIEGDASQIDLGLDPTTYEDLREEITV # IIDNAWQLDLNAPLRNFISNIASTRNLIDLAYSSSRVSSIRYTFISSIASAQNWISETGGHEEVPEEILENSKQAAIAWLPFSFELNLLISQLVSMSS # LQASVYRVGQLCGASESGSWTIKEWIPKLTRTSLSLNAVPNMGGVILNFYEDINAGFDLYYHKQIVSWIPIDKVASIVIEITLDPTSSPPPPVLNIVH # PRPVTWTSIMEIVLKDLLPLKNTGETMKMKPYMEWVGLLEAVDGNGTEMSENYVRSVIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g68 ### # start gene g69 5 AUGUSTUS gene 384689 385756 0.97 - . g69 5 AUGUSTUS transcript 384689 385756 0.97 - . g69.t1 5 AUGUSTUS stop_codon 384689 384691 . - 0 transcript_id "g69.t1"; gene_id "g69"; 5 AUGUSTUS CDS 384689 385756 0.97 - 0 transcript_id "g69.t1"; gene_id "g69"; 5 AUGUSTUS start_codon 385754 385756 . - 0 transcript_id "g69.t1"; gene_id "g69"; # protein sequence = [MILFPRLATSVARTTFTRSARFHTPIRIAALSTKPRSSTIFVRSVASTVSNKPGSQTFDHAALNIREEAGNTAADVAK # SIAGGSSHIPASDHSFVAITSSMASSVPKPVMVFGLLGTIPYVGAGATTVYLASVAGAAAAGHPTSIDPGVALTMLDQSLNIQVTYGAIMLSFLGALH # WGMEFASPLPTQSQSIRRLLLGAAPLFLAWPTLGLQPMTALLVQWVGFTGLWWADATVCGMGWTPPWYSQYRFYLSVLVGACIIGSLAGTSYYGPVAG # HGFLSRDLELTREMRKEVKGEREGTVPGVVEAVPADAKDGAYVVLKKRDLTKEVQQQQEREREESVKEGVEEVKKAKREQK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g69 ### # start gene g70 5 AUGUSTUS gene 391711 392211 0.37 + . g70 5 AUGUSTUS transcript 391711 392211 0.37 + . g70.t1 5 AUGUSTUS start_codon 391711 391713 . + 0 transcript_id "g70.t1"; gene_id "g70"; 5 AUGUSTUS CDS 391711 392211 0.37 + 0 transcript_id "g70.t1"; gene_id "g70"; 5 AUGUSTUS stop_codon 392209 392211 . + 0 transcript_id "g70.t1"; gene_id "g70"; # protein sequence = [MPPGGKDTAVVFGPQPPMIADLHIIIARMNTPREHSMIGIHDTVLHATFPDPSDRTPDTILIVERLDSPMETLKEDHH # SIFIGQARFKDEKDFQEAIEEMLKVKMPPIRYKGTCRDYIWQVLQKLKVRGNIIYSGVLRKFRKIYNERYEQVFKDTHRRLGIESGTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g70 ### # start gene g71 5 AUGUSTUS gene 393022 393816 0.51 - . g71 5 AUGUSTUS transcript 393022 393816 0.51 - . g71.t1 5 AUGUSTUS stop_codon 393022 393024 . - 0 transcript_id "g71.t1"; gene_id "g71"; 5 AUGUSTUS CDS 393022 393816 0.51 - 0 transcript_id "g71.t1"; gene_id "g71"; 5 AUGUSTUS start_codon 393814 393816 . - 0 transcript_id "g71.t1"; gene_id "g71"; # protein sequence = [MYVSRRQDDWDRLLPTAEFVINSRVHFAHDKAPFEVLYGYTPEFSIPIGSWKEYPLITDRLDALRHAREDAEAALRMS # KQRITDTIAEHPNQPSFEVGQPVWLSVNNLKIRRKSEKLGSRRLGPFKVIEKTGAHTYRLALPTWMKIHDNINVKRLAPWKGNEVNGILPAPPEPEVI # DGEEFYDVDRILDSRIHGRWKKLQYLVRWKGYDEGHDTWENEENVVGSSDEAINEFYAAHPNAPRKISATIFHSLPWQPMVNFTEVNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g71 ### # start gene g72 5 AUGUSTUS gene 393927 396125 0.99 - . g72 5 AUGUSTUS transcript 393927 396125 0.99 - . g72.t1 5 AUGUSTUS stop_codon 393927 393929 . - 0 transcript_id "g72.t1"; gene_id "g72"; 5 AUGUSTUS CDS 393927 396125 0.99 - 0 transcript_id "g72.t1"; gene_id "g72"; 5 AUGUSTUS start_codon 396123 396125 . - 0 transcript_id "g72.t1"; gene_id "g72"; # protein sequence = [MIDSGATGLFLHQKFVNKHHIYVRSLPRPIELYNIDGTANLAGRITHSARLLARVDQNQPQILEFLVTNIGSEDVILG # LPWLRKVNPDINWHDGQIQIPAKPKVPHHVAIEEIPEPKEPNVGGNTEQILEPNRAESNGLPHTVPRTELGPETAETGTSLEDELVFEESGSPLYRLT # GNRKRRRAWLRAGFIQEVTEELWCAAGYTYSQQLAEAANKDKPQKTFEEMVPEPYRRHAKVFSEKESEQLPEHKPWDHAIDLKPDAPKTLRTKIYPMS # VNEQKELDRFLEDNLRKGYIRPSKSPLSSPVFFVKKKDGKLRFIQDYRRLNEYTVKNRYPLPLVADIINCLRQAKYFTKFDVRWGYNNVRIKEGHEWK # AAFSTNRGLFEPLVMFFGLTNSPATFQALMNSIFADLIAAGKVAVYLDDILIFSASLQEHRKIVHEVLERLAKNDLYLRPEKCEFEQTSIEYLGLIIS # EGEVRMDPVKVEAVKNWPAPTCLRDVRGFLGFANFYRRFIDGFAKKARALNDLTKKGVGWSWGTNEQVAFEALKEAFTTAPILVLWDPDKPTRIEVDA # SGFATGGALLQQQGDGLWHPVAFRSASMDPAERNYEIYDREMLAIIEALKDWRHFLEGLPNPFEIVTDHRNLEYWRTAQDLSRRQARWTLWLSRFDFT # LTHRAGKANAQADALSRVSQLEVMDADDNQQQIVLRPEHFLRAATAVLFQNDDLSLIEDHNLLPTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g72 ### # start gene g73 5 AUGUSTUS gene 396302 397408 0.98 - . g73 5 AUGUSTUS transcript 396302 397408 0.98 - . g73.t1 5 AUGUSTUS stop_codon 396302 396304 . - 0 transcript_id "g73.t1"; gene_id "g73"; 5 AUGUSTUS CDS 396302 397408 0.98 - 0 transcript_id "g73.t1"; gene_id "g73"; 5 AUGUSTUS start_codon 397406 397408 . - 0 transcript_id "g73.t1"; gene_id "g73"; # protein sequence = [MSSAQDVRDTITELTKNQAKLQDVVSELVSGLSTTKSVGKPQNYNGKRGEDARRFLAAFELWANSIPALSTDCKKKIT # SAITYLEGDAAIWATPISETINRSSITGSGVPFPYDTWEEFVTAFKTRFETTDASADAKQLLKRLYQNRNTVGTYASTFQQYADRTGYSDKDLRDRFY # DHLADRVKDGLVFTTRPTGSLQELIEAAIDVDNQQITRAWEQGKKLVDDGILTNFRPTTVATPFTAPTRDPNAMDIDATTTRSPDAFRRFMIGRCYGC # GSKEHRKANGHHERDICRHCGLNGHVEAVCRRKFLGLPGRKATTISATSIPDTTQSAAPGTIIAATPDLAALLKELAANQQVLAGQIAELHKNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g73 ### # start gene g74 5 AUGUSTUS gene 403051 403751 0.8 + . g74 5 AUGUSTUS transcript 403051 403751 0.8 + . g74.t1 5 AUGUSTUS start_codon 403051 403053 . + 0 transcript_id "g74.t1"; gene_id "g74"; 5 AUGUSTUS CDS 403051 403069 0.8 + 0 transcript_id "g74.t1"; gene_id "g74"; 5 AUGUSTUS CDS 403237 403751 0.91 + 2 transcript_id "g74.t1"; gene_id "g74"; 5 AUGUSTUS stop_codon 403749 403751 . + 0 transcript_id "g74.t1"; gene_id "g74"; # protein sequence = [MHSAQPILPLPLPTGDNNAGDIDNAAPVFFGPPQPPILIQIAIANKDTPKEHAFIAVGDTLLHAVYPTNTDHTQLIPE # KEDMSTKAAMEAYRLGMKTIGEAKFGSKFEEGKVIEELLKIKLPPIAENGNCWDFIMIVLKKMKKDGRIVGDADSVLEKYKDIYEERKQARMKRVSVS # Q] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g74 ### # start gene g75 5 AUGUSTUS gene 411623 412841 0.7 + . g75 5 AUGUSTUS transcript 411623 412841 0.7 + . g75.t1 5 AUGUSTUS start_codon 411623 411625 . + 0 transcript_id "g75.t1"; gene_id "g75"; 5 AUGUSTUS CDS 411623 412328 0.7 + 0 transcript_id "g75.t1"; gene_id "g75"; 5 AUGUSTUS CDS 412492 412841 0.92 + 2 transcript_id "g75.t1"; gene_id "g75"; 5 AUGUSTUS stop_codon 412839 412841 . + 0 transcript_id "g75.t1"; gene_id "g75"; # protein sequence = [MLVFAVRLHRSSNFDNLHPDIDLAGHNDNTELAHVDFSYIRKEYGVPHMVGHRSSLANAMFDACKQETAITFHFESSC # GGIKSWLPKPIFTVVPREGESYDVSVDVVLAADGIKSVVRPQILRELNIDAEVIDSGQSAYRIMLTREQMASDPEMLQLLDSDQVTRWIGERRHIIAY # PISNKSIYNISTAQPDVHFAAAPSATYTTRGSKADMLDNFKDFCPLVLRMLNLVPKGEVYQGAAQAIEDAGVLAVILSKLPDRRPDSINKALKVYEYV # RKKRAETLVELAAASGRTLHLGEGAAREDRDKQFAALKDKGGPSPDKAVDAEVQKMILGTDVMQLARKNFENIFENL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g75 ### # start gene g76 5 AUGUSTUS gene 413395 413823 0.98 - . g76 5 AUGUSTUS transcript 413395 413823 0.98 - . g76.t1 5 AUGUSTUS stop_codon 413395 413397 . - 0 transcript_id "g76.t1"; gene_id "g76"; 5 AUGUSTUS CDS 413395 413823 0.98 - 0 transcript_id "g76.t1"; gene_id "g76"; 5 AUGUSTUS start_codon 413821 413823 . - 0 transcript_id "g76.t1"; gene_id "g76"; # protein sequence = [MWIGHPDTPFEHWVLNIDKSNNFHTKKVSRNPKHPLKPSLYSKDYSSVNDPDWQYIDLDCEATFNSDSKMEDVFKDLV # NIPWTSAPIDSGGNCLDYVKAALELLAEGNFISAVPSKFTDRYNKYYVDVTKTVWKVEVTLPQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g76 ### # start gene g77 5 AUGUSTUS gene 415003 415821 0.26 + . g77 5 AUGUSTUS transcript 415003 415821 0.26 + . g77.t1 5 AUGUSTUS start_codon 415003 415005 . + 0 transcript_id "g77.t1"; gene_id "g77"; 5 AUGUSTUS CDS 415003 415821 0.26 + 0 transcript_id "g77.t1"; gene_id "g77"; 5 AUGUSTUS stop_codon 415819 415821 . + 0 transcript_id "g77.t1"; gene_id "g77"; # protein sequence = [MAGKIRYMDSREDEQERGITMEASAVGLKYRVKDGDMYVLNMIDTPGHVDFQSEVSTASRLCDGALILVDVVEGVQTQ # TTSLLRQAYQDQLTPILVLNKIDRMIMELKLTPEEAYERLARVVEDVNVVMGGLWGGERMKKADNDTDTGVDASGGVTTKDDEEDDSGIYFDPAQGNV # IFASAIDSWGFRPSHFARIFARKLFAEQIKSGKLSPEASKEKEESLKKVMWGEWYFDTKSKRVVGAKGKRPGMKTLFVQIVLENLWQVYDAVIGNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g77 ### # start gene g78 5 AUGUSTUS gene 416110 417294 0.27 + . g78 5 AUGUSTUS transcript 416110 417294 0.27 + . g78.t1 5 AUGUSTUS start_codon 416110 416112 . + 0 transcript_id "g78.t1"; gene_id "g78"; 5 AUGUSTUS CDS 416110 417294 0.27 + 0 transcript_id "g78.t1"; gene_id "g78"; 5 AUGUSTUS stop_codon 417292 417294 . + 0 transcript_id "g78.t1"; gene_id "g78"; # protein sequence = [MGRMLGLDNVSSPNSTDGTTSSSPIPYEHLYKASPSPAVPVCAYVSKMFAVRRGDLPEERENARSAQAKAARDRKRVA # AEKLNEEVKVTDAGDGNDGNDDELQEKDQEDHQKDLDEDILLGFARIYSGTLSAGEQVLVLLPKFNPAMENTAASLNDISTAVVHPSNVQYVLGLPST # SSQSLVAQASKMHSSSQPTHPTRITIAALYLMMGRELLPVSSVSAGQIFAARFKYEFSSSTKSNQDLEEKTGNTKEEIESVVWRGGTIVRPPSTQGPR # PHHSWLLNLGRITHTVPPIVRLSLLPALPGDLPALLCGLRILEQADPCVETFQMDGGEWVIGGAGELHLERCLKDLRERFAKVEIHASKPIVPFRETA # IRESGQRYYHSMLFRIFFSSLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g78 ### # start gene g79 5 AUGUSTUS gene 420386 422686 0.94 - . g79 5 AUGUSTUS transcript 420386 422686 0.94 - . g79.t1 5 AUGUSTUS stop_codon 420386 420388 . - 0 transcript_id "g79.t1"; gene_id "g79"; 5 AUGUSTUS CDS 420386 422686 0.94 - 0 transcript_id "g79.t1"; gene_id "g79"; 5 AUGUSTUS start_codon 422684 422686 . - 0 transcript_id "g79.t1"; gene_id "g79"; # protein sequence = [MKFRPLVFRNTHPYIYVDRLQDLTPPELIRTSHSKCDRRISVYGYVRGTNWRGQGQKVHIPGVGDLLVESIEKMVDPV # PIIEKGGDEEKRRRMSEKRKLVVHAPMSDLGGVSFDKDAVYVNVKGSFTRREGEEVEEGEGEKMVMDLQEAGMTLDDAVKQTKIRLFGSSEKPLAVGG # NDDDDDEPSSADEVEDDFASVDDEGESSGSEAELDTLNKVQSDPRNTGRSQPRRPARSLPQAKSTGKGLDFDSDSGDSDENEDEDAEEGFIVNDDDDD # ENYIEEEEDEVEGEDGEDLDMVDEDSDDDRDTVHPKTKHLDSQALSLRRPTRRDWTKDIYSTNLSPEEIVLQHSSSSSSSSSLTAHAQKSNVDVDMDN # EDDGFFFKKPSNDTANTLLDSSTTLSDLADKSKPEFSSAELNKWEDEDMLESIRRFFITAVTETTGEDGGGDGAEDDDDDESGGDFVDFEATGGDPSL # TSASAPSTAKKIPDPPPISSSSRSALATKKALLKARFDEEYDDPSNSNPSSTFYDQKKAELTTQQSLNATAFASIQDPELRAQLEGYVPGTYVRVVLD # GVPGEMVNFFDPEYPLILGGLGAGEGFFPISTSTTSSSQTAPTPSSDLTLLRLRLKRHRFHPRPLKSNDPLILSIGWRRFQTLPIYSLDDHSIRMRMI # KYTPDHMHCFATFWGPGMVPGLGVCAFNSVYDGPTSSGGGGNGFRVSATGTLLSLSPGTSSPIVKKLKLTGTPYKVFKNTAFIKGMFGSALEVARFEG # AG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g79 ### # start gene g80 5 AUGUSTUS gene 428921 429502 0.98 - . g80 5 AUGUSTUS transcript 428921 429502 0.98 - . g80.t1 5 AUGUSTUS stop_codon 428921 428923 . - 0 transcript_id "g80.t1"; gene_id "g80"; 5 AUGUSTUS CDS 428921 429502 0.98 - 0 transcript_id "g80.t1"; gene_id "g80"; 5 AUGUSTUS start_codon 429500 429502 . - 0 transcript_id "g80.t1"; gene_id "g80"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVANLATAMEEHSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAEKPPFRGNWDTFLKEFSQRFEPMDPGMEAHSEVKNLRQGKGQTVAEFAQKFKDIRDPSRSLPRPQHLLLHPY # LLLRAPLTRTFPTRLVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g80 ### # start gene g81 5 AUGUSTUS gene 438561 439019 0.42 - . g81 5 AUGUSTUS transcript 438561 439019 0.42 - . g81.t1 5 AUGUSTUS stop_codon 438561 438563 . - 0 transcript_id "g81.t1"; gene_id "g81"; 5 AUGUSTUS CDS 438561 438810 0.8 - 1 transcript_id "g81.t1"; gene_id "g81"; 5 AUGUSTUS CDS 438865 439019 0.43 - 0 transcript_id "g81.t1"; gene_id "g81"; 5 AUGUSTUS start_codon 439017 439019 . - 0 transcript_id "g81.t1"; gene_id "g81"; # protein sequence = [MWIAKKKKKLQKTSTGPIPWATPLKQVTFHIGFYGKTGDLAAGKAKRPTPAEFQFMQYSGHIRAVIINKNASHDDICN # AIKLKFDKLLPTTDIARFSLLQCVLNGRQRTLAALKPSPLTLFTVKDFEMYVNTYF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g81 ### # start gene g82 5 AUGUSTUS gene 444599 445318 0.43 - . g82 5 AUGUSTUS transcript 444599 445318 0.43 - . g82.t1 5 AUGUSTUS stop_codon 444599 444601 . - 0 transcript_id "g82.t1"; gene_id "g82"; 5 AUGUSTUS CDS 444599 445318 0.43 - 0 transcript_id "g82.t1"; gene_id "g82"; 5 AUGUSTUS start_codon 445316 445318 . - 0 transcript_id "g82.t1"; gene_id "g82"; # protein sequence = [MMVEILFDRYKFPPEYVLRVWKQAGDLEETEAILKQLRDLENGLLRESSSRRSSHTGSNTSSGNARKVGDQITAEPIL # GGPQRASYAGGDSSIVRNPSRLRESFSGDFLKPEERATETRATFSFPRALDARHDFANSSSFKSNVTTPATYQSRVPNDTSTSPKSSKSSTTRDSSDN # QSEAHTSNPSDVEAALPPKLQEIYSAISSPDRKMVLQKFWKAYGTDYIQVESTLNDNLPTFML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g82 ### # start gene g83 5 AUGUSTUS gene 445517 446372 0.76 - . g83 5 AUGUSTUS transcript 445517 446372 0.76 - . g83.t1 5 AUGUSTUS stop_codon 445517 445519 . - 0 transcript_id "g83.t1"; gene_id "g83"; 5 AUGUSTUS CDS 445517 446149 0.76 - 0 transcript_id "g83.t1"; gene_id "g83"; 5 AUGUSTUS CDS 446202 446372 0.77 - 0 transcript_id "g83.t1"; gene_id "g83"; 5 AUGUSTUS start_codon 446370 446372 . - 0 transcript_id "g83.t1"; gene_id "g83"; # protein sequence = [MRSISLLDSCTSSTDNVHRDRGRTAFNPRDDAHLVKYLAEYNQGRKGNKLYHQLVDNLELFPWARRHSWQAWRHRYMR # ESADFDRRIDLQQKRNLSTLFRNTQDDASTSRDLPQAQEHLDQSAAHRPQRQKRKETPEREINVQEKRRRIDASEQTVPTNGRDLQEGFEAQDMARRV # RLGEGSSRPPPETTKKHVLLDRSRKLSPQPVQQRTLSSESSSESNKMKDIPYHRSSSDHSKKEVDRDHEQDGDIAMGRMFLSPSNTSTSDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g83 ### # start gene g84 5 AUGUSTUS gene 446715 447542 0.46 - . g84 5 AUGUSTUS transcript 446715 447542 0.46 - . g84.t1 5 AUGUSTUS stop_codon 446715 446717 . - 0 transcript_id "g84.t1"; gene_id "g84"; 5 AUGUSTUS CDS 446715 447542 0.46 - 0 transcript_id "g84.t1"; gene_id "g84"; 5 AUGUSTUS start_codon 447540 447542 . - 0 transcript_id "g84.t1"; gene_id "g84"; # protein sequence = [MFWHNEEYIDAQSIGSENGIVLDGVVCVVDAVFGLKQMEEDHSNNGDDEPGESLKQIAGSDVIILNKVDLVQPSTLSA # IEAAIKHVNPVAPLHRTVRAELDLAHILGIQAYSTGRHLPPRDDQNQPHNHDHEHEHEHTHSSFSAAVPHYVTRGISSLQLSLPPLSASQFAAFDVWI # RTILWENCLPELEGTDTQSKESASKGNINVLRCKGLLTLTSGEKHVLQGVRSMYEIIPVKGDDESTKSEFPFAGKVVLIGKGLGEDVRRSFISNVVGE # D] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g84 ### # start gene g85 5 AUGUSTUS gene 456418 459073 0.16 - . g85 5 AUGUSTUS transcript 456418 459073 0.16 - . g85.t1 5 AUGUSTUS stop_codon 456418 456420 . - 0 transcript_id "g85.t1"; gene_id "g85"; 5 AUGUSTUS CDS 456418 457703 1 - 2 transcript_id "g85.t1"; gene_id "g85"; 5 AUGUSTUS CDS 457804 458055 0.3 - 2 transcript_id "g85.t1"; gene_id "g85"; 5 AUGUSTUS CDS 458149 459073 0.32 - 0 transcript_id "g85.t1"; gene_id "g85"; 5 AUGUSTUS start_codon 459071 459073 . - 0 transcript_id "g85.t1"; gene_id "g85"; # protein sequence = [MLAITSTEALSILDHIVLKKAPSSYPSTVALLSPPVASSWSSDNKFLFIASADTIHRYDAEHHSIVDIFSTSESITSL # VVKGKSPVIFGAGERVHVLECGSTTKISQTFVSHQDSVKSLSLSCDSTLLASTSSKAAYVHNLTLISHTALRGLPVSDQQSITTCTFHSHARTRLLLG # IGKKVVIYDINRPSGPAKVISLSETSSGNICAISCSPFSKTLIAVATTGGTLGLIDLDKEKGYVSGLVLIYALKFMVPHRLFRTINVKVPIASLSFSQ # EGASVYLGTENGKLLILDLRSLDKPPKSVVLSENASETPKDPTATTKSTEPSKPTSRKASATIASVNKPSPARRIMSVSSKGKEPARLTAGTERVSAA # KEKEGVNKKVFSPLRNLLSIIQIDTLPVVRDISKASRPAPARDTPERVRDPASSALSNSNSASRIGTSARLRPPPQPSPLSASASRSKLSPKEDLRRT # RTVSTTSRTAAASSPLSASTSKKVKEDATGVSRRTRTVSTSSTRTSRAPKASDVTVTTTESISAAATPTRTEVDHLSVPKDVKKSRVIFPSSHASSAK # VETKTGSTSGAGPQSNARTPSPDLSDIEAMTSSDPGPVTPLPASRRRGMASPVLGAPVGIEVNADDDVDLPVPGNKSRKRDSGKGKARTVLFQDSGKE # FDNGCAVREASSDDDIESEKENQREESVSWQISPRRPGSIGPSGGPSASSMPWNGSPIRHSQSYLHKQYANIPGSPGGTSPQGLLRNIVRDVMYDFHQ # ESRAEMMSLHLDLVSMGRGWKKELRELMGEYGGKLKELREENRRLREENERLRRGY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g85 ### # start gene g86 5 AUGUSTUS gene 469001 471561 0.18 + . g86 5 AUGUSTUS transcript 469001 471561 0.18 + . g86.t1 5 AUGUSTUS start_codon 469001 469003 . + 0 transcript_id "g86.t1"; gene_id "g86"; 5 AUGUSTUS CDS 469001 470188 0.38 + 0 transcript_id "g86.t1"; gene_id "g86"; 5 AUGUSTUS CDS 470293 471561 0.33 + 0 transcript_id "g86.t1"; gene_id "g86"; 5 AUGUSTUS stop_codon 471559 471561 . + 0 transcript_id "g86.t1"; gene_id "g86"; # protein sequence = [MQVTAVLCGSFGISQAKVSDYSLFLIIQTNDICVARLMDESTEQRESLIDLILPFLAVPFRYPSAFAPANHFRLPLRS # SVPSSSSTPFSIPTPHGPFPIYLHPSRHTWLTPHFDRWTPLCTPLAADAAKLVYFSRRETMLFSVLDLLPRNREEHRARIRARLAAQGNGEVDEYQVE # TVLQSELPRPTQEDFEELNAGLLGGNMVPSTPFSKGGGTPLPRIYDPWDDARKRLPDLLDPRLNHTDIYESHLDTAEQIFGNEIDESACSSRRWDADW # WRLRLCRSAWVGQGESESEDNLFASDIGTVVNDTDTSIATDVNDEEGEDCDDDEDDGVMSEYDGDIQQNVDMPVNEEAQESAQVEQVDNDMQRNHTML # TGYPQKGAVYTPGSLNGLWTGRMITHLRALLLPPAPTANQQELLLPHDQLPLPNNDNHEDGPQPAVAAAQNPLNNANLTPDPRQEAGHRPLPFNEGTL # GLVAVPLYVRLSEYAVYSGGRTVPCAHDTEDDNDYETDFDFDDDNGIHSSTRSHNSGDGSNTTRSGSRHDTVPRSTNINPDDAFDQGIKDSWFPPNTT # LSTKGDRVIASVPSSGPTNGEEYEYVAVRNSDLNADDDFRFSPSVASTSTLIPGRSEAEAQSKRKPGTFHDRETCMGCIARERALLVARTEAQALMDI # DPEHPADAPSDGSSDEDLSEEEPAEDLPPYVPSAKTIPPCNGIRDVLITGSTDPRHAAAWGKWVWRGRVRKWDGLVGLVRSVDNGVSFQVMFFILSCL # VSSSMDSCLLSAPSFFDFYLAFWILSKQRQRREDFLLWHPSWWTKSRRNVAAST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g86 ### # start gene g87 5 AUGUSTUS gene 480150 480647 1 - . g87 5 AUGUSTUS transcript 480150 480647 1 - . g87.t1 5 AUGUSTUS stop_codon 480150 480152 . - 0 transcript_id "g87.t1"; gene_id "g87"; 5 AUGUSTUS CDS 480150 480647 1 - 0 transcript_id "g87.t1"; gene_id "g87"; 5 AUGUSTUS start_codon 480645 480647 . - 0 transcript_id "g87.t1"; gene_id "g87"; # protein sequence = [MDNSTDDGNSDGADDGANHGADDGADDGANHGADDGADDGANHGADDGANHGADDGANHGADDGANHGADDGANHGAD # DGANHGADDGANHGADDGADDGANHGADDGADDGANHGADDGADDGASHGADDGANNGADNGANNGADNGANNGADHGAKKLIAVKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g87 ### # start gene g88 5 AUGUSTUS gene 485171 488185 0.12 + . g88 5 AUGUSTUS transcript 485171 488185 0.12 + . g88.t1 5 AUGUSTUS start_codon 485171 485173 . + 0 transcript_id "g88.t1"; gene_id "g88"; 5 AUGUSTUS CDS 485171 486706 0.12 + 0 transcript_id "g88.t1"; gene_id "g88"; 5 AUGUSTUS CDS 486799 486838 0.38 + 0 transcript_id "g88.t1"; gene_id "g88"; 5 AUGUSTUS CDS 486939 488185 0.6 + 2 transcript_id "g88.t1"; gene_id "g88"; 5 AUGUSTUS stop_codon 488183 488185 . + 0 transcript_id "g88.t1"; gene_id "g88"; # protein sequence = [MTLRLEDVIRIQECIPEDIAMVLREVLELMGIEILGNGLEFSDLRVQFLTVGSQLEIDLPEKAQQWLMIPVNRSDFLW # LYNVLLDPERMLELLEAEARYGRSFQNSRGILPLLPHTHGREKKFCGEAGLRILYRASNYRSGAVWFEPPPSRVNIPNYQAIQILRNANLAAVAAKIN # EDANTIAAKNRRHRRYTTAHLLAPVESMPDQDSPVRVHSGQTVYTYTPMRHMHQLLVRSEESEAMLCSQETRHRTLLVESDTLMLSEELSGSNLERAL # EFRCRLVADNRGTSYMVQCEPESVGEFPPEQFDQKRQLHGSDGRFLAQKHSSPRNIEVPEFLNPGNTATRSPQLRSGTSPTVHALAQNSTPPPRVNLQ # MKPVTPVLTQRYQFGEVRMDGEQHSSRISGHDLTARLVPNPVHVPPRLSNPSVVPYQGSVSMQSQVVGTENQRVPNQQRMRAVHKKAAPLQGAPFGTP # FVTGAQTNQPGMVVDSARSQESVAMIQQQAWVIETLQEQLREGNERIHEGRSFSCRQILATPSVDRRHIHEWGARVQRAELGEYVRPEGGVYALENEG # GGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSDEGEQNQSSRNGGRREEDRGELPTGAPEVP # PTRYDPDQPGYYDPRQGWHCKAAPRNPNEGRNTWESNEEKNQITIESKLDIGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASTASHLT # GAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQIV # TGREEPRSYDEWTRVFTKLDGAVCAQAESLRNLHGEKALQGWLSRFPGLELAPEAPYKSPCVGNEIQLTSGPPIRNQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g88 ### # start gene g89 5 AUGUSTUS gene 488716 490308 0.73 + . g89 5 AUGUSTUS transcript 488716 490308 0.73 + . g89.t1 5 AUGUSTUS start_codon 488716 488718 . + 0 transcript_id "g89.t1"; gene_id "g89"; 5 AUGUSTUS CDS 488716 490308 0.73 + 0 transcript_id "g89.t1"; gene_id "g89"; 5 AUGUSTUS stop_codon 490306 490308 . + 0 transcript_id "g89.t1"; gene_id "g89"; # protein sequence = [MGRGFEVDQGELRSPATPLPTTIRAALAGSQPARLISRSYNSFIILTRFPFSDLDEDKEYATLVDSGATRCFIDKTVA # MQHPENLVDLTNSIPLELFDGQPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLLWLRMHNPVIDWKELCLTFQDRNVRISAALASEI # VQPGAEGGTEELGRGVNGEGIHEGTLQPPPEAPQQPPEAPQPPPEVPQQSPEAPLRALRTGVKLEEVKDEEYEASQQGPHKLFPSYRDLGPDDPILMG # INEWLAFASESTEEEVEILEAGRSAMEKVTPKPAKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDLPTLDIESLNIPKIPSRSGLTP # KGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEILRASDSNDPERVQQPKDPESGNPSPGQGG # VVKELDEEVSKRQETEELKKSIPVQYQDYLDVFSPGEARTLPRTDPTISKSKRKVMRYLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g89 ### # start gene g90 5 AUGUSTUS gene 492224 493183 0.59 + . g90 5 AUGUSTUS transcript 492224 493183 0.59 + . g90.t1 5 AUGUSTUS start_codon 492224 492226 . + 0 transcript_id "g90.t1"; gene_id "g90"; 5 AUGUSTUS CDS 492224 493183 0.59 + 0 transcript_id "g90.t1"; gene_id "g90"; 5 AUGUSTUS stop_codon 493181 493183 . + 0 transcript_id "g90.t1"; gene_id "g90"; # protein sequence = [MPSDITSDRGSLFVSQFWRELCSALGIESRLSTAYHPQTDGQMERVNQSVEAYLRIYCSYDQDDWDLLLPMAESVYNN # TPNTTTGVSPFFANKGYHPKSSITLEQVQGAEVNEYMSNLKELHAYLQERIRVANKVYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKW # TGPYTILSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQNSPPPPIFVKGEMEHFVEDILDSKPKKGRPEEVEYLVKWEGYNDEFNSWVGW # EGMVGSIELLRSWHKHHPRKRQPSRLQWASLEREAQEDEEEGPGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g90 ### # start gene g91 5 AUGUSTUS gene 493458 493973 0.9 - . g91 5 AUGUSTUS transcript 493458 493973 0.9 - . g91.t1 5 AUGUSTUS stop_codon 493458 493460 . - 0 transcript_id "g91.t1"; gene_id "g91"; 5 AUGUSTUS CDS 493458 493973 0.9 - 0 transcript_id "g91.t1"; gene_id "g91"; 5 AUGUSTUS start_codon 493971 493973 . - 0 transcript_id "g91.t1"; gene_id "g91"; # protein sequence = [MLALSTPLPHSDGAGRWDDIIPALPSIDQLTADWEQLMLDYIHHITDTPLPGPNPPAPVSAVDPVTEPSREVVVEQSP # EVPVAPVSSSSTGSQPQAPLFLPEQESPTSPSPPPPSPTLPPLFGSVVNLAIDLTGDNDELYETEESRVARVSMTGEVVDLAPGQGIIKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g91 ### # start gene g92 5 AUGUSTUS gene 494151 496071 0.62 - . g92 5 AUGUSTUS transcript 494151 496071 0.62 - . g92.t1 5 AUGUSTUS stop_codon 494151 494153 . - 0 transcript_id "g92.t1"; gene_id "g92"; 5 AUGUSTUS CDS 494151 494678 0.65 - 0 transcript_id "g92.t1"; gene_id "g92"; 5 AUGUSTUS CDS 494761 496071 0.69 - 0 transcript_id "g92.t1"; gene_id "g92"; 5 AUGUSTUS start_codon 496069 496071 . - 0 transcript_id "g92.t1"; gene_id "g92"; # protein sequence = [MSPTPTRPLSRTPSPLLPPLTALGEVPSPAPESDGEVEADQLAFTIESPSRPQLQLFETVFNTGKSLSAYCQDDPLWP # ILAEVASPCTNCLKTPGKCKVLPSSPRCTSCSSKKTCSLGKILRYRYFAHRCNQDLAYSRRFLELHGTPAHKSTWGIPLTAWREYDSALHASTSSTSI # LLELNMLDEQDAVDADQQELQQFPTLQQNEAAVSAKRKRNCSPMPVAGPSSKKIRSDAPKKCSRHKSPAVEVNVEPFRRVRLVVLPVRSVAPTSLPVP # PPASPSLMGVLNKDLPTQGPSDLVRLATVVELHSGLVQQAVSSPSARTPIKGAGQDLLSSPMPPTPRPALVPRTFTAHPYRAENQRLAARVRELESQL # ADSQWENSSLTSALRDTSHALESRQWEVEQLRSSNCEVREQEVEYRGVLDQFRALDEALPGASGQEDLQGATRERRVAAEKLSTANRKNSHLTTTLLH # QQGLVDESNLLATRQRRLVEQLQEEVHRVRDRAAFVDRMIKEYPDKGYYEVVLPPLSQLEGDLNKAHEDLRRVATFAHRLYRSDPATILHHHHRYIGA # IIEAVVAFLRRGLDSDDLDVVGHNFRLALDYMQAARGIHGDLYM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g92 ### # start gene g93 5 AUGUSTUS gene 497436 498174 0.97 + . g93 5 AUGUSTUS transcript 497436 498174 0.97 + . g93.t1 5 AUGUSTUS start_codon 497436 497438 . + 0 transcript_id "g93.t1"; gene_id "g93"; 5 AUGUSTUS CDS 497436 497446 1 + 0 transcript_id "g93.t1"; gene_id "g93"; 5 AUGUSTUS CDS 497541 497665 0.97 + 1 transcript_id "g93.t1"; gene_id "g93"; 5 AUGUSTUS CDS 497747 498174 1 + 2 transcript_id "g93.t1"; gene_id "g93"; 5 AUGUSTUS stop_codon 498172 498174 . + 0 transcript_id "g93.t1"; gene_id "g93"; # protein sequence = [MISSTPYPTTGSNKGSNKDEKSAVNDVAPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKF # IAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSCQDSGSDPSASDASFATAQSIPTTGSEDTIVTPTEIAVPVLKTVERATTPFTRGVT # PMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g93 ### # start gene g94 5 AUGUSTUS gene 498427 499283 0.2 - . g94 5 AUGUSTUS transcript 498427 499283 0.2 - . g94.t1 5 AUGUSTUS stop_codon 498427 498429 . - 0 transcript_id "g94.t1"; gene_id "g94"; 5 AUGUSTUS CDS 498427 498691 0.94 - 1 transcript_id "g94.t1"; gene_id "g94"; 5 AUGUSTUS CDS 498880 499283 0.2 - 0 transcript_id "g94.t1"; gene_id "g94"; 5 AUGUSTUS start_codon 499281 499283 . - 0 transcript_id "g94.t1"; gene_id "g94"; # protein sequence = [MLAWLEEKYGIKGIRISAYNSQANGKIERVHLDICQALIKATGGDVSKWFYFLKMILWADRVTLRRGLGCSPYFLVTG # AEPLLPFDIVESTWLVNPPNRILTRDELIGYHAQALSKHNSFIEKVRRRVDANKVAEWNSTLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQL # DLMVEDKDEYWMTPENDYIFDAIPHLRLSDPNSDKELSEEEDQQLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g94 ### # start gene g95 5 AUGUSTUS gene 499623 500906 0.56 - . g95 5 AUGUSTUS transcript 499623 500906 0.56 - . g95.t1 5 AUGUSTUS stop_codon 499623 499625 . - 0 transcript_id "g95.t1"; gene_id "g95"; 5 AUGUSTUS CDS 499623 500906 0.56 - 0 transcript_id "g95.t1"; gene_id "g95"; 5 AUGUSTUS start_codon 500904 500906 . - 0 transcript_id "g95.t1"; gene_id "g95"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPSEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETNASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGRWQTKRPEVNPEDYVDEDDGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNYMLGSKNETCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGDYLSNPTDEVLGEMSKDERIKFIRLIK # KFQVDNQGRLYHRNTDQPDQPQLVVEKEKCMHMLNSAHDCLGYKGVFATNDFLQK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g95 ### # start gene g96 5 AUGUSTUS gene 501105 502290 0.31 - . g96 5 AUGUSTUS transcript 501105 502290 0.31 - . g96.t1 5 AUGUSTUS stop_codon 501105 501107 . - 0 transcript_id "g96.t1"; gene_id "g96"; 5 AUGUSTUS CDS 501105 501684 0.93 - 1 transcript_id "g96.t1"; gene_id "g96"; 5 AUGUSTUS CDS 501809 502139 0.31 - 2 transcript_id "g96.t1"; gene_id "g96"; 5 AUGUSTUS CDS 502242 502290 0.43 - 0 transcript_id "g96.t1"; gene_id "g96"; 5 AUGUSTUS start_codon 502288 502290 . - 0 transcript_id "g96.t1"; gene_id "g96"; # protein sequence = [MIIGINLKTLKELGREAQDSKDKKENVQPDLLNEPPTNKLEERIKLNQQDRSPINLIDETNKQVVNEAIGVEKPINLN # TEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPLCLAPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIE # SKIDSGIYEPSNASYRSKWFCVIKKDSKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDEQELDQLSRDMTTFQMPYGPHR # LVKLPMGWMNSVPIFHDDMTYILRDEIPHVTIPYIDDVPVKGPST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g96 ### # start gene g97 5 AUGUSTUS gene 502783 504509 0.38 - . g97 5 AUGUSTUS transcript 502783 504509 0.38 - . g97.t1 5 AUGUSTUS stop_codon 502783 502785 . - 0 transcript_id "g97.t1"; gene_id "g97"; 5 AUGUSTUS CDS 502783 503800 0.38 - 1 transcript_id "g97.t1"; gene_id "g97"; 5 AUGUSTUS CDS 503866 504509 0.63 - 0 transcript_id "g97.t1"; gene_id "g97"; 5 AUGUSTUS start_codon 504507 504509 . - 0 transcript_id "g97.t1"; gene_id "g97"; # protein sequence = [MPRDDPNIPRCKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR # VFNQDSSNGKKISTPMKEQDRSMRTLRSNAVAPEESEKAKRNQFNDNTKRLVFDGVHIPTKPGLIPGKLVETTNGNQKTVRFEAPKSIDWPLKKPSVT # IEDVDESNDEDAIKLIPSSRPMNQINSEHRPYDHVQPRTHGYTPAYKIRNEVSRPGVEEDIAKKIFNAKVDLSMEELAALSPAIRKIIMRKIRNRRVR # PRTKTNNYVSTLSEDGETEILDNPSKVQMIDTCIRIEDLWQDQADMFEVLTESHNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHS # DHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPF # QVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNNQINTSRYNEPKNVPPDNEKSTGENDSKGNFHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g97 ### # start gene g98 5 AUGUSTUS gene 505346 506859 0.47 + . g98 5 AUGUSTUS transcript 505346 506859 0.47 + . g98.t1 5 AUGUSTUS start_codon 505346 505348 . + 0 transcript_id "g98.t1"; gene_id "g98"; 5 AUGUSTUS CDS 505346 505424 0.48 + 0 transcript_id "g98.t1"; gene_id "g98"; 5 AUGUSTUS CDS 505496 506859 0.97 + 2 transcript_id "g98.t1"; gene_id "g98"; 5 AUGUSTUS stop_codon 506857 506859 . + 0 transcript_id "g98.t1"; gene_id "g98"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRPIARRTGKQPQRRAASESPRDPPPHFNLDTGDHEDQDPPVDPDDPGADNNND # DLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGEPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDP # RKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRK # YNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQP # SGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEAT # VEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g98 ### # start gene g99 5 AUGUSTUS gene 507191 508351 0.48 + . g99 5 AUGUSTUS transcript 507191 508351 0.48 + . g99.t1 5 AUGUSTUS start_codon 507191 507193 . + 0 transcript_id "g99.t1"; gene_id "g99"; 5 AUGUSTUS CDS 507191 508351 0.48 + 0 transcript_id "g99.t1"; gene_id "g99"; 5 AUGUSTUS stop_codon 508349 508351 . + 0 transcript_id "g99.t1"; gene_id "g99"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHPDSPQTSVPSAINPVAAKVAV # PLPEPSPSVSPTILETPPGDSLRPRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYHSYQISSTLRKELKYTPNWISLTLIISSESLKVTNGRPPFGPATARMNGRLCRSALRTLLRLSSGLLMTSSL # TCSMFVSSSIWTIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g99 ### # start gene g100 5 AUGUSTUS gene 508456 510543 0.4 + . g100 5 AUGUSTUS transcript 508456 510543 0.4 + . g100.t1 5 AUGUSTUS start_codon 508456 508458 . + 0 transcript_id "g100.t1"; gene_id "g100"; 5 AUGUSTUS CDS 508456 510543 0.4 + 0 transcript_id "g100.t1"; gene_id "g100"; 5 AUGUSTUS stop_codon 510541 510543 . + 0 transcript_id "g100.t1"; gene_id "g100"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSC # QEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVV # TDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPALRASII # MDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRD # YVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSD # RGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVD # MKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKISWSFQGHQSTWYSVLRAQTPRLSSPHS # PGFPRLTAGAGYAESVPESYSISSTSNRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g100 ### # start gene g101 5 AUGUSTUS gene 514450 515504 0.27 + . g101 5 AUGUSTUS transcript 514450 515504 0.27 + . g101.t1 5 AUGUSTUS start_codon 514450 514452 . + 0 transcript_id "g101.t1"; gene_id "g101"; 5 AUGUSTUS CDS 514450 514827 0.27 + 0 transcript_id "g101.t1"; gene_id "g101"; 5 AUGUSTUS CDS 514926 515504 1 + 0 transcript_id "g101.t1"; gene_id "g101"; 5 AUGUSTUS stop_codon 515502 515504 . + 0 transcript_id "g101.t1"; gene_id "g101"; # protein sequence = [MSHSRTQTITTPSSTTAGPSRSRPLNPPPADPINDDDEALEEDDDEAIRQAEETVRRMKARKAAAAARRKAEEEAAKK # AAEEAQRKKEAAARELEERRRLMAEAAAARSRRGSSPGGSSISPRRPVPVGGDPDDGDDGDDDDDDEDDRTPCERCRSKRIPCLQQAGKRSSTTCKPC # HDAKVRCSHSNRPPTVKKEAASHPTGERLAVLESQVAQLLADNRVLREGQIKSNTYDRHIIKKLEWLMRDAARRRDSPPEMPEPGPSRLPKKRRRVVD # SEEEEEDRIVGAEDGEGEEEVEEEEGIEPAPKKARSEKGKEREE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g101 ### # start gene g102 5 AUGUSTUS gene 515871 519434 0.98 - . g102 5 AUGUSTUS transcript 515871 519434 0.98 - . g102.t1 5 AUGUSTUS stop_codon 515871 515873 . - 0 transcript_id "g102.t1"; gene_id "g102"; 5 AUGUSTUS CDS 515871 519434 0.98 - 0 transcript_id "g102.t1"; gene_id "g102"; 5 AUGUSTUS start_codon 519432 519434 . - 0 transcript_id "g102.t1"; gene_id "g102"; # protein sequence = [MANIAVWFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNLLIDRASRNITFRNTSHFDSPQTSVPSAINPVVAKVAV # PLPEPSPSVSPTILETPPGDSLRSRSRSRSRTSRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLCAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRHHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGAPWIWDRSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYITSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGFTAILVVVDRSSKQAIFI # STHDTITSEQLAELFVIHVFSEHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHAQYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g102 ### # start gene g103 5 AUGUSTUS gene 519767 521440 0.98 - . g103 5 AUGUSTUS transcript 519767 521440 0.98 - . g103.t1 5 AUGUSTUS stop_codon 519767 519769 . - 0 transcript_id "g103.t1"; gene_id "g103"; 5 AUGUSTUS CDS 519767 521440 0.98 - 0 transcript_id "g103.t1"; gene_id "g103"; 5 AUGUSTUS start_codon 521438 521440 . - 0 transcript_id "g103.t1"; gene_id "g103"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDGQP # VQVVTPRRGQPPVVAPARGRSTARIDSPILQAIARRTGKQPQRRAVSESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPDGPGGPGGPGGPRSPNSPDIPNEQRAMLDLLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYF # TDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGIYDAQGEAEDALGNLKMKETENIRKYNIRFNTLAASTNWDSTALKW # AYGRGLAERIKDEMVRLPEPATLAAYRLEVLRIDNRYWKREETKKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNN # NGKPQNSANSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEENPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g103 ### # start gene g104 5 AUGUSTUS gene 521868 523146 0.74 - . g104 5 AUGUSTUS transcript 521868 523146 0.74 - . g104.t1 5 AUGUSTUS stop_codon 521868 521870 . - 0 transcript_id "g104.t1"; gene_id "g104"; 5 AUGUSTUS CDS 521868 521921 0.75 - 0 transcript_id "g104.t1"; gene_id "g104"; 5 AUGUSTUS CDS 521998 523146 0.74 - 0 transcript_id "g104.t1"; gene_id "g104"; 5 AUGUSTUS start_codon 523144 523146 . - 0 transcript_id "g104.t1"; gene_id "g104"; # protein sequence = [MNESSRPSSSQIPTEALRGSSVSRGTGSSISRGRRTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSS # TSIESTRLIDTLNQTISQASNMIEPVKMTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDKAKVRLAL # EWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAP # LTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKLS # SPCLGPPFRRSSLLIVFYLTLQDYTYNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g104 ### # start gene g105 5 AUGUSTUS gene 531328 532299 1 + . g105 5 AUGUSTUS transcript 531328 532299 1 + . g105.t1 5 AUGUSTUS start_codon 531328 531330 . + 0 transcript_id "g105.t1"; gene_id "g105"; 5 AUGUSTUS CDS 531328 532299 1 + 0 transcript_id "g105.t1"; gene_id "g105"; 5 AUGUSTUS stop_codon 532297 532299 . + 0 transcript_id "g105.t1"; gene_id "g105"; # protein sequence = [MPVLIPQIPNGALFHEQFGHPGVDLTNELLTGSSATGLDEWNGTKMCGICDSCLKGKHPRFAYPYHGNRASAPLELIH # TDTCGPIGTMSNHHSSHFNIIVDDYTSALSGGCFAKKNQALQIIKTTISTWENLLSPHKVKSIRLDGAKEFHGSEATSYFKEKGISVQKTTAYSHQQN # GKAERWVRIIENDTITMLVHAGLPLQFWEDTVRTALYIRFRLPTKTLPNNKTPYEMVHKKAPNLSNLCVWGCQYWIQVSEDIRLKFGNKMLEGIFVGY # EDNRIGWRVWDTKGKEHFSDQVVFTAITVIIRNSIFLKSCKVVFGITFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g105 ### # start gene g106 5 AUGUSTUS gene 536276 538675 0.54 + . g106 5 AUGUSTUS transcript 536276 538675 0.54 + . g106.t1 5 AUGUSTUS start_codon 536276 536278 . + 0 transcript_id "g106.t1"; gene_id "g106"; 5 AUGUSTUS CDS 536276 538675 0.54 + 0 transcript_id "g106.t1"; gene_id "g106"; 5 AUGUSTUS stop_codon 538673 538675 . + 0 transcript_id "g106.t1"; gene_id "g106"; # protein sequence = [MSATSTERPSISKTESKKQKSALSRGNTTQAQKSNPAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERVQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEV # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMR # HMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKH # SSPRNTEVPELLNPGNTATRSPQPRSGTSPTVHALAQNATPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSN # PSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAPFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTEG # EVPTGGPLSKTGNTAGLSGRAPRVMREYTRGVLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g106 ### # start gene g107 5 AUGUSTUS gene 729400 731180 0.11 - . g107 5 AUGUSTUS transcript 729400 731180 0.11 - . g107.t1 5 AUGUSTUS stop_codon 729400 729402 . - 0 transcript_id "g107.t1"; gene_id "g107"; 5 AUGUSTUS CDS 729400 730398 0.67 - 0 transcript_id "g107.t1"; gene_id "g107"; 5 AUGUSTUS CDS 730986 731180 0.13 - 0 transcript_id "g107.t1"; gene_id "g107"; 5 AUGUSTUS start_codon 731178 731180 . - 0 transcript_id "g107.t1"; gene_id "g107"; # protein sequence = [MLDEKDTVEADQQELREFLALQQGEAAVAAKRKHDRSPLPVAGSSRKKVRLDAPKKHSRHRTPVADYSPHAIVCLTFP # LQSLLERFQKVEEELRITKKDWDDATGKLSTSSRRISELTTALLYQHGITDEGNALSTRQRARLEELQEEVHRTRGRAAFVERMIKEYPDGYYEVVLP # PLSQLKGDLVKVWADLRRVATLAHRLYRSDPATVLHHHNRYIGAIIEVVVAFLRRALETEDPDVMVHNVRLALDYMQLAHGTHGDLHIRSLSSIQWFF # NSAVDQDEGLYTLMLENSRFDSDRPFLTAAQHAGFTSPPSDLLEPPLHRRMLALSTALPHREGAGWWDDLVPAIPSDDQLTLDWEQLMLQYMHHITDT # PLPAPDVATSISLVGPGGESSGELE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g107 ### # start gene g108 5 AUGUSTUS gene 733140 733490 0.62 - . g108 5 AUGUSTUS transcript 733140 733490 0.62 - . g108.t1 5 AUGUSTUS stop_codon 733140 733142 . - 0 transcript_id "g108.t1"; gene_id "g108"; 5 AUGUSTUS CDS 733140 733490 0.62 - 0 transcript_id "g108.t1"; gene_id "g108"; 5 AUGUSTUS start_codon 733488 733490 . - 0 transcript_id "g108.t1"; gene_id "g108"; # protein sequence = [MSNSSKEPPPGQQKLGFHPTQTVRNQMTPASSAVSTNGDDDQRTLIAKAITMKLMASDEDCTVVLPVKLVKLAAAAKD # GKTKITQGDMWEKVALIGKILQECSFRDRMKHFRDELI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g108 ### # start gene g109 5 AUGUSTUS gene 739103 739756 0.58 + . g109 5 AUGUSTUS transcript 739103 739756 0.58 + . g109.t1 5 AUGUSTUS start_codon 739103 739105 . + 0 transcript_id "g109.t1"; gene_id "g109"; 5 AUGUSTUS CDS 739103 739109 0.59 + 0 transcript_id "g109.t1"; gene_id "g109"; 5 AUGUSTUS CDS 739356 739756 1 + 2 transcript_id "g109.t1"; gene_id "g109"; 5 AUGUSTUS stop_codon 739754 739756 . + 0 transcript_id "g109.t1"; gene_id "g109"; # protein sequence = [MIESTSSAPTTSTFVSTLLSTSSSISVPTSSSPSTLQTTVVTEAEASSSASTFAPESSATNTVTSVITVSSGPASSTT # AEIGSASSLSISSTSGSSASPSATEAAASSNSAWQPGVSQSQVYAFVVAGLLAAFLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g109 ### # start gene g110 5 AUGUSTUS gene 744860 745306 0.6 + . g110 5 AUGUSTUS transcript 744860 745306 0.6 + . g110.t1 5 AUGUSTUS start_codon 744860 744862 . + 0 transcript_id "g110.t1"; gene_id "g110"; 5 AUGUSTUS CDS 744860 745306 0.6 + 0 transcript_id "g110.t1"; gene_id "g110"; 5 AUGUSTUS stop_codon 745304 745306 . + 0 transcript_id "g110.t1"; gene_id "g110"; # protein sequence = [MTYCTPILILLVPTQLVTPTASSFVHAVSKEEEHHSTAKVLFDFTATSEFELSVSGEPFVAQFHNSEFKCSSEGSTVT # VIEHDDGSGWVKVKDGSGDGLVPASYLQHGTGPASSSNEQGSGQYGGFHLFSSLARDLHKGFFPSFTFMY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g110 ### # start gene g111 5 AUGUSTUS gene 754082 755219 0.95 - . g111 5 AUGUSTUS transcript 754082 755219 0.95 - . g111.t1 5 AUGUSTUS stop_codon 754082 754084 . - 0 transcript_id "g111.t1"; gene_id "g111"; 5 AUGUSTUS CDS 754082 754879 0.99 - 0 transcript_id "g111.t1"; gene_id "g111"; 5 AUGUSTUS CDS 754935 755219 0.96 - 0 transcript_id "g111.t1"; gene_id "g111"; 5 AUGUSTUS start_codon 755217 755219 . - 0 transcript_id "g111.t1"; gene_id "g111"; # protein sequence = [MQIFPLYEDILQRLRKEEPNERTLGLLWKLFLSPIERPVPSKEAVKAFEVFWFATYHGKDILFEPELIGYLKGLDMAL # GVGLAAGLTQSDDSQQTTGSLVPETQSLEPVPLTGSQILEKWFDTFTHADKANDPKIVPPSSSPIREPEISPPGGAAESSNLIPMLIDDEIPENQSNS # ASPRGFKRKRRQEDEEIVEETPAPISSVRISQREGAVPDIDELNNGSLDQRTKLKEKSKFKDKGKGRALSASEKQLKTPTKSGQKASETRSWIRESQL # MTPEPSAPPSSHHGHAAAVSVSLDEDEGDEDYGSWENAVVSPETFLHISRELDVDMDAPDTNMVERGEPITATRRHSNTLPHLSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g111 ### # start gene g112 5 AUGUSTUS gene 757590 758195 0.84 - . g112 5 AUGUSTUS transcript 757590 758195 0.84 - . g112.t1 5 AUGUSTUS stop_codon 757590 757592 . - 0 transcript_id "g112.t1"; gene_id "g112"; 5 AUGUSTUS CDS 757590 758195 0.84 - 0 transcript_id "g112.t1"; gene_id "g112"; 5 AUGUSTUS start_codon 758193 758195 . - 0 transcript_id "g112.t1"; gene_id "g112"; # protein sequence = [MNQSSNVKENIPLNKERYKAIEAEHDNKKYHTSHPHNNLNPPILSMASSSTTSPAEEAGNTIMSAHYLLSPLETLDES # LNDSHEERIGLHDLTETYNLLATRIKEILLQSSEPDQAASPLTLLAERSHVLLSALRRDVKRVLINPRTTSPKERSQGMDLDEVHYARDLALLGQQAI # RLTSELFAFPQLNATMHGMIHHSMH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g112 ### # start gene g113 5 AUGUSTUS gene 759509 759658 0.36 + . g113 5 AUGUSTUS transcript 759509 759658 0.36 + . g113.t1 5 AUGUSTUS start_codon 759509 759511 . + 0 transcript_id "g113.t1"; gene_id "g113"; 5 AUGUSTUS CDS 759509 759658 0.36 + 0 transcript_id "g113.t1"; gene_id "g113"; 5 AUGUSTUS stop_codon 759656 759658 . + 0 transcript_id "g113.t1"; gene_id "g113"; # protein sequence = [MGDSGNRSPEFMIQSGSGGAASNNSSDTSSTPTDSSSDSASDPPNTDAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g113 ### # start gene g114 5 AUGUSTUS gene 767361 768329 0.47 + . g114 5 AUGUSTUS transcript 767361 768329 0.47 + . g114.t1 5 AUGUSTUS start_codon 767361 767363 . + 0 transcript_id "g114.t1"; gene_id "g114"; 5 AUGUSTUS CDS 767361 768329 0.47 + 0 transcript_id "g114.t1"; gene_id "g114"; 5 AUGUSTUS stop_codon 768327 768329 . + 0 transcript_id "g114.t1"; gene_id "g114"; # protein sequence = [MLSHVMCDRYMRICGLAAGYLRGECEFQEEFPLETLRNYGRQFSESRSSIGDELPPPPYSQDGSSTSPTSVSIASQNN # LIKYDQASRRPRVRPLPPIPAVAVASGSTAPLLFHEKTVSPLPVPLPEIYRDRTGAPSASSSRRKQVLDVLFIPQSDALADSTTGHSISSGTPVHNTL # ESDIITEQRELDLRPLSLSISDTLSPTSSLNSPESPSSSPCLTSPSTIRRRFSLFRKKEKEKRFSLPSSMSSEASQLSLDNKALKAEEKRRKKEESRA # RTERLAEQLKARAEEHAQSEVDHNSTISAERRNKEPSAMYGGITGVIM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g114 ### # start gene g115 5 AUGUSTUS gene 769453 770448 0.97 + . g115 5 AUGUSTUS transcript 769453 770448 0.97 + . g115.t1 5 AUGUSTUS start_codon 769453 769455 . + 0 transcript_id "g115.t1"; gene_id "g115"; 5 AUGUSTUS CDS 769453 770448 0.97 + 0 transcript_id "g115.t1"; gene_id "g115"; 5 AUGUSTUS stop_codon 770446 770448 . + 0 transcript_id "g115.t1"; gene_id "g115"; # protein sequence = [MQVGNGNFAFGADVTSLQTFLPFATMSSWGWKNDSLPPNRTIEDVYNYKGESWYNHGRLVQYDFGGDPEIEQWLTANP # NRVNLGIVGLVFLDAQTGLIQNVSESDLSDVHQTLDLWTGIMSSEFTYEDTTINVTTTSAQDISAITVTVSSPLLSPNTSNAFTRLGIFLDFPWGDGS # QKFSAPFVGNFSSALFDNHTTTLLDHSEIQAQIKHQMVDAIFYTAVESSTKFDITRDSPIAHRYTILPHSDTNSLSLVISYNSTLPSSLPSSASLVQS # SIATWESYWMDGGFIDLITGSTDSRADELQRRIILSRYLMRVNEAGEDPPQEVMYSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g115 ### # start gene g116 5 AUGUSTUS gene 770716 771468 0.77 + . g116 5 AUGUSTUS transcript 770716 771468 0.77 + . g116.t1 5 AUGUSTUS start_codon 770716 770718 . + 0 transcript_id "g116.t1"; gene_id "g116"; 5 AUGUSTUS CDS 770716 771468 0.77 + 0 transcript_id "g116.t1"; gene_id "g116"; 5 AUGUSTUS stop_codon 771466 771468 . + 0 transcript_id "g116.t1"; gene_id "g116"; # protein sequence = [MEEYFWHSAHWALWSNWDILHRSSNVYTSFLPTSLSRSQVQQGWSSGARWPKMTDPSGRSSPGEINNLLIWEQPHPLV # FATYEYRAFPSLSTLEKWKDVVKATADWMAVFAWFNASTGVYDLGPPLYVVSEDTSPNVTVNPAFELAYWRFGLGLAEAWFNELREEVPRDWTTVKNN # LAPLPIQNNGTSTVYAVYEGIEPDFWTDPAYINDHPSLVGLHGWLPPTEGLDLGIAKVTIEEVWARWNFSNCWG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g116 ### # start gene g117 5 AUGUSTUS gene 776793 777800 0.64 - . g117 5 AUGUSTUS transcript 776793 777800 0.64 - . g117.t1 5 AUGUSTUS stop_codon 776793 776795 . - 0 transcript_id "g117.t1"; gene_id "g117"; 5 AUGUSTUS CDS 776793 777800 0.64 - 0 transcript_id "g117.t1"; gene_id "g117"; 5 AUGUSTUS start_codon 777798 777800 . - 0 transcript_id "g117.t1"; gene_id "g117"; # protein sequence = [MLGVLSRHSEVLRDMFELPQPDTMYDNDNDASRYEGCQVITMYDIPIELSNLVKALYDGVCVLLQIFLVVQETKWDLT # MGRTFHNRSVDDFFYLAGILRLSTKYVISHLRTQAIKHLTQTWSYDLKGHDNMLDLAIRTPQLSYSSDPNTPSKLSYPYIHPIHVLNLARSTNVRIVV # PSALYFLSLYPLTDLLRADHPKLQVAHPSKPSSSLQPSDLVNYTLMFQRRIDAILDFVNTVVGQRTSSARCTNGTGRTCTRNFQRLGMRLASSWVVRT # GPFNFIGQTMSQVSQNTEGFCAACRGDFATDVGAFRQKFWDDLPAVCGLPAWDVMREEELS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g117 ### # start gene g118 5 AUGUSTUS gene 786834 787877 0.91 - . g118 5 AUGUSTUS transcript 786834 787877 0.91 - . g118.t1 5 AUGUSTUS stop_codon 786834 786836 . - 0 transcript_id "g118.t1"; gene_id "g118"; 5 AUGUSTUS CDS 786834 787877 0.91 - 0 transcript_id "g118.t1"; gene_id "g118"; 5 AUGUSTUS start_codon 787875 787877 . - 0 transcript_id "g118.t1"; gene_id "g118"; # protein sequence = [MSVVSLRTAREMHDVADLLGSAIDAPVDRPRHERAKSDETILDPSVHPPTTDDESDVDKHSSSISSPSRSRLSYASTY # SQPSEFELVTADGQIERVYLPPSPSFSGFNIPRSRTSVISETPSLASSRSRSSYSSTSSHQLPPTPGIITPAEFADGTLLPVIVEKQSEGQEWSSNSS # SEEISVLHVSPPDTLVSSWPKQKSKLRWKVPISPRRDAITEEVRRPDSPGPWPPSFFDTLSPMSQNSPTTPSPTSPSTKTSPFSLFTKREKGSRSSLT # SSISSQASQLPLDNKTMKAEEKRRRKEEAKARTEKLAEQLKAKSKERARMEADNNSNFSAERRKRSQALCMVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g118 ### # start gene g119 5 AUGUSTUS gene 794900 795274 0.53 + . g119 5 AUGUSTUS transcript 794900 795274 0.53 + . g119.t1 5 AUGUSTUS start_codon 794900 794902 . + 0 transcript_id "g119.t1"; gene_id "g119"; 5 AUGUSTUS CDS 794900 795274 0.53 + 0 transcript_id "g119.t1"; gene_id "g119"; 5 AUGUSTUS stop_codon 795272 795274 . + 0 transcript_id "g119.t1"; gene_id "g119"; # protein sequence = [MKQLLRDQLDNCREQVSLLEEQERKNEQIRIEKEVQRDEMKNFLHGALEAQKELSAVSSEMAKSEGSSWVLFVVCRAL # IRAAGDLETIRVVLEENHHVQMAELRAHLEGALYPVARILLLRTDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g119 ### # start gene g120 5 AUGUSTUS gene 800885 802371 0.55 - . g120 5 AUGUSTUS transcript 800885 802371 0.55 - . g120.t1 5 AUGUSTUS stop_codon 800885 800887 . - 0 transcript_id "g120.t1"; gene_id "g120"; 5 AUGUSTUS CDS 800885 801875 0.94 - 1 transcript_id "g120.t1"; gene_id "g120"; 5 AUGUSTUS CDS 801941 802371 0.56 - 0 transcript_id "g120.t1"; gene_id "g120"; 5 AUGUSTUS start_codon 802369 802371 . - 0 transcript_id "g120.t1"; gene_id "g120"; # protein sequence = [MASLCHTIRQNQRDNSGNGSFDSFDDLLRQHAMELGEDEPSSSGIVSSTELSKRTPNNTSTRAAQISYSKDPLLAGSP # IDFSSGSSSSSDADADGETDEELYAQSDDSSSDSSESDSDVDFMILDCNPSPREYSAKPQLPVDVSVEPEDAPFIPQPTQPVHEHDSVAVFASDYPAA # SSPRLAPSDPLQFTSPFHSPTLPHRAFTPGPFTVLSAEIYDKAAVDPTPPMNLSATSMINPLQPMSKRKRVPTSSKRTSKARATTISDDDDEYKNNGS # DDDDEYAPSPPLAPKSRKRGRTVAVSRHRTSRRKQGVSPSSTSSRPTSSRSIPKRRRIAPESRNEQSDSPVLLDAIANTSVEDCDFICPVCGWEQSNK # RMPDYQRHLKTHLRPDREDKTKGWWCKGVRLEDKDEFNVKCEVNGSRKVRDDADPYWFHDHMRVGGCCQTFSRRDALKRHMANPNVRCGGIIAEGLRE # GDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g120 ### # start gene g121 5 AUGUSTUS gene 808921 812722 0.34 + . g121 5 AUGUSTUS transcript 808921 812722 0.34 + . g121.t1 5 AUGUSTUS start_codon 808921 808923 . + 0 transcript_id "g121.t1"; gene_id "g121"; 5 AUGUSTUS CDS 808921 808926 0.97 + 0 transcript_id "g121.t1"; gene_id "g121"; 5 AUGUSTUS CDS 809041 809543 0.35 + 0 transcript_id "g121.t1"; gene_id "g121"; 5 AUGUSTUS CDS 810610 812722 0.39 + 1 transcript_id "g121.t1"; gene_id "g121"; 5 AUGUSTUS stop_codon 812720 812722 . + 0 transcript_id "g121.t1"; gene_id "g121"; # protein sequence = [MFVIVNSVTLFWVSHYGLQNDEHARACSRSQSDDESIRFKSFITTQNSNNLESKSSDVAAEMTASELPSVPSRPLEVP # IIDVNGNQSQIGHIIQHDKDSKDEEFDHHASDFSSVSRSTDPEVAIVAIRTSSVYVDVDADEINSFTGPESVVFASMPPVSQTDHRDHTRNRVVNELL # LEANEARKSVDEARKFAEDSKKDALSQRDWFKSELDRIRIEWSAKSSESQTLLDEARVELQDIKYEFNNAKAESKEACNELEAIRLEKDTARNERDQA # VKMLHQAQLETEEWKREYEKREGEACILSYISTFTDTHKHHQVTHLHTQIAYWKDQAKKWHAFVVDSTHRQSKKVKSESAIAAVAPLTPASASGYSSR # RRGVDDEEQSEEIEDEDDTDPDTPIDSQRRRNPVATTFGNTTTLRQGAGVDTFNATGSEGNFQTPKTLTRTPKTVKPSTSGLTSTARAKAATSTSSAH # PSSSSKPALSRNEVLSSSRARRRDEVGTSHDNRGRQEDEVHSRDLNDPEDSQGEYERDKSLSSLVYPADPDRVLHIPPRTPRIRHDTNQDSHDDRITH # PVIAPTSSTSKAKAPPRSVIHSRLIRPVREYQFVVDIKEEDDEPGVIPGSSGGKVNGSVHHTSNRDVFEDVYAGEIEDDELEETSGDDTQPTPTRGRT # KRKGKARATERVPEHRSQSAWNLFDDEQVEDSVGVEAEIGPGVGSSTGVGSLSKRRGRDCSKKIGSVKSRGKSDVASSRSRSRPKPKSKHVDGDNDSD # GENDPNSEHGDDDDNKVEYHRPIQRTRHRVNPSRLSSPSLASSEDELMITSNGVGGIGDSPKTIGTGASRTPHHDSHASHPSSSKKRPPTPLTSSTSD # GGTASRKRRKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g121 ### # start gene g122 5 AUGUSTUS gene 813877 814170 0.94 + . g122 5 AUGUSTUS transcript 813877 814170 0.94 + . g122.t1 5 AUGUSTUS start_codon 813877 813879 . + 0 transcript_id "g122.t1"; gene_id "g122"; 5 AUGUSTUS CDS 813877 814170 0.94 + 0 transcript_id "g122.t1"; gene_id "g122"; 5 AUGUSTUS stop_codon 814168 814170 . + 0 transcript_id "g122.t1"; gene_id "g122"; # protein sequence = [MPSFPFRTIPPTIIRGSGIGSSKYLAEAQVHRVGENYQGKAIPLFIFDVVIDFPMSIYIDHNLVTIPYPASEDSDCID # SITNGDAELIKCKFNDPDF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g122 ### # start gene g123 5 AUGUSTUS gene 826045 827397 0.51 - . g123 5 AUGUSTUS transcript 826045 827397 0.51 - . g123.t1 5 AUGUSTUS stop_codon 826045 826047 . - 0 transcript_id "g123.t1"; gene_id "g123"; 5 AUGUSTUS CDS 826045 827397 0.51 - 0 transcript_id "g123.t1"; gene_id "g123"; 5 AUGUSTUS start_codon 827395 827397 . - 0 transcript_id "g123.t1"; gene_id "g123"; # protein sequence = [MDELTGRGTQFLVGDDNPAFEGIWEFCTISAGGSLGAAKRINEGRSDIAINWAGGLHHAKKREASGFCYINDIVLAIL # DLLRVFPRVLYVDIDCHHGDGVEEAFYTTDRVMTCSFHKYGEYFPGTGTQEDRGRGKGRGYALNVPLKDGMSDETFKSVFDPVLERILAVFRPSAIIL # QCGADSLSGDKLGCFNLTMQGHAHCTSFLRKFNIPLILLGGGGYTVKNVARAWCYETACALGVQHELVPEGEEGGMMPWNEYFEWFGPRYRLEVVKNN # MEDVNLRIADPSQDSEDSPDNSTHRIPIPHDVGRSWKQTEIDRVRERALQQIKELEGRIGAPSVQMMDVPRESVAEHAGFFNGSKEGQERQMEWQDEL # DVRLARKYQFRFFFASFACYFRSVLEGQYEYEQVGVCTTVILVYCLVYAFSMIFHYAYSPVPPRTDSTNLSPFFFRTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g123 ### # start gene g124 5 AUGUSTUS gene 829074 830094 0.9 + . g124 5 AUGUSTUS transcript 829074 830094 0.9 + . g124.t1 5 AUGUSTUS start_codon 829074 829076 . + 0 transcript_id "g124.t1"; gene_id "g124"; 5 AUGUSTUS CDS 829074 829426 0.9 + 0 transcript_id "g124.t1"; gene_id "g124"; 5 AUGUSTUS CDS 829497 830094 1 + 1 transcript_id "g124.t1"; gene_id "g124"; 5 AUGUSTUS stop_codon 830092 830094 . + 0 transcript_id "g124.t1"; gene_id "g124"; # protein sequence = [MFTLTKSFALLATILIHFHTAAAAPTQARQPPRPSPPSGSGSQFANAPGGQRGAGGASTAPTGSSTPQDVTTGTACAV # STATIDTSGTTLPAPSFAPSFIGLGVGTQNYTCNSAGTYTSTGALAELFDVSCLVGQSSFTSLQSTAFAAWNSSTSTAVSSTSGVLSSANVIASPITL # GQHYFITNPVTGSGLSPKWDFTSNALAGNADAFVVAAKIDDVAAPTGSADVDWLYLTNLTGTTGTLANEIYRIDTQGGQPPASVRFSCNPLVSKIACL # YCALQCTSGTADITVKYTAMYCEFPFAMSSKFEAPLLIIALL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g124 ### # start gene g125 5 AUGUSTUS gene 831781 832570 0.32 - . g125 5 AUGUSTUS transcript 831781 832570 0.32 - . g125.t1 5 AUGUSTUS stop_codon 831781 831783 . - 0 transcript_id "g125.t1"; gene_id "g125"; 5 AUGUSTUS CDS 831781 832144 0.36 - 1 transcript_id "g125.t1"; gene_id "g125"; 5 AUGUSTUS CDS 832414 832460 0.54 - 0 transcript_id "g125.t1"; gene_id "g125"; 5 AUGUSTUS CDS 832520 832570 0.64 - 0 transcript_id "g125.t1"; gene_id "g125"; 5 AUGUSTUS start_codon 832568 832570 . - 0 transcript_id "g125.t1"; gene_id "g125"; # protein sequence = [MAKGFLANLKGVDAFGKTTDDVKIKTRTGAFRAVDVMDISGETQRDISHSVRKMRLDPSGKEIHGSRSTSLKNEVEKY # TEDQPSDYCGSCYGGLEPASGCCNTCEEVRTAYINKGWSFSNPDTIEQVRSNVLFIYKYLYRIPRSVKKKVGHPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g125 ### # start gene g126 5 AUGUSTUS gene 847130 848164 0.58 + . g126 5 AUGUSTUS transcript 847130 848164 0.58 + . g126.t1 5 AUGUSTUS start_codon 847130 847132 . + 0 transcript_id "g126.t1"; gene_id "g126"; 5 AUGUSTUS CDS 847130 848164 0.58 + 0 transcript_id "g126.t1"; gene_id "g126"; 5 AUGUSTUS stop_codon 848162 848164 . + 0 transcript_id "g126.t1"; gene_id "g126"; # protein sequence = [MADMLHQHEDVYAPPTYPLYHSSTRSHHSKSEHAQGSPPSDIESDCLSTTTTDISYSSPTSESSALPASTPITCYPKQ # RSSSFLTGGSSRSGPRYIPSSLPTTSTLSSAFSDYEGKSTPPTQDDFLLSQFHGSFSRRSESRVSMYSSPSSPGSRSPPSLSALSTSPRRERPILPHA # AQGKLLVPEVYVRVPTRPSTSRRESSSSLASLASISSAPGGFTTRNRTGSMASIGSSRASLRSPLARYGGEFGDDEKDQCDLSEEDESACDDDDAPLS # PGLSGFGFASSPKRPMMSDMRAWSFDAYSKPSTGSAFSTIREPRRERRKKAEDRQRYNPDGKKLFLFPTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g126 ### # start gene g127 5 AUGUSTUS gene 855634 858949 0.45 + . g127 5 AUGUSTUS transcript 855634 858949 0.45 + . g127.t1 5 AUGUSTUS start_codon 855634 855636 . + 0 transcript_id "g127.t1"; gene_id "g127"; 5 AUGUSTUS CDS 855634 856171 0.45 + 0 transcript_id "g127.t1"; gene_id "g127"; 5 AUGUSTUS CDS 856257 858949 0.93 + 2 transcript_id "g127.t1"; gene_id "g127"; 5 AUGUSTUS stop_codon 858947 858949 . + 0 transcript_id "g127.t1"; gene_id "g127"; # protein sequence = [MYASYLKIDTSVSSLPGPFSVGSSASPVANSLGVSQVHVNRMRTSSNASSASSLSVLSPLASSSTNASSTSLVPSDTQ # SSTSRPASPGVNEPISILPEYVLAMHDYEPQHNISTCLSFRAGQVIHVLNRDASGWWDGELEGKRGWFPSNYVNADVNPLVETDEAETDIVVRYSLCY # SITTNSDIESHVPPVMVPLLHGLSLLQSAARSNRISHFQPSTACIISCVRSVLSATDTLLRDAPILRQFPPLADERRLILSTLASLVAQAKRASDEKL # NEDNLETEVEAMLRLAQQVFTLVRRFLAIVSQCGIELPTRRDASSPVVNVRVLRDANINSADDSNDTIMAQSIPLMSSGRTPTKPRVKGRPGTPGGAA # KAKSMGDLRSRAKATAEAVPAVPPLPSVRSTSAQHQLNGNRHKVGESSVSSTASTSTSSSVASMEALPQPPFPCGPCTMAQVLQALRTTHDHYLSAVA # AFVGHAHSHSRFSHASSMGHMYDLVREIVEMSCKLLTIVEAVLQHPDVPNHRLESLRTAKDQLYNVTSELAESVRLLTVPLPLAMSDDEEKKILLRSA # TAALKAGGDLVFSVKVCLNRSLGERPFIINVPHLGESGSAEAFRTASYSSSQIVLSLNHSPTPNNYGVDEEEDVTIQPRNAPNLRPDASSGSESSSSG # RVSKTSSMRSGETVVTDPDEPKALTPLIISKAVVDPALCSPTSLARTDDGTTWEGSTRNHPLSLEDKIIYGELPTVPSEPTAPIPFTFSNSAGYMFSH # DYAVDDIAYNSDGVLVGATLAVLVEKLTPHDSIVDPAFSAVFFMTFRLFCTPLEVVEALIARYNLVPPLGLSHDDILVWQQRKGLAVRLRVSNFIKLW # LDLYWRPTPDDSALPMLEAFTRNGLMTMFPGPAERIIDMIYGRKEQKDSGFSPKGDRSRDPGMSLNPPSAPPPSEIPRPLMTKTLLSALRSRNFAAIS # ITDFDPLELARQMTIMESRLYGQIMPEEILESGQDGSKPPVNVKEMSSLSTAITGWVAESILNERDTKKRTALVKFFIKVADVSSPWMKLQFSDPSIF # SVALVSTTTALSVRYWPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g127 ### # start gene g128 5 AUGUSTUS gene 861814 862882 0.95 + . g128 5 AUGUSTUS transcript 861814 862882 0.95 + . g128.t1 5 AUGUSTUS start_codon 861814 861816 . + 0 transcript_id "g128.t1"; gene_id "g128"; 5 AUGUSTUS CDS 861814 862095 0.95 + 0 transcript_id "g128.t1"; gene_id "g128"; 5 AUGUSTUS CDS 862148 862882 0.96 + 0 transcript_id "g128.t1"; gene_id "g128"; 5 AUGUSTUS stop_codon 862880 862882 . + 0 transcript_id "g128.t1"; gene_id "g128"; # protein sequence = [MPLDGHSYLVAQGWSGKGNGLRKGAIAKPIAVSQKKTLAGLGKDRDEAFPFWDQYVWSNSTTLTLHFSDVKKSLFSAA # SQAITVKIDDSDVSDSDEITPSVAPVLRRTTTGILSNRRPVNVKPASTSGTSTPDSTSSDTPRLSLIAVAKREAAKRNLYSRFYRGAVLAPAVDIQTI # ADPAGSTSSVTLPSPGSLSSRAKSKAQANEEETYVGEKNKKKKKKRKAGELEKEEGDIDKVESKAGRRERKRRKKEAKEMKLEAKMAKQEASEVLLKE # SKKKKNKEETKTSVDAYDDFPSRVASTGSDKVQEKEEKRQKKKKKERRVQDTEQVKSRKEKNQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g128 ### # start gene g129 5 AUGUSTUS gene 863267 864056 0.5 - . g129 5 AUGUSTUS transcript 863267 864056 0.5 - . g129.t1 5 AUGUSTUS stop_codon 863267 863269 . - 0 transcript_id "g129.t1"; gene_id "g129"; 5 AUGUSTUS CDS 863267 863695 0.99 - 0 transcript_id "g129.t1"; gene_id "g129"; 5 AUGUSTUS CDS 863754 864056 0.5 - 0 transcript_id "g129.t1"; gene_id "g129"; 5 AUGUSTUS start_codon 864054 864056 . - 0 transcript_id "g129.t1"; gene_id "g129"; # protein sequence = [MLPLTTADLLTHAIVGSVLENLDMERLVREVGAAVAQRILGNNESVDDVARELHERLLLRNESTKKVVIESIYKDSEE # SRHNVAVFTAAPSLADARPLLKRVQGTRFTDKYLAARAALTRSSYTYTSSYAPATPPRSPPSKAASSPTSSAFSSSGSPPRKVVTDFAAFGAPKNASV # FGTAVASSPFSLAGGKAAFGGMRTGVSRTTFDDDEDEEDDGRQRVELREDSISLDQACLYSSTCFIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g129 ### # start gene g130 5 AUGUSTUS gene 864321 864930 0.62 - . g130 5 AUGUSTUS transcript 864321 864930 0.62 - . g130.t1 5 AUGUSTUS stop_codon 864321 864323 . - 0 transcript_id "g130.t1"; gene_id "g130"; 5 AUGUSTUS CDS 864321 864742 0.62 - 2 transcript_id "g130.t1"; gene_id "g130"; 5 AUGUSTUS CDS 864840 864930 0.87 - 0 transcript_id "g130.t1"; gene_id "g130"; 5 AUGUSTUS start_codon 864928 864930 . - 0 transcript_id "g130.t1"; gene_id "g130"; # protein sequence = [MDEDMDFDAGSALQANAPQQSSTYPSNGSDSSQGSYISSATKNIENICGHIFESGKLQAVEDLRIGLVAFRDHPPQDH # TYIVKNFGFSSDISKVQKDLSTLYASGGGDGPEAVTAALVEALNMDWREHASRMVVLIADAPPHGIGEYGDGALSDLLNPYISTNYSRHRIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g130 ### # start gene g131 5 AUGUSTUS gene 871344 873071 0.45 + . g131 5 AUGUSTUS transcript 871344 873071 0.45 + . g131.t1 5 AUGUSTUS start_codon 871344 871346 . + 0 transcript_id "g131.t1"; gene_id "g131"; 5 AUGUSTUS CDS 871344 873071 0.45 + 0 transcript_id "g131.t1"; gene_id "g131"; 5 AUGUSTUS stop_codon 873069 873071 . + 0 transcript_id "g131.t1"; gene_id "g131"; # protein sequence = [MFLPMLKSSPDFRYIGYSTPSGHILWDTETWDKIIFSPTRTPFHRCFAVSNNHYLIGAEIRNIARESRNLFTLGIDPQ # QVMSCAFSCDGQTIALGLTGGLIEAWRIPLSKMVASYQLAPAAESPGLYLSLASSPRSNFIAVCFGVEVYLLHIADDSIVPAGHFRGPYPAYLRAVSY # SPGGQYIACRDNNGMVHVWSPEASIAQMPEFEGSSDSWQSIRSSSCCFIDGRFCISGTHDGTLSIWECDTGAVTQSWDAQSSVNAIAISTDGRFIASS # GFEEARIWSITKVDSAQPLFNLELEVVIAAPVEAVGFIPSTCAVTFSSDSTMLAISTGFNVDIWKLAKFNNWQRFTQIRTSLTRFIPHDDVALADDFI # RGNSSSLRALRFSYQWLAHSYHKLSVQVPSYFRYQISEAEYAESLQQCRGAFEWWKLPKSQLDILSFAHFQLYFSPDTKYILTPSGIYEVATGKEVVN # HERVRRPWEDSEFEELEVQFFWENNKQQYKRNGILKTLHPVHYRTGWIADSEDNLCFWIPHSHYHDTWPWTPWYSCASNGDRFGFISRDNSNLVFIHV # PGAGAVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g131 ### # start gene g132 5 AUGUSTUS gene 875359 875799 1 + . g132 5 AUGUSTUS transcript 875359 875799 1 + . g132.t1 5 AUGUSTUS start_codon 875359 875361 . + 0 transcript_id "g132.t1"; gene_id "g132"; 5 AUGUSTUS CDS 875359 875799 1 + 0 transcript_id "g132.t1"; gene_id "g132"; 5 AUGUSTUS stop_codon 875797 875799 . + 0 transcript_id "g132.t1"; gene_id "g132"; # protein sequence = [MSSLNSRGAWNYSTIAGSGKLGDSTPNVITTGDIGADISRRVSVTPLTPRLTQYKPTTFNLQNMAPPVSPSRIYVHVE # SHELRDIDIEANHPYDRASQAFKQPMFVNTKIRATDKQNYKENDVNSSASTDTVLELVKQDAHVGHNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g132 ### # start gene g133 5 AUGUSTUS gene 876903 878008 0.64 + . g133 5 AUGUSTUS transcript 876903 878008 0.64 + . g133.t1 5 AUGUSTUS start_codon 876903 876905 . + 0 transcript_id "g133.t1"; gene_id "g133"; 5 AUGUSTUS CDS 876903 877048 0.64 + 0 transcript_id "g133.t1"; gene_id "g133"; 5 AUGUSTUS CDS 877642 878008 0.98 + 1 transcript_id "g133.t1"; gene_id "g133"; 5 AUGUSTUS stop_codon 878006 878008 . + 0 transcript_id "g133.t1"; gene_id "g133"; # protein sequence = [MHPGTIKTDSVITAIPYWERIAIDTLQLPAATVLRLTDGSGRFDWLSGNVYPAISPESYFSGSSFRDKVVLVVGASKG # IGLSISTFYARAGAKLAIVSRSQKALDVAKSQIHLEVGSSAKPEVFSAVADVTDTNTIGEVVRKVMDKYGRLDIVVANAGTSSPWDKRKFYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g133 ### # start gene g134 5 AUGUSTUS gene 885708 887220 0.63 - . g134 5 AUGUSTUS transcript 885708 887220 0.63 - . g134.t1 5 AUGUSTUS stop_codon 885708 885710 . - 0 transcript_id "g134.t1"; gene_id "g134"; 5 AUGUSTUS CDS 885708 886765 0.65 - 2 transcript_id "g134.t1"; gene_id "g134"; 5 AUGUSTUS CDS 886823 886861 0.64 - 2 transcript_id "g134.t1"; gene_id "g134"; 5 AUGUSTUS CDS 887022 887220 0.64 - 0 transcript_id "g134.t1"; gene_id "g134"; 5 AUGUSTUS start_codon 887218 887220 . - 0 transcript_id "g134.t1"; gene_id "g134"; # protein sequence = [MSSTQPPSEPPSNPEKQPEAPEQSSPNEQTQDAAMDITPDQPAEDTFDDLSEDILSLGTDEILTRIQQSFTLSCWECG # RDVDPEGEEDGANQDLDSMRKGKCAVIKTSTRQTVFLPMIGLVPPEKLKPGDLVGVNKDSYLVLDTLPAEFDSRVKAMEVDERPTETYTDIGGLEKQI # EELVEAIVLPMQEAEKFKTLGIKPPKGCLMYGPPGTGKTLLARACAAQTQACYLKLAGPSLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGT # KRFDSDKSGDREVQRTMLELLNQLDGFSSDERIKVKLFYPFFATSDAIYSQVIAATNRIDILDPALLRSGRLDRKIEFPLPNETARARILEIHSRKMT # LSEDVNFEELARSTDEFNAAQLKATCVEAGMMALREGASKLTHEHFLTGIAEGELDLIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g134 ### # start gene g135 5 AUGUSTUS gene 887707 887961 0.43 + . g135 5 AUGUSTUS transcript 887707 887961 0.43 + . g135.t1 5 AUGUSTUS start_codon 887707 887709 . + 0 transcript_id "g135.t1"; gene_id "g135"; 5 AUGUSTUS CDS 887707 887961 0.43 + 0 transcript_id "g135.t1"; gene_id "g135"; 5 AUGUSTUS stop_codon 887959 887961 . + 0 transcript_id "g135.t1"; gene_id "g135"; # protein sequence = [MSEENGDDEFVKQTNTGLTTVVVPPATRSEGLTAAQQNKLMRDKEYQRRKRASTRRSAGTISDDDSVPTLGRRPTKRA # RLMDDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g135 ### # start gene g136 5 AUGUSTUS gene 892984 902100 0.88 + . g136 5 AUGUSTUS transcript 892984 902100 0.88 + . g136.t1 5 AUGUSTUS start_codon 892984 892986 . + 0 transcript_id "g136.t1"; gene_id "g136"; 5 AUGUSTUS CDS 892984 902100 0.88 + 0 transcript_id "g136.t1"; gene_id "g136"; 5 AUGUSTUS stop_codon 902098 902100 . + 0 transcript_id "g136.t1"; gene_id "g136"; # protein sequence = [MGGAGTDGAKGKSSDIQFTQNSTATDSAKDSAAQDKPSSYDEVCSSHPLRDAAIPHTVSTANASKAAVGTVGSISVAH # KGQTTGVGPGLVSQGGNNPTGSANADEVSSEDVNRSNVDEINENSSGLSSAPDSEDDGQGPWTTVQSRRSKSLDNLKTRKDFFKPDKLTKEQKATVKA # AEQRMTPAQREIINNRNIAIQKQQQACSYSKPQEVGPSSYVTKGKFVDHNNEVCDAELNIEVQKAELNHWNTAHGSIGAKNISSDVESEISDKSRRRL # RKNYHHKNGSQRRKSRNSKSEHSNSGTDDSANEHKKTKTSSRSIFKDVESLKPISSRFAKKIKDIAKGHQTTSKSTTHHGRHLSTQPVDQLPQDSLLA # RMIKTKKRSKKSIKNHESSSDSDADSESSDSESRSESMSSNGSSSSSSEELDSSDESVQYRKRHRHRSRSHSRKRGGRKSKKRTYNRIIKPVPPSIWN # GEADAEVFQRIVLEGYQFCKEGKIPKNERVFLISHYLSGKAYQFFALKVAKNHSKWSLQEFYEGLFNYCFPVNHREQMRTKLRKCYQNGRTVSEYVHE # LESIMDHVGIMSQREKVLKLWDGLSPGMRYELKRARVSKEVHSWRRIVREAELIELAGFEKDPSPRFAPKQSDRPRDDGIYFNKRDKNGRFRQRYHNS # STREKSEPIRTAPQSTPAPPSSSAPRNSARSDNSVRHNKNDYQSGRGRPQTNHDRTSRTTRKPDSDGNCYKCGQPGHFARNCPSNNIVHSRNNGPPGI # SARGMQFPLHDESSEMLAQLVETTEQPGVLTLNMMHFTSFVNDVSEDSAFEYMSEDNISLTPISNADSVLEDGLLPLPSNLSCSEIPDNDHDSLPDLE # SVSDSDIEADDIPDLQDVSDSEYDDDDMFDSLSTFEIDLLESDLWPQCSDSDPEGEESINLEWDSETLYQTEISSETPTMSGNESDSISESSETPEFS # FASDAKEVFGYPTTNWSDFFLHKTLEPGWWPRAIDDWMCLALTFVLNHDAPYPFDFMLWGAEGSYRFHVRNLDDGNYGITDENAPYDELTLPAQLLND # TTFKPGAWYAEQQTNLLNYPFDAGHWQDISTNLGDVYMQGMKFVLTCGIPAYPKSAFPALHDPFERFVIYKASGDDEDEYYFKDRENHLFSEHLPISL # LRNTKFNLVGWWCKQLTKSLHDIEVRLERKRIATHRKAFRKAKRSTWTCQKQGEIIAHAVAECLELNQPFPGDPELLERFYCRFDTWMTSDNLTICIL # DLLRKIRCDVSMEKAIQPGFKPGELWNEVCARISDVPEFIDMDYSRIGHLLETTARNKLARHVPFIPAIEAPGYSSRDNYSVYIDPEDSSQFIIADEG # RDFKTRISVNLLIRPQFNLPAWYRKRLENAENELLQRLRGPVECEFLPRLLFGTPTDEFELELDQLVGFSDHYLHLLFGNLSWEERNGLVHVTSLANA # YIEPKTYPGLQRNSGIAKEVGRLIPRPIVIVVRINDRPVRALIDSGSLGDFMSTQLSDQLKVTKQFHKTPIPLHLAIQGSRSKIHCGTTVNLRYQSIH # ADHYFDIANISNYDLILGTPWLFQYQVRIGLNPTTIEVGSDVPTAIQGDNVAEVRAQSMSIDGDDLEGARNVLLQYAQPICKTAAETPLPPLRRINHT # IPLIDENKIYPWRPSRCPEAYRPQWDQKRNDYVCSGRWIVTNSRNTVPMLLIPKAGQKDSLRVVFDLRARNANTYKMASPLPNIEGILRRVAKCKYRS # IVDGKDAYEQIRIVPEHVPRSTVTTPDGNMDSQVIQQGDCNGGATFQTVMNDLFSSMIGVFMDVYLDDIVIYSNTLEDHIRHVKIVIDILQREQFYLN # AKKLNFLPRELKILGQIVDDAGIRMDPDKVDSILKWKVPTSKEMLSGFLGAVGYLTDNLPGIRGPMGILHARTGAAVPFQWTFTEQRAFEDIQRITHQ # WQNHSRVPLDYSTGHKPIWIVTDASSASIAGFVCQGTNWRRSKIAAFFSAKLNSAQQNYAVHELEMLAGVETMLRHRDILQGTNFTWITDHKGLVHLL # KQKNLSGRQARWMEKLGEFDFTIEYVPGEENILSDALSRIYLNDAPGTVRAASEYTLFDDNSDNSHLGLHSVSMPVFTGQEARNKRVRKPVETADTGR # PETSKEFAARMKGRVRFLAPRKRGQEGAGTTGILLTTKSDKKSDFNMDYIENNVSVDVESQPKPPSSNGKLTIKLPARPKVPAHRSQREKADGHTQEH # VSKANSTSGTNPGLPAGKAPDSVNSITELDSGLSDATLISVLSKTNDNFDLYPALKGRYKEDPLFKKILESPKDYHNFEVINDLIYLKQKETRVLCIP # KIIINGRSIQEIIIAEAHSLLAHLGASKTLDYLRDHVWWKDMVADTKSFCESCHVCKLSKPDNTKSYGKLHPLEIPSYPWEAIGVDFVGPLPQSKNRD # SSFDSICVIIDLLTSMVHLVPCKTTYTARQVAELMFEHVYKLHGLPKRIISDRDSLFTSIFWKRLHELIGVNLHMSSAYHPQSDGATERANRTVTQML # RQCVSATQKDWVSKLPAIEFAINCARSESTGYAPFILNNGRMPRSMVWSSDLSNEYPSVRTFARLRRLAIMAAHDSILEARVKQTRAANRKRRFDPFK # EEDLVYVSTKNLTFEKGLARKLIPKYIGPFKITKDFGNHSFRVSLPNHFIQRGVHPVFHSSLLRIHVPNDDRRFPGRHDTQLHESPVAQPQWRIEKIL # SHTGSRRHAIFQVQWSTGDITWMPFAEISQLPCLPEYLELLGLQTIDQLPKGAGTVPEEVSIEMGIASIRFQVFDLCDGFENMKFSPSSSSYNSDSLS # NPFPPSVYQHSLPASPHLSHSSLPILPHPIMAPLEFQHIERQSHSKFALVAKNDDGDKIIFSAQQVRLYVYFDKNLRRMQKRIGYTPIGYHSFASEFN # KEDLPYKFAYWDHASFHEPTITNLNTQSPPMSIFGIKEWECFAPNKAVRPGYEEVLSTEYRELCSMALEQARGATRGRRKAEVRKQEKKNAAAAAEHK # KTGTLHFHSGPKNAGSSSRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g136 ### # start gene g137 5 AUGUSTUS gene 908544 909062 0.72 + . g137 5 AUGUSTUS transcript 908544 909062 0.72 + . g137.t1 5 AUGUSTUS start_codon 908544 908546 . + 0 transcript_id "g137.t1"; gene_id "g137"; 5 AUGUSTUS CDS 908544 909062 0.72 + 0 transcript_id "g137.t1"; gene_id "g137"; 5 AUGUSTUS stop_codon 909060 909062 . + 0 transcript_id "g137.t1"; gene_id "g137"; # protein sequence = [MQLDGLGALFDQARQSFLRSFLDLQQAGQDPIVVLEALKAAEPQRESISVEDWTLLATLFQWSSPFNLNGLKFDNRTP # AEWIDLLRSIHSGATSATVTVDGHLVDTSQPPEAAVEVSEALDPQGSPPSTVIEQTSGVENLASLSEGSPIQTELDLPQIESLTESALAPEKGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g137 ### # start gene g138 5 AUGUSTUS gene 912416 914148 0.56 + . g138 5 AUGUSTUS transcript 912416 914148 0.56 + . g138.t1 5 AUGUSTUS start_codon 912416 912418 . + 0 transcript_id "g138.t1"; gene_id "g138"; 5 AUGUSTUS CDS 912416 912970 0.7 + 0 transcript_id "g138.t1"; gene_id "g138"; 5 AUGUSTUS CDS 913045 914148 0.66 + 0 transcript_id "g138.t1"; gene_id "g138"; 5 AUGUSTUS stop_codon 914146 914148 . + 0 transcript_id "g138.t1"; gene_id "g138"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTARIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPCGEPG # DPSGPGGPAQRAMLDLLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKE # WFVPDILDPDLDSLPAWMSSFTALVKELQDNFGVYDAQGEAEDALGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPE # PATLAAYRLEVLRIDNRYWKREETKKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPA # FNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARNRRAALPRLKKTPKQPLRLLKRIRKTNPQLLFPGTKRELH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g138 ### # start gene g139 5 AUGUSTUS gene 914918 917998 0.99 + . g139 5 AUGUSTUS transcript 914918 917998 0.99 + . g139.t1 5 AUGUSTUS start_codon 914918 914920 . + 0 transcript_id "g139.t1"; gene_id "g139"; 5 AUGUSTUS CDS 914918 917998 0.99 + 0 transcript_id "g139.t1"; gene_id "g139"; 5 AUGUSTUS stop_codon 917996 917998 . + 0 transcript_id "g139.t1"; gene_id "g139"; # protein sequence = [MEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGHIYP # LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRVKIYTKLDLAHAYHLVRIAEGDE # WKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRHHRLYANPEKCEFNMDTVEYLGYIL # SPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGAPWIWDRSCQEAFENLKTAFTSAPILAHWEPNRPLIVETD # ASDYAIAAILSIQYADGEIHPLAFLSRMLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNM # VIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLELAKDPS # NERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRGQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRP # WDSISMDFIEQLPMSNGFTAILVVVDRSSKQAIFIPTHNTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEA # DGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTSITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRY # KEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDG # EEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g139 ### # start gene g140 5 AUGUSTUS gene 918364 919247 0.56 - . g140 5 AUGUSTUS transcript 918364 919247 0.56 - . g140.t1 5 AUGUSTUS stop_codon 918364 918366 . - 0 transcript_id "g140.t1"; gene_id "g140"; 5 AUGUSTUS CDS 918364 918942 0.79 - 0 transcript_id "g140.t1"; gene_id "g140"; 5 AUGUSTUS CDS 919122 919247 0.56 - 0 transcript_id "g140.t1"; gene_id "g140"; 5 AUGUSTUS start_codon 919245 919247 . - 0 transcript_id "g140.t1"; gene_id "g140"; # protein sequence = [MKARKAAAAARRKAEEEAAKKAAEEAQRKKEAAARELEERRRPVGGDPDDGDDGDDDDDDEDDRTPCERCRSKRIPCL # QQAGKRSSTTCKPCHDAKVCCSHSNRPPTVKKEVASHPTGERLAVLESQVAQLLADNRVLREGQIKSNTYDRHIIKKLEWLMRDAARRRDSPPEMPEP # GPSRLPKKRRRVVDSKEEEEDRIVGAEDGEGEEEVEEEEGIEPAPKKARSEKGKEREE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g140 ### # start gene g141 5 AUGUSTUS gene 920313 921707 0.51 - . g141 5 AUGUSTUS transcript 920313 921707 0.51 - . g141.t1 5 AUGUSTUS stop_codon 920313 920315 . - 0 transcript_id "g141.t1"; gene_id "g141"; 5 AUGUSTUS CDS 920313 921707 0.51 - 0 transcript_id "g141.t1"; gene_id "g141"; 5 AUGUSTUS start_codon 921705 921707 . - 0 transcript_id "g141.t1"; gene_id "g141"; # protein sequence = [MPQDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYK # DVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTD # NAGQMKNMLAWLEEKYGIKGLRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVEST # WLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKNWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKG # GSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g141 ### # start gene g142 5 AUGUSTUS gene 922524 924215 0.98 + . g142 5 AUGUSTUS transcript 922524 924215 0.98 + . g142.t1 5 AUGUSTUS start_codon 922524 922526 . + 0 transcript_id "g142.t1"; gene_id "g142"; 5 AUGUSTUS CDS 922524 924215 0.98 + 0 transcript_id "g142.t1"; gene_id "g142"; 5 AUGUSTUS stop_codon 924213 924215 . + 0 transcript_id "g142.t1"; gene_id "g142"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQGPPVDPDDPGADNNNNDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAQFTPKPKPFS # GGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g142 ### # start gene g143 5 AUGUSTUS gene 924548 928111 0.96 + . g143 5 AUGUSTUS transcript 924548 928111 0.96 + . g143.t1 5 AUGUSTUS start_codon 924548 924550 . + 0 transcript_id "g143.t1"; gene_id "g143"; 5 AUGUSTUS CDS 924548 928111 0.96 + 0 transcript_id "g143.t1"; gene_id "g143"; 5 AUGUSTUS stop_codon 928109 928111 . + 0 transcript_id "g143.t1"; gene_id "g143"; # protein sequence = [MANIAVRFPAGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINTVVAKVAV # PLPEPSPSVSPTILETPPGDSPRSRSRSRSRTSRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTAPTVPPLPPSIPAEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g143 ### # start gene g144 5 AUGUSTUS gene 928475 929573 0.47 - . g144 5 AUGUSTUS transcript 928475 929573 0.47 - . g144.t1 5 AUGUSTUS stop_codon 928475 928477 . - 0 transcript_id "g144.t1"; gene_id "g144"; 5 AUGUSTUS CDS 928475 929059 1 - 0 transcript_id "g144.t1"; gene_id "g144"; 5 AUGUSTUS CDS 929160 929573 0.47 - 0 transcript_id "g144.t1"; gene_id "g144"; 5 AUGUSTUS start_codon 929571 929573 . - 0 transcript_id "g144.t1"; gene_id "g144"; # protein sequence = [MSASRTTTTTISATAGPSRSRPVPPPPPPPPSDSAAQEEEDLEDEDEDDIIRRAHARVERVRARKAAEAARKKAEEEA # ARAAAERERKAQEAREQARRAQQQQEEVTERRRLLAAAATARSQRGTSPSEVSVSPRRPVPVDEDPDDGDDGDDDDDEKEPCERCRTKKISCQMQAGK # RSSIICKPCHDAKVRCSYSGRPFTVKREGGSNPTGERLAVLESQVAQLLADNRQLRDGQVKANTYHRHMNRKLDWLVTDAARRRRTPPEMPQAGPSEL # PKKRRRVMDSDEEEDREREKEVEEQGMEEDGEGDEDEMVEEEPAPAKAQSEKGKERAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g144 ### # start gene g145 5 AUGUSTUS gene 930723 934681 0.3 - . g145 5 AUGUSTUS transcript 930723 934681 0.3 - . g145.t1 5 AUGUSTUS stop_codon 930723 930725 . - 0 transcript_id "g145.t1"; gene_id "g145"; 5 AUGUSTUS CDS 930723 933175 0.47 - 2 transcript_id "g145.t1"; gene_id "g145"; 5 AUGUSTUS CDS 933376 934681 0.32 - 0 transcript_id "g145.t1"; gene_id "g145"; 5 AUGUSTUS start_codon 934679 934681 . - 0 transcript_id "g145.t1"; gene_id "g145"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRIEAPKSIDRPLKKPSVTIE # DVDESDDEDTIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEVNNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPHGYKRCEQETFSKKELSEAYVLASREHLKSQDEQA # EEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPIRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNE # NTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINL # IDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFAPTGRYTEERKEIIDKNHPEGFLWEQ # ERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVH # SLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPY # IDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKVFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKT # EVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFG # SMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRVTPGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g145 ### # start gene g146 5 AUGUSTUS gene 934711 935772 0.52 - . g146 5 AUGUSTUS transcript 934711 935772 0.52 - . g146.t1 5 AUGUSTUS stop_codon 934711 934713 . - 0 transcript_id "g146.t1"; gene_id "g146"; 5 AUGUSTUS CDS 934711 935772 0.52 - 0 transcript_id "g146.t1"; gene_id "g146"; 5 AUGUSTUS start_codon 935770 935772 . - 0 transcript_id "g146.t1"; gene_id "g146"; # protein sequence = [MITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPP # INNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMIEIRAVKSLQSHFKEGADIMTQLT # AVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRNNARMPRDDPNVPR # YKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g146 ### # start gene g147 5 AUGUSTUS gene 936646 937821 0.98 + . g147 5 AUGUSTUS transcript 936646 937821 0.98 + . g147.t1 5 AUGUSTUS start_codon 936646 936648 . + 0 transcript_id "g147.t1"; gene_id "g147"; 5 AUGUSTUS CDS 936646 937821 0.98 + 0 transcript_id "g147.t1"; gene_id "g147"; 5 AUGUSTUS stop_codon 937819 937821 . + 0 transcript_id "g147.t1"; gene_id "g147"; # protein sequence = [MSTPIPPATPAPPASAEDLMTQLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS # QAKLIKSALGFFTESAGDWATPHLLHFNAEHPPFGGNWEEFLKEFGQRFESVDPGMEARSKIKNLKQSKGQTVAEFAQKFKDIGDRTGMSDIDLRERF # FTALLPEIRQNLIIVNIAQGLAPTLKEAIKQAISVDVYMHDPTMTGRNSGHTPTHAAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQG # HVKQNCPHQETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPTPFSLFPNESVQIASSTPTSAPATVPATPSPPNQDFSNQIGQIRE # LLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g147 ### # start gene g148 5 AUGUSTUS gene 938652 941588 0.99 + . g148 5 AUGUSTUS transcript 938652 941588 0.99 + . g148.t1 5 AUGUSTUS start_codon 938652 938654 . + 0 transcript_id "g148.t1"; gene_id "g148"; 5 AUGUSTUS CDS 938652 941588 0.99 + 0 transcript_id "g148.t1"; gene_id "g148"; 5 AUGUSTUS stop_codon 941586 941588 . + 0 transcript_id "g148.t1"; gene_id "g148"; # protein sequence = [MVPEQYRDFKKVFSESASEQLPAHQPWDHAIDLIPGAPATMRTKIYPMSLNEQEELDCFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLMADIISRLQGAQYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAVYLDDILIFSSDLQEHRRVVREVLIRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPTPTNLRELRGF # LGFANFYRRFIRNFARIARPLNDLTRKDISFTWMDTQQQAFDTLRGAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ # PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRINTQADALSRMAAHQVLDNEDN # RQQTVLKPNHFTKIAASILRNPLEDRIRKASQREAQVLEGLKTVKEHGLQHLANGIAEWEEDNGLVYYRGQVYVPADNDLRTEVLRQCHDHPTAGHPG # LHGTLDLVSTHFWWPTLRSFVEKYVEGCETCARKKIQRHPRAVTQPLDVPLGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHALPCTSSITAEG # VADIYYKEIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSAL # GMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDFVWLSAEDINLQLSSEKLGDRQLGPYR # ILEKIGPLDYRLDLPISLDRIHPVFHVDKLYPWKGNTINGEIPPPPEPVYLEDEDEPEYEVEEILDSRVRWKRLEYLVKWKGYDAGHNSWEPAPNLSR # APKIVRAFHKKHPTAAKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g148 ### # start gene g149 5 AUGUSTUS gene 942049 943950 0.38 - . g149 5 AUGUSTUS transcript 942049 943950 0.38 - . g149.t1 5 AUGUSTUS stop_codon 942049 942051 . - 0 transcript_id "g149.t1"; gene_id "g149"; 5 AUGUSTUS CDS 942049 942932 0.6 - 2 transcript_id "g149.t1"; gene_id "g149"; 5 AUGUSTUS CDS 943935 943950 0.46 - 0 transcript_id "g149.t1"; gene_id "g149"; 5 AUGUSTUS start_codon 943948 943950 . - 0 transcript_id "g149.t1"; gene_id "g149"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLNPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIVSRSGRGGVTSGAGKRSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g149 ### # start gene g150 5 AUGUSTUS gene 960481 960969 0.84 - . g150 5 AUGUSTUS transcript 960481 960969 0.84 - . g150.t1 5 AUGUSTUS stop_codon 960481 960483 . - 0 transcript_id "g150.t1"; gene_id "g150"; 5 AUGUSTUS CDS 960481 960969 0.84 - 0 transcript_id "g150.t1"; gene_id "g150"; 5 AUGUSTUS start_codon 960967 960969 . - 0 transcript_id "g150.t1"; gene_id "g150"; # protein sequence = [MPSSPNVDAMLGIIQELVEETSQWDDSLFMDTSFKALIENSRLTSADSPLLSSKSFRHSRQPSGPRGIVLPVPSPPNS # RSSSESARPRTHSSSSVTSVKFKAPSINDNTAAVTNAPGNTSSLHNSSAIGTERKLSPKSILKKTLMMPRVPSSLSRGWLGSVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g150 ### # start gene g151 5 AUGUSTUS gene 962582 966948 0.29 + . g151 5 AUGUSTUS transcript 962582 966948 0.29 + . g151.t1 5 AUGUSTUS start_codon 962582 962584 . + 0 transcript_id "g151.t1"; gene_id "g151"; 5 AUGUSTUS CDS 962582 963901 0.42 + 0 transcript_id "g151.t1"; gene_id "g151"; 5 AUGUSTUS CDS 964061 964200 0.3 + 0 transcript_id "g151.t1"; gene_id "g151"; 5 AUGUSTUS CDS 964752 966948 0.88 + 1 transcript_id "g151.t1"; gene_id "g151"; 5 AUGUSTUS stop_codon 966946 966948 . + 0 transcript_id "g151.t1"; gene_id "g151"; # protein sequence = [MSTQSSVASNNNTRTLTRYRSALLADATRSLSELPFFDSDFSLSRDLDIAHGFYQVPISTYRPSSPVSSDSDSDSEYY # FSQTPIHPEMPSVFSSVLDETVTYAKWKPCGNGMPGNMSCGKITVETLEAAKRDLWIFLTNNRKLALSDYTLRCLNVWEDPRVSNWIEQNCEEFTKLS # FEEFFVVVRDRVLDPDWQDSTFRKMRAVRMPDDLQTSISDLAVQLMVLNNLLQGTPRFQSEDSLKMMLIDAADTGLREAYNKEVDDHSGNPLHGIHAK # DFHIFTRAFQVLDHGRHRQLLIACQMAEHMICSHPNSRATTPLALSTAANTQGRRTANTSGGQNGRLPPLTTNERRLLSENDGCFKCRSFFVKCRTSS # SEHEFPLPNGNGYKELTTTDVDTARKLRGTIETNKKPRTGPIAAEDDGVVASIMPSAVLGDGTDSEEEKPEPVCAAFQSGNQSIAPLTEYVLLKISSV # NGSFTSRNVPFVIAPNFGKIRPSDSAYASPSFVIPKADPNALPHWVADYRQLNDNTITDAQPLPRIDDILSDCAKGHIWGKIDMTDSFFQTRMDEDSI # KLMAITTPFGLYEWTVMPQGLKNSPAIHQRRVTSALRHLIGKICYVYVDDIIIWSKSVEEHIINVEKVLLALRTAQLYCNLKKCELFTFNVHFLGHSI # SKDGIAADDKKVDRILDWPIPKTVKELRAFLGLVRYVAAFLPRLAELTEILTRLTANNVDKDNLPWEAQHDRAFEAIKVLVASCECLTVIDLDLLDTH # KIFVTTDASDRCSGAVLSSGTSWETARPVSFDSSTFKGAELNYPVHEKEMLAIIRALKKWRVDLLGVPFVIMTDHCTLENFHTQPDLSRRQARWMEFF # PQFDCKIVYVTGERNSVADALSRHIDLCSTPVDSSAEAILGSHHPYAYCADTDDNLDLLILCVLEDSSWSGARALANLPYVEPDPPFVAATLEITGDA # TLLQEIREGYTTDPWCKDLPSMAASMPLVRKDLESKLWYIGEQLIIPRSGHIRKELFRLAHDNLGHFGFDKSYAALRESYYWPTCDATLRKPTSRPAM # NASATSLLPKRKLALCIPCLCQNTGSPPSQWTLLGLSLRTAARTASSQSPTGWVPTYGSSPAAPIYLLAIVLNSSLTIGTAKTACRRTLSATVITYSC # QNFGKPCALCLVSASGCLPPTTPNLTAPANGAIKPLYKCSATTLNGIKKAGSEPCLASVSKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g151 ### # start gene g152 5 AUGUSTUS gene 970943 971752 1 + . g152 5 AUGUSTUS transcript 970943 971752 1 + . g152.t1 5 AUGUSTUS start_codon 970943 970945 . + 0 transcript_id "g152.t1"; gene_id "g152"; 5 AUGUSTUS CDS 970943 971752 1 + 0 transcript_id "g152.t1"; gene_id "g152"; 5 AUGUSTUS stop_codon 971750 971752 . + 0 transcript_id "g152.t1"; gene_id "g152"; # protein sequence = [MLTPVPPAPNTSAEDLMAQLIRQVANLATGMKERSSSKSSMNKPEVFKGKDGAEAHRFMAQFQNWVSEQPDLAKSQVK # LMKSTLGFFTESAGDWATPHLLHFSAENPPFGGNRDMFLKEFSQRFEPMDPGMEARSKIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLREPFFTA # LLPEIRQHLITVNIAQGIALTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHTMDIDATHTSNGNTREAFLACMRGRCFGCGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g152 ### # start gene g153 5 AUGUSTUS gene 972160 973725 0.97 + . g153 5 AUGUSTUS transcript 972160 973725 0.97 + . g153.t1 5 AUGUSTUS start_codon 972160 972162 . + 0 transcript_id "g153.t1"; gene_id "g153"; 5 AUGUSTUS CDS 972160 973725 0.97 + 0 transcript_id "g153.t1"; gene_id "g153"; 5 AUGUSTUS stop_codon 973723 973725 . + 0 transcript_id "g153.t1"; gene_id "g153"; # protein sequence = [MFATSSYDLHPSCTISLIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFATRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQEQWMDFLITNLGGEDVILGLPWLRKVNPEIDWEKRQLSVKPPRVAIEEVPDEEILYSHLAATTTESPILELPN # LEPPTEPPHIEVPLEATLEESESAVVEEPLIHRIRANHKTRWAWVKAGILEEQTEEVWCTAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLIPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYWKLNEYTVKNRYPLPL # VADIISQLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFARTQGLFEPKVMFFGLTNSPATFQALMNAIFADLIAASKVAVYLDDILIFSNDLEEHRRV # VREVLTQLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRIDLVKVAAVCD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g153 ### # start gene g154 5 AUGUSTUS gene 976850 977547 0.39 + . g154 5 AUGUSTUS transcript 976850 977547 0.39 + . g154.t1 5 AUGUSTUS start_codon 976850 976852 . + 0 transcript_id "g154.t1"; gene_id "g154"; 5 AUGUSTUS CDS 976850 977060 0.59 + 0 transcript_id "g154.t1"; gene_id "g154"; 5 AUGUSTUS CDS 977126 977547 0.61 + 2 transcript_id "g154.t1"; gene_id "g154"; 5 AUGUSTUS stop_codon 977545 977547 . + 0 transcript_id "g154.t1"; gene_id "g154"; # protein sequence = [MMRSVPSKDLDAFASLRGKGSLAGASKRNPLAPPLEIKSSTSIPKAPVAPPRLIRRNRELENLKADASSFLASPRSTR # SRDSDNELLSGFPLVDAAPRASSPTKVPVSRKEPKSKTAVKVVEDSKASDPPTSALVYKRVRLPPRSRKIAPAASKGKARQTIVTEADSASSEVESED # EDEEEDSAPPPKRLKTTSSISGKSLFFIYFVLFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g154 ### # start gene g155 5 AUGUSTUS gene 978162 978826 0.46 + . g155 5 AUGUSTUS transcript 978162 978826 0.46 + . g155.t1 5 AUGUSTUS start_codon 978162 978164 . + 0 transcript_id "g155.t1"; gene_id "g155"; 5 AUGUSTUS CDS 978162 978210 0.46 + 0 transcript_id "g155.t1"; gene_id "g155"; 5 AUGUSTUS CDS 978273 978826 1 + 2 transcript_id "g155.t1"; gene_id "g155"; 5 AUGUSTUS stop_codon 978824 978826 . + 0 transcript_id "g155.t1"; gene_id "g155"; # protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTARELFLRSILDLQNAGEDPVVVLEALKAAEPNRRAIN # LNEWTLLATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIHSGESTASIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGTSSQVGGSIPMELDLP # AIESLAEPALSPEKGAEPAQTLES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g155 ### # start gene g156 5 AUGUSTUS gene 979855 981305 0.48 + . g156 5 AUGUSTUS transcript 979855 981305 0.48 + . g156.t1 5 AUGUSTUS start_codon 979855 979857 . + 0 transcript_id "g156.t1"; gene_id "g156"; 5 AUGUSTUS CDS 979855 980022 0.93 + 0 transcript_id "g156.t1"; gene_id "g156"; 5 AUGUSTUS CDS 980664 980796 0.99 + 0 transcript_id "g156.t1"; gene_id "g156"; 5 AUGUSTUS CDS 980878 981305 1 + 2 transcript_id "g156.t1"; gene_id "g156"; 5 AUGUSTUS stop_codon 981303 981305 . + 0 transcript_id "g156.t1"; gene_id "g156"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRGTPYPTGPNKGSNKDEKSA # VNEVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSR # QDSGSDSSVSDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g156 ### # start gene g157 5 AUGUSTUS gene 981567 984836 0.74 - . g157 5 AUGUSTUS transcript 981567 984836 0.74 - . g157.t1 5 AUGUSTUS stop_codon 981567 981569 . - 0 transcript_id "g157.t1"; gene_id "g157"; 5 AUGUSTUS CDS 981567 984836 0.74 - 0 transcript_id "g157.t1"; gene_id "g157"; 5 AUGUSTUS start_codon 984834 984836 . - 0 transcript_id "g157.t1"; gene_id "g157"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY # ILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIA # QVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQI # DPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHG # PDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKD # ATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIEKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEK # EKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLS # SWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLK # MILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDF # KPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWM # TPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g157 ### # start gene g158 5 AUGUSTUS gene 985126 985586 0.87 - . g158 5 AUGUSTUS transcript 985126 985586 0.87 - . g158.t1 5 AUGUSTUS stop_codon 985126 985128 . - 0 transcript_id "g158.t1"; gene_id "g158"; 5 AUGUSTUS CDS 985126 985507 0.92 - 1 transcript_id "g158.t1"; gene_id "g158"; 5 AUGUSTUS CDS 985564 985586 0.92 - 0 transcript_id "g158.t1"; gene_id "g158"; 5 AUGUSTUS start_codon 985584 985586 . - 0 transcript_id "g158.t1"; gene_id "g158"; # protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY # ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDEGINK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g158 ### # start gene g159 5 AUGUSTUS gene 985910 987982 0.28 - . g159 5 AUGUSTUS transcript 985910 987982 0.28 - . g159.t1 5 AUGUSTUS stop_codon 985910 985912 . - 0 transcript_id "g159.t1"; gene_id "g159"; 5 AUGUSTUS CDS 985910 987162 0.58 - 2 transcript_id "g159.t1"; gene_id "g159"; 5 AUGUSTUS CDS 987322 987982 0.3 - 0 transcript_id "g159.t1"; gene_id "g159"; 5 AUGUSTUS start_codon 987980 987982 . - 0 transcript_id "g159.t1"; gene_id "g159"; # protein sequence = [MKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTD # HFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELS # DRLGNLKHTEKMMSVCSTKIVQMEKNKYSNEGAGSVHENFKIQCCSKVHRSAFEEAFSHDEDVDESDDEDTIKLIPSSRPTNQINNEHRPYDHVQPRT # YRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGE # TEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVT # SEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIK # TFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g159 ### # start gene g160 5 AUGUSTUS gene 988036 988899 0.81 - . g160 5 AUGUSTUS transcript 988036 988899 0.81 - . g160.t1 5 AUGUSTUS stop_codon 988036 988038 . - 0 transcript_id "g160.t1"; gene_id "g160"; 5 AUGUSTUS CDS 988036 988899 0.81 - 0 transcript_id "g160.t1"; gene_id "g160"; 5 AUGUSTUS start_codon 988897 988899 . - 0 transcript_id "g160.t1"; gene_id "g160"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIQGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g160 ### # start gene g161 5 AUGUSTUS gene 1005454 1006620 0.86 + . g161 5 AUGUSTUS transcript 1005454 1006620 0.86 + . g161.t1 5 AUGUSTUS start_codon 1005454 1005456 . + 0 transcript_id "g161.t1"; gene_id "g161"; 5 AUGUSTUS CDS 1005454 1006620 0.86 + 0 transcript_id "g161.t1"; gene_id "g161"; 5 AUGUSTUS stop_codon 1006618 1006620 . + 0 transcript_id "g161.t1"; gene_id "g161"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFIGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g161 ### # start gene g162 5 AUGUSTUS gene 1006671 1010387 0.96 + . g162 5 AUGUSTUS transcript 1006671 1010387 0.96 + . g162.t1 5 AUGUSTUS start_codon 1006671 1006673 . + 0 transcript_id "g162.t1"; gene_id "g162"; 5 AUGUSTUS CDS 1006671 1010387 0.96 + 0 transcript_id "g162.t1"; gene_id "g162"; 5 AUGUSTUS stop_codon 1010385 1010387 . + 0 transcript_id "g162.t1"; gene_id "g162"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVGEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNNLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQHIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRLASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLNLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g162 ### # start gene g163 5 AUGUSTUS gene 1012500 1012829 0.87 - . g163 5 AUGUSTUS transcript 1012500 1012829 0.87 - . g163.t1 5 AUGUSTUS stop_codon 1012500 1012502 . - 0 transcript_id "g163.t1"; gene_id "g163"; 5 AUGUSTUS CDS 1012500 1012829 0.87 - 0 transcript_id "g163.t1"; gene_id "g163"; 5 AUGUSTUS start_codon 1012827 1012829 . - 0 transcript_id "g163.t1"; gene_id "g163"; # protein sequence = [MVHSRTVYTTLFAIAGSASSVLAVPISSSSSSSAPTSSTLAAIATATTSGIGIAPASTSGLVVPFGSVPNSRRSEAVD # VFVDNVNDKVEDEEEDEENVCSSQLFYKRFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g163 ### # start gene g164 5 AUGUSTUS gene 1014543 1016876 0.66 + . g164 5 AUGUSTUS transcript 1014543 1016876 0.66 + . g164.t1 5 AUGUSTUS start_codon 1014543 1014545 . + 0 transcript_id "g164.t1"; gene_id "g164"; 5 AUGUSTUS CDS 1014543 1014650 0.66 + 0 transcript_id "g164.t1"; gene_id "g164"; 5 AUGUSTUS CDS 1014714 1016876 0.67 + 0 transcript_id "g164.t1"; gene_id "g164"; 5 AUGUSTUS stop_codon 1016874 1016876 . + 0 transcript_id "g164.t1"; gene_id "g164"; # protein sequence = [MLRPQAGIHSIKVALLAERGVIEFDPKHWNVEKIVEEISDIGFDATAIPPSREDEVTLRIYGMTCASCTTTVESGLLS # VPGILSVSISLVSETCQIAFNRGIIGPREMISHIEDMGFDAMISDENNATQLQSLTRTKEIMEWRSRLIWSLMFAVPVFLLTMIIPRIPGLKLFHQIH # IYNGVYLSDVLVMLVTTPAQFWVGAKFYRAAYKSLKHGTATMDVLVMLGTSSAYFYSLAVLGCAAFNPTPDFRPMLFFDTSTMLIMFVSMGRYLENKA # KGRTSAALTDLMALAPSMATIYTDAECTQEKKIATELVEVGDTVKLVPGDKIPADGNVIRGSSSVDESAITGEAVPVLKQVGDTVIGGTVNGLGTFDM # VVTRAGKDTALAQIVKLVEDAQTSKAPIQAFADKVAGYFVPTVISLGVITFIAWVAISGLSSEDSLPAMFHRHGSSKLAVCLQMCISVIVVACPCALG # LSTPTAIMVGTGMGAKNGILIKGGRALEASKNVKRVVMDKTGTVTVGKLSVVGLCWVPADGAENTELYGGDPDLNGLCADGVTTRKSIIAMVSATEAR # SEHPLAKAIAVYGKDLLKEDGSEPDVGIESFESVTGAGVKALITCCGQKYVILIGNTAFITQSSNGSLNSSLAAFETQETNLGRTIIYVSIQRGNARP # QPLLSVSLADSPKPSSKHAIRALQNMGIEVNMMTGDGKATAIAIAKQVGIRPENVWSTMTPKGKATMITELIEKHGEGVAMVSKSFLIFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g164 ### # start gene g165 5 AUGUSTUS gene 1017676 1018032 0.72 + . g165 5 AUGUSTUS transcript 1017676 1018032 0.72 + . g165.t1 5 AUGUSTUS start_codon 1017676 1017678 . + 0 transcript_id "g165.t1"; gene_id "g165"; 5 AUGUSTUS CDS 1017676 1018032 0.72 + 0 transcript_id "g165.t1"; gene_id "g165"; 5 AUGUSTUS stop_codon 1018030 1018032 . + 0 transcript_id "g165.t1"; gene_id "g165"; # protein sequence = [MFPTRLLRSSTVNANEIAHFSRLSAEWWNERGEFTFLHKMNPVRMQFIREKLIETAYDEQPEEAVDAKKVEVLAGLDV # LDVGCGGGLLSEVRINLFCLLLLKLIVHRAWLALVLELPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g165 ### # start gene g166 5 AUGUSTUS gene 1018959 1019825 0.31 + . g166 5 AUGUSTUS transcript 1018959 1019825 0.31 + . g166.t1 5 AUGUSTUS start_codon 1018959 1018961 . + 0 transcript_id "g166.t1"; gene_id "g166"; 5 AUGUSTUS CDS 1018959 1019825 0.31 + 0 transcript_id "g166.t1"; gene_id "g166"; 5 AUGUSTUS stop_codon 1019823 1019825 . + 0 transcript_id "g166.t1"; gene_id "g166"; # protein sequence = [MRPLLFVPQHKGSSFSQHSPHFSFRRYKQTGPSASDKLLTDAAREEAEGTSIRPKSAYLQSLEQKHENWDGEESVQDA # VLRMLVDKYKPLRSGTIATAEQKLKQTPPKITSFTTPSSGSWATESLLPSSDAHRPWHTEFKVPSHAVSSVKFANIPPPPPVRLTSTPKDEKAKKKER # ALLKRTEQAGRLGRARESTLDYRLGLKNTQTRSDGPQLPTGGRPNPVGMRGWTSLIEDKIEVPARLLQLYDALTLSIRKLAVLVCSIISRVVVSLSCK # QRRKRTLSLVENSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g166 ### # start gene g167 5 AUGUSTUS gene 1022851 1024226 0.25 + . g167 5 AUGUSTUS transcript 1022851 1024226 0.25 + . g167.t1 5 AUGUSTUS start_codon 1022851 1022853 . + 0 transcript_id "g167.t1"; gene_id "g167"; 5 AUGUSTUS CDS 1022851 1022997 0.33 + 0 transcript_id "g167.t1"; gene_id "g167"; 5 AUGUSTUS CDS 1023615 1024226 0.38 + 0 transcript_id "g167.t1"; gene_id "g167"; 5 AUGUSTUS stop_codon 1024224 1024226 . + 0 transcript_id "g167.t1"; gene_id "g167"; # protein sequence = [MAHTSRMLQARPNSWSGKAVQRGTSDLGTKNPQCLPGSPLHDATKRNCTAYLAAKPPDLRLPTVDRLLDAGVEDAADS # QPTLCPIFEEFGECKYGFKCRYLSAHIQKSSSEDGGTESLSLVVDEEKKACAAISAKEVNYIGGETQKLLRTKKYPFPVTDAYLLELQEAGKREQEIE # KERKRVKEEETEKAEAGDDTVVVAEPEQSLDSAAKVQERTAMDVTSAPQADLDTPDVPMRFSEKNRLDWKGKTCEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g167 ### # start gene g168 5 AUGUSTUS gene 1027963 1032918 0.54 - . g168 5 AUGUSTUS transcript 1027963 1032918 0.54 - . g168.t1 5 AUGUSTUS stop_codon 1027963 1027965 . - 0 transcript_id "g168.t1"; gene_id "g168"; 5 AUGUSTUS CDS 1027963 1032918 0.54 - 0 transcript_id "g168.t1"; gene_id "g168"; 5 AUGUSTUS start_codon 1032916 1032918 . - 0 transcript_id "g168.t1"; gene_id "g168"; # protein sequence = [MSSALFTAVTTTLKGDNYDTWASEMEAFLQATGLESAITTDQPSEPSPLVAANAASVEAWKNYEVVFKAWKEIDTKAI # GNIRLRISPSIRILAKEYSDTAKKLWNYLAKTYNVKSLGAVFNDFAAAMAIKIPYKQNPLSSMMEIGMYFTRMDEAGIGLADHLEALILLSKLPSRYS # VVIQTMSQLETAELKKLTFAKVCIAVMNAFSGDTIGNSQPQNVNKFSNVHRKGNDPKFSQQQHGNGSNQQQKGQNGNDDNKKKHKRGSGKNKKAKKNA # NAAQADADSMDFSPIGSTVDFGPVRTDLTPSVQDVCKHSIHPPYNPPPNATSLHLHKKTRMAIKRARDIGVRATAEVICTLEPAGHISELDSDDELDP # PTKRTRAMSPVDDVENGSKAPTPPPPSPPMDFEVPGTASFDPDELMNFDLDREILAITGFMDTMGSVPSSDLDHMGYTNAPSSVAVAKTCKSAFEPDL # LSRLYNYRIDAKYISNEHFCVHDVSYSVCKKCKGKQRNQPKWWMNDSGCSEHTTFDLSDFIEYEDLEEKVLIATATTTAYITGVGTVLINFKDVRGRM # HSAQIAPVFYMKELSHRLIAQGRFLQDGKTVRGNADKVDFWDKDGLFLSFEPRTHSDTIYILKDYSPQPMAVNLVIHSVDYTTMHRRMGHPSREALTQ # LRKHAEGVPTFSIPHEEDLCEGCAKGKMTLRPFPPTNRRASRPFEIIHSDLKEWPTISYHKYKYTIFFIDDYTLHGFYCHLKKKSGALPVIKQFIATV # KNLYETNVKEWMSDGGGEFRSNALDEFFKNKGIKAQWSSPHIHQQNGRAERFIRTIIEKSEPQRFQACIPDSWWEFSVAHAVHVYNRTPMRRHKWKTP # YEILYNKVPRIDHLRVFGCGAYVYLHEEIRTNKQSPRSELMTYLGVSDGGHGNIYMRSNNAMFTATHAVFDEKLFPRCKSSERHRSTRLPDRNPDPKD # PIPPPGDDDVPIFHQPTTPQMRQDPEQDVAPPVPAEQPARDPSPPPQPRNEQPPAQEQLRRSGRVRRPPTRLTGDPRSSTKLPTEQQVERPKRDIQRR # APQPGSSSAEQERPEPEQVPGPSTEHPTPENGEQPSVTPGDEANTLIRLCREGGAELIYFLMAKAVPFEGELKSSENVREWTYKDITRLPKAEREEWL # KACQEELEALKRRGTFELMDRPADRKVIKNRWVFDIKSDGRKKARLVVKGFSQIEGLDYDQVFSPVVRFETVRLLLALTALNNWYLTGLDVRNAYLYG # VSHETIYMEQPEGFRIKGKEDKVLLLRKALYGLKQAGLVWWQTLDSYMKTLGFKRLSSDAGIFIRRGKDGSLVIAIIYVDDALFAGPDKKLVDSLKGK # FMSHWECRDLGEAKEFLRMRINRHGKKIYIDQCAYLDKVLKRCGMENAKMADTPLPAGFQPEPTIGQSNSALRSKFQMVIGSLLYLMLGTRPDISFAV # TKLAQHAANPSQEHLNKALYICCYLLGTRSYALCYDGELGIGLSAWTDSDWASDPYTRRSQTGFFMKLANGIFSWTSHAQKTIAHSSTEAEYMALSDC # SRQVVWIRNLLEELGYKLDAIPIAGDNQGSIFMASNPVTSKHSKHIDIRYHYIREVVERGLVQVFFVDGSNNPADLFTKNLGRIKFELFRSMLGLEFY # SSTNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g168 ### # start gene g169 5 AUGUSTUS gene 1036060 1036757 0.47 + . g169 5 AUGUSTUS transcript 1036060 1036757 0.47 + . g169.t1 5 AUGUSTUS start_codon 1036060 1036062 . + 0 transcript_id "g169.t1"; gene_id "g169"; 5 AUGUSTUS CDS 1036060 1036270 0.61 + 0 transcript_id "g169.t1"; gene_id "g169"; 5 AUGUSTUS CDS 1036336 1036757 0.78 + 2 transcript_id "g169.t1"; gene_id "g169"; 5 AUGUSTUS stop_codon 1036755 1036757 . + 0 transcript_id "g169.t1"; gene_id "g169"; # protein sequence = [MMRSVPSKDLDAFASLRGKGSLAGASKRNPLAPPLEIKSSTSIPKAPVAPPRLIRRNRELENLKADASSFLASPRSTR # SRDSDNELLSGFPLVDAAPRASSPTKVPVSRKEPKSKTAVKVVEDSKASDPPTSALVYKRVRLPPRSRKIAPAASKGKARQTIVTEADSASSEVESED # EDEEEDSAPPPKRLKMTSSISGKSLFFIYFVLFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g169 ### # start gene g170 5 AUGUSTUS gene 1037372 1037928 0.56 + . g170 5 AUGUSTUS transcript 1037372 1037928 0.56 + . g170.t1 5 AUGUSTUS start_codon 1037372 1037374 . + 0 transcript_id "g170.t1"; gene_id "g170"; 5 AUGUSTUS CDS 1037372 1037420 0.57 + 0 transcript_id "g170.t1"; gene_id "g170"; 5 AUGUSTUS CDS 1037483 1037928 0.9 + 2 transcript_id "g170.t1"; gene_id "g170"; 5 AUGUSTUS stop_codon 1037926 1037928 . + 0 transcript_id "g170.t1"; gene_id "g170"; # protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTARELFLRSILDLQNAGEDPVVVLEALKAAEPNRRAIN # LNEWTLLATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIHSGESTASIDEHGHLVESSPPPDSATEALEGLKEVERGLRTRVPVAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g170 ### # start gene g171 5 AUGUSTUS gene 1039059 1040507 0.21 + . g171 5 AUGUSTUS transcript 1039059 1040507 0.21 + . g171.t1 5 AUGUSTUS start_codon 1039059 1039061 . + 0 transcript_id "g171.t1"; gene_id "g171"; 5 AUGUSTUS CDS 1039059 1039226 0.83 + 0 transcript_id "g171.t1"; gene_id "g171"; 5 AUGUSTUS CDS 1039867 1039999 0.59 + 0 transcript_id "g171.t1"; gene_id "g171"; 5 AUGUSTUS CDS 1040095 1040507 0.6 + 2 transcript_id "g171.t1"; gene_id "g171"; 5 AUGUSTUS stop_codon 1040505 1040507 . + 0 transcript_id "g171.t1"; gene_id "g171"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRGTPYPTGPNKGSNKDEKSA # VNEVSPRLSKVHCHTDSHVSSNSYQSCSAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGS # DSSVSDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERATTPFTCGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g171 ### # start gene g172 5 AUGUSTUS gene 1040769 1041020 0.31 - . g172 5 AUGUSTUS transcript 1040769 1041020 0.31 - . g172.t1 5 AUGUSTUS stop_codon 1040769 1040771 . - 0 transcript_id "g172.t1"; gene_id "g172"; 5 AUGUSTUS CDS 1040769 1041020 0.31 - 0 transcript_id "g172.t1"; gene_id "g172"; 5 AUGUSTUS start_codon 1041018 1041020 . - 0 transcript_id "g172.t1"; gene_id "g172"; # protein sequence = [MGQYSKKRSEPSEYADFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELS # EGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g172 ### # start gene g173 5 AUGUSTUS gene 1042397 1043035 0.99 - . g173 5 AUGUSTUS transcript 1042397 1043035 0.99 - . g173.t1 5 AUGUSTUS stop_codon 1042397 1042399 . - 0 transcript_id "g173.t1"; gene_id "g173"; 5 AUGUSTUS CDS 1042397 1043035 0.99 - 0 transcript_id "g173.t1"; gene_id "g173"; 5 AUGUSTUS start_codon 1043033 1043035 . - 0 transcript_id "g173.t1"; gene_id "g173"; # protein sequence = [MDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLA # LEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIM # GDGETEEPYQFDDFKDQMTLEVVTYTKQLKKLMILN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g173 ### # start gene g174 5 AUGUSTUS gene 1043861 1046538 0.92 - . g174 5 AUGUSTUS transcript 1043861 1046538 0.92 - . g174.t1 5 AUGUSTUS stop_codon 1043861 1043863 . - 0 transcript_id "g174.t1"; gene_id "g174"; 5 AUGUSTUS CDS 1043861 1045032 0.95 - 2 transcript_id "g174.t1"; gene_id "g174"; 5 AUGUSTUS CDS 1045107 1046538 0.97 - 0 transcript_id "g174.t1"; gene_id "g174"; 5 AUGUSTUS start_codon 1046536 1046538 . - 0 transcript_id "g174.t1"; gene_id "g174"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVDEPDDEDTIKLIPSSRPTNQINNEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTSEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSK # GNFHSSMNGYKQCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNEQFNLNPIKSFFLQNGRIKP # KPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKK # GKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDEGNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHG # DPLLELPELSKHPKPFAPTGRYTEERKEIIDKNHPEGFLWERERDLMHKMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIS # RMCAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g174 ### # start gene g175 5 AUGUSTUS gene 1046568 1048094 0.35 - . g175 5 AUGUSTUS transcript 1046568 1048094 0.35 - . g175.t1 5 AUGUSTUS stop_codon 1046568 1046570 . - 0 transcript_id "g175.t1"; gene_id "g175"; 5 AUGUSTUS CDS 1046568 1048094 0.35 - 0 transcript_id "g175.t1"; gene_id "g175"; 5 AUGUSTUS start_codon 1048092 1048094 . - 0 transcript_id "g175.t1"; gene_id "g175"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNG # TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g175 ### # start gene g176 5 AUGUSTUS gene 1058133 1059104 0.85 - . g176 5 AUGUSTUS transcript 1058133 1059104 0.85 - . g176.t1 5 AUGUSTUS stop_codon 1058133 1058135 . - 0 transcript_id "g176.t1"; gene_id "g176"; 5 AUGUSTUS CDS 1058133 1059104 0.85 - 0 transcript_id "g176.t1"; gene_id "g176"; 5 AUGUSTUS start_codon 1059102 1059104 . - 0 transcript_id "g176.t1"; gene_id "g176"; # protein sequence = [MLFGNTPNIPRLPDEKQLVGKENWRLYKREILFAVQSRGLTGYIDGMIPRPNSYPGLIYPSAQTTTPLFSSTPCLEEW # EACDRLIAGAIVSNITNPVGLGIDETKRASETWTALIKRFEKCNEQCIYLADMNIQQEKFNPVKLTMEDHEKQMRNLIKKVHNLGGTATDAQFHRIVI # SSMPSDWRQDIRSIPGASSADVFAYLHTLWYKKEEEWKEEERDTKRVKALMAVNSTNNPTQTNSRMVLTCHNCNRPRHIARKCWAKGGGMEGQWPKQN # QPNKQKNGTNMNTVSPDGTEITYPMATYVMSIHPEVNTKQIHPGIPADR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g176 ### # start gene g177 5 AUGUSTUS gene 1063531 1065701 0.42 - . g177 5 AUGUSTUS transcript 1063531 1065701 0.42 - . g177.t1 5 AUGUSTUS stop_codon 1063531 1063533 . - 0 transcript_id "g177.t1"; gene_id "g177"; 5 AUGUSTUS CDS 1063531 1064937 0.51 - 0 transcript_id "g177.t1"; gene_id "g177"; 5 AUGUSTUS CDS 1065033 1065701 0.42 - 0 transcript_id "g177.t1"; gene_id "g177"; 5 AUGUSTUS start_codon 1065699 1065701 . - 0 transcript_id "g177.t1"; gene_id "g177"; # protein sequence = [MTPERWAEYQSTTKQQLISGKVVRSLVCGQSSQCLFMLTIACKLVPLSRHSPLPELQAFVSLFRPNRIIPNTLDPSLK # NLDWAGIDRVFESCCRKPQHTSANFHHAIPPAPIAHEFDLGLFQPQSDDDEDDIAVKNIVADATNDADLKARAMAKKWLVDPGYGLDPSALKGRNGRR # VDVLRSWLGLRKWDNHQGSSPLTHSDAAKGKQKWKIADNHNLGNRKVFFAPSDEGKDHLVQRYWESSSFSFQLSDEEDVAEVQASLTPSAANERRLGS # GQQSKIGIGRTMISSPVRAVALKSYKAKIRTSLIPVDFVTSTPSLKHRSCPRPDPFVPSQSPLIAQARSLHFSPSSPAHSPSPFKKLAHRPETPHKQG # IRPKKLAKRTLDSPIHLVSSSPSSKSGSRSQESKHSSSNTRERRRSGTTKGGVNSSPPLSSPLNNRKRASRQPEITDLAASEERPRKRFKEVPNIPNM # EPQALDQPLKEVKNISRPSNSPKNPLVLSSNDAGFLSRESDQKNLNRVQCASNSPRIGSSKVLRAAVTIPALITSKHISPSRSRRNPYVRVCRSSPHR # NKSELLDIQLRAARKAASALFPNVPPAFEAKCLKLEQRRDHARLKETVSVDYASAEMKMNKRRVEEFDKKIRNNPTWNGQDNAVDWERSRMLERRATE # DLRQGKKPTFPTLECVQGLDNNDDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g177 ### # start gene g178 5 AUGUSTUS gene 1071487 1071960 0.99 - . g178 5 AUGUSTUS transcript 1071487 1071960 0.99 - . g178.t1 5 AUGUSTUS stop_codon 1071487 1071489 . - 0 transcript_id "g178.t1"; gene_id "g178"; 5 AUGUSTUS CDS 1071487 1071960 0.99 - 0 transcript_id "g178.t1"; gene_id "g178"; 5 AUGUSTUS start_codon 1071958 1071960 . - 0 transcript_id "g178.t1"; gene_id "g178"; # protein sequence = [MQQIEGQVGLLFTDTEPEEVIEWFADFAQPDFARAGNVASRTVILPAGPVMMHHSDPPVPFPHDEDPQLRRLGLTTKM # ERGVPTLQAPHKLCQKGKVLTAEQAQLLKLTGEKMVTFRVGLIARWDAATGEVTQVEGPRLTQDEIISGDAEDEGAMSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g178 ### # start gene g179 5 AUGUSTUS gene 1073343 1074377 0.7 + . g179 5 AUGUSTUS transcript 1073343 1074377 0.7 + . g179.t1 5 AUGUSTUS start_codon 1073343 1073345 . + 0 transcript_id "g179.t1"; gene_id "g179"; 5 AUGUSTUS CDS 1073343 1074377 0.7 + 0 transcript_id "g179.t1"; gene_id "g179"; 5 AUGUSTUS stop_codon 1074375 1074377 . + 0 transcript_id "g179.t1"; gene_id "g179"; # protein sequence = [MSSDELPEMMARGWAYDTAPNHTAGYVYPFSICGAAPIYRLFNPTITDHFYTMDIAECQSAAKDNGYQDQGIAGFAIL # PSANGSVVKSVASAVPNLLPSTVTASPESQVSVTPSAGCANNTNAIPFMRAISTADTDHFYTTNSTEMNVVAIAQNSYLFEGDTVFLWPTQESSTVPL # YRLYSQTARDHFYTIDANELSEALLEGYVFDTDSHIAGYVYPYSICGASPIYRLYSSFSSDHYYTMTQAESASATASFGYIVQGIAGFALLPSADGQL # QTVTVSASPFLLPVSIEPSPTSSSRLPAFLTTVSITPSSLSFPSKALVQSVVSRREILGLSVLTAVWMIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g179 ### # start gene g180 5 AUGUSTUS gene 1076124 1077284 0.88 + . g180 5 AUGUSTUS transcript 1076124 1077284 0.88 + . g180.t1 5 AUGUSTUS start_codon 1076124 1076126 . + 0 transcript_id "g180.t1"; gene_id "g180"; 5 AUGUSTUS CDS 1076124 1077284 0.88 + 0 transcript_id "g180.t1"; gene_id "g180"; 5 AUGUSTUS stop_codon 1077282 1077284 . + 0 transcript_id "g180.t1"; gene_id "g180"; # protein sequence = [MNNNALAGGVYAFEGESAFIWATPQTGTVPLFRLYNQNSTDHFYTMSSDELPEMMSLGWTNDTALNQTAGYVYPYSTC # GAAPIYRLFNPSTIDHFYTMDVAESQNAVQVGYQDQGIAGFAILSSADGSSVQNSAVPYLLPSTITATPESQASPVSSSSCANSADAIPFLRAYASTG # TDHFYTTNSTEMNNAQGSYSFEGDAAFLWSTQEASTVPLYRLFNQNLNDHFYTMDANESNEALSSGYAFDTDSHIAGYVYPYSICGASPIYRLYSSTL # ADHFYTLSQNESASAAGYALEGIAGFALLPSADGQPQTATVSASPLLLPVTLDPSPISISSTFVAAYSTTIDIDPVSTSAASNSGNKAIARRGVSGYG # FLSVLVSGLVTAVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g180 ### # start gene g181 5 AUGUSTUS gene 1077813 1079042 0.62 + . g181 5 AUGUSTUS transcript 1077813 1079042 0.62 + . g181.t1 5 AUGUSTUS start_codon 1077813 1077815 . + 0 transcript_id "g181.t1"; gene_id "g181"; 5 AUGUSTUS CDS 1077813 1079042 0.62 + 0 transcript_id "g181.t1"; gene_id "g181"; 5 AUGUSTUS stop_codon 1079040 1079042 . + 0 transcript_id "g181.t1"; gene_id "g181"; # protein sequence = [MNNNALAGGVYALEGDSAFLWSTPQPGTVPLFRLYNEKSTDHFYTMSSDELPEMMENGWAYDTAPNHTAGYVYPYSIC # GAAPIYRLFNPTIVDHFYTMDVAESQNAVKTGYQDQGIAGFAILPAANGNVVQSSAVPYLLPSAVTASPESQVSASSSSDCANNANAIPLLRAFSSTG # KDHFYTTNSTEMNVVAIAEDVYSFEGDATFLWSTQETSTVPLYRLYSQTASDHFYTIDANETSEAIASGYAFDTDSHIAGYVYPYSICGASPMYRLYS # SSSSDHFYTMSQAESQSASASGYILEGIVGFALLPSVDGQPQTATVSASPLLLPASLEPSAVSIPSSSSSESGFPTTIAVGPTISFSSNPGSISATSI # SGHSTNKAIPQSAVSLCGAFGVYMLVAARTTAMFSIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g181 ### # start gene g182 5 AUGUSTUS gene 1081877 1082153 0.35 - . g182 5 AUGUSTUS transcript 1081877 1082153 0.35 - . g182.t1 5 AUGUSTUS stop_codon 1081877 1081879 . - 0 transcript_id "g182.t1"; gene_id "g182"; 5 AUGUSTUS CDS 1081877 1082048 0.82 - 1 transcript_id "g182.t1"; gene_id "g182"; 5 AUGUSTUS CDS 1082107 1082153 0.41 - 0 transcript_id "g182.t1"; gene_id "g182"; 5 AUGUSTUS start_codon 1082151 1082153 . - 0 transcript_id "g182.t1"; gene_id "g182"; # protein sequence = [MADSRPAIEALGSMMWYLQQLNIDKDIITMRNFNIYDPMKRGEGLVLDGQTLAHIEVRKNVCPRGLLVSTKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g182 ### # start gene g183 5 AUGUSTUS gene 1082389 1084534 0.04 - . g183 5 AUGUSTUS transcript 1082389 1084534 0.04 - . g183.t1 5 AUGUSTUS stop_codon 1082389 1082391 . - 0 transcript_id "g183.t1"; gene_id "g183"; 5 AUGUSTUS CDS 1082389 1082683 0.27 - 1 transcript_id "g183.t1"; gene_id "g183"; 5 AUGUSTUS CDS 1083234 1083418 0.37 - 0 transcript_id "g183.t1"; gene_id "g183"; 5 AUGUSTUS CDS 1083458 1083921 0.88 - 2 transcript_id "g183.t1"; gene_id "g183"; 5 AUGUSTUS CDS 1084264 1084534 0.29 - 0 transcript_id "g183.t1"; gene_id "g183"; 5 AUGUSTUS start_codon 1084532 1084534 . - 0 transcript_id "g183.t1"; gene_id "g183"; # protein sequence = [MASKSKSSENLKQKSLMSFFGKTQESTPSASQQAKKHATEKQSKPTPKDASKIASSDNVLQTPAPKKPNLHALNSSAA # ASSSSYSSGIKVCRIKKARYSELTPDEDEEDSEVSSSFTHRITKFRKSPAKTGRRSSKASEDDDDFIVPSEDSDADVGSMKTSSSRPSSRQSLLSDEV # EDEEEEPISKKLKSKGKANIKPKASTQTSDSFSFLTAAEQREQDKKEEKKATESPYGFLQDVKDVSILFKDGCRPGDPKYDPRTLYIPTKAWKEFTPF # EKQVHPRPELPYRPQSHRAYCSFGKLSRTIMILELNKVYTNGTLVDGEMITDDEAGHCISIREIESDDGSHNTFGISVLDCSTSQFDLAVFEDDICRT # KLETMIRQIRPKEMLFTKVRFAEHHVSSSVSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g183 ### # start gene g184 5 AUGUSTUS gene 1085236 1086384 0.79 + . g184 5 AUGUSTUS transcript 1085236 1086384 0.79 + . g184.t1 5 AUGUSTUS start_codon 1085236 1085238 . + 0 transcript_id "g184.t1"; gene_id "g184"; 5 AUGUSTUS CDS 1085236 1086384 0.79 + 0 transcript_id "g184.t1"; gene_id "g184"; 5 AUGUSTUS stop_codon 1086382 1086384 . + 0 transcript_id "g184.t1"; gene_id "g184"; # protein sequence = [MKNDALAGGVYVFEGESAFLWPTPEPGTVPIFRLYNQNSSDHFYTMSSDEVPEMMNAGWAYDTAPNHTAGYVYPYSIC # GAAPIYRLFDPTSVDHFYTMDIVESQNAVQAGYQDQGIAGFAILPSANGTVAQSSAIPYLLPSTITASPESQVSATTSSSCANIANAVPLLRAYSSGG # TDHFYTTNSTEMNDSVAVNAYSFEGDATFLWPTQETSTVPLYRLWNLNSSDHFYTIDKNEVNEALAMGFTFDTEAQNVGYVYPYSICGASPIYRLFSS # FGSDHFYTMNQAESMSAPGYVLEGIAGYALLPSADGQRQTSASPFLLPLSLQASPVSISLSPIPAFTTSIAIDTGSPSGLPSTAGVQSTVSRHVFLGV # TALVAFWIAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g184 ### # start gene g185 5 AUGUSTUS gene 1090626 1092750 0.47 + . g185 5 AUGUSTUS transcript 1090626 1092750 0.47 + . g185.t1 5 AUGUSTUS start_codon 1090626 1090628 . + 0 transcript_id "g185.t1"; gene_id "g185"; 5 AUGUSTUS CDS 1090626 1091256 0.94 + 0 transcript_id "g185.t1"; gene_id "g185"; 5 AUGUSTUS CDS 1091375 1092750 0.49 + 2 transcript_id "g185.t1"; gene_id "g185"; 5 AUGUSTUS stop_codon 1092748 1092750 . + 0 transcript_id "g185.t1"; gene_id "g185"; # protein sequence = [MFGLLSSQSTGAESSKDVAPVASTENAASSLRAAALLTLKSSKRRKVNPDQAQSSTLPIRPAAVDNSVQLDYGQDDAE # TDIASSPPEKPSLNQQPPPSIKIPEVDMEDGQVREEGEISDSEEVSPVIAAASVQSKTTTPSPTSNRPSPPKPSNNRHVPSSTFALKVETSSSSLLDR # MSAVPPGPTSKSPQRVEVTNGEHTYFVDVDHVRPGWGVAPEYLVDCGLSREIVFYVFSELNLRLPQNLNTDGIIPYTPSTLETLLRVPTRVSSPLGSD # SDTPRPLGHPSLPPKPSFPGQDRSRDSMPKPAESSGDTADVTVLLDMERQRRQELLARKAVQASRLTRSMGSISPTSKPMDVDDKDVEMTPSTSLAPS # ESVDDFLRSIEPVGSGKMDVDEVPGLASTSTPVLVEREKSIDRMVESPSSQTPLPTDEHLMSSVGASTSGEGSRRSSSSEDISGTSNGLARRNGKRPV # AADFVDFDAAPRDRHGSGIKRSTGSFASISTMRRCVIDLSDSEGEADGEDVQIKPAAVPPGTTNSRYSTPPTSSAAAATPDFRTMSPAALAVKELEIQ # KMRQMIAEREQGRRMKLKVGSTEQICANFKLKTWQKLEAMSNPDSIPVKQEEEDLLSSLAIPVTQSPSMESSGISPMHHRMFISLIISVRSHREHHIL # VG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g185 ### # start gene g186 5 AUGUSTUS gene 1094483 1095994 1 + . g186 5 AUGUSTUS transcript 1094483 1095994 1 + . g186.t1 5 AUGUSTUS start_codon 1094483 1094485 . + 0 transcript_id "g186.t1"; gene_id "g186"; 5 AUGUSTUS CDS 1094483 1095994 1 + 0 transcript_id "g186.t1"; gene_id "g186"; 5 AUGUSTUS stop_codon 1095992 1095994 . + 0 transcript_id "g186.t1"; gene_id "g186"; # protein sequence = [MSSSKISVRTLPIVTVQPTFPIVVNEVYSGVIPFENIWISCYNNSSSDPPAPSSSIHSKVRVVLDDEDREKVVYQVRE # GDVNISEAERRDFGYIYSVSSPSLRIPPTRLLFPVQEYADPEKSNPQKPHRITAFSLAPDRSQYAIGYLDGSVLLYPSVPIQNSQSKYPTSAMSPPSE # STYTYRRQVLISAASASSGLSPALTRAHKSTVTSLRFFPSSRVLLSSGADFTLQVYPADPIAAASVSSASGQSSKRVSSVRTLTAHTRSVTSSAMIGR # GRAIISSSMDGTIRVWDVSTGEEETLVHSAAGVGIGINRIFLDSDRDLSSSEDAEPSSNSRLYAALHDGSFEVFALGGNQKPRKLVHEFRSEKSIYGA # LNAITVSMPTAEAREKFIAVGSAQGVISIYNASSYASVHFRRNEASIEDLDFVPLPQSKLGLVITTGDGLPWIASLDELPITGSVDAKVSVYAELVGG # DVDAVRNVSVHTVSSTIEVWTASDDGIVRRYVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g186 ### # start gene g187 5 AUGUSTUS gene 1100329 1101583 0.49 + . g187 5 AUGUSTUS transcript 1100329 1101583 0.49 + . g187.t1 5 AUGUSTUS start_codon 1100329 1100331 . + 0 transcript_id "g187.t1"; gene_id "g187"; 5 AUGUSTUS CDS 1100329 1100551 0.58 + 0 transcript_id "g187.t1"; gene_id "g187"; 5 AUGUSTUS CDS 1100748 1101583 0.88 + 2 transcript_id "g187.t1"; gene_id "g187"; 5 AUGUSTUS stop_codon 1101581 1101583 . + 0 transcript_id "g187.t1"; gene_id "g187"; # protein sequence = [MAGNPADPQHSHPGHPGVTDDAFINDRDAVDSGGDDDDDDDKPKSDKKAGRRKIKIEFIQDKSRRHITFSKRKAGLVY # TFTTAKLQPLVTQPEGKNLIQACLNAPHGSLPSSMPVGAPLGRSSNIGPPAATPANNMPGGLSIGSTAGGNAKEDEDSVEEDESSRGGRAQVGDKRRR # RASSNAGPPPPSSSSNRGGPTGSPHSVNSTIPPHLSISSGTNASQSQPSSAHPGTSPQMSMGASPTSPQQGHAVPPTNSNPQYASSYGHHTHHPSQHP # SHQQQSPDGGMYGGTPAHMMPAGNYSYPGNQSNATGGQQQLGGLAAAAAQHGHWGTAQQQQQQQPQQVAGQNTHYTRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g187 ### # start gene g188 5 AUGUSTUS gene 1103353 1105672 0.62 - . g188 5 AUGUSTUS transcript 1103353 1105672 0.62 - . g188.t1 5 AUGUSTUS stop_codon 1103353 1103355 . - 0 transcript_id "g188.t1"; gene_id "g188"; 5 AUGUSTUS CDS 1103353 1104237 0.87 - 0 transcript_id "g188.t1"; gene_id "g188"; 5 AUGUSTUS CDS 1104323 1105672 0.69 - 0 transcript_id "g188.t1"; gene_id "g188"; 5 AUGUSTUS start_codon 1105670 1105672 . - 0 transcript_id "g188.t1"; gene_id "g188"; # protein sequence = [MKPGAAFEMIEEDLMFPGGAIRVDDENESIPENFNSHPVESTLFSDSGARQHSSASSISSFYFASGPEIRNRNRPRSS # SSTDSSSTATNIANSHIVEKTFRRRSVPVKGSDQRRNTTLDYATLTSLMGLGDGENNLVISETEDENHYQELDRKRYSGSDWDSLLANTSSSPRNSSV # EEQDRTTHDPLAVPSPANQAAGVTSPSRCSPLPLPSPSSAPALPSFLASPTTAFMSMPSVIPNTMGRGLEAEAIVEDEEGEKNATWASVNDDRTANGQ # LDTSAESHMPSHFQEPTDSTIMPVKPQLSEIHTPSIPASSKSTPLRHPLSVSTGSLTDLQLSSPYSPNPYAKLNYVTSSNSPSSPKRPLSTSNNGFGT # SSSIHLPSMSFSQSMHSLSSSSPHSLNAAVDADKESRIISSGSTAAPFLLRTLPKPPVNPRDHSMLEMIYNEMNAARFVLILFPLDLRTHPPVIFTFP # PIPVVEQSRSSDPDPDPDEDAQDAIRPSPLSAGTVHTARGRSMSNASNVSSRLTGSPTPSSVRTAYFEGLPDHWINMRQIVKRESPYVIYDGSRLSAL # SPSTRASILSSSIKQPTSSSLASSTASARTGSMKEEDSAAADADRSYSEIDPPRGTHDMFSPRPHNPDHDVRFRLPNTTMNIDLRSLNLHLALRVTEI # LACSETMWEWVLDYQEQARNKKIIQEKKTRARSRSIGPVRPPSRDQPSEPESSEARLKTALTELTRETYEDMLRRFYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g188 ### # start gene g189 5 AUGUSTUS gene 1108295 1109341 0.57 - . g189 5 AUGUSTUS transcript 1108295 1109341 0.57 - . g189.t1 5 AUGUSTUS stop_codon 1108295 1108297 . - 0 transcript_id "g189.t1"; gene_id "g189"; 5 AUGUSTUS CDS 1108295 1109341 0.57 - 0 transcript_id "g189.t1"; gene_id "g189"; 5 AUGUSTUS start_codon 1109339 1109341 . - 0 transcript_id "g189.t1"; gene_id "g189"; # protein sequence = [MQTSTKRQKRSQRKDDDNALDWAQNSFDEIDDPDLDVIDDAHFVTAQTPVSRMAQQVRMRNEMEELRRWLEEDERDSR # NDESEDGGDSRNDPWGRAVSSTTSQSAMMTLSPTSEEGGLSYPEPLKEDKFDDDFTVFVSAPAQDSVPNPSHPASASPSKSHQDFISEGSFPSFASFG # DSSFTAAYPFDDESSGLYGDTSFDSLAPPDQHSGIMYHSLGSASDLGDLPNEEAFPAHSSPHMQADNDHKEADDSDDGLPTQSEIRASAHRIFGTLSS # PSSSSAKRLEADAAEETNAKFDEFDDDMDFDLTHMVSAIQGMKAEISGMENEDDRRKAAARVALGLVYGLDRRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g189 ### # start gene g190 5 AUGUSTUS gene 1119394 1120230 0.62 + . g190 5 AUGUSTUS transcript 1119394 1120230 0.62 + . g190.t1 5 AUGUSTUS start_codon 1119394 1119396 . + 0 transcript_id "g190.t1"; gene_id "g190"; 5 AUGUSTUS CDS 1119394 1120230 0.62 + 0 transcript_id "g190.t1"; gene_id "g190"; 5 AUGUSTUS stop_codon 1120228 1120230 . + 0 transcript_id "g190.t1"; gene_id "g190"; # protein sequence = [MLPSFNDVPSVQPIILLPNVNTVSCTWTLPNCYIKFTPLSFLVLPKLRNLQLQWNEGLELEVIKLFERSSFKLETLTL # IQAQRGVYRPPTEQFVSLMTRFSEADLINQSLVGLELNHTDAKWDVNEFREIMEVLSLGERSPSSGSGDTQNAGGLNEIPQIPHFDRFPFLKQLTIAA # YTIPDHSAFTAMLKSRRSQSPPSSLISKGQHSSTLLQNSPRDSVGLEILRLRCSKSAFLEKEELLKHLETFSDEGLKLFYDPWVGVSRKNLTLWSHPS # YELN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g190 ### # start gene g191 5 AUGUSTUS gene 1120659 1121516 0.29 - . g191 5 AUGUSTUS transcript 1120659 1121516 0.29 - . g191.t1 5 AUGUSTUS stop_codon 1120659 1120661 . - 0 transcript_id "g191.t1"; gene_id "g191"; 5 AUGUSTUS CDS 1120659 1121081 0.69 - 0 transcript_id "g191.t1"; gene_id "g191"; 5 AUGUSTUS CDS 1121161 1121402 0.7 - 2 transcript_id "g191.t1"; gene_id "g191"; 5 AUGUSTUS CDS 1121492 1121516 0.37 - 0 transcript_id "g191.t1"; gene_id "g191"; 5 AUGUSTUS start_codon 1121514 1121516 . - 0 transcript_id "g191.t1"; gene_id "g191"; # protein sequence = [MPDLLTTANEDEEKVEERDGWETVNMDGQTFGIRTAAIEEKCQAFETMVIFASTLNARYAPYLAQSLEITLPALRFYF # HDGVREACALYSGTLTDQMIAATLQQLISVISDEQDSTFLASLYKALDDCVKLLGGPSVLNADYVNAIVQATKRQLHTLAQKRRSRAARPSSFLDDDR # EDLALLEEMEDFALEEMAKVLSMLNSNHELLVAISSVKELGTNQYQTELEEDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g191 ### # start gene g192 5 AUGUSTUS gene 1121909 1123347 0.92 - . g192 5 AUGUSTUS transcript 1121909 1123347 0.92 - . g192.t1 5 AUGUSTUS stop_codon 1121909 1121911 . - 0 transcript_id "g192.t1"; gene_id "g192"; 5 AUGUSTUS CDS 1121909 1122096 0.96 - 2 transcript_id "g192.t1"; gene_id "g192"; 5 AUGUSTUS CDS 1123064 1123099 0.97 - 2 transcript_id "g192.t1"; gene_id "g192"; 5 AUGUSTUS CDS 1123173 1123347 0.97 - 0 transcript_id "g192.t1"; gene_id "g192"; 5 AUGUSTUS start_codon 1123345 1123347 . - 0 transcript_id "g192.t1"; gene_id "g192"; # protein sequence = [MFSPSGPKSEQELIGSFATPTGSPSRELPVTETEDEEEGQSLRLSALEFMLSLCEARPNSSPTSPTGVNVDPIVQRLL # KLLNPEADPTQVQRHVQEQVITTLAMVADASEATFAKVGVTWTIGLFLLGFELF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g192 ### # start gene g193 5 AUGUSTUS gene 1130936 1132219 0.54 - . g193 5 AUGUSTUS transcript 1130936 1132219 0.54 - . g193.t1 5 AUGUSTUS stop_codon 1130936 1130938 . - 0 transcript_id "g193.t1"; gene_id "g193"; 5 AUGUSTUS CDS 1130936 1132219 0.54 - 0 transcript_id "g193.t1"; gene_id "g193"; 5 AUGUSTUS start_codon 1132217 1132219 . - 0 transcript_id "g193.t1"; gene_id "g193"; # protein sequence = [MEGKIAVRCVPFGEPEGLREPTSTAMEIVVADTGCGIPPTKLESIFREIEQVESSEPKTSAEPGVGLGLAVVARIVEQ # LGGQLRVESKVGEGSQFSFLLPLSLMVPSETSTSSAHSRSNSSLGSLQAKSTSEVDFIVEALANSSQRSSSAHSIDESRSPRKTTTGLFPVADSQYPV # RPIKVPEIDTQKPLTHQTSQPSPKSSNPAIQPPLNSTSETKPIEYKSLPLLTSKAEKLSLRVLIVEVRLSSFLFCSIFKLILCTKDNDINRLLLAKRL # RMDGHVVVNTTNGQEGLDKVMSDRNFDCVLMDINMPILNGLEASERIREFEKAFPSSDVQRLSLKLNGRIPIFAVSASLYEHQRSKLSDAGMDGWILK # PIDFKRLATILKGVTDLAQRERDRYTPGGNWEVGGWLAMSPTPSDAPIEGLPRPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g193 ### # start gene g194 5 AUGUSTUS gene 1133957 1136790 0.32 - . g194 5 AUGUSTUS transcript 1133957 1136790 0.32 - . g194.t1 5 AUGUSTUS stop_codon 1133957 1133959 . - 0 transcript_id "g194.t1"; gene_id "g194"; 5 AUGUSTUS CDS 1133957 1135503 0.96 - 2 transcript_id "g194.t1"; gene_id "g194"; 5 AUGUSTUS CDS 1135627 1135660 0.65 - 0 transcript_id "g194.t1"; gene_id "g194"; 5 AUGUSTUS CDS 1135756 1136790 0.34 - 0 transcript_id "g194.t1"; gene_id "g194"; 5 AUGUSTUS start_codon 1136788 1136790 . - 0 transcript_id "g194.t1"; gene_id "g194"; # protein sequence = [MTNGSSSSFVYPIKSLLGNIQPASDDHNSLPFHPTARNVTTDIGSKTPLCAFPTQFSIFKLTLYRSAGTQTSNVIVSV # TSSPSHDRHLSHTTTSTGSKKRRTKRSKQAIATYDDLVDSQEQSKQAKRHSDNVPNFSHFPAGEDVSIETSSPRFYTSTVSSSSSPSLSPSSSPLISS # TIPKDGEPYPLPISQEYNPRHPPALPIIAQQAFTSMSDSLLPNVTTTGPQLNPSERGIVHLSPIPSSSNGNSTKRFDRSSTKPISRQYGSNSSGSSSN # ASSSLSNYYTPEEISSGDDSQFSSQKSGSTSSSSRNGGLSRSDDVSVYSQASEPRVSVRFQHIQDAHGHHIPIRAPGAVQGFELLGLPPRYLFKLECF # TDVLPESQASLLWDNIQFLSESANSTNTTRDEELERDSPDIFLLSGYGAPGTAISSLPVSVDPYDPWGVHVGKRRWTCWCAIHRPQPSPYLSNTQSKA # QKPLIVMEFELESDFFNPLYPRSSSNPASTTSAPSGSDSPDSIKTHSSGSDGTSSSGAQTGSSESEITVVPNSSSTAARSAEDSNFTTSIATSSNSSG # VTTVTNSSTLPQSPLEETDPLEALQPRSGHPPVHGLVGDYSWTPNTEDIIESTTTRSKPLLALERLRRLSQMPGASDNTLPNTSSCSTPGFNAKTRRP # LRPSRDANGKIQRVAPGAPNGGVSMMDVFAVMAQINEQLGDAPDLDTFLKVTVGVIKDLTQFHRVLVYQFDEVWNGQVVAELVDWSMTHDLYKGLHFP # AGDIPAQVRVLDGIRVRKLIGLVLDRRESCTRLVSDCPSLHPFLIAYHYLLDKVRILYDRDQPTARIVVRDKEDLEQPLNMTHCYLRAMSPLHVKCQY # GIYPLCLWF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g194 ### # start gene g195 5 AUGUSTUS gene 1137644 1138845 0.9 + . g195 5 AUGUSTUS transcript 1137644 1138845 0.9 + . g195.t1 5 AUGUSTUS start_codon 1137644 1137646 . + 0 transcript_id "g195.t1"; gene_id "g195"; 5 AUGUSTUS CDS 1137644 1137883 0.91 + 0 transcript_id "g195.t1"; gene_id "g195"; 5 AUGUSTUS CDS 1137937 1138845 0.99 + 0 transcript_id "g195.t1"; gene_id "g195"; 5 AUGUSTUS stop_codon 1138843 1138845 . + 0 transcript_id "g195.t1"; gene_id "g195"; # protein sequence = [MLLSLLQQVSTQAKDKIKDASVLESEKDEKLTKALIDGMKFHVDQLGNTIQKDEAELAAELKEQKKHITSDDLHDGFS # SKYIPPKPEPAPVPLKKIEKPKTTTVEFETLNPEASGSKLPSSSVLTEEDDALPELTPTLAEFSKIPYRGFEKSFEFIQKHRDVIVGGASDALLVAAF # TAEGEGKKKLAKQCVHQSLLLQYCEKLGGDGVRVFFQKFVQSFSSSCVSSFTHRVSRMISGDKRAEKVFLDDVESTYNHLRGRVEASKQEELAGKEQI # QLVPESPDQTIGFNVPEGPPPEKLVLEGPGTEDMDIEEVKKALQLRWDVFTSFPEHLQKALQEGSLEGVNKVLGDMDVAEAEDVVQKLDIAGILSFAE # GGIRDETGKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g195 ### # start gene g196 5 AUGUSTUS gene 1140196 1140545 0.59 + . g196 5 AUGUSTUS transcript 1140196 1140545 0.59 + . g196.t1 5 AUGUSTUS start_codon 1140196 1140198 . + 0 transcript_id "g196.t1"; gene_id "g196"; 5 AUGUSTUS CDS 1140196 1140202 0.59 + 0 transcript_id "g196.t1"; gene_id "g196"; 5 AUGUSTUS CDS 1140256 1140545 0.62 + 2 transcript_id "g196.t1"; gene_id "g196"; 5 AUGUSTUS stop_codon 1140543 1140545 . + 0 transcript_id "g196.t1"; gene_id "g196"; # protein sequence = [MTPIDVVKTRIQIDPKYKPFGFVSGTRYLIANEGPSALLTGFGPTAVGYLAQGGAKFAGYEYWKKSFATFAGDQETAV # KYRTAIYLGAASVAEWVGSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g196 ### # start gene g197 5 AUGUSTUS gene 1146942 1148450 0.93 - . g197 5 AUGUSTUS transcript 1146942 1148450 0.93 - . g197.t1 5 AUGUSTUS stop_codon 1146942 1146944 . - 0 transcript_id "g197.t1"; gene_id "g197"; 5 AUGUSTUS CDS 1146942 1148450 0.93 - 0 transcript_id "g197.t1"; gene_id "g197"; 5 AUGUSTUS start_codon 1148448 1148450 . - 0 transcript_id "g197.t1"; gene_id "g197"; # protein sequence = [MLQALENGGRDQYAIYDSRAAVHEKTLRLREALLDVKEAIRLAPNRWQCYSRAARLFLLIRKFEEASKMVDIALQKID # PSDDKNRATLVALQSQVIESRKRLSCHIGMLPVELLSSIFQYMVEEEPVLVIKISRVCRHWRTVALGDAALWSTLVLSKKDPNRKSKCWIQRSRGRIR # ELCLRRTLSDKVDWSLEKLGGIQWDYIRTCQLEDIDIFKQLEKAGALHVISQLETLVIRDKLMDSREEFVSYLSDNLRHLTIDGALHVWLSDLQVHSL # VSLETIRLGERFIGDLFQLLTKNLSLQSLVVNSPFSAFSEYPEATITLAHLTVLDYCSGSTQLFKFLRLPSLQVISIQTCVQTKNVIQCLLDSGTSQL # KSITFDSCAHLPASELIRILSTNPFVASLTLKKFGGGTVTPILDMLGSSEQLCPALTHLDLSSSSEISSHLLVRIVSSRITAVVESLLNQNEETGRPR # VEKIHSLIVDGCTGIDSDTILGSVKGSHTSVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g197 ### # start gene g198 5 AUGUSTUS gene 1161789 1162241 0.72 + . g198 5 AUGUSTUS transcript 1161789 1162241 0.72 + . g198.t1 5 AUGUSTUS start_codon 1161789 1161791 . + 0 transcript_id "g198.t1"; gene_id "g198"; 5 AUGUSTUS CDS 1161789 1162241 0.72 + 0 transcript_id "g198.t1"; gene_id "g198"; 5 AUGUSTUS stop_codon 1162239 1162241 . + 0 transcript_id "g198.t1"; gene_id "g198"; # protein sequence = [MLMNDDVCDHEAVILVHQPGVCVFFFSTKTFSVAKCTVQLHASDLRQLPKTSHIARSISAASSSRQYAYVPAMYTSDE # DEHHLEFAQSASQKCHARLLNILAGQGGDVDFQAGGQKSVVVVVNLPGVEGSQSESRLNGMAEHGALGLSIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g198 ### # start gene g199 5 AUGUSTUS gene 1164233 1164682 0.93 - . g199 5 AUGUSTUS transcript 1164233 1164682 0.93 - . g199.t1 5 AUGUSTUS stop_codon 1164233 1164235 . - 0 transcript_id "g199.t1"; gene_id "g199"; 5 AUGUSTUS CDS 1164233 1164682 0.93 - 0 transcript_id "g199.t1"; gene_id "g199"; 5 AUGUSTUS start_codon 1164680 1164682 . - 0 transcript_id "g199.t1"; gene_id "g199"; # protein sequence = [MQRILSFEADRRTVNITINSFNTELSKDERARLFPAIGRLFPEGNNQLAKADEIDQVRSVCENVGEYRQFFADAGSSS # DEDSGILSQLEDRFFQTEVHLNKMAFLQQFQYGVFYAYMKLKEQEIRNITWIAECIAQNAKDRIQDFIPIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g199 ### # start gene g200 5 AUGUSTUS gene 1165676 1168644 0.92 + . g200 5 AUGUSTUS transcript 1165676 1168644 0.92 + . g200.t1 5 AUGUSTUS start_codon 1165676 1165678 . + 0 transcript_id "g200.t1"; gene_id "g200"; 5 AUGUSTUS CDS 1165676 1166795 1 + 0 transcript_id "g200.t1"; gene_id "g200"; 5 AUGUSTUS CDS 1167228 1167628 0.96 + 2 transcript_id "g200.t1"; gene_id "g200"; 5 AUGUSTUS CDS 1167688 1167794 0.92 + 0 transcript_id "g200.t1"; gene_id "g200"; 5 AUGUSTUS CDS 1167891 1168644 1 + 1 transcript_id "g200.t1"; gene_id "g200"; 5 AUGUSTUS stop_codon 1168642 1168644 . + 0 transcript_id "g200.t1"; gene_id "g200"; # protein sequence = [MATTAYTIYSHYDPVDREELERETGQLAENNDDDAWQLEAAKVYKRKQPLPPPRFVPASSTSSLTVDDWSTSTPGAGS # SRLSSGPSSSNEVSGWYRSVISSTDVKNTKATSSSHSHSQASAATIHNKPLISKNDWFIQKVLASESSSHIRPAPTTASPSLADILARNPPPAPNEEP # FKPPVFLAIGPSNKGFAMLQNSGWNEGEALGQDVVRRRRIQRGDPSPWVKIEEGQEEKEETVVEVPLGDGEITETRKIPIIDLTASDSESDSEPEDDS # PTDTLITFNDKQQQVSSASGRKALLTPLPTVLKSDRLGIGLKAKTAGPYKESVKRVTHNTAALAAHFRRAEEARARKEKWGKGRRGFARRDKEEQVRR # RSVAGLYDYGPSGSTLQANIIAEWRKHFIVEESMLELDTTIITPAPVFETSGHVARFADWMVKDVKTGDVIRADHLVKNVLEARLAGDKEARGQAAAP # AKEDEKDKKKKKSKTAKAAAVQLADDVAKSYEVTLAQLDNFSGAELGELCRKFNIRNPDTDNEVTEPQEFNLIYLRPETAQGHFLNFSRLLDYNNGRV # PFASAQIGRSFRNEISPRAGLLRVREFTMAEIEHFVDPQNKSHPRFKEMRDVVLVLLDRHVQSSGNTTLIKMSIGEAVEKGIIANETLAYFMARIYLF # LLKIGINPDRLRFRQHMSNEMAHYATDCWDAEIQNSTGWTECVGCADRAAYDLTVHSARTGHPLVVREALKEPIVTEKEVPEFNKKALGKTFKQDAGG # LQKHVESLDEAALSKLKSELAEGCVCFDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g200 ### # start gene g201 5 AUGUSTUS gene 1170829 1171440 0.72 - . g201 5 AUGUSTUS transcript 1170829 1171440 0.72 - . g201.t1 5 AUGUSTUS stop_codon 1170829 1170831 . - 0 transcript_id "g201.t1"; gene_id "g201"; 5 AUGUSTUS CDS 1170829 1171440 0.72 - 0 transcript_id "g201.t1"; gene_id "g201"; 5 AUGUSTUS start_codon 1171438 1171440 . - 0 transcript_id "g201.t1"; gene_id "g201"; # protein sequence = [MSTETRQFGDLANQLIMESRRSTQTDTLLKYNDSLVRLLIREQRDLERAADALEARMDELQGPPPALLIIQTAVSRNK # RCLLAYHSHRIDRLRDLYWDVGGALPHILNNQDIRSKFSPHEVDYLRQYNNSLMEFRSEFSHELDITASITNPPKDLHVLVNVVKDCGVIQTELGSIN # FQKGQRFMVRRADIEHLIIQGYLEEVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g201 ### # start gene g202 5 AUGUSTUS gene 1179818 1180342 0.49 - . g202 5 AUGUSTUS transcript 1179818 1180342 0.49 - . g202.t1 5 AUGUSTUS stop_codon 1179818 1179820 . - 0 transcript_id "g202.t1"; gene_id "g202"; 5 AUGUSTUS CDS 1179818 1180342 0.49 - 0 transcript_id "g202.t1"; gene_id "g202"; 5 AUGUSTUS start_codon 1180340 1180342 . - 0 transcript_id "g202.t1"; gene_id "g202"; # protein sequence = [MNERRLAYEGAVTLAEEEKMAHVTNLVLKQQTAEYRTEREHLLGRQKRAKMKAIREAKRVKMQAKMEAQAEMEAQAKT # EVQAETETEARTAVVQLDSEQDPVTAQPESVEVKTDTPEESASLEPVETKTDAPEVVQSQQVVEKSEQTTKFRPSQSESASEVATAGLFGTRGRRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g202 ### # start gene g203 5 AUGUSTUS gene 1182466 1183107 0.75 - . g203 5 AUGUSTUS transcript 1182466 1183107 0.75 - . g203.t1 5 AUGUSTUS stop_codon 1182466 1182468 . - 0 transcript_id "g203.t1"; gene_id "g203"; 5 AUGUSTUS CDS 1182466 1183107 0.75 - 0 transcript_id "g203.t1"; gene_id "g203"; 5 AUGUSTUS start_codon 1183105 1183107 . - 0 transcript_id "g203.t1"; gene_id "g203"; # protein sequence = [MIQFSSLLRARLTAFSTPYGSLPIHASLWDSATLTSRSLLSRLAIIHLVHEARGLDVNPKTIEKFRKAGDKESVDVLE # VIHADEVTHVTAGHRWFVWMCEQQQQRQGGLEVNPVQAFREEVRRCWHGDIKGPFNVEDREKAGLSREFYDDLKGEMSYPDHEENARMTMNKTTKSAE # ISPEETQVEQKRGNREGPVYTDGIQEALAAVRVTYET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g203 ### # start gene g204 5 AUGUSTUS gene 1184709 1185113 0.71 + . g204 5 AUGUSTUS transcript 1184709 1185113 0.71 + . g204.t1 5 AUGUSTUS start_codon 1184709 1184711 . + 0 transcript_id "g204.t1"; gene_id "g204"; 5 AUGUSTUS CDS 1184709 1185113 0.71 + 0 transcript_id "g204.t1"; gene_id "g204"; 5 AUGUSTUS stop_codon 1185111 1185113 . + 0 transcript_id "g204.t1"; gene_id "g204"; # protein sequence = [MASLNKLAIRGIRSFDDKQVSIIEFFSPVTVIVGHNGSGKTTIIECLKYATTGDQPPNSRGGAFVHDPKMANEKEVNA # QVKLRFFAANGQRMLAVRSLSVTTKKTAGLTMKTLESILAVDDTSVEKNSKVSIRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g204 ### # start gene g205 5 AUGUSTUS gene 1187094 1188736 0.09 + . g205 5 AUGUSTUS transcript 1187094 1188736 0.09 + . g205.t1 5 AUGUSTUS start_codon 1187094 1187096 . + 0 transcript_id "g205.t1"; gene_id "g205"; 5 AUGUSTUS CDS 1187094 1187638 0.41 + 0 transcript_id "g205.t1"; gene_id "g205"; 5 AUGUSTUS CDS 1187727 1187880 0.27 + 1 transcript_id "g205.t1"; gene_id "g205"; 5 AUGUSTUS CDS 1188413 1188736 0.67 + 0 transcript_id "g205.t1"; gene_id "g205"; 5 AUGUSTUS stop_codon 1188734 1188736 . + 0 transcript_id "g205.t1"; gene_id "g205"; # protein sequence = [MNSAFEKKEMTLEEAIKDAFAQLNFAKELVLFDIAWLAHPFIIVIGRYTLVQGQRKYMSEYSKPGSKRKSVPPAIVIW # MTMNCMSLRNMLVFIIATQAVHILSRFQLKEEINKSKQTKDAEASVEGWAEEHERLQKLRPIQSRLDTLKLKEIPAMEEQVAKAETTAMETKEIAEQV # EQRLLREYGKTIARLQAEVERLKQDVKSIENELAASGSTKSTEDIQNEIEALSSEMYRKEQQLRDSNASLEEAKEEIKELEKQVEEARDKIAKIDKEI # SESGSTLSNLRENIRLRKLVTQIQETQTEIDSYDMEEAAKAKRTFQDKWKIAKNKEETLQLEVHIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g205 ### # start gene g206 5 AUGUSTUS gene 1208718 1209026 0.7 - . g206 5 AUGUSTUS transcript 1208718 1209026 0.7 - . g206.t1 5 AUGUSTUS stop_codon 1208718 1208720 . - 0 transcript_id "g206.t1"; gene_id "g206"; 5 AUGUSTUS CDS 1208718 1209026 0.7 - 0 transcript_id "g206.t1"; gene_id "g206"; 5 AUGUSTUS start_codon 1209024 1209026 . - 0 transcript_id "g206.t1"; gene_id "g206"; # protein sequence = [MVNSRTQTTVSVTNPDNGTNNIKGSPSSAASPPPEVVDKPKLTRRPSSVSLPPSIAPRTNKSAALRAAKKEQEAAAAA # ALVAKQQRRASRPPPSSMPKSLIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g206 ### # start gene g207 5 AUGUSTUS gene 1209149 1210505 0.42 - . g207 5 AUGUSTUS transcript 1209149 1210505 0.42 - . g207.t1 5 AUGUSTUS stop_codon 1209149 1209151 . - 0 transcript_id "g207.t1"; gene_id "g207"; 5 AUGUSTUS CDS 1209149 1210103 0.78 - 1 transcript_id "g207.t1"; gene_id "g207"; 5 AUGUSTUS CDS 1210154 1210268 0.6 - 2 transcript_id "g207.t1"; gene_id "g207"; 5 AUGUSTUS CDS 1210310 1210505 0.49 - 0 transcript_id "g207.t1"; gene_id "g207"; 5 AUGUSTUS start_codon 1210503 1210505 . - 0 transcript_id "g207.t1"; gene_id "g207"; # protein sequence = [MTTPPLSSDAPFNFMHGGTDHVDNEELSIPSAPATPQPKITRTVAIIKHHALEHRFDIESRIQEAILVLKIHVQIVKE # RQMEFDVSDPDTLYELFGEDAESFADGPVWVYVLERRRAVEVLQTLMGDRDPEVAKKATPHSLRALYGVSMQQNAVMGSPDSEMAEIQIASLFASSPP # FPTSDLPSDDGRFATMRSVSSSILSNLRKATSDEGYAASSATNDGSRGSGSGKALAANGKPLFKARGLPSTHEKPDIVPRTTRAASLRAGFPLEKSPG # PRKPPTKEQLAKTFANVPGHKRTDTIPVASTAAPAIAPRLTKAAALRLGLPPPPPTVRRQSSNSFEGVPGHKRRESIVVASTQEPTVKPKLNKSASLR # VSKDNAPPTSFMCAYFFPLSTRLSAEFPILQFVVRLNLNYLQEVVLDYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g207 ### # start gene g208 5 AUGUSTUS gene 1211177 1212813 0.41 + . g208 5 AUGUSTUS transcript 1211177 1212813 0.41 + . g208.t1 5 AUGUSTUS start_codon 1211177 1211179 . + 0 transcript_id "g208.t1"; gene_id "g208"; 5 AUGUSTUS CDS 1211177 1211424 0.42 + 0 transcript_id "g208.t1"; gene_id "g208"; 5 AUGUSTUS CDS 1211490 1212813 0.74 + 1 transcript_id "g208.t1"; gene_id "g208"; 5 AUGUSTUS stop_codon 1212811 1212813 . + 0 transcript_id "g208.t1"; gene_id "g208"; # protein sequence = [MNYFPPLIPVPSTQSNSDAKEQLEEEFATLFSPPTPRASPEPPSNIIFKPLARSVQQHEASNSPDSEFGSFVSVPPSE # DPCPFPSWSFFDSFAQEAKAAHERNKRDVMDEILYEENRSKRPQDLRNPSQQSSEAPNSLLDLDLDFFSPKPDSIKPGEEYDFEAHDSSIQHTPRHAK # TSSPQIPTRKSTLSLPHGPAPPVASTSSALSSSRTEDVPDAESTITQSPSYQTLSNISSRWVPSLLRSSSSESSPHGSGFEHPSRSATTSISISNTHT # RSQSSSDSRGSRHAQSFPFPTSIASSLSSSFTPSLPSTILNQPTLHGGTHHSPFAPHVFVAPTGAPGYKPEGYDWDKGYSGDLDRELLEAGSSSNGRS # NLLDVPGPISRHSSPVDKILVPGLPSSNSQPHSHSRTPSPNPSIGIGGLIEKKSGNLELKGRRDATVAVLDVNLAEMVRMLTLEKSCVRSETLCSKIR # SRLPALARLPVPGICSTLSISTAFLCTRFTISAKTSRNLRSARRLPPKSVHWL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g208 ### # start gene g209 5 AUGUSTUS gene 1226997 1227359 0.49 - . g209 5 AUGUSTUS transcript 1226997 1227359 0.49 - . g209.t1 5 AUGUSTUS stop_codon 1226997 1226999 . - 0 transcript_id "g209.t1"; gene_id "g209"; 5 AUGUSTUS CDS 1226997 1227359 0.49 - 0 transcript_id "g209.t1"; gene_id "g209"; 5 AUGUSTUS start_codon 1227357 1227359 . - 0 transcript_id "g209.t1"; gene_id "g209"; # protein sequence = [MPNVVMMNATAVEDLIIHEDHAGQQRVAGVVTNWTLVALNHDTQSCMDPNTITCPVVVSATGHDGPMGAFSAKRLVSA # GLLKELGNMRGLDMNRSEPAIVNNTREVAPGLIMAGMIAFLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g209 ### # start gene g210 5 AUGUSTUS gene 1230958 1232491 0.73 - . g210 5 AUGUSTUS transcript 1230958 1232491 0.73 - . g210.t1 5 AUGUSTUS stop_codon 1230958 1230960 . - 0 transcript_id "g210.t1"; gene_id "g210"; 5 AUGUSTUS CDS 1230958 1231891 0.96 - 1 transcript_id "g210.t1"; gene_id "g210"; 5 AUGUSTUS CDS 1232036 1232349 0.84 - 0 transcript_id "g210.t1"; gene_id "g210"; 5 AUGUSTUS CDS 1232441 1232491 0.73 - 0 transcript_id "g210.t1"; gene_id "g210"; 5 AUGUSTUS start_codon 1232489 1232491 . - 0 transcript_id "g210.t1"; gene_id "g210"; # protein sequence = [MDLSLGLPQASTVNEELVVGGLGTGKTSLLRLLLETADLSPTATVDQRAAVDRFLSGSPKPTQSIHTACVEICESKYD # RVLFSVIDSPGLDFMEGRELKLERQVSSVIKYIDAQYADTLSEVCIYLIDPSSIMTVAERRIKSSLPTKTRSETTVSYRTPPDLIPDTSSDSEDEESP # LTMAPAEIRVIRRLAARCNVLPTIAKSDSLTDDALKNAKEAVRRSLSEAGLDFGIFGPPQISTPKKARAARFAGDLNDATDTSNTEDEDEERQSRPVI # KLRRPTVGRALSRSRSRRDLSQAAEDEHRPVSPDMESVASVRFSAHIVAKPDLTTLMPFALIAPEITALNRRNTSTDDQMLNTAPSSPIQQSEDGHAL # SVESSRRHSYLQGPPPDALKNVFIRKFRWGTVDVLDPDHCDFSALRTAVLSTHLKVSPCT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g210 ### # start gene g211 5 AUGUSTUS gene 1240043 1240530 0.39 + . g211 5 AUGUSTUS transcript 1240043 1240530 0.39 + . g211.t1 5 AUGUSTUS start_codon 1240043 1240045 . + 0 transcript_id "g211.t1"; gene_id "g211"; 5 AUGUSTUS CDS 1240043 1240219 0.39 + 0 transcript_id "g211.t1"; gene_id "g211"; 5 AUGUSTUS CDS 1240321 1240530 1 + 0 transcript_id "g211.t1"; gene_id "g211"; 5 AUGUSTUS stop_codon 1240528 1240530 . + 0 transcript_id "g211.t1"; gene_id "g211"; # protein sequence = [MASAAETMGMTLPGSSSFPAESQEKRAECASIGPAMYELVSRNILPREIMTRSAFENAMVLTMILGGSTNAVLHLIAI # AHSVGITLTIDDFQNVSDRTPFLADIKPSGKYLMEDVYKIGGIPSKSIAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g211 ### # start gene g212 5 AUGUSTUS gene 1241515 1241905 0.53 + . g212 5 AUGUSTUS transcript 1241515 1241905 0.53 + . g212.t1 5 AUGUSTUS start_codon 1241515 1241517 . + 0 transcript_id "g212.t1"; gene_id "g212"; 5 AUGUSTUS CDS 1241515 1241573 0.53 + 0 transcript_id "g212.t1"; gene_id "g212"; 5 AUGUSTUS CDS 1241653 1241905 0.77 + 1 transcript_id "g212.t1"; gene_id "g212"; 5 AUGUSTUS stop_codon 1241903 1241905 . + 0 transcript_id "g212.t1"; gene_id "g212"; # protein sequence = [MGAGLGFDVACLTDGRFSGGSHGFCIGHVVPEAQVGGPIAFVQDGDVISVDAVKNTIELHITPEEMEKRRKAWVAPPL # KVTQGTLYKYVKLVTDASHGCVTDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g212 ### # start gene g213 5 AUGUSTUS gene 1242240 1243085 1 - . g213 5 AUGUSTUS transcript 1242240 1243085 1 - . g213.t1 5 AUGUSTUS stop_codon 1242240 1242242 . - 0 transcript_id "g213.t1"; gene_id "g213"; 5 AUGUSTUS CDS 1242240 1243085 1 - 0 transcript_id "g213.t1"; gene_id "g213"; 5 AUGUSTUS start_codon 1243083 1243085 . - 0 transcript_id "g213.t1"; gene_id "g213"; # protein sequence = [MYCSTYIHLKLIHYRASPRLKDAQLTLEESINLYVELILAVRKIFQQCKLVHADLSEYNILFHEGHLWIIDVSQSVEQ # DHPSAFDFLRKDLSNVEEFFGRLGVRCLGLRRVFEFVITDNLPRSSEALSDEDILRIWIEEGLNPENAASEDLESSAAHEDSVFKESYIPRTLNELFD # PERDVAAVNRGEGTKLIYAGTIGLVDPSSSTNDPERLQSSRSARANMSRTGGAVDKIENVSASESDKESDDSDNDTDSAGVYSERKPRGHRHEDREAK # KVGFTLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g213 ### # start gene g214 5 AUGUSTUS gene 1243411 1244082 0.65 - . g214 5 AUGUSTUS transcript 1243411 1244082 0.65 - . g214.t1 5 AUGUSTUS stop_codon 1243411 1243413 . - 0 transcript_id "g214.t1"; gene_id "g214"; 5 AUGUSTUS CDS 1243411 1243763 0.65 - 2 transcript_id "g214.t1"; gene_id "g214"; 5 AUGUSTUS CDS 1243887 1244082 0.68 - 0 transcript_id "g214.t1"; gene_id "g214"; 5 AUGUSTUS start_codon 1244080 1244082 . - 0 transcript_id "g214.t1"; gene_id "g214"; # protein sequence = [MPAVTQDGQFDDAPEVPDPRAGFFYIDSFEESDDISEDEVYEDEDIDDIYQDDRVEDEDWEIAERALNQSTSVAALPA # INHPRSGTTTASISSPVVKDKTADQLAALSKYNSRLAKIDVPYFLGVGINRKGPSASANLKDKSDRATNEQVLDPRTRLILFKMIGRELIHEVNGCVS # TGKEVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g214 ### # start gene g215 5 AUGUSTUS gene 1254289 1255932 0.83 + . g215 5 AUGUSTUS transcript 1254289 1255932 0.83 + . g215.t1 5 AUGUSTUS start_codon 1254289 1254291 . + 0 transcript_id "g215.t1"; gene_id "g215"; 5 AUGUSTUS CDS 1254289 1255932 0.83 + 0 transcript_id "g215.t1"; gene_id "g215"; 5 AUGUSTUS stop_codon 1255930 1255932 . + 0 transcript_id "g215.t1"; gene_id "g215"; # protein sequence = [MTRRSSGMVGPQYIVHFTSHLQLTVKRNAAGVQMLSRSLHEQIFKNCTFPSPPKTYTNISLEHLKTHGLDPTQSSTLP # STDFILPPLQGNNLLEHFHRIGASSSQPYISFAKQFAEAELPPIPDDWQLQAGWTKYHHSSDGSGYCEHVAFPSHDGKSEIMLAFDVETMPKYHQYPI # LACAASPNAWYVWISPWILDSSSNSPEHLIPLGPPDVSRLVVGHNVSYDRARIQEEYHLAGTKNRFLDTMSLHVAIKGISSHQRPAWAKYRKEKQDAI # ESRDEAIEAVIHLLHDVEQQLKGLREAVASGLVDDRGEVQKLVDLQSNLEESLSGLKITQSASSDTNQPDPLLTDADLDDEPSIETSQKRWEDITSGN # SLVDVAKLHCDIDISKEIRNDFMTATPLEILESINDYISYCATDVGTTHAVYKKVLPGFLQACPHPVSFAGVATMGSGFLPVNEQWEAYIDRAERVWQ # NLEGKVRTGLENLARAAIAEYKVTSPDAPVVGPWQDDVWLNQMDWTPKVAGKTRGVYPPGEQPVRPTFIQSSLFSLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g215 ### # start gene g216 5 AUGUSTUS gene 1256020 1258494 0.32 + . g216 5 AUGUSTUS transcript 1256020 1258494 0.32 + . g216.t1 5 AUGUSTUS start_codon 1256020 1256022 . + 0 transcript_id "g216.t1"; gene_id "g216"; 5 AUGUSTUS CDS 1256020 1258494 0.32 + 0 transcript_id "g216.t1"; gene_id "g216"; 5 AUGUSTUS stop_codon 1258492 1258494 . + 0 transcript_id "g216.t1"; gene_id "g216"; # protein sequence = [MLLADPFSKKCIERILPLLLELSFDDHPLRFTTKDKWHYCPSEDASKITLLPTALKKGLKTGTVLTRSHSLPLLQDGS # MTSCDVDLALKLSRGDKGDEVKHGVLRLAEHAYRKDRAATIHTSWLSQLDWSPVEINNDGVPKTKLKKPKVQKAPPVYWPKWYWDLTKPKKGMPPGAL # DITTRNRYAPLLLKMSWQGFPLVFSREHGWIFRVPLSPSSADPPIDSAIRERLQRSSPLSFYHSDDEHLANAASYVFYKLPHKDGESANVGSPLAKSF # LRFAMDGVLKSSAGDELKELVDVGVKCSYWISARDRILNQMVKWDEKSSDMGFPDIATTQSPEEFKSQQKELAEVAAALGEEFVETPRAKKWGIIVPQ # VITMGTVTRRAIERTWLTASNAKKNRVGSELKAMVRAPPGYAIVGADVDSEELWISSCMGDAQFGMHGATAIGWMTLEGTKSAGTDLHSKTASILGIS # RDQAKVFNYSRIYGAGMRHAMLLLQQGNSNMSQEEAQKLAENLYASTKGKNTHRSDLFGKKFWYGGTESYLFNKLEEIALSDKPQTPALGCGVTHALQ # KDCLPAGFGSDYMPSRINWVVQSSGVDYLHLLIVSMDYLIQKYDIGARYLISVHDELRYLVKEEDRFRAALALQIANLWTRSMFAYKLGLDDLPQGVA # FFSAVDVDGVLRKEVDMTCVTPSQPIPIPPGESLDIGDVLTRTNGGSLWADGRPMESSSAETTLEGSLDGYVEAQCLTHRADNAAFLRAQATSDLGEV # KHLAKQFQGKTFEAKLKSVPAGNRNRASKHRKSVPVGDGEGVDWSEIVERLLRSGRELVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g216 ### # start gene g217 5 AUGUSTUS gene 1261054 1262775 0.35 - . g217 5 AUGUSTUS transcript 1261054 1262775 0.35 - . g217.t1 5 AUGUSTUS stop_codon 1261054 1261056 . - 0 transcript_id "g217.t1"; gene_id "g217"; 5 AUGUSTUS CDS 1261054 1262775 0.35 - 0 transcript_id "g217.t1"; gene_id "g217"; 5 AUGUSTUS start_codon 1262773 1262775 . - 0 transcript_id "g217.t1"; gene_id "g217"; # protein sequence = [MHLSTGLSLVSIAYLWGVVSASTNLTQCFLDMQAGKFGPDAGLDSYGNPVQNLRDATAIPYDLCVVVCGGGPEAFDWS # NFSNQLNTWLLPWLALLSQLPFGANDHLQNLLAVVLTIGSPVLASYSVVLTVLNGRWIAQRFSGSTYPNTLAAVRALKDLQQAPITLNLDDKALLASL # VVLPENDDWWKKLLQHIDCTHTWSISAGISLAWVFIAYAISVIDSLFNVLQGVEVDGLGSVWLWLLPVVISWLQISPKCDSGRITESLRHANEIAYVA # VEGCNKSKRAGEISDHRAFFFKDGHNPLYSDERCTSPIYNYSRLFSWTAVVEEVCVCFEEATRRSRLYQPVASEKEWVLGEQSCYVELENRYGTSSEV # VTYCSPLFRQTDRWGPGVFGRIAVSSIMALFLQWGTAGAAMIVAIKTPTRGLSCLSGSFLVYASVSTVVWFFLLIASILSHFSSFNNVYSNMTATLSI # IIRRVGKFLAAANAVWILTACIFNFSSFFDRCYCNSSVLGIGAAKAFNVLIFTQADQFSTRTAWIGAAFLAMGSAAIYIIFINLYVNSPLSATICDSE # SNVCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g217 ### # start gene g218 5 AUGUSTUS gene 1273284 1273913 0.89 - . g218 5 AUGUSTUS transcript 1273284 1273913 0.89 - . g218.t1 5 AUGUSTUS stop_codon 1273284 1273286 . - 0 transcript_id "g218.t1"; gene_id "g218"; 5 AUGUSTUS CDS 1273284 1273913 0.89 - 0 transcript_id "g218.t1"; gene_id "g218"; 5 AUGUSTUS start_codon 1273911 1273913 . - 0 transcript_id "g218.t1"; gene_id "g218"; # protein sequence = [MDESLSELTQIHDIQTEMDNKEEWNSKTLEYRREREGTLRQLERHASSYTTLGRSTVELLKLFTAETKKPFMMPEIVD # KLAAMLDYNLEALVGPRMQNLKVRQPEKLRFDPKALLSDVLQIFLNLSDQPEFMKAIAGDGRSYSKGLFEQAERIMFRRSLKSGTDLEKWRLLITKVE # EAKETLEAEEDLGDIPDEFLGMNVSCHYLCRDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g218 ### # start gene g219 5 AUGUSTUS gene 1275942 1276430 1 - . g219 5 AUGUSTUS transcript 1275942 1276430 1 - . g219.t1 5 AUGUSTUS stop_codon 1275942 1275944 . - 0 transcript_id "g219.t1"; gene_id "g219"; 5 AUGUSTUS CDS 1275942 1276430 1 - 0 transcript_id "g219.t1"; gene_id "g219"; 5 AUGUSTUS start_codon 1276428 1276430 . - 0 transcript_id "g219.t1"; gene_id "g219"; # protein sequence = [MSNLPDANIRRLLGPPELVAPLLSLSTLSTPLYSSNTASANTLSPTDVELFLQDLARRFEPDNEIDEVLGDVVRQLLF # HESLFRPEGLGGAVATWRGVVGGLEALVSVKSIAVMITRMPEWIPANATAANFEKLSLMGPLCRLGVFAREWVSLLSKIDYPLY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g219 ### # start gene g220 5 AUGUSTUS gene 1279335 1280672 0.44 - . g220 5 AUGUSTUS transcript 1279335 1280672 0.44 - . g220.t1 5 AUGUSTUS stop_codon 1279335 1279337 . - 0 transcript_id "g220.t1"; gene_id "g220"; 5 AUGUSTUS CDS 1279335 1280672 0.44 - 0 transcript_id "g220.t1"; gene_id "g220"; 5 AUGUSTUS start_codon 1280670 1280672 . - 0 transcript_id "g220.t1"; gene_id "g220"; # protein sequence = [MPKLGRHYLEVWEEQDRLGLTTSSSALGTLQQVALNGGDIPPNPSAVAPNPSFDPSTLSESDTQLEHLGHGPLTERLI # SALLPMPDSHLTWKGVKAAEDAMEGRPGGSGAAASRKEKLSVSDLERRIGDTMRWYNLLPSGSNVQPLDYSNKTDDPIATALRINQAELRRVSAINRL # RKARYAEIARDRVAWAEYLELRESIDRNITNVYNKLQKMQKAQRDAPKLGRKKKFKSEESTPVKGVNGSNGNGSVNGDTPPLPLCPAALGLGPDEDNQ # LVVSETLKQLVQTRRNWVKLGETLLDEKEGPLEVIELMEPGESSPEPNAEDLSSSPGVNDSSSSKWRVPVMERPRRGRLVGFPKESIFKGIEEEVEEL # MRDWERHNVEREQAEGQAKIPTTTNSRVGATTVPHSNDTSTSGSGLKIHLNGHVQATYGKGKGKARDDQMDVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g220 ### # start gene g221 5 AUGUSTUS gene 1284734 1287782 0.81 + . g221 5 AUGUSTUS transcript 1284734 1287782 0.81 + . g221.t1 5 AUGUSTUS start_codon 1284734 1284736 . + 0 transcript_id "g221.t1"; gene_id "g221"; 5 AUGUSTUS CDS 1284734 1286205 0.97 + 0 transcript_id "g221.t1"; gene_id "g221"; 5 AUGUSTUS CDS 1287020 1287782 0.96 + 1 transcript_id "g221.t1"; gene_id "g221"; 5 AUGUSTUS stop_codon 1287780 1287782 . + 0 transcript_id "g221.t1"; gene_id "g221"; # protein sequence = [MKFFSGKGGDGCAAFHREKFLPFGPPSGGNGGRGGDVYILPTPELTTLTSVAKRVRGENGGNGQGTWQNGKNGAPLII # RVPLGTIVRELPRDDPRRAKDEWEAEAEALEGLDPADKQAKMRDKRWVHYPRHSESNVDRDVFKEAEQMLYKQERDRRYARRKREIEQPIYLDLDKDM # ELEEDPNLPLGLPRKDALGHLIASGGQGGLGNPHFLSQDNRSPKFATRGHEGERVTLSLELKLLADIGFVGIPNAGKSTLLRALTGGRAKTEVAGYAF # TTLNPVIGVVRVAADGSFEGGLSEGMVHDETLVEEAQNQAKMEEGAFADALTRNQQANSDAVARGFGAGYRFDIVEHFRFTIADNPGLITKASENVGL # GHSFLRSMERSLGLVYVVDFSSPAPWEEIAILRDELEQYLPGMSNKARMVIANKADLLAGDGDAASIEEAKLKLKRLEEFVEKEMLVVDDDGNRRSLS # VVPISAKYSQNLKKVVELMQRSPTASAPINRRGDIHSSLSITPTSHRRVRPPRSTHSNADPLTSDGIQLDLPPSSAPLLSAANDPVSEEPDEIRAIWG # TTVNINQTIQLFTDFLKNFKIKYRIAYNRENRLPTSALATPEEGEVLLYEGYLRRMRQTGETNLNLDVRNLLAYPPTKKLHTQVIKYPQEVIPTFDQA # LKDVMIDLAEQDQAEGLEGMQDAAGDAEISDILSKVYKVRPLGVTPINMRELNPSGELHPVLLAIQVMAYLTSPLRYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g221 ### # start gene g222 5 AUGUSTUS gene 1287955 1289891 0.18 + . g222 5 AUGUSTUS transcript 1287955 1289891 0.18 + . g222.t1 5 AUGUSTUS start_codon 1287955 1287957 . + 0 transcript_id "g222.t1"; gene_id "g222"; 5 AUGUSTUS CDS 1287955 1288668 0.43 + 0 transcript_id "g222.t1"; gene_id "g222"; 5 AUGUSTUS CDS 1289316 1289891 0.83 + 0 transcript_id "g222.t1"; gene_id "g222"; 5 AUGUSTUS stop_codon 1289889 1289891 . + 0 transcript_id "g222.t1"; gene_id "g222"; # protein sequence = [MSLIHNRSEFADRQVVRVQETPDAVPDGQTPHTVSLSVYDELVDVSKPGDRILVTGIFRSTPVRVNPRQRSLKSLFKT # FVDVVHIKLGTDKGLGFDRSTRPMGGDKIPGVGGVGDGLDGDNPDANPLDDVPSVEGGSSRRALHQDHLRELSQQPDIYERLARSLAPSIWEMDDVKK # GILLQLFGGTNKSISRGGGGGGPRYRGDINVLLVGDPGTSKSQILQVGDLVSRCLPKLTLMVPIHELAAYIDYARSRIHPIITESAGKELVAAYVEMR # NMGTDPRTSEKRITATTRQLESMIRLSEGHARMRFSEFVEDQDVEEAVRLMREAIRTSAMDPRTGKIDMGMLNTGTGQGQLKLREDMRRELLKIINAT # GGTRGVKWTDVVKSLSAQSSIKIDPAEFTEVVKGLENEGLVKIVGERDKRMIRKMDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g222 ### # start gene g223 5 AUGUSTUS gene 1291167 1291472 0.44 - . g223 5 AUGUSTUS transcript 1291167 1291472 0.44 - . g223.t1 5 AUGUSTUS stop_codon 1291167 1291169 . - 0 transcript_id "g223.t1"; gene_id "g223"; 5 AUGUSTUS CDS 1291167 1291472 0.44 - 0 transcript_id "g223.t1"; gene_id "g223"; 5 AUGUSTUS start_codon 1291470 1291472 . - 0 transcript_id "g223.t1"; gene_id "g223"; # protein sequence = [MIHRENDITDVLYETFTRTEDRFGEIVTIDLKPNGADIPVTEENKKEYVDAVVEYRISKRVKDQFNAFMEGLLELIPL # DLISVFDEREMELLIGGISEIDM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g223 ### # start gene g224 5 AUGUSTUS gene 1292113 1293021 0.75 - . g224 5 AUGUSTUS transcript 1292113 1293021 0.75 - . g224.t1 5 AUGUSTUS stop_codon 1292113 1292115 . - 0 transcript_id "g224.t1"; gene_id "g224"; 5 AUGUSTUS CDS 1292113 1293021 0.75 - 0 transcript_id "g224.t1"; gene_id "g224"; 5 AUGUSTUS start_codon 1293019 1293021 . - 0 transcript_id "g224.t1"; gene_id "g224"; # protein sequence = [MSSNNLPVYGKLLFGFTLTSRPPPPTPRLADTSSFPMPAADTAHLSPNHPSGSATLDRIRSSSVIARTYDNEFPRTQH # LASSQSLRPSSSNANLSSSMSQRFPQPEVAGRPVSTAGVTNPTPARVVEDSEGNPLPDGWERRVDPQGRTYYVDHNTRSTTWYRPTSSQQNRTSQVPQ # QAPTRNPSATSSAPSTTQSTSPPSEYNDVHLPLGWEERRTPEGRPYFVDHTTRTTTWVDPRRTLNQSTVAPATNVNSNLGPLPSGWEMRLTSTGRVYF # VDHNTRCDFYVYLLHFCLTLPQKNYELG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g224 ### # start gene g225 5 AUGUSTUS gene 1294461 1296515 0.78 + . g225 5 AUGUSTUS transcript 1294461 1296515 0.78 + . g225.t1 5 AUGUSTUS start_codon 1294461 1294463 . + 0 transcript_id "g225.t1"; gene_id "g225"; 5 AUGUSTUS CDS 1294461 1296515 0.78 + 0 transcript_id "g225.t1"; gene_id "g225"; 5 AUGUSTUS stop_codon 1296513 1296515 . + 0 transcript_id "g225.t1"; gene_id "g225"; # protein sequence = [MYVSSNPVSSVERRDTKPKEKSTAGPVAALPTPPSSLPARRHRSASISSDDTSKATFLPQFDHTSGTSSRLKYNLRAG # HPSLFRSIKLLRALRSTADVPGVRSLAQVLLSSIINVVHLMQVPQDVKDDQKYLENIQAVSFMVQQFQQGVERLEHVDASRGAAAVSRVVDIAELTID # ALERLLGLTERLVKPLPEIPADAVEEVKAPGLPLTPHLRASKGSTSDRSFARMSLAQITTEVLDHPTEDSPKSSSSSRTSAILTILHKARDKSVLGSL # FKSKSDAASSGDEYPQYAPRNSALYYPVDPLNPDVDVELPPMSEDAMNITLSHDSVHMIKMSLVAVIRLLTSKDAIQDPYLIHWFFTTFRYVLLPSDV # LDLLISRFNETMPDEPMDQKQMRVWCNNHAKIVRPRVVSVLIRWLTQFWEPPYDDSCVLNDMQDFVLKQVSASLLPDRLGIAFAQAVKVVRVDGVTRT # TWLQKRQQSISYRRLSNPAPYAFVEQCTTKFPLEAFNCTAGYKVLAEQLTRMEASIWGQLPVQALVRLWLERKTTTCEIRLGAKLCDIKERHEAIGME # SKNLQEQVDKSTKRILINTLKSQQRALLRQSSSLAAQIQVYEGTIQEITASRNLAERAATAVRHFNRSLFMLVISTILLEAENEDGMVRAIKFWFKVC # EVSPCPSSINSLFTYEYT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g225 ### # start gene g226 5 AUGUSTUS gene 1300774 1302111 0.97 - . g226 5 AUGUSTUS transcript 1300774 1302111 0.97 - . g226.t1 5 AUGUSTUS stop_codon 1300774 1300776 . - 0 transcript_id "g226.t1"; gene_id "g226"; 5 AUGUSTUS CDS 1300774 1302111 0.97 - 0 transcript_id "g226.t1"; gene_id "g226"; 5 AUGUSTUS start_codon 1302109 1302111 . - 0 transcript_id "g226.t1"; gene_id "g226"; # protein sequence = [MTRICRAQFENDDIREAKLVCGRAPSSDITPTETRILEEDVEAATGSQTQQDLPIHDSSSTSRSKLSVRLPEWISSSY # ATIRQRPRNIAHRAPIPFSDDRPSFSRLMSMHSTAVGSPTELPPTIAALSSTAHENSGPVTPHPPPISWDDQSTLDLPYDNPYYTRAISNVLWLPRNP # CGTLDLDDTVDLKVAISVDPTTGKIGTWSVSGETRSPSDAVESISDSFRLSPAPFSDGGASMLSVNSGVNTGAFPSTSEPEIDGTENIELPEILAKRA # LQKDNVEPAVRPRRPSLFQQRQNERSSSLSLGPHRRPSTRHRQTSESRSISDIAIAAQTKPQKQKSIMSMFDDHSIQRSSSHEIDPAARPDAHAQAEL # VMAHPAPSHMSIDHPPPTLKRAVTISANRAIYHEILAEEQQALGQRLVEERAEADRNKSTKSWLTKWMFKKAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g226 ### # start gene g227 5 AUGUSTUS gene 1303485 1305080 0.44 - . g227 5 AUGUSTUS transcript 1303485 1305080 0.44 - . g227.t1 5 AUGUSTUS stop_codon 1303485 1303487 . - 0 transcript_id "g227.t1"; gene_id "g227"; 5 AUGUSTUS CDS 1303485 1305080 0.44 - 0 transcript_id "g227.t1"; gene_id "g227"; 5 AUGUSTUS start_codon 1305078 1305080 . - 0 transcript_id "g227.t1"; gene_id "g227"; # protein sequence = [MTRASISSLVDTTTGLSLLWIHICLMFWIALSWMATLFWIMHGAFRMRSDNIAATARRKALRDSDGHEYHPHPHPPYT # FAESPSLDTNTPVEGLRFRTIMVSNVPPQLRNESELKEYFEYYMSRKLEKPALGVNSTTQPGMFNKVFSFLFNRVKKLPVYLPQEGKENTGHTEETAN # PDDKPVIERVVIARKMTELASLLERREEILRLLETAHIKLANTTLNAVKHAMERKANATSFTRSSSRAGLIAKQRAQQTNLEAGDASQDGTMTEEQRI # ERLIKALGPYVDEFGIKSYPYLRKSFKTRYSFKKVRTDRSLDSDSESTEPPTSPKYPPSTVASHPPRRQKTVWDVLLSLPRSSIDAYQPLVRLSHLFR # GKTVPSIDYYTAKLNLLTALITENRAKPANRYDPVSTAFVTFAEPEDARRACKYLAVHPNNPLACIATMAPQYQDLDWQRIMKSSFKAEVSHFVCLVG # PLVDHHLQFVKDWVVDAGVWAFTIFWLFPVSLLVGLVSIQNISTFWPSLVWRFPATIIVSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g227 ### # start gene g228 5 AUGUSTUS gene 1318075 1318908 1 + . g228 5 AUGUSTUS transcript 1318075 1318908 1 + . g228.t1 5 AUGUSTUS start_codon 1318075 1318077 . + 0 transcript_id "g228.t1"; gene_id "g228"; 5 AUGUSTUS CDS 1318075 1318347 1 + 0 transcript_id "g228.t1"; gene_id "g228"; 5 AUGUSTUS CDS 1318432 1318908 1 + 0 transcript_id "g228.t1"; gene_id "g228"; 5 AUGUSTUS stop_codon 1318906 1318908 . + 0 transcript_id "g228.t1"; gene_id "g228"; # protein sequence = [MQRQVSNPEYPCNPGKRAEAVGRDCALLFPVTWGIFQPFLSLQWTVPEGDTDEANKIHQLKLKVVYLPPEGQVLEEED # ENLANQSSIIPDSPTANGHDIPEFALEGEPSTLQHPEEEEHHDAHEEVPIPPVSVFIQPPPPEVAVPESATPAIAPVTSTPAAPVVPPLTDLTEELMD # ARAEIDRLRSLLAAAAPPPELRQRTRRLSDDITIAPSDVGTMVEELPMPQDGVPLQVVVIISLGVFIMTYLFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g228 ### # start gene g229 5 AUGUSTUS gene 1323019 1324580 0.53 - . g229 5 AUGUSTUS transcript 1323019 1324580 0.53 - . g229.t1 5 AUGUSTUS stop_codon 1323019 1323021 . - 0 transcript_id "g229.t1"; gene_id "g229"; 5 AUGUSTUS CDS 1323019 1323612 1 - 0 transcript_id "g229.t1"; gene_id "g229"; 5 AUGUSTUS CDS 1323740 1323847 0.99 - 0 transcript_id "g229.t1"; gene_id "g229"; 5 AUGUSTUS CDS 1323903 1324580 0.53 - 0 transcript_id "g229.t1"; gene_id "g229"; 5 AUGUSTUS start_codon 1324578 1324580 . - 0 transcript_id "g229.t1"; gene_id "g229"; # protein sequence = [MQAITHGRGAASKLFATIDRVPAIDSADPNGLQPEHVEGEITLENIKFAYPSRPGVVVVKDLSLNFRAGKTAALVGAS # GSGKSTVISLVERFYDPLAGVVKLDGRDIKTLNLKWLRSQIGLVSQEPTLFATSIRGNVGHGLIGTKYEHASDEEKFALIKDACIKSNADGFISKLPL # GYDTMVGERGFLLSGGQKQRIAIARAIVSDPRVLLLDEATSALDTQSEGVDALDKAAAGKFIIFADQFLFLDINASRSYNYHDCASKLREAAEVTEAA # ENDENAEDTPENMEKAALEEIPLGRKNTGRSLASEIIEQKQKNISNEKTEYSIVYLFRRMGWINRASWKKYLFGGFCAILTGLVFPAYGIVYGVLTNK # PFYFLLMTLPITAQGINGFAETGHAERVAGDRNALWFFLIAIISSLTIGVQNYNFSASAANLTAKLRSLSFRAILRQDSQFIASPLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g229 ### # start gene g230 5 AUGUSTUS gene 1331360 1331590 0.54 - . g230 5 AUGUSTUS transcript 1331360 1331590 0.54 - . g230.t1 5 AUGUSTUS stop_codon 1331360 1331362 . - 0 transcript_id "g230.t1"; gene_id "g230"; 5 AUGUSTUS CDS 1331360 1331590 0.54 - 0 transcript_id "g230.t1"; gene_id "g230"; 5 AUGUSTUS start_codon 1331588 1331590 . - 0 transcript_id "g230.t1"; gene_id "g230"; # protein sequence = [MDAHIGDLHSLIVDREIEIIQALLEEILVHDAAMSHACDVCAELDCLLAFADVSRAYDYQRPVMVEDNIIDIVQGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g230 ### # start gene g231 5 AUGUSTUS gene 1334443 1335670 0.7 - . g231 5 AUGUSTUS transcript 1334443 1335670 0.7 - . g231.t1 5 AUGUSTUS stop_codon 1334443 1334445 . - 0 transcript_id "g231.t1"; gene_id "g231"; 5 AUGUSTUS CDS 1334443 1334796 0.88 - 0 transcript_id "g231.t1"; gene_id "g231"; 5 AUGUSTUS CDS 1334950 1335339 0.81 - 0 transcript_id "g231.t1"; gene_id "g231"; 5 AUGUSTUS CDS 1335395 1335670 0.99 - 0 transcript_id "g231.t1"; gene_id "g231"; 5 AUGUSTUS start_codon 1335668 1335670 . - 0 transcript_id "g231.t1"; gene_id "g231"; # protein sequence = [MLSSSPLRVFTSSGTPFRSGSAALITKRKFRNYATQAKIPVNIVEVGPRDGLQNEKGVIPVDVKVELIEKLALAGCNN # IEAGSFVSPKWVPQMAGTGEIISRMHRLPDVHYAVLVPNQKGLDGLLSVLNAYNSSPDSESVPPPSDEISVFTAATDAFTRANLNTSITESLVKMAPM # VRAALDKGLRVRGYVSVAIACPYTGQVDYKKVREVSRELLEMGCYEFHDTFGTAVANVFTALEHGVRTIDSSVGGLGGCPYSPGATGNVATEDVLYAL # QGSKYGITGTEYGKGTIDLDQITEIGWWISEKLGRESVSRAGRALRAKKIRDAEMAKDGEVRAKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g231 ### # start gene g232 5 AUGUSTUS gene 1342437 1343676 0.28 - . g232 5 AUGUSTUS transcript 1342437 1343676 0.28 - . g232.t1 5 AUGUSTUS stop_codon 1342437 1342439 . - 0 transcript_id "g232.t1"; gene_id "g232"; 5 AUGUSTUS CDS 1342437 1343320 0.54 - 2 transcript_id "g232.t1"; gene_id "g232"; 5 AUGUSTUS CDS 1343379 1343676 0.51 - 0 transcript_id "g232.t1"; gene_id "g232"; 5 AUGUSTUS start_codon 1343674 1343676 . - 0 transcript_id "g232.t1"; gene_id "g232"; # protein sequence = [MPETRPRQSSIGSRRRPPKAHIPYRGDSLEVTRKTGVKVAHDPDSDGFETYEHFAQQADKITPYKIKDSKKKKKGISP # DPEPQEEEGDSDMEIDSAYYFTNSRQPSSPISRRTNSMSRPVARNSANQFDDVPSPHTRSHNKLRHSNISAGRSRLSQRVMVNDDDPISTTTHGTNGF # ADMSLDIGFPDDLSISHRSFTELDRDAMEDDEMDGVVDELPIPSPKRKKGNPPLSDDPPAQSPKRKRGQAIERTTSPEEPPPRTQTPDAEDEIQQQLE # DLTNGNESIGEQEEVQEDEEEEAVASKKSRMDKGKEKQKEKGQARKKETHREGMSFALMMIWTHYFIYPQVCAAVNEDLSDHSSGGETRNMCMNGLRM # APSLYLTLKKSFEYRRNRRSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g232 ### # start gene g233 5 AUGUSTUS gene 1345982 1346572 0.8 - . g233 5 AUGUSTUS transcript 1345982 1346572 0.8 - . g233.t1 5 AUGUSTUS stop_codon 1345982 1345984 . - 0 transcript_id "g233.t1"; gene_id "g233"; 5 AUGUSTUS CDS 1345982 1346572 0.8 - 0 transcript_id "g233.t1"; gene_id "g233"; 5 AUGUSTUS start_codon 1346570 1346572 . - 0 transcript_id "g233.t1"; gene_id "g233"; # protein sequence = [MEVAYAASLCREKSLIEDNLKLVERLRDLHSFDVPDSDTEAKEDLRPLSRSTAEPELKRSASSAPPQLIDAEDGEVSM # DLATPLQPTTFIATPEKTRRSNTSGTPSTPRPLIPLSPAPVSSSLFGQEQSPSSPRQGQSSIPFEDIKSVGPLSQPSAEDVGNEITSELASGEQQVVQ # SAGAVNETELVLDSGTNLND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g233 ### # start gene g234 5 AUGUSTUS gene 1346927 1347460 0.36 - . g234 5 AUGUSTUS transcript 1346927 1347460 0.36 - . g234.t1 5 AUGUSTUS stop_codon 1346927 1346929 . - 0 transcript_id "g234.t1"; gene_id "g234"; 5 AUGUSTUS CDS 1346927 1347460 0.36 - 0 transcript_id "g234.t1"; gene_id "g234"; 5 AUGUSTUS start_codon 1347458 1347460 . - 0 transcript_id "g234.t1"; gene_id "g234"; # protein sequence = [MLFPEPADPKLLMHRNQDVSNDSDQRLMNYAAAMIDTLVHERDLARTAHQSLLLDAKAQIAALEAELAHRDLELEKCI # SHCVDCPEFQRSRTGFEPFTPMEPSVLSKILQKTSTRHKILELGNQQLKGQVRTIQLDANHNQSYIILYLLVLAGKSQAEYIGTTGFNLANEVQRPHT # T] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g234 ### # start gene g235 5 AUGUSTUS gene 1348174 1349106 1 + . g235 5 AUGUSTUS transcript 1348174 1349106 1 + . g235.t1 5 AUGUSTUS start_codon 1348174 1348176 . + 0 transcript_id "g235.t1"; gene_id "g235"; 5 AUGUSTUS CDS 1348174 1349106 1 + 0 transcript_id "g235.t1"; gene_id "g235"; 5 AUGUSTUS stop_codon 1349104 1349106 . + 0 transcript_id "g235.t1"; gene_id "g235"; # protein sequence = [MQDENQADEALDIHVNQRQEHSELLESIFCVRDEQSDDVSLSDWSTDEKDRFFAALCSHSALRPDLIAESIGTKNVAQ # VCVYLFALEDAVGNCDTGPLRPDLEIAMEVTDEWLEAEEEQAAFLRDIELAWGTDLGSQDHDTSEPADANLTSMRNDALKILTVDHCKVIDKIFRQEG # TSSGIPSLPVPETEPEWAAEVSPAERRRLKKRLHMRRKRAEIAGTDIVTDAQRLQRGRKRKAVGSPPYTPSQVNSESEEGSEFEDRHKKRQRKRGLTR # EQKVLETFIELEIDAAVCHNQGLDLFHLHPLGRLLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g235 ### # start gene g236 5 AUGUSTUS gene 1349425 1349877 0.99 + . g236 5 AUGUSTUS transcript 1349425 1349877 0.99 + . g236.t1 5 AUGUSTUS start_codon 1349425 1349427 . + 0 transcript_id "g236.t1"; gene_id "g236"; 5 AUGUSTUS CDS 1349425 1349877 0.99 + 0 transcript_id "g236.t1"; gene_id "g236"; 5 AUGUSTUS stop_codon 1349875 1349877 . + 0 transcript_id "g236.t1"; gene_id "g236"; # protein sequence = [MLGYPTTKAQAFEHLCGEDACSDDGDNSADQEGNVQVDGDNQADQEGNDQLESEEGVEESDDSLGNSSPLSLLASSPL # LSHFELNPPFIRFPTSTSVDLESLIPLETDEELLHEELAEEEILDQRDQALEKIQQDELWASHKHNIAAFQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g236 ### # start gene g237 5 AUGUSTUS gene 1349997 1351064 0.46 - . g237 5 AUGUSTUS transcript 1349997 1351064 0.46 - . g237.t1 5 AUGUSTUS stop_codon 1349997 1349999 . - 0 transcript_id "g237.t1"; gene_id "g237"; 5 AUGUSTUS CDS 1349997 1351064 0.46 - 0 transcript_id "g237.t1"; gene_id "g237"; 5 AUGUSTUS start_codon 1351062 1351064 . - 0 transcript_id "g237.t1"; gene_id "g237"; # protein sequence = [MHRSTCLKRFYRCEDCETEQACSSRAAHASCCHAAQVRCPQEHHGCPWEGRRKDVSSHTTTCSYEAIKGFFAIQDAQK # ATLVNENTLLKQKVETLESQLRVAQYELRCVQSALGPWSRIPTSRSVSALPPSSQLPTSLPHNHTSPSLSYMPPGDQASITQYFPDISFDDLQARSIS # SAEDQRVPERPNFPPSTQSMSSRVSFGGTSIQNWHSTGSLPIGSGSRPSQNVVAPLNLNTTLEGSLEGLRESIVTLSTSLDSLGRRSDIALTNETLRL # NEEVTSLRVALHGLRMQARTFVNFPCSFIDQSQVHTIMMDRNAQVTGQGPGFDPLFIQGDIQWLPNRSHMQNPPHNSVTKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g237 ### # start gene g238 5 AUGUSTUS gene 1363073 1363716 0.76 - . g238 5 AUGUSTUS transcript 1363073 1363716 0.76 - . g238.t1 5 AUGUSTUS stop_codon 1363073 1363075 . - 0 transcript_id "g238.t1"; gene_id "g238"; 5 AUGUSTUS CDS 1363073 1363306 0.91 - 0 transcript_id "g238.t1"; gene_id "g238"; 5 AUGUSTUS CDS 1363461 1363485 0.83 - 1 transcript_id "g238.t1"; gene_id "g238"; 5 AUGUSTUS CDS 1363564 1363602 0.83 - 1 transcript_id "g238.t1"; gene_id "g238"; 5 AUGUSTUS CDS 1363703 1363716 0.87 - 0 transcript_id "g238.t1"; gene_id "g238"; 5 AUGUSTUS start_codon 1363714 1363716 . - 0 transcript_id "g238.t1"; gene_id "g238"; # protein sequence = [MFVKTIDDVKAKTQDKEGEQLQDGRTTPRKIKHKRKKVKMAILKYYKVDLDDKIGRLRRKYPAESGAGIFVNIHHSML # QYLAYCSTTVRWISTRIASTAANVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g238 ### # start gene g239 5 AUGUSTUS gene 1366880 1368921 0.34 - . g239 5 AUGUSTUS transcript 1366880 1368921 0.34 - . g239.t1 5 AUGUSTUS stop_codon 1366880 1366882 . - 0 transcript_id "g239.t1"; gene_id "g239"; 5 AUGUSTUS CDS 1366880 1368063 0.35 - 2 transcript_id "g239.t1"; gene_id "g239"; 5 AUGUSTUS CDS 1368168 1368921 0.34 - 0 transcript_id "g239.t1"; gene_id "g239"; 5 AUGUSTUS start_codon 1368919 1368921 . - 0 transcript_id "g239.t1"; gene_id "g239"; # protein sequence = [MGQRGIIGKMSPGPSSSPSRTSLPKRTLPPEGSALRNQVVYAAVQKAKLRKPSTSIVPKHVTPVEKVTDLEAAHHDNT # ALLLRRWYRNDELVWVELKSPIAGLKGNGDVINAWPAIVEDSWTRSNSFKNSAHSTSSSRNCPYLDYDPENPPWTVIHHTKYKLRLLATSCSMMARDD # QVLPYQAYLPPTELIYALQDVPLSKIRLDPEYTTNFTPVISQNLEEAASLPPSFEDSTGPYALAIQIGSQIAGFWDAIIVASNNNAYNADPQTSYGSS # DISGNRHMTVEELNQTKTTTLGPPKAVGHTFTQKNFHGLWWGAERIWTGDLLRLKIGRNVIAKDGTPHILAPSPADSNALLHSAQNGDNLNQKELGAP # SQGVFMRLDALFTVEVDLEKGRKRNDCRAAGMLYELTNIDWIDPSEDAVRRPTSTPLTTDAAISDEDYQGVSNAVPHSPLKPTALRNPNPAIPITETA # RQMLSKILPHSSVPENEANRVYKPPIPVSHYDLPQPPTGFKFRPILNPEYEAVFSLTLLNGRYYPGILGHPLLVETIHQVRTPEGKIDPHDPQSNHLW # ALEGLEPGFSNSVNPIRYKKDRFSMVVDGEINARAQLTKHFSTNSEQTDGDVSTENGNAKQSMEIDPISNDQMQVDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g239 ### # start gene g240 5 AUGUSTUS gene 1369847 1371024 0.43 - . g240 5 AUGUSTUS transcript 1369847 1371024 0.43 - . g240.t1 5 AUGUSTUS stop_codon 1369847 1369849 . - 0 transcript_id "g240.t1"; gene_id "g240"; 5 AUGUSTUS CDS 1369847 1370423 0.56 - 1 transcript_id "g240.t1"; gene_id "g240"; 5 AUGUSTUS CDS 1371005 1371024 0.66 - 0 transcript_id "g240.t1"; gene_id "g240"; 5 AUGUSTUS start_codon 1371022 1371024 . - 0 transcript_id "g240.t1"; gene_id "g240"; # protein sequence = [MVQSLESLSNGETHNSSANCNVIGGLSRQYSPTPYPYFQYPSLSHPVPLGSVLGGNSYPISTNSCLNKNEAFLPSIAR # SDNVDEICQSYSRWPPHWDSTFHSASSFSSAEQFLAASIPNFEIDMFNSVNSATKETFVPVLPPISVLEDLRGFHVDDALNVLHRLTADDEENIAAEQ # FSQVSILSMSSHYFIQITCLFQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g240 ### # start gene g241 5 AUGUSTUS gene 1488288 1491224 0.33 + . g241 5 AUGUSTUS transcript 1488288 1491224 0.33 + . g241.t1 5 AUGUSTUS start_codon 1488288 1488290 . + 0 transcript_id "g241.t1"; gene_id "g241"; 5 AUGUSTUS CDS 1488288 1489912 0.33 + 0 transcript_id "g241.t1"; gene_id "g241"; 5 AUGUSTUS CDS 1490399 1491224 0.6 + 1 transcript_id "g241.t1"; gene_id "g241"; 5 AUGUSTUS stop_codon 1491222 1491224 . + 0 transcript_id "g241.t1"; gene_id "g241"; # protein sequence = [MVPEQYCDFKKVFSESASERLPAHQPWDHAIDLIPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNKYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKEGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVVVYLDDILIFSSDLQEHRRVVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPAPTNLRELRGF # LGFANFYRRFIRNFARIARPLNDLTRKDTPFTWMDTQQQAFDTLRKAFISAPILALWTPDRPTQIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ # PAERNYEIYDWEMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRINTQADALSRMAAHQVLDSEDN # RQQTVLKPNHFTKIAASILWNPLEDRIRKASQREAQVLEGLKTVKEHGLQCLANGIAEWEEDNGLVYYRGRVLGIKSDLTSGYRPQSNGQTERANQEV # EKYIRLYVGRRQDDWVEHLPMAEFIINSRTHSALGMSPFELTYRYLPLFNIPVGQRSGIPAVDDCIRILREARQDAGAALHLGKKQQKEGYERGKRKA # HQFKVGDFVWLSAEDINLQLCSEKLGDRQLGPYRILEKIGPLDYRLDLPISLDRIHPVFHVDKLYPWKGNTINGEIPPPPEPVYLEDEDKPEYEVEEI # LDSRVRWKRLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVQAFHKKHPTAAKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g241 ### # start gene g242 5 AUGUSTUS gene 1493363 1494529 0.87 + . g242 5 AUGUSTUS transcript 1493363 1494529 0.87 + . g242.t1 5 AUGUSTUS start_codon 1493363 1493365 . + 0 transcript_id "g242.t1"; gene_id "g242"; 5 AUGUSTUS CDS 1493363 1494529 0.87 + 0 transcript_id "g242.t1"; gene_id "g242"; 5 AUGUSTUS stop_codon 1494527 1494529 . + 0 transcript_id "g242.t1"; gene_id "g242"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELTD # CANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g242 ### # start gene g243 5 AUGUSTUS gene 1494580 1498296 0.8 + . g243 5 AUGUSTUS transcript 1494580 1498296 0.8 + . g243.t1 5 AUGUSTUS start_codon 1494580 1494582 . + 0 transcript_id "g243.t1"; gene_id "g243"; 5 AUGUSTUS CDS 1494580 1498296 0.8 + 0 transcript_id "g243.t1"; gene_id "g243"; 5 AUGUSTUS stop_codon 1498294 1498296 . + 0 transcript_id "g243.t1"; gene_id "g243"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAVTHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLWKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTQQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDNPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g243 ### # start gene g244 5 AUGUSTUS gene 1499383 1500327 0.95 + . g244 5 AUGUSTUS transcript 1499383 1500327 0.95 + . g244.t1 5 AUGUSTUS start_codon 1499383 1499385 . + 0 transcript_id "g244.t1"; gene_id "g244"; 5 AUGUSTUS CDS 1499383 1500327 0.95 + 0 transcript_id "g244.t1"; gene_id "g244"; 5 AUGUSTUS stop_codon 1500325 1500327 . + 0 transcript_id "g244.t1"; gene_id "g244"; # protein sequence = [MTENQTGKRLKTICIDSGGEFDNGLMKAYCADQGITIKKITPYSSSANGMAKRGNRIVIKRVHTFLEESGLPCSFWAE # GAATFTYVDNFVPTAQFPDQVPIEYWSNKCQDVLHLCPFRCQAWATLPDSRTNGKLSCQAVECQLIGYMGCRGYRLWHQPSCTFMESRDIRFKEGEAH # CSREYRSEVDNSNLEDCQQVAPTNGPTAQQHADQEGKEPWTSGPTSDTSDTTPPLCRSTHTCTPSRVAIENQALKEHKCKAQVNREDWVTNLPSTGQT # LALIAVNPWAFASVTSLLPGPPSQAHTPLGALTSEAHILY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g244 ### # start gene g245 5 AUGUSTUS gene 1507367 1508013 0.3 + . g245 5 AUGUSTUS transcript 1507367 1508013 0.3 + . g245.t1 5 AUGUSTUS start_codon 1507367 1507369 . + 0 transcript_id "g245.t1"; gene_id "g245"; 5 AUGUSTUS CDS 1507367 1507396 0.31 + 0 transcript_id "g245.t1"; gene_id "g245"; 5 AUGUSTUS CDS 1507496 1507535 0.84 + 0 transcript_id "g245.t1"; gene_id "g245"; 5 AUGUSTUS CDS 1507616 1508013 0.82 + 2 transcript_id "g245.t1"; gene_id "g245"; 5 AUGUSTUS stop_codon 1508011 1508013 . + 0 transcript_id "g245.t1"; gene_id "g245"; # protein sequence = [MFCIHDSFHVQGSLPPDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTY # ATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSFPPLVLRTPSSLLQRLLFQSLRPSNEPLLHSLVVLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g245 ### # start gene g246 5 AUGUSTUS gene 1508296 1508556 0.62 - . g246 5 AUGUSTUS transcript 1508296 1508556 0.62 - . g246.t1 5 AUGUSTUS stop_codon 1508296 1508298 . - 0 transcript_id "g246.t1"; gene_id "g246"; 5 AUGUSTUS CDS 1508296 1508556 0.62 - 0 transcript_id "g246.t1"; gene_id "g246"; 5 AUGUSTUS start_codon 1508554 1508556 . - 0 transcript_id "g246.t1"; gene_id "g246"; # protein sequence = [MDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEE # LSEERINN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g246 ### # start gene g247 5 AUGUSTUS gene 1509024 1511552 0.98 - . g247 5 AUGUSTUS transcript 1509024 1511552 0.98 - . g247.t1 5 AUGUSTUS stop_codon 1509024 1509026 . - 0 transcript_id "g247.t1"; gene_id "g247"; 5 AUGUSTUS CDS 1509024 1511552 0.98 - 0 transcript_id "g247.t1"; gene_id "g247"; 5 AUGUSTUS start_codon 1511550 1511552 . - 0 transcript_id "g247.t1"; gene_id "g247"; # protein sequence = [MCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCV # IKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSERSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYI # LRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQ # VVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQID # PTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDTSYIKGMLDNPSCGPNATINHWIEHVRNYHFTLIHVKGATHGP # DGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFMMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKNA # TCEVFSRNLFPTFDKEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDEFLGKMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKE # KCMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHIPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSS # WSEARAVKHENARTLGEWFFDDIICCWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g247 ### # start gene g248 5 AUGUSTUS gene 1511724 1514068 0.96 - . g248 5 AUGUSTUS transcript 1511724 1514068 0.96 - . g248.t1 5 AUGUSTUS stop_codon 1511724 1511726 . - 0 transcript_id "g248.t1"; gene_id "g248"; 5 AUGUSTUS CDS 1511724 1512562 0.99 - 2 transcript_id "g248.t1"; gene_id "g248"; 5 AUGUSTUS CDS 1512637 1514068 0.97 - 0 transcript_id "g248.t1"; gene_id "g248"; 5 AUGUSTUS start_codon 1514066 1514068 . - 0 transcript_id "g248.t1"; gene_id "g248"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSINRPLKKPSVTIE # DVDESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYCPIQINTPTQVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMCKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDDQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDEFNLNPIKSFFLQNGRIKP # KPVRKKVQKRRFVEPILQNFSLGENCDKFESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKQ # GKAQDSKDKKENIQADVVNEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEEPINLNTEEVFTKYKPVDKKVNPIKATLPDEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g248 ### # start gene g249 5 AUGUSTUS gene 1514098 1517034 0.41 - . g249 5 AUGUSTUS transcript 1514098 1517034 0.41 - . g249.t1 5 AUGUSTUS stop_codon 1514098 1514100 . - 0 transcript_id "g249.t1"; gene_id "g249"; 5 AUGUSTUS CDS 1514098 1516016 0.63 - 2 transcript_id "g249.t1"; gene_id "g249"; 5 AUGUSTUS CDS 1517019 1517034 0.57 - 0 transcript_id "g249.t1"; gene_id "g249"; 5 AUGUSTUS start_codon 1517032 1517034 . - 0 transcript_id "g249.t1"; gene_id "g249"; # protein sequence = [MTNDRRKPRTSRNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQITTEESRESSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTNNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASLSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ # SHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWRMPREDPNVPRYKK # IEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g249 ### # start gene g250 5 AUGUSTUS gene 1517568 1518427 0.35 + . g250 5 AUGUSTUS transcript 1517568 1518427 0.35 + . g250.t1 5 AUGUSTUS start_codon 1517568 1517570 . + 0 transcript_id "g250.t1"; gene_id "g250"; 5 AUGUSTUS CDS 1517568 1517590 0.38 + 0 transcript_id "g250.t1"; gene_id "g250"; 5 AUGUSTUS CDS 1517740 1518427 0.93 + 1 transcript_id "g250.t1"; gene_id "g250"; 5 AUGUSTUS stop_codon 1518425 1518427 . + 0 transcript_id "g250.t1"; gene_id "g250"; # protein sequence = [MGKLTNLWRVNGQPVQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIAHRTGKQPQRCAASESPRDPPPHFDLDTGDH # DDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPGDPSGPGGPSGPGGPGGPGEPSGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGCPSD # SSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPLQGKVKDNKEGLERKGMCSEKEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g250 ### # start gene g251 5 AUGUSTUS gene 1522652 1523840 0.38 + . g251 5 AUGUSTUS transcript 1522652 1523840 0.38 + . g251.t1 5 AUGUSTUS start_codon 1522652 1522654 . + 0 transcript_id "g251.t1"; gene_id "g251"; 5 AUGUSTUS CDS 1522652 1523096 0.94 + 0 transcript_id "g251.t1"; gene_id "g251"; 5 AUGUSTUS CDS 1523148 1523251 0.73 + 2 transcript_id "g251.t1"; gene_id "g251"; 5 AUGUSTUS CDS 1523328 1523368 0.64 + 0 transcript_id "g251.t1"; gene_id "g251"; 5 AUGUSTUS CDS 1523435 1523840 0.71 + 1 transcript_id "g251.t1"; gene_id "g251"; 5 AUGUSTUS stop_codon 1523838 1523840 . + 0 transcript_id "g251.t1"; gene_id "g251"; # protein sequence = [MANASIFIQDACYQHRYIRSRDTSLIVERPERLIAAKIGLAAAVTRIQEVVGKSTGDPNDLVAALDKLTLGSRSSDIT # APINVVHSSATLDILNHPAVRFTHGFPDPNTAKDSNEYLRNLKKWSEDSIEKISKGDSEIPQELAQGDLYLCPESLNAIQGALGTVCESIDTVVDPSP # SSSKRAFLEQPMPISNTEFIAAHSSQGNGTQSLAWAINEETQRQKLEAEARIEAGNSFPATIPGLQVYYSSIHDILSYPCEDGTPSMVQAASVSISGA # HGQWIENVHLKDHAKEGDFWGLYEEHYKKIIHKAEEFVQSTATKNNEDVLVFIRYGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g251 ### # start gene g252 5 AUGUSTUS gene 1523917 1524660 0.71 + . g252 5 AUGUSTUS transcript 1523917 1524660 0.71 + . g252.t1 5 AUGUSTUS start_codon 1523917 1523919 . + 0 transcript_id "g252.t1"; gene_id "g252"; 5 AUGUSTUS CDS 1523917 1524660 0.71 + 0 transcript_id "g252.t1"; gene_id "g252"; 5 AUGUSTUS stop_codon 1524658 1524660 . + 0 transcript_id "g252.t1"; gene_id "g252"; # protein sequence = [MSRHGRKVPTNFYAQFTRDARAFAEKHAKGRIVSVLEGGYSDRALISGTFAHFCALGLSEERTWNETWWNKDNLDALQ # NATKPKKPRGHVSGPLSAPKTDLEPEPWLKQAVSIFQHLEPIPFKTPRKGKAILVEPSSRTLRQRKVGNASSSSPASAKSKPEKSEATGKGMPRGKIN # SSLSKSKGKKTKPGVVTESTRSEGQAEDTDSSTESSSTLSSMSDSDVDLPISAPSKKLPRVILKLGPPPNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g252 ### # start gene g253 5 AUGUSTUS gene 1525451 1526131 0.4 - . g253 5 AUGUSTUS transcript 1525451 1526131 0.4 - . g253.t1 5 AUGUSTUS stop_codon 1525451 1525453 . - 0 transcript_id "g253.t1"; gene_id "g253"; 5 AUGUSTUS CDS 1525451 1526131 0.4 - 0 transcript_id "g253.t1"; gene_id "g253"; 5 AUGUSTUS start_codon 1526129 1526131 . - 0 transcript_id "g253.t1"; gene_id "g253"; # protein sequence = [MKFFALSELKDIASDESPAAAACRSDLFADQKYSPNQWSQLCRDCLLLLGNDYQLLLRRGAPAPPPPAASPLPKPEPP # LPATPTPLLRKDIFRKEKSSPIRAVLDSFASDGSLAQAVDEGTESIHVPRLIKTVEDAVLPQLEKSKGEVVKSVIGATEIMPKITGGLNAVAEGIVDR # HAPNFVRRTVKHWREWWTEDRLSKTVEGCIPFRELDVLAVEGIFHTHEPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g253 ### # start gene g254 5 AUGUSTUS gene 1527513 1529006 0.76 - . g254 5 AUGUSTUS transcript 1527513 1529006 0.76 - . g254.t1 5 AUGUSTUS stop_codon 1527513 1527515 . - 0 transcript_id "g254.t1"; gene_id "g254"; 5 AUGUSTUS CDS 1527513 1529006 0.76 - 0 transcript_id "g254.t1"; gene_id "g254"; 5 AUGUSTUS start_codon 1529004 1529006 . - 0 transcript_id "g254.t1"; gene_id "g254"; # protein sequence = [MYLLRTLLGAFNLAGIYQLVVDGSIQPFLIKSIDWVSPDSAVALLSSSHRGLKSDASTKKSTPVDFDIWAAEVNISLK # ELPAVAQTMSVLWNRRGDEVPILSKYDASRKAFMLIGGSPYRDLKVVTSPPYEPSPDEIAPIPRTGENLNADPARPPPYSWTQTSDSVTVAFPLPSST # PKTAINVKFSTTSLILSISDSLSAHVVTLPSFSSKAFWDGVSPSSSYWTWDKDAEHSFGILTLHLDKQHEGTKWMQVFASAGKSAAAELSPEDAEVPE # TLDPSELWHIRESLEKYTAALLTGEDASGLGLGQGVPSLAEGEMDEEVDSSVGRTAVITWVHLDGSSPSWSNPGHEDPFTLLSTPFPGHRMRTPFSLV # LKEGLDGPTYALQPISTESDSDTAKWTHTSTFPALGFVLASKQDVRFTHHNENLVFALESGLRNGGGNMYVYRCAKPSEVWAKQSILKIGDGAGGALL # GVGAFRIGGRDVILALTERQLVIVQTW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g254 ### # start gene g255 5 AUGUSTUS gene 1529725 1530072 0.54 + . g255 5 AUGUSTUS transcript 1529725 1530072 0.54 + . g255.t1 5 AUGUSTUS start_codon 1529725 1529727 . + 0 transcript_id "g255.t1"; gene_id "g255"; 5 AUGUSTUS CDS 1529725 1530072 0.54 + 0 transcript_id "g255.t1"; gene_id "g255"; 5 AUGUSTUS stop_codon 1530070 1530072 . + 0 transcript_id "g255.t1"; gene_id "g255"; # protein sequence = [MPIPIRTSMTSSGNTSRRSSTETRTTRNSRSSSSRDHYKTSSSSRELALLLAVERNKSDSLKLSLDEAQKELAAQRRR # IEEAEMNLLEFTSKFMRANKDRLEALHNAAIATEERE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g255 ### # start gene g256 5 AUGUSTUS gene 1530107 1531069 0.61 + . g256 5 AUGUSTUS transcript 1530107 1531069 0.61 + . g256.t1 5 AUGUSTUS start_codon 1530107 1530109 . + 0 transcript_id "g256.t1"; gene_id "g256"; 5 AUGUSTUS CDS 1530107 1531069 0.61 + 0 transcript_id "g256.t1"; gene_id "g256"; 5 AUGUSTUS stop_codon 1531067 1531069 . + 0 transcript_id "g256.t1"; gene_id "g256"; # protein sequence = [MGACDRLYRLQLLAAQNDIDRARNIVKTIDERRVQAEKDAAKYKRTARELREEQLVMAAREEGRRIGFREGLQRARAE # VGFLDIGEDGYVTPPSRTRLDSVSDEDRSTFYSDELGEEPDPMPRPMPSEPPSIRNESPQPQPSPHPQDIPIPVAPPRPPSSATGQIHPIPIHNMPMS # PRHPPVNIPPDGMIPLDNASGNGIQLPPPHELSPMPPIMELSPAPPPPQELDEEPRIVPPPGSHRTPMYATRSDYRPSHSYRGQSSPESSSTAMSQFD # MLTEPQDIMANLSPMSAIPEVASGFTSPNPPSMHGGDLHRSGSMVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g256 ### # start gene g257 5 AUGUSTUS gene 1531820 1532562 0.51 + . g257 5 AUGUSTUS transcript 1531820 1532562 0.51 + . g257.t1 5 AUGUSTUS start_codon 1531820 1531822 . + 0 transcript_id "g257.t1"; gene_id "g257"; 5 AUGUSTUS CDS 1531820 1531915 0.51 + 0 transcript_id "g257.t1"; gene_id "g257"; 5 AUGUSTUS CDS 1531978 1532562 0.97 + 0 transcript_id "g257.t1"; gene_id "g257"; 5 AUGUSTUS stop_codon 1532560 1532562 . + 0 transcript_id "g257.t1"; gene_id "g257"; # protein sequence = [MYTTLAPPELQVEASSPQSSSSGDYSVAILSPTPPGSAHNDNEEGVRRAPLNEFLSAKDAERPMPMPGSPRAQSPSPR # LHPMSIAQSDDPSPLPTAPFGSPNIGTPIALGGGGIFIPSGFTPRQTPRPGLASSPDPNASSTSPETGLEAQYSYNSLGMSTNPHRPVIPDPSLLGPA # DSDTDSEDRVSSGMNSEANTLTTPPTVARGLPSQRGRGSRGQATSKKKRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g257 ### # start gene g258 5 AUGUSTUS gene 1532911 1533681 0.39 - . g258 5 AUGUSTUS transcript 1532911 1533681 0.39 - . g258.t1 5 AUGUSTUS stop_codon 1532911 1532913 . - 0 transcript_id "g258.t1"; gene_id "g258"; 5 AUGUSTUS CDS 1532911 1533681 0.39 - 0 transcript_id "g258.t1"; gene_id "g258"; 5 AUGUSTUS start_codon 1533679 1533681 . - 0 transcript_id "g258.t1"; gene_id "g258"; # protein sequence = [MMCEHCLAPDTSAGAGIGCDNMTVLIVALLHGRTKQEWYAWIKNRVDSKYGFDTPSVLPQLYAQSRLTAFKARREALQ # AREASLLEYEEQPSFLSPGLSFTRVLGSTGGISFNRESGILSSATSLMFTGDDSDDEDDGEDSTSSFFTETLGLGATLHDEDDDGLDATQNLKAKLEE # FEKDIRQEGSDDSPDSDSTTEGDTSHPKLQGEAPPPPAPQANGGPVTPAPQLKSEPGGDKASPVVAAEGLMDTSEDPLKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g258 ### # start gene g259 5 AUGUSTUS gene 1539626 1540671 0.94 - . g259 5 AUGUSTUS transcript 1539626 1540671 0.94 - . g259.t1 5 AUGUSTUS stop_codon 1539626 1539628 . - 0 transcript_id "g259.t1"; gene_id "g259"; 5 AUGUSTUS CDS 1539626 1539959 0.94 - 1 transcript_id "g259.t1"; gene_id "g259"; 5 AUGUSTUS CDS 1540016 1540671 0.94 - 0 transcript_id "g259.t1"; gene_id "g259"; 5 AUGUSTUS start_codon 1540669 1540671 . - 0 transcript_id "g259.t1"; gene_id "g259"; # protein sequence = [MQTALSKELTTNLLKPAESGTVAAKIQSRLLSSKVLSTEVAAAVEDLRSVIIIPTDSQEGDISANLDESASERPTKMK # KIAGNSEDSDVEMELGKADEAADDIEEEDEGDTDGWQSGTVGDDEKEPEDDWESGSVVGELDEYMDEDLPSDSQEELKAASNKSGPMAKTNFKVLTGE # STFLPTLSAGFVRGSDSDWSDKEEDAADFGQKKNRRGQRARRAIWEKKYGKNANHKKKEAALNENERGRKRWPNGDSFSNRPSNKAGTSRKPHQSEVP # TRPRQQDSGWEQREVIVLHQDHESRPLHPSWEAKKKLKERQSAAAIPSGRKIKFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g259 ### # start gene g260 5 AUGUSTUS gene 1550266 1551150 0.82 + . g260 5 AUGUSTUS transcript 1550266 1551150 0.82 + . g260.t1 5 AUGUSTUS start_codon 1550266 1550268 . + 0 transcript_id "g260.t1"; gene_id "g260"; 5 AUGUSTUS CDS 1550266 1551150 0.82 + 0 transcript_id "g260.t1"; gene_id "g260"; 5 AUGUSTUS stop_codon 1551148 1551150 . + 0 transcript_id "g260.t1"; gene_id "g260"; # protein sequence = [MLFLEVPNCVSDNFSCYVHSLQQSLSGHDLMFDNGLQFRPTYSRRKRQLSEAYWTAVIREVESGCTCFSVDKSGAPMM # TPACVCNQIPIPPLHPIIGYCPALQVMTVRSPSRIRPLLSEFLEVLLLVIQPLQSVSGMYVNPDSFKAQMEEHSTQANYIRSIIDPALIEQELRHNLF # DLSSLLRAIGVLLKGHCAPMRDSAVEDMVRAAETCKPGGPGTKAEGVNALRTCLEILELMKLVNESLQKHFVLHKLMLMLSFVAIFIRISPTTNSKAY # ALASPEPRPYTSFKISKQNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g260 ### # start gene g261 5 AUGUSTUS gene 1551408 1552232 0.41 + . g261 5 AUGUSTUS transcript 1551408 1552232 0.41 + . g261.t1 5 AUGUSTUS start_codon 1551408 1551410 . + 0 transcript_id "g261.t1"; gene_id "g261"; 5 AUGUSTUS CDS 1551408 1552232 0.41 + 0 transcript_id "g261.t1"; gene_id "g261"; 5 AUGUSTUS stop_codon 1552230 1552232 . + 0 transcript_id "g261.t1"; gene_id "g261"; # protein sequence = [MRLRSLSKDLDDIVISYMLLLLFRQLVYSSAWDDMTSRSKPDDATLLKIKNEIAIINSARPGHAMLYGFRQADAEGTR # SADFKENVVLHIAKRAQQFRETTLDNSPSASSSTLNSPATTPPTSPISEDESPVSPSSPFPHAPYSLSSYNLASPPDTRILNVARRWVVENINIASPL # CSVIYDRLHEVVFTGVVAQAYPGRQCTTGQLFSSAIESSAPLRQGGQPYTMPLFSGMEPLVDEIRNLTDKISRVVIMHLNVYLPIYELNGFLEDPVLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g261 ### # start gene g262 5 AUGUSTUS gene 1555677 1556627 0.36 + . g262 5 AUGUSTUS transcript 1555677 1556627 0.36 + . g262.t1 5 AUGUSTUS start_codon 1555677 1555679 . + 0 transcript_id "g262.t1"; gene_id "g262"; 5 AUGUSTUS CDS 1555677 1556627 0.36 + 0 transcript_id "g262.t1"; gene_id "g262"; 5 AUGUSTUS stop_codon 1556625 1556627 . + 0 transcript_id "g262.t1"; gene_id "g262"; # protein sequence = [MNVTGTAKARFPLEKEDLLSRGRKLIHESVDCGVTSMRAHVEIDDLVGFSGLDVALHLKEEARLACHIQIAGAFPSLG # LWAWLSRILCPVFAQEALFSRAGDAQPGSNFRLLAEAVQRDGVEAVGSAPYVEPTIEQAKKNIELIFELASHTSLTLIDFHLDYNLDPDSEPLIYEVI # KQARKYCPVWKSHGPELFRRHITIGHATRLQLFTPNEWRHLQNAIGDLPITFVGLPNSDMYMQGRSQAGEPLGAPRSTLRVPYLSDKYNIQIAMSVNN # VENAFTPQGSADPLALCTFGAAIFQAATKTDIQTLAVTSCPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g262 ### # start gene g263 5 AUGUSTUS gene 1557509 1558976 0.21 - . g263 5 AUGUSTUS transcript 1557509 1558976 0.21 - . g263.t1 5 AUGUSTUS stop_codon 1557509 1557511 . - 0 transcript_id "g263.t1"; gene_id "g263"; 5 AUGUSTUS CDS 1557509 1557534 0.63 - 2 transcript_id "g263.t1"; gene_id "g263"; 5 AUGUSTUS CDS 1557611 1558976 0.21 - 0 transcript_id "g263.t1"; gene_id "g263"; 5 AUGUSTUS start_codon 1558974 1558976 . - 0 transcript_id "g263.t1"; gene_id "g263"; # protein sequence = [MFYARAKQTFFTPNSHYELNLPSDMLAPFHMTNSSPHPDPAVFDQVAIETQRMLKESLQRFVSAQFNNVGNNRVICGL # IGGTVFCLVGALLPIIYNFTMGQSRWSRLSALPGLWLGLSVLFASLHGVCLGVYIFGDLRQLRRFELSRPPISKPQPYRPRPVISSPITSLPVSPTQI # ISIDNYTEDFGILPPPPAHTRFSFPSSHHSVPSVYSPSASSSDLSYSGSDGMIHISPAYYDPEPIEGPATSPGGIIALPAKQKSAFDDDDDDEENRPP # FGATAAFIHPFDHFEDDDYDLNNPKRPLVQERQRVSSFDFDALPPPPAARVQPRSPPPPQPRRPPYPIHSDSPKSTSSLQLTPSIMVIQPEQETPDKE # LTPKGFIRRIQSRCNINKWLVMTSSNSTTDLNEKVPDDLEKAEYERSNFPRPHPSLQRDQKTSNLKRQFKMVKAVPAFASPLTPGSQLGFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g263 ### # start gene g264 5 AUGUSTUS gene 1560431 1561468 0.57 - . g264 5 AUGUSTUS transcript 1560431 1561468 0.57 - . g264.t1 5 AUGUSTUS stop_codon 1560431 1560433 . - 0 transcript_id "g264.t1"; gene_id "g264"; 5 AUGUSTUS CDS 1560431 1560994 0.83 - 0 transcript_id "g264.t1"; gene_id "g264"; 5 AUGUSTUS CDS 1561079 1561468 0.63 - 0 transcript_id "g264.t1"; gene_id "g264"; 5 AUGUSTUS start_codon 1561466 1561468 . - 0 transcript_id "g264.t1"; gene_id "g264"; # protein sequence = [MRENNNLNYTEALSQVTKDMLKNNPFVPPTSGCPINDLPNELLAHIFYVGMEMEEEGPSEDELEEEDDEYEDELDLLD # WDSDDEGEENHTPASKRKNIGKGKVDCGEEQEKEEEEEEEEAGLPFQVLVSHSPLLWTTLRFQLGTSLDKAKIWLARSKGHPLQIEIDCTSSDEDDEE # EVIASSSSNNVTDPPDNASENEGSPLESEPSYLTKAQISEIMDIIIPAVDRWRIFSVTASYYNSIHLILERLSKCSSAPLLEVFEMYHYEDCDEFDEF # SPPELNTKFTIFGGVAPKLKSVALWGVHIDWRTEHAQSLDKHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g264 ### # start gene g265 5 AUGUSTUS gene 1562475 1563117 0.61 + . g265 5 AUGUSTUS transcript 1562475 1563117 0.61 + . g265.t1 5 AUGUSTUS start_codon 1562475 1562477 . + 0 transcript_id "g265.t1"; gene_id "g265"; 5 AUGUSTUS CDS 1562475 1562477 0.64 + 0 transcript_id "g265.t1"; gene_id "g265"; 5 AUGUSTUS CDS 1562524 1563117 0.96 + 0 transcript_id "g265.t1"; gene_id "g265"; 5 AUGUSTUS stop_codon 1563115 1563117 . + 0 transcript_id "g265.t1"; gene_id "g265"; # protein sequence = [MPVLGPQPTAPSTNFGDDSSSPASQNLNGHTSTVQGITPISNTIHQPRTADESQKEEDERQLKQLKEALEKSKEPMTT # AINTEIEELKKKIRLSHDAPKIVTPSSKGSKEDDVAMVDVHSTEHLDVHMHGSSNPHSPQSQPDTNMGGVSHGSPMSLDPPSPHQARSDIGSGQPLST # NSHIPSPHRVRSLSDLYGDDLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g265 ### # start gene g266 5 AUGUSTUS gene 1564034 1565832 0.24 + . g266 5 AUGUSTUS transcript 1564034 1565832 0.24 + . g266.t1 5 AUGUSTUS start_codon 1564034 1564036 . + 0 transcript_id "g266.t1"; gene_id "g266"; 5 AUGUSTUS CDS 1564034 1564264 0.42 + 0 transcript_id "g266.t1"; gene_id "g266"; 5 AUGUSTUS CDS 1564675 1564923 0.37 + 0 transcript_id "g266.t1"; gene_id "g266"; 5 AUGUSTUS CDS 1564990 1565832 0.76 + 0 transcript_id "g266.t1"; gene_id "g266"; 5 AUGUSTUS stop_codon 1565830 1565832 . + 0 transcript_id "g266.t1"; gene_id "g266"; # protein sequence = [MVYSPSVFTVFAVGAVSCVLAAPIPAFISDSLAPTGGRSIETNPVSGNFNVVFDDTGNGVDVEQKHPEFELEIEEEEF # SGSSMGIPSLDMSYGATPSMGMGMNDFLLPPMGNPEQMPPSHMSMGAGSPPPPPPPPPPPPPPPPPPPPSDIGAGNPIHPPMVEDANISVGMSMSASV # VAGASSGPSQTLSGQVTSQTPSKDVVSSDPFGPSQTSTSQVTGTSQRPSKDVVPSDLSEPSQTSTGQAISQISSVSAEPTASPTPSHSPGDGSGPVKN # GFNPKHIRLGLAAANAKLGATPTASDESGPGSALPTPGIGDSPTSSFTRSPSTGAKSGMPSSVVARSPSAPPTPDESTEAVNMSQAALQEKLAALAAQ # QATNSAERAKQVDAAQDFFNTASGSSVKLPSIQEQPAKTQNPKRRSVSSGTPMTHSARALYHYGQDLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g266 ### # start gene g267 5 AUGUSTUS gene 1566896 1568557 0.97 + . g267 5 AUGUSTUS transcript 1566896 1568557 0.97 + . g267.t1 5 AUGUSTUS start_codon 1566896 1566898 . + 0 transcript_id "g267.t1"; gene_id "g267"; 5 AUGUSTUS CDS 1566896 1568557 0.97 + 0 transcript_id "g267.t1"; gene_id "g267"; 5 AUGUSTUS stop_codon 1568555 1568557 . + 0 transcript_id "g267.t1"; gene_id "g267"; # protein sequence = [MSRQSTLSSAGTLRRGTLNKTRPESVNEVLEPTETDNTPTVTATKEQIAREYLTSKAAIIGTNALLTKEDVYDAMLRA # TRLPKKEIDVTLKTVEHGIMLLRDIDEKRSQRELLGEIKGAVESSFAKLDIEKQLQHQLTQVRNEFNERLDSIAANINGTEEKIDSIAKKSQPITPEI # SYADITRTNGKRTMAPTQAMTRQRMRAHVEVKRRQILILNAGNDAGKEIISKNPGEMLEYLNNMLIKMGALNKGTFVSATKLKNTDNLLTEVSSPELA # DWIHRVEQMIQFTTLSSQALTIADKEYEIILHFVPTTFGADDAFELRRLEDINDLPTCSITRAKWAKAVQRRKEGQRVASLLLYLNNANAANRLLLSG # AVISNKRVEAEKTVREEKRCYKCQRFGHIAGQCTEEVENICGKCGEHHSTANCSSEKRYCINCKTDEHASLDRECPIFRQKCESLNKRSPTNLLPFFP # SDEEWTWAEEPDNAPRMGPPPKITIRQDRHRQRQTQLTGWQQSNQLNVNTLPLGGPLRWGSQDPTGSQNEIADISDENQGSLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g267 ### # start gene g268 5 AUGUSTUS gene 1569571 1572359 0.78 + . g268 5 AUGUSTUS transcript 1569571 1572359 0.78 + . g268.t1 5 AUGUSTUS start_codon 1569571 1569573 . + 0 transcript_id "g268.t1"; gene_id "g268"; 5 AUGUSTUS CDS 1569571 1572113 0.79 + 0 transcript_id "g268.t1"; gene_id "g268"; 5 AUGUSTUS CDS 1572194 1572359 0.88 + 1 transcript_id "g268.t1"; gene_id "g268"; 5 AUGUSTUS stop_codon 1572357 1572359 . + 0 transcript_id "g268.t1"; gene_id "g268"; # protein sequence = [MKKALNRLSAKSYKYRAIPDDDSHRELRELRTQYKALIFKEKEEHWKDFLDNVDTDSIFTAAKYATTPNIDQDTTTVI # PELKALDENGAVRRIASTNEEKAALLAETFFPSAPRNYSLDRNPCRDQLPNPPPITQQRIIDALQRLKSYKAPGPDGIPNIILKKCAGMLAPYLCEIY # NAIGYLKAYPKEWLNSTTVVIRKPARKSYSLPKSYRPIALINTLAKGYTSIIAEDITFLATQHNLLPDTQFGGRPCRMTTDGIHMVIDKIKNAWRNKR # EASMLSLDIEGAFPNAVTQRLLYNLRKRRIPERLVQAVSLSLKGRVTRLKFGDFTSAPISLTNGIGQGDPLSMIAYLFYNADFFDIAFKSRRQGLSVG # FVDDKNILVEGKSLTGNVEMLESFMNKPGGGFSWAMKHNSSFELSKLVLTHFPRPKTKQEAPPPALVLQGTAVTEKTEVRMLGITLDSKLKWNEQAAQ # AAAKASSIASAFWKLSRPSAGVSLKMMRKLYLTVVIPKMTYGLDVWYTPPHRPEGAKNRRGSLKALRNFTRIQRMVTITTAGAMRSSPTDLLDIHTNL # LPMDLMLEKICHRAILRIYTLPDENPVVKTAQAAYRQRRVEKMAPPLRLLPRIFGLPSPATVETITSPQRTAQWTSPIETRILKKDDASRSLEEESAT # YKIFSDGSGYGGMTGAAAVLYKNGQLLTDAVLRYQLGPITEHTTYDAEGVGILLGLQLIDRYVNEPNHLSSLICLDGRSAIEALESRLPKSGQNIIEA # TLRTAKRMAKANNTEKISTIAWIPGHCGIEGNERADREAKKAAEGNTSAKVDLPAYLRNGNLPATASAIRQHFHKSLKTRWAHRGDAKKANKHPIPTA # NRTCAPKLAPPQDRKGRQPELPTLRHRREDNHRNGKTLHY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g268 ### # start gene g269 5 AUGUSTUS gene 1579580 1581528 0.99 + . g269 5 AUGUSTUS transcript 1579580 1581528 0.99 + . g269.t1 5 AUGUSTUS start_codon 1579580 1579582 . + 0 transcript_id "g269.t1"; gene_id "g269"; 5 AUGUSTUS CDS 1579580 1580133 0.99 + 0 transcript_id "g269.t1"; gene_id "g269"; 5 AUGUSTUS CDS 1580184 1581528 1 + 1 transcript_id "g269.t1"; gene_id "g269"; 5 AUGUSTUS stop_codon 1581526 1581528 . + 0 transcript_id "g269.t1"; gene_id "g269"; # protein sequence = [MASSHARNLKKAAAARAREGRARKRLGLDVTFELLPDSEPATRAQEGRAHEHLGLDVTSELRPDLEPEELGELILEED # DLEMLADMLEDLDLWDPADGPMDSGQESDSEVEELKGEELVRSLEEKEARTESAFEVLMKERSVKEWGRAENSSRMGVYNGRSDRTKRYHAQKVVKKK # KKDAAMRNTNTAKAFTSFFIPIQKAVVVAPESIPRTCTPESDPTPTLPNPSPMFSVTGNSECPELEGFLSDAEEDPGDDFDLSDGDKTATPDYRCGIN # EQSASLVGPPRKRQKRAERAEASAKYQQTRDHQLTSALKDIEKLLASKKDSFVNGHDGLQATRARSIRSTLTMVVEKKKGLIDASHIAAEANNFSLNW # GSRCIRQWTQNWIKTRVLPQSSRGRHTKVYSLLSEPAARDAIRGYLRTNKWSVNPPRLKKLFANELAPDEAREYAKQIISQEMPRGLKGFVEEHLLPR # MQCRPGRFGLSLSSMRRLMLREGFVFIEHKKAVYFDGHERPDVVQDHQTRFIPQANIFRHQLVRYDTKDVTKELPPEEGFADKPKYVLCSHDEMVAQA # HDGQKKGWVLEGEQPLKKKGPGQGIHQSDFICSTVGWLKDASVTLEYGKNHEGYWNCELFIRQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g269 ### # start gene g270 5 AUGUSTUS gene 1584679 1585131 0.86 + . g270 5 AUGUSTUS transcript 1584679 1585131 0.86 + . g270.t1 5 AUGUSTUS start_codon 1584679 1584681 . + 0 transcript_id "g270.t1"; gene_id "g270"; 5 AUGUSTUS CDS 1584679 1585131 0.86 + 0 transcript_id "g270.t1"; gene_id "g270"; 5 AUGUSTUS stop_codon 1585129 1585131 . + 0 transcript_id "g270.t1"; gene_id "g270"; # protein sequence = [MVDNSCDTDNDDFLPPFILSICRNANEFDKVIRDDSNTKGGFDELVAKDLDQNELDAVERSARLDVAGTTWTDAEFTS # EPDSYSDDTLIPNFDPQFHRVATLDGDSWKLDSDELVNLLVQEFGSLGEDEKLIFEADAFMFSDVLIVVCLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g270 ### # start gene g271 5 AUGUSTUS gene 1585338 1586052 0.2 + . g271 5 AUGUSTUS transcript 1585338 1586052 0.2 + . g271.t1 5 AUGUSTUS start_codon 1585338 1585340 . + 0 transcript_id "g271.t1"; gene_id "g271"; 5 AUGUSTUS CDS 1585338 1585356 0.2 + 0 transcript_id "g271.t1"; gene_id "g271"; 5 AUGUSTUS CDS 1585451 1586052 1 + 2 transcript_id "g271.t1"; gene_id "g271"; 5 AUGUSTUS stop_codon 1586050 1586052 . + 0 transcript_id "g271.t1"; gene_id "g271"; # protein sequence = [MCTYASMSSIQGLSILDPNNPRIFQVSLGEDVDVSGIVEFDTEESAQEWRKEVGGALFLQRHRRREAIGSDFSDASDG # IRVSYPLHKIASVKMVESFNKNVAIIRVEGSEQNEGQLYLAPILRVPAWLALEDHINTAKRRVAALSTQPEAPVVVDMGPLTFAQDVQSLNPPPVDAK # EKMLRNALGLGDEPEIWCKFVLFWASAEAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g271 ### # start gene g272 5 AUGUSTUS gene 1586178 1586876 0.5 + . g272 5 AUGUSTUS transcript 1586178 1586876 0.5 + . g272.t1 5 AUGUSTUS start_codon 1586178 1586180 . + 0 transcript_id "g272.t1"; gene_id "g272"; 5 AUGUSTUS CDS 1586178 1586876 0.5 + 0 transcript_id "g272.t1"; gene_id "g272"; 5 AUGUSTUS stop_codon 1586874 1586876 . + 0 transcript_id "g272.t1"; gene_id "g272"; # protein sequence = [MRIINSASPISGKILKIHGLRLELEGSPDLKFQFKTQDIRDEVIRRINVSRYLLVPESSIFSTPALSTSSSSTPTRGS # RPSTPQSSNFSLTPTSPPTSPARSALDAISPLERGTALLASAGMKYPISAILSLPKVINMESNVLISRPSMHFVCLTIGSRGDVQPYIALGVGLKKEH # HRVTIVTHEEYREWIEGFGLEFKQAGGDPGALMKLSVENKVQARLPGPHASLMLVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g272 ### # start gene g273 5 AUGUSTUS gene 1592223 1592384 0.58 + . g273 5 AUGUSTUS transcript 1592223 1592384 0.58 + . g273.t1 5 AUGUSTUS start_codon 1592223 1592225 . + 0 transcript_id "g273.t1"; gene_id "g273"; 5 AUGUSTUS CDS 1592223 1592384 0.58 + 0 transcript_id "g273.t1"; gene_id "g273"; 5 AUGUSTUS stop_codon 1592382 1592384 . + 0 transcript_id "g273.t1"; gene_id "g273"; # protein sequence = [MNYGAHSKFVTKWLEKLQKEKEVPEANPAQATEVVPEAAPAVTEETPASPESN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g273 ### # start gene g274 5 AUGUSTUS gene 1592927 1593373 0.76 - . g274 5 AUGUSTUS transcript 1592927 1593373 0.76 - . g274.t1 5 AUGUSTUS stop_codon 1592927 1592929 . - 0 transcript_id "g274.t1"; gene_id "g274"; 5 AUGUSTUS CDS 1592927 1593373 0.76 - 0 transcript_id "g274.t1"; gene_id "g274"; 5 AUGUSTUS start_codon 1593371 1593373 . - 0 transcript_id "g274.t1"; gene_id "g274"; # protein sequence = [MVRNDFDHVFSIPSVLYTEKSSEEDLAGPGVNGVDVLIHPSAIRTAPRLDDVLDTSRERDTLQDYVQDVLTVPASLSG # LPALSVPMQNRSKSVAFSLPTYTDEGFLQEARKDEDGDAGWPIGVSVVGQWGTDELVLRVGQVIERLSRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g274 ### # start gene g275 5 AUGUSTUS gene 1596447 1596896 0.69 + . g275 5 AUGUSTUS transcript 1596447 1596896 0.69 + . g275.t1 5 AUGUSTUS start_codon 1596447 1596449 . + 0 transcript_id "g275.t1"; gene_id "g275"; 5 AUGUSTUS CDS 1596447 1596896 0.69 + 0 transcript_id "g275.t1"; gene_id "g275"; 5 AUGUSTUS stop_codon 1596894 1596896 . + 0 transcript_id "g275.t1"; gene_id "g275"; # protein sequence = [MDFPDNETTAFWVGTEEGNVYQANRYDRAGAKAGLNQYDVYKAHAGPVMGLHFHPTSGSVDFSDLFLTSSVDWTVKLW # RAKSLAKPSTTLHAISPLYSFDESDDPVYDVKWHPTHPAVFGAVDGSGKFDLWNLNMDTEVRSLYLYLVLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g275 ### # start gene g276 5 AUGUSTUS gene 1597272 1598492 0.5 - . g276 5 AUGUSTUS transcript 1597272 1598492 0.5 - . g276.t1 5 AUGUSTUS stop_codon 1597272 1597274 . - 0 transcript_id "g276.t1"; gene_id "g276"; 5 AUGUSTUS CDS 1597272 1598492 0.5 - 0 transcript_id "g276.t1"; gene_id "g276"; 5 AUGUSTUS start_codon 1598490 1598492 . - 0 transcript_id "g276.t1"; gene_id "g276"; # protein sequence = [MPAKISPGHCQHSGSGTGKVEAEVCLLDPGSSSRGQRNCQGTMGRTDREGSIESLGPGERSGGACMNENGSDYSEFFS # ALPSEHLFFTDTSLAYEDNSSNSGIYARNLHDILGANPETENEIRSVTPHCFNCGSSSHMVNACPEQVDRALVSLSRQMNEFYRDLFSLDRIGGDFSA # RIYSVEEWKSVRLDWINSFNPGEIKGHDLRQALGIMPAEDDSQAQDEWLQNMAVWGYPPGWISRWDPKELMKERVLSQCIGNPQESEQSFHIFGEEGN # SETVLGQLKDPSKLLNSTVDQTLKRWAFYPPLRFSSSLLPVYNGVALPPVESKSQVSYYVPFSAVLPAPPPPPGSPPPLPPPPPIEPPPPLPPSLPPS # TPPSLPSTAFLSALLPLRPKTEAEDSDMDMSDEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g276 ### # start gene g277 5 AUGUSTUS gene 1598911 1599660 0.95 - . g277 5 AUGUSTUS transcript 1598911 1599660 0.95 - . g277.t1 5 AUGUSTUS stop_codon 1598911 1598913 . - 0 transcript_id "g277.t1"; gene_id "g277"; 5 AUGUSTUS CDS 1598911 1599660 0.95 - 0 transcript_id "g277.t1"; gene_id "g277"; 5 AUGUSTUS start_codon 1599658 1599660 . - 0 transcript_id "g277.t1"; gene_id "g277"; # protein sequence = [MAQQDTTASRGLGTFYNLYGSNANASAMTAWVWGVSRIIDVLEETPAAQINTERIGVTGCSRDGKGALMAGAFEPRIA # LTIPQESGSGGDAGWRISLYEQNQGSVVQTATEIVTENVWFSPSFNNYVNTLNVLPYDHHSLLAMVAPRGLIAFENTDYVWLSPVSAFGCETGARTVY # QALGVPENHGFEQVGGHAHCAWPSSLTPALDAFINKFLLGQNVSTDEWSSNMVFNGVTWDQTQWINWETPTLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g277 ### # start gene g278 5 AUGUSTUS gene 1601170 1602063 0.99 - . g278 5 AUGUSTUS transcript 1601170 1602063 0.99 - . g278.t1 5 AUGUSTUS stop_codon 1601170 1601172 . - 0 transcript_id "g278.t1"; gene_id "g278"; 5 AUGUSTUS CDS 1601170 1602063 0.99 - 0 transcript_id "g278.t1"; gene_id "g278"; 5 AUGUSTUS start_codon 1602061 1602063 . - 0 transcript_id "g278.t1"; gene_id "g278"; # protein sequence = [MQVNPLPLPAQDQAYCIVSALESGHIDVPLEVFLDNAVPGSQATLPSLSFLLRHSKTNETFVFDLGFRKDLENYSSSI # VKLGLEKFVRVPQDVVDSLAKGGLSPLDVKTVCLSHCHFDHYGDPSHFVNSEFVVGADSAMHVNPGFPADPDSQCPSDLLPEGRTRFVELSDQPLLGP # FPHALDFWGDGSLHLVDAAGHLPGHIVLIARTSPDGGWILLGGDSAHHWNLITGESQIAEGRPGFPTGCAHLDKKEAELTIQRIREFWQLPRTRVILA # HDEPWYKENKDGAGFWPGHITSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g278 ### # start gene g279 5 AUGUSTUS gene 1602446 1603339 0.99 - . g279 5 AUGUSTUS transcript 1602446 1603339 0.99 - . g279.t1 5 AUGUSTUS stop_codon 1602446 1602448 . - 0 transcript_id "g279.t1"; gene_id "g279"; 5 AUGUSTUS CDS 1602446 1603339 0.99 - 0 transcript_id "g279.t1"; gene_id "g279"; 5 AUGUSTUS start_codon 1603337 1603339 . - 0 transcript_id "g279.t1"; gene_id "g279"; # protein sequence = [MSSLPPPTNDQAFCTVSALESGHLNLPLPIFLDNAAPGSAIVAPSLSFLLRHSKTDKTLLFDLGIRKDIENAPPSAQR # WIITACFHTTVPQDVSESLIQGGLSPADVDTVCISHCHWDHTGDTRPFVKSEFIVGAGSESLFRPGYPEDPESPYSSDLLPKGRTRFVELGEQPSLGP # FPHALDLYSDGSLYIVDAAGHLPGHVILVARTSADGGWILLGGDSAHHWNLINGESGIASGRPGFPSGCAHLDKEAAELTIQRIREFWKLPRTRVLLA # HDESWYSENKGTAAFWPGCIESK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g279 ### # start gene g280 5 AUGUSTUS gene 1603990 1604427 0.59 - . g280 5 AUGUSTUS transcript 1603990 1604427 0.59 - . g280.t1 5 AUGUSTUS stop_codon 1603990 1603992 . - 0 transcript_id "g280.t1"; gene_id "g280"; 5 AUGUSTUS CDS 1603990 1604300 0.71 - 2 transcript_id "g280.t1"; gene_id "g280"; 5 AUGUSTUS CDS 1604424 1604427 0.59 - 0 transcript_id "g280.t1"; gene_id "g280"; 5 AUGUSTUS start_codon 1604425 1604427 . - 0 transcript_id "g280.t1"; gene_id "g280"; # protein sequence = [MAAVARHIYLRKDVGIGALTKLHGGRNRRGNRPSHHADSSAAVQRKICQSLEKIGVLEQTDNGGRRISQDGQRDLDRI # ATAVVEAAKGDDEEDEEEEEEEEEEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g280 ### # start gene g281 5 AUGUSTUS gene 1605904 1607358 0.94 + . g281 5 AUGUSTUS transcript 1605904 1607358 0.94 + . g281.t1 5 AUGUSTUS start_codon 1605904 1605906 . + 0 transcript_id "g281.t1"; gene_id "g281"; 5 AUGUSTUS CDS 1605904 1607358 0.94 + 0 transcript_id "g281.t1"; gene_id "g281"; 5 AUGUSTUS stop_codon 1607356 1607358 . + 0 transcript_id "g281.t1"; gene_id "g281"; # protein sequence = [MEFSTISVDASPSHSHSLIPPVGNLPAELLIETFAFCAAEDPLAPLTLGTVCRLWKKVVDESPRVWQVVILDDKRYIP # ASQSQAKLWISRSAPLELDVKLHVEDANNILSLLAPFLPVLRRWRRLTISGAREESIRLSDTFSRLDTLNDLSISVYDDEDANDTCRSTFVQYSPLWP # NRMVMNIWLTKLPHAESMIPLQFTSLSITEQSPLTTQPDPTAVLGLLKSCPQLESFTLSGWMEAENYRYHPLPVVSLPRLHTLHLRRTTLARAILSHI # DAPVLSKLYLANLNISHRISPEYLEPGDSEDEAHDYSQSPWSDQATGMGLRNLIARCNPPIKALEMDYSDMRTKDFIYVFDHLTELEDFLIVASDMSN # TVIRLLKPYDEAALAANFNAASTSEESDNDPCLSPAPSLTVRLPHLRNLELYNCHRISGDAIVETLMQRVKYTDRFAPEDTMEEVIIADCEQFNYQHQ # DMLSKEMGLRFKMD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g281 ### # start gene g282 5 AUGUSTUS gene 1608292 1608636 0.38 - . g282 5 AUGUSTUS transcript 1608292 1608636 0.38 - . g282.t1 5 AUGUSTUS stop_codon 1608292 1608294 . - 0 transcript_id "g282.t1"; gene_id "g282"; 5 AUGUSTUS CDS 1608292 1608636 0.38 - 0 transcript_id "g282.t1"; gene_id "g282"; 5 AUGUSTUS start_codon 1608634 1608636 . - 0 transcript_id "g282.t1"; gene_id "g282"; # protein sequence = [MTAVLTTSMTLRIILNIRGSLKSGGVFTGGTASSGHSSSRTTHVISTRSGGHHSSQAAHTYNLEDMRTTKPEANWSEP # DADNKVIAIDGAQLDPDGVRVTVDREVGYDQYHHTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g282 ### # start gene g283 5 AUGUSTUS gene 1614906 1616093 0.38 - . g283 5 AUGUSTUS transcript 1614906 1616093 0.38 - . g283.t1 5 AUGUSTUS stop_codon 1614906 1614908 . - 0 transcript_id "g283.t1"; gene_id "g283"; 5 AUGUSTUS CDS 1614906 1616093 0.38 - 0 transcript_id "g283.t1"; gene_id "g283"; 5 AUGUSTUS start_codon 1616091 1616093 . - 0 transcript_id "g283.t1"; gene_id "g283"; # protein sequence = [MARIMYPHKPPNLLNVQVPGQELVLAFAESFRDYLPAESQMSDSRVIEVSLKPFYLHPVRCSKRHQDNERDEYQLKSR # NTPSPPHYASGQQLVVRAPYANHKRRDSDTLRGYSPGGNSPTVMEAPPRVSPSVKGLSGGVSSRTSSNDKNAVNIAAKHRRSPTAPEPATGSGLLQAG # VVHNVQGRTWAAGDRDSGDGYDAYSGNEEKEREREARRERGRSQQLALSQVPQAKGPAPPPPNAAQHGYPPALGRHILVQFNPSQSIADRMLMNNAQV # NKKVYARLDMIGKGGSSRVFRVMTYASELYAIKKVALDKTDSETMAGYMNEIALLKRLEGNSRIIRLVDSEVKAGPGGSKGHLLLVMECGEIDLARLI # SERSQEGLDMVWIAYYWQQVRSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g283 ### # start gene g284 5 AUGUSTUS gene 1616317 1617228 0.63 - . g284 5 AUGUSTUS transcript 1616317 1617228 0.63 - . g284.t1 5 AUGUSTUS stop_codon 1616317 1616319 . - 0 transcript_id "g284.t1"; gene_id "g284"; 5 AUGUSTUS CDS 1616317 1617228 0.63 - 0 transcript_id "g284.t1"; gene_id "g284"; 5 AUGUSTUS start_codon 1617226 1617228 . - 0 transcript_id "g284.t1"; gene_id "g284"; # protein sequence = [MSVSSLLQDYASPSPMTPLSRAPSVSPSSSESSVIDELSFDYDYDEAGNIVRNSKGSRTSPQSFLSTPPTDTSGVSRL # ELPKSSSPPLRRASLSRSESAYPVLNGPATASSDREKVHSSSANPARSFHRAASGPIPSTTTADSAGPPIRTLPRTRIDNQYEARQKRHTEEVRARLA # SIELEEKENAVPIVDDLYGSRPAASTSSSSRLVPPTRATYGSQSLGGLSRPLIDAPQRVMSSSSRMLLKGTGTKPQIDRISEAGTEGESDGGEDAYAG # YGGHGHELFENNAYGTDTDAGQSFACAFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g284 ### # start gene g285 5 AUGUSTUS gene 1617579 1620323 0.6 - . g285 5 AUGUSTUS transcript 1617579 1620323 0.6 - . g285.t1 5 AUGUSTUS stop_codon 1617579 1617581 . - 0 transcript_id "g285.t1"; gene_id "g285"; 5 AUGUSTUS CDS 1617579 1619237 0.98 - 0 transcript_id "g285.t1"; gene_id "g285"; 5 AUGUSTUS CDS 1619313 1620323 0.61 - 0 transcript_id "g285.t1"; gene_id "g285"; 5 AUGUSTUS start_codon 1620321 1620323 . - 0 transcript_id "g285.t1"; gene_id "g285"; # protein sequence = [MSLTSSDEEYLQGVITTIESTPSDTPHMVDSNALLLLVAQLSTLNKAEDSTPAGSDNGQSRARGRPRALSTSSDSSSG # SNGTSRYPSRPPSRSGPPPSTPTHPQTPLDKRQRSAPLSSNPPSAYTKRPPPHRRKSDASPGRGYSSGGAGGDSDGTSGPGKRSRSRAGSQSITTPSS # SSTAFPLSPSGTFSPGDSPSRDRFLAESGSSSPEDSTTHLPRTDYDLVDSISRIPMPHSSDSDDSDDDQDGNTYTHFVFDPEHGPRSTTSSTASLLPG # ERLEALSRANTELAKRLQDAERTLSRKIGEHESELEELQYKLEELRSELARSKRDEKELRAKEISSLESEVARLTKELSTTRDSLHSLHKQYNEQTSI # SERYRGDLRIREDHIRSLQDQAGLHDIEIGKMTEREREWEDRVLKLEREVEEAREGCAELVRQKTENLGLKETIDRLRFEMDDMRSGMGNGLGTIGMP # GSGLNSRNNTISKSLGAELQSQLEREERERAERGDFGDDDDTEGEDTVVEEIVDDNDDEGNFVTTIIKRTRRKVASKAQAELPTPKKGYSERRIEEFE # DDKVNSFAFLVSFIHLHALVQEYADCAIQYDPLAFFDPDSEDGFWRSESLQTEAEALPLPPVERVMTEMDIQTDVLEEEEDNLTGSSSTPTPTVPSDE # PPAYPGPSTSHAEKAEEQREKEVQAELAVLRKWHRSLEGRDVMDIKNIIMHNSSGSGLSVPKGIMKDWARVQRVAGIDCDVVERLLASAVADEAMVED # EEEEGKKESFKSRLSLRRFSPRIPHLPANLNISSYIPPTLIYSSLSVLIGVMLAPHIANQMNEPYGGATYYDRRAWTSFNNLGGGGEGFPGFGAAGYQ # GGTEGALWKVLEAVFGGGARYARGLPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g285 ### # start gene g286 5 AUGUSTUS gene 1621730 1622056 0.57 - . g286 5 AUGUSTUS transcript 1621730 1622056 0.57 - . g286.t1 5 AUGUSTUS stop_codon 1621730 1621732 . - 0 transcript_id "g286.t1"; gene_id "g286"; 5 AUGUSTUS CDS 1621730 1622056 0.57 - 0 transcript_id "g286.t1"; gene_id "g286"; 5 AUGUSTUS start_codon 1622054 1622056 . - 0 transcript_id "g286.t1"; gene_id "g286"; # protein sequence = [MRGVPSDPTSSFSTSVPSSHLRASLPSSTSSSVPSSNSRPQKTGRLTTVSGSDWRYPYHRELVPRSLTGLQHEMERKI # SAISNPHISTKSAKERASWASNPYGLLSMN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g286 ### # start gene g287 5 AUGUSTUS gene 1625997 1626365 0.83 - . g287 5 AUGUSTUS transcript 1625997 1626365 0.83 - . g287.t1 5 AUGUSTUS stop_codon 1625997 1625999 . - 0 transcript_id "g287.t1"; gene_id "g287"; 5 AUGUSTUS CDS 1625997 1626365 0.83 - 0 transcript_id "g287.t1"; gene_id "g287"; 5 AUGUSTUS start_codon 1626363 1626365 . - 0 transcript_id "g287.t1"; gene_id "g287"; # protein sequence = [MNLGDNQTLADRTNVAQAVRQAKQDVGQDSDKRTITISSDSEGQENDTVPPAFMAPKAYKLAKLTNRTSSATDNAALS # ELVLEFIKVMKSNTSRTLIKDGFAFLDALNKQLEDPSVFVVPMR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g287 ### # start gene g288 5 AUGUSTUS gene 1635772 1636554 0.45 - . g288 5 AUGUSTUS transcript 1635772 1636554 0.45 - . g288.t1 5 AUGUSTUS stop_codon 1635772 1635774 . - 0 transcript_id "g288.t1"; gene_id "g288"; 5 AUGUSTUS CDS 1635772 1636554 0.45 - 0 transcript_id "g288.t1"; gene_id "g288"; 5 AUGUSTUS start_codon 1636552 1636554 . - 0 transcript_id "g288.t1"; gene_id "g288"; # protein sequence = [MMAENQSLQHDNKQLNTLIKEYEQTLDTLMSEHFYILSCKFSLFTGTFRNRAQTVQENELSLIRHYESHLLQLEEENS # SRELEASTRISESISRLSELLRNCLREVGGERTRLSTYDDHENDSETEEDPDLLEREPWQSTDATHAEWALEREIELARLERENEELRNLIMAGRAIP # VHAPQAAHPAPTQIKPQTEEPLQPSQGTDPGPQLATKVEEVKDSSTRDRPTPQPHGEEDLDTVPEGDLLNVDPYATVKRSKMGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g288 ### # start gene g289 5 AUGUSTUS gene 1636980 1638077 0.88 + . g289 5 AUGUSTUS transcript 1636980 1638077 0.88 + . g289.t1 5 AUGUSTUS start_codon 1636980 1636982 . + 0 transcript_id "g289.t1"; gene_id "g289"; 5 AUGUSTUS CDS 1636980 1638077 0.88 + 0 transcript_id "g289.t1"; gene_id "g289"; 5 AUGUSTUS stop_codon 1638075 1638077 . + 0 transcript_id "g289.t1"; gene_id "g289"; # protein sequence = [MASVQKPFSTSTSHLASRSKHSVNINSSVAPLEAMVCLFHCSLSSTYSSYVTQVNPPKQSIPAPVQSKTYYGQEAISR # LCARFITHLFGCPERPPNQSGWHVELPYYIAYAIYRTKLPECVVFSALALLQRLKSRFPSAKGSSGHRLFISAFMIASKVMCDDTYSNKSWSVVAQGM # FTVREVNQMEREMCGYLDWELTVDGEILTPFQARVTQDFAPLHGPYPIYSLQDVSKHAPKATASKPNSPAPSPDSLNPHFPSFSQRHPSPAKTPTATA # PIPMPRSSSTRSERLHVAIKTPSPSYSNSTSPASSISPQTPVGGEDFYTQIQDFATTSPPEFSIKEKTITGWPVNHPLKNDIFARAVPAAW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g289 ### # start gene g290 5 AUGUSTUS gene 1639955 1641985 0.7 - . g290 5 AUGUSTUS transcript 1639955 1641985 0.7 - . g290.t1 5 AUGUSTUS stop_codon 1639955 1639957 . - 0 transcript_id "g290.t1"; gene_id "g290"; 5 AUGUSTUS CDS 1639955 1641985 0.7 - 0 transcript_id "g290.t1"; gene_id "g290"; 5 AUGUSTUS start_codon 1641983 1641985 . - 0 transcript_id "g290.t1"; gene_id "g290"; # protein sequence = [MSLSGIRDPSLPASTKRPVTPSSLDSSVMFKKTKIVPSTMSVDVEDFSLTAAQAQRKNLLEEDPMATNVQHNSVTCDV # CGKIVKYTMFDLYHWNRHKTRCKSDLSLNSRSSSVISNNADSSLTAAQAERKRILDQDPLATNVQHNSVTCDACGKVVKYTMFDLYHWNRHKTRCKPG # LPGPSQSSSVSSNDADSSLTAAQAQRKGILEEDPLATNVQHNSVTCNACGKVVKYTMFDLHHWTKHKTRCKSNISLSRSSSVTMNSTSSQSQVKTAAP # SSQTPTSDTNSTLMLTAAQAERKQVLEEDTLATNIQHCSVTCRACGKVVKYTMFDLFLWEKHKSRCKLDASVLQSSSSLISSISQANDTQPRIKDIDI # LYTAKPSRVSPFEAGETSTDHSLTEAQSKRKRVLELDPLASNVKHCSLTCKACGKLVKYTMFDLFHWNRHKARCKPLPSNMSSTQGEATSVTKGKRFT # PLVASTKIANLASTKASVFSEEEDLVHSHAGPPLTTSLAIPIASVFSSHEIAVPIASGSSSHETAMLCTTRSSVAIHADAKSTPRTRTYAAFAPPSAI # PSARLRALKVATSGPIVRKASSVPDITLEVNSPTSLSLYHLDFPMSIPIVLNRISMPPALAQRKQVARFAVILSQIAIQDLSNCMLVSRMFRYASTPF # SVYTSIQWLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g290 ### # start gene g291 5 AUGUSTUS gene 1643074 1643967 0.57 + . g291 5 AUGUSTUS transcript 1643074 1643967 0.57 + . g291.t1 5 AUGUSTUS start_codon 1643074 1643076 . + 0 transcript_id "g291.t1"; gene_id "g291"; 5 AUGUSTUS CDS 1643074 1643967 0.57 + 0 transcript_id "g291.t1"; gene_id "g291"; 5 AUGUSTUS stop_codon 1643965 1643967 . + 0 transcript_id "g291.t1"; gene_id "g291"; # protein sequence = [MFDFVEVVQDQSVMIISDSDSDDIQFIGSRLSAGARQQVVQRPNPSTLDSTIERGRTSYSSISASRVRAAAPHNENVT # PQTDMELKPTPALQTYPAPLVVRVAEGLVTSLPSSKTRISEDGPRVPVLPWPAPQSFVTKNELPSLNHVPHVQHIARPQQNAASEITTLKIVRKARKV # TYRPPLSVTPPEISVSLSPASRSSTGPLTLADFVSELRDRNANTLLVTREYDPLTLVSANLRQWLTVDNQDGAEEVMRLADGRVSNQKETEMVAQARS # QRKKFKGRRFDTEKYDPDILIFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g291 ### # start gene g292 5 AUGUSTUS gene 1645818 1646692 0.62 - . g292 5 AUGUSTUS transcript 1645818 1646692 0.62 - . g292.t1 5 AUGUSTUS stop_codon 1645818 1645820 . - 0 transcript_id "g292.t1"; gene_id "g292"; 5 AUGUSTUS CDS 1645818 1646255 0.91 - 0 transcript_id "g292.t1"; gene_id "g292"; 5 AUGUSTUS CDS 1646429 1646692 0.68 - 0 transcript_id "g292.t1"; gene_id "g292"; 5 AUGUSTUS start_codon 1646690 1646692 . - 0 transcript_id "g292.t1"; gene_id "g292"; # protein sequence = [MVLVKPGDGHSYSWTAEGNLEEIRDGFHEWDPWCVFENSKYMTDLENLTLSITQCSEIAVSSRVCTRKQATHLQAFED # LDSFKRSRSFIEDAVVLGNLFSRISDNSQIPDLLKAYEGLRHARASATQAASARNRSVYHLPDGLEQEKRDAAMKLAMEEELLNYEWSKDGDPPSVFG # NRNRDNPNAWSDKNKNAEQFDYDPDTAVDEWWASESNGFQRDQSLESVEVDSNFQTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g292 ### # start gene g293 5 AUGUSTUS gene 1651953 1655462 0.99 - . g293 5 AUGUSTUS transcript 1651953 1655462 0.99 - . g293.t1 5 AUGUSTUS stop_codon 1651953 1651955 . - 0 transcript_id "g293.t1"; gene_id "g293"; 5 AUGUSTUS CDS 1651953 1655462 0.99 - 0 transcript_id "g293.t1"; gene_id "g293"; 5 AUGUSTUS start_codon 1655460 1655462 . - 0 transcript_id "g293.t1"; gene_id "g293"; # protein sequence = [MFATSSYDSLPSCTISSIWEINSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQCEPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQV # LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ # RHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLA # RLGIKSDLTSGYRPQSNGQTECANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINLRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE # ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNP # INGKIPTPPSRCT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g293 ### # start gene g294 5 AUGUSTUS gene 1655513 1656670 0.87 - . g294 5 AUGUSTUS transcript 1655513 1656670 0.87 - . g294.t1 5 AUGUSTUS stop_codon 1655513 1655515 . - 0 transcript_id "g294.t1"; gene_id "g294"; 5 AUGUSTUS CDS 1655513 1656670 0.87 - 0 transcript_id "g294.t1"; gene_id "g294"; 5 AUGUSTUS start_codon 1656668 1656670 . - 0 transcript_id "g294.t1"; gene_id "g294"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHSPAHTAHITPADPHAMDIDATHTSTGNSREAFLACMRGRCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPATPSPANQDFSTQIGQIRELLDRAN # AMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g294 ### # start gene g295 5 AUGUSTUS gene 1746260 1749097 0.91 - . g295 5 AUGUSTUS transcript 1746260 1749097 0.91 - . g295.t1 5 AUGUSTUS stop_codon 1746260 1746262 . - 0 transcript_id "g295.t1"; gene_id "g295"; 5 AUGUSTUS CDS 1746260 1749097 0.91 - 0 transcript_id "g295.t1"; gene_id "g295"; 5 AUGUSTUS start_codon 1749095 1749097 . - 0 transcript_id "g295.t1"; gene_id "g295"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEETLYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADVYYRRDLPSPWSSSSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g295 ### # start gene g296 5 AUGUSTUS gene 1749148 1750314 0.91 - . g296 5 AUGUSTUS transcript 1749148 1750314 0.91 - . g296.t1 5 AUGUSTUS stop_codon 1749148 1749150 . - 0 transcript_id "g296.t1"; gene_id "g296"; 5 AUGUSTUS CDS 1749148 1750314 0.91 - 0 transcript_id "g296.t1"; gene_id "g296"; 5 AUGUSTUS start_codon 1750312 1750314 . - 0 transcript_id "g296.t1"; gene_id "g296"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNSAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSASAPVAATPNPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g296 ### # start gene g297 5 AUGUSTUS gene 1751496 1752008 0.54 + . g297 5 AUGUSTUS transcript 1751496 1752008 0.54 + . g297.t1 5 AUGUSTUS start_codon 1751496 1751498 . + 0 transcript_id "g297.t1"; gene_id "g297"; 5 AUGUSTUS CDS 1751496 1752008 0.54 + 0 transcript_id "g297.t1"; gene_id "g297"; 5 AUGUSTUS stop_codon 1752006 1752008 . + 0 transcript_id "g297.t1"; gene_id "g297"; # protein sequence = [MGLSRQGRLQFSLSRLLRSTKRYTQRGVQPNSSKPLIQSTPSPSSLNEDLTRRLRAITNGEANKYSDANMVTETLKEG # LWSSVDEKKKKKKKKKKVPEPESGLAGWSGESWKRDWGEDSMFTVYDNLASMLKAIRAALLNIFLSISRYPSAQQFTDCLFSTYRRSPGRHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g297 ### # start gene g298 5 AUGUSTUS gene 1753408 1754150 0.2 + . g298 5 AUGUSTUS transcript 1753408 1754150 0.2 + . g298.t1 5 AUGUSTUS start_codon 1753408 1753410 . + 0 transcript_id "g298.t1"; gene_id "g298"; 5 AUGUSTUS CDS 1753408 1753558 0.2 + 0 transcript_id "g298.t1"; gene_id "g298"; 5 AUGUSTUS CDS 1753648 1754150 1 + 2 transcript_id "g298.t1"; gene_id "g298"; 5 AUGUSTUS stop_codon 1754148 1754150 . + 0 transcript_id "g298.t1"; gene_id "g298"; # protein sequence = [MGKDLNIWVEPLDWQPEFMKNGFKQAKARQTPIKQIVVTAKSFCGNVPAKGTVHWTITHRSSDSDKEDEIRASLQAAK # DRRFRAYSLPTGISPQNIREWWDALDFSGSKKINVPITPVDDEGNEGIEVGLSSVPTKKTRDESFFSDNFTPPDSRIQYLRDLANSGREETIRIGLED # RGRRKVVLGVGEIDWEDTLAEQEISAQIRRKEATADAETAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g298 ### # start gene g299 5 AUGUSTUS gene 1757964 1759040 0.87 + . g299 5 AUGUSTUS transcript 1757964 1759040 0.87 + . g299.t1 5 AUGUSTUS start_codon 1757964 1757966 . + 0 transcript_id "g299.t1"; gene_id "g299"; 5 AUGUSTUS CDS 1757964 1759040 0.87 + 0 transcript_id "g299.t1"; gene_id "g299"; 5 AUGUSTUS stop_codon 1759038 1759040 . + 0 transcript_id "g299.t1"; gene_id "g299"; # protein sequence = [MVPPTARALSDSSGATTSAYKLDDQFPQSEHVHRRFFIGPMPQKILPTPEELKRRNKRKHLFTRISNSDSTDEELTQI # IKVHARSFFIRQGGREEDWGENEEQSTREEMYRRWKESEWGVALRRLRGQSESSKNAPPDAWIGGSFEIGNFVGINIMDEAESLSKVSTHTSQLSAPI # FPLESGLEPLGRPGQSSLATEQQTFVTAPSEFTELSQVQTPEPTTQNLSPSPPDGEHQNARGPSPSSSTALLRPSTSRKNDTGTSHAQSEPARRSIIR # LPSFSRNGDSPHKAKKSVHYNLSPVESNSSLPPVSPSAVLERTGTDVSGTSAGAMNIPAIDDQQIDWGDTVMRGMSRPMLENAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g299 ### # start gene g300 5 AUGUSTUS gene 1767291 1768301 0.97 + . g300 5 AUGUSTUS transcript 1767291 1768301 0.97 + . g300.t1 5 AUGUSTUS start_codon 1767291 1767293 . + 0 transcript_id "g300.t1"; gene_id "g300"; 5 AUGUSTUS CDS 1767291 1768301 0.97 + 0 transcript_id "g300.t1"; gene_id "g300"; 5 AUGUSTUS stop_codon 1768299 1768301 . + 0 transcript_id "g300.t1"; gene_id "g300"; # protein sequence = [MLLRHDRNIDGKSYIRNRIGAVLSKGLTIAGREFKFLAYTQSSLKDHTGELLLYIDLRKIDLQAVWFFKPNSNIKFYD # SFSIIQEIGSFEEPELRRCPALYGARISQAFTATEASFTKVEEVFPIEDKLTLDKAYNFTDGVGTTSKDFAEKVWNELKATKRRTRNGADPTIPCFQI # RYGGSKGMLSIDYKLRGNVISVRPSMRKFDSILTHDIEVAQFFDRPLKLTLNRPLVMILEDLGVPYETFEDLQEEAIEHTRRATESLATAARLLDNFG # LGNSFRLTSILLGLSRLGVDNHIQAEPFHRSVLNYAVHHILRGTRDFSCKLTFLIMNFRLKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g300 ### # start gene g301 5 AUGUSTUS gene 1769806 1770177 0.98 + . g301 5 AUGUSTUS transcript 1769806 1770177 0.98 + . g301.t1 5 AUGUSTUS start_codon 1769806 1769808 . + 0 transcript_id "g301.t1"; gene_id "g301"; 5 AUGUSTUS CDS 1769806 1770177 0.98 + 0 transcript_id "g301.t1"; gene_id "g301"; 5 AUGUSTUS stop_codon 1770175 1770177 . + 0 transcript_id "g301.t1"; gene_id "g301"; # protein sequence = [MRNQIAEEHDLKTVCERAWSTWVLSRKQAAQGKFGAWSFQYIVLGLLLDSIKDLTDDEDEDTRTRLKRKHSFEGVSEQ # KRSRYTTTQRDLSIELNMETEYTDHETNEEEDSEEGLEEDTYAEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g301 ### # start gene g302 5 AUGUSTUS gene 1771020 1771442 1 - . g302 5 AUGUSTUS transcript 1771020 1771442 1 - . g302.t1 5 AUGUSTUS stop_codon 1771020 1771022 . - 0 transcript_id "g302.t1"; gene_id "g302"; 5 AUGUSTUS CDS 1771020 1771442 1 - 0 transcript_id "g302.t1"; gene_id "g302"; 5 AUGUSTUS start_codon 1771440 1771442 . - 0 transcript_id "g302.t1"; gene_id "g302"; # protein sequence = [MPAASSSRRKRVAPSSDIEDGPTQKSTREDVEEEDDEQPQRVVKKEKKVVKGKGRAAEAYYSEEEEDDDDKIDVDSFA # DQPLDKSHIISMNGFASDWGTMIKIVQRTNNMVADVAVALADNVEGDVGKKVRFPSWFAMVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g302 ### # start gene g303 5 AUGUSTUS gene 1773963 1775078 0.88 + . g303 5 AUGUSTUS transcript 1773963 1775078 0.88 + . g303.t1 5 AUGUSTUS start_codon 1773963 1773965 . + 0 transcript_id "g303.t1"; gene_id "g303"; 5 AUGUSTUS CDS 1773963 1775078 0.88 + 0 transcript_id "g303.t1"; gene_id "g303"; 5 AUGUSTUS stop_codon 1775076 1775078 . + 0 transcript_id "g303.t1"; gene_id "g303"; # protein sequence = [MLGIDALFKSHLELEHLPSLRRLALDISIAYLLPILRRLASAYDARHSELSASESQAAMESLPSITHLYIPAIGYKSS # FRGPNDADLAPANDAPQLHLNQDQELLAEDTDIQPTGTAPVFHDLNKNLHEALEVLLPIHPVFEDLVELRCDADDLYNAADFAMASSTQFFQSQYYWR # MQAKEAAESDSVSSTRGVSQPYSTFVPFRRTDTVLALGEADADAEADAEVLTPTQFSLGSASLHRYPRPGTLSHSRLRLHVRKLRKHMPLCAAKGITP # IPVVRYWFNDVPTGLVFEERMWASGDGYASITGVGNWDTSVGGPDGEEIAAFAQAEEDVESMGGMQGLSMRGMEIWDTEKGRVLIVLFLLSAVVMLW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g303 ### # start gene g304 5 AUGUSTUS gene 1779905 1780810 0.8 + . g304 5 AUGUSTUS transcript 1779905 1780810 0.8 + . g304.t1 5 AUGUSTUS start_codon 1779905 1779907 . + 0 transcript_id "g304.t1"; gene_id "g304"; 5 AUGUSTUS CDS 1779905 1780810 0.8 + 0 transcript_id "g304.t1"; gene_id "g304"; 5 AUGUSTUS stop_codon 1780808 1780810 . + 0 transcript_id "g304.t1"; gene_id "g304"; # protein sequence = [MSESELAKTPAIDYLRPIVADADTGHGGLTAIMKLTKLFVEKGAAGIHVEDQAPGTKKCGHMAGKVLVPISEHINRLV # AIRLQYDILGVENLAVARTDSEAATLITSNIDDRDHPFILGCTNSSLPPLNKVMVDAERAGKVGDELQSIEDKWMAAANLQVFSSTLAQALAKEGKND # ATVKKFLALVSKSSYPDAVVIAQKEFGLQSVPYWDWDSPRTREGYYRYQGGTECAIHRAIAFAPYADLLWMETKKPILSQAQQFSAGVHAAYPGHWLA # YNLSPSFNWDAAGLNEKDMQSYVWELV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g304 ### # start gene g305 5 AUGUSTUS gene 1783515 1783880 0.81 + . g305 5 AUGUSTUS transcript 1783515 1783880 0.81 + . g305.t1 5 AUGUSTUS start_codon 1783515 1783517 . + 0 transcript_id "g305.t1"; gene_id "g305"; 5 AUGUSTUS CDS 1783515 1783880 0.81 + 0 transcript_id "g305.t1"; gene_id "g305"; 5 AUGUSTUS stop_codon 1783878 1783880 . + 0 transcript_id "g305.t1"; gene_id "g305"; # protein sequence = [MSQIQDKRNISYAGAYLKYGFHEDGFTSGLLAASSYASILQPTVRLPFEIEYAESSGPRGNNAACGTYHTGSNGAGIV # KWLALFFDVFEYTGLRAVVGLVLGTGLACVIRALKTCGFDSEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g305 ### # start gene g306 5 AUGUSTUS gene 1784737 1785492 0.53 + . g306 5 AUGUSTUS transcript 1784737 1785492 0.53 + . g306.t1 5 AUGUSTUS start_codon 1784737 1784739 . + 0 transcript_id "g306.t1"; gene_id "g306"; 5 AUGUSTUS CDS 1784737 1784943 0.53 + 0 transcript_id "g306.t1"; gene_id "g306"; 5 AUGUSTUS CDS 1785016 1785492 0.61 + 0 transcript_id "g306.t1"; gene_id "g306"; 5 AUGUSTUS stop_codon 1785490 1785492 . + 0 transcript_id "g306.t1"; gene_id "g306"; # protein sequence = [MLATVIFSSLLAFSSSAVGAAIFKRDDGCSNFPINGISTNSDYFSLWAQYNETGVELPLAMSTFGTGGDPADYAGVTV # GNLFQLNNSGLVGIGYPDGNDQTRNWISESTEDGGPLPFFLSKNSTLAGIAEDYCELVRCDPFSYQGYDFDYTPSFQVNTDPNGSPIPGPVLAAEGTS # DSWSICNRTDNSLQLGLVFKPASFSEDYGYDFSTCQFVHVFLRSSAIGNQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g306 ### # start gene g307 5 AUGUSTUS gene 1788720 1788998 0.45 + . g307 5 AUGUSTUS transcript 1788720 1788998 0.45 + . g307.t1 5 AUGUSTUS start_codon 1788720 1788722 . + 0 transcript_id "g307.t1"; gene_id "g307"; 5 AUGUSTUS CDS 1788720 1788998 0.45 + 0 transcript_id "g307.t1"; gene_id "g307"; 5 AUGUSTUS stop_codon 1788996 1788998 . + 0 transcript_id "g307.t1"; gene_id "g307"; # protein sequence = [MPLPAPSSANSITAAPAEDFLEADWAVLQAIGGDNTILGGVFDEDAPAAGANDTDDESVSSDGSYTGVGVGEGFSPVR # QLYSILNVFKLHNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g307 ### # start gene g308 5 AUGUSTUS gene 1794092 1796257 0.56 + . g308 5 AUGUSTUS transcript 1794092 1796257 0.56 + . g308.t1 5 AUGUSTUS start_codon 1794092 1794094 . + 0 transcript_id "g308.t1"; gene_id "g308"; 5 AUGUSTUS CDS 1794092 1794697 0.56 + 0 transcript_id "g308.t1"; gene_id "g308"; 5 AUGUSTUS CDS 1794758 1796257 0.99 + 0 transcript_id "g308.t1"; gene_id "g308"; 5 AUGUSTUS stop_codon 1796255 1796257 . + 0 transcript_id "g308.t1"; gene_id "g308"; # protein sequence = [MEKRTGSPSSEESDAKRARMSENATPVDPETAPGKRSELEPISAGEIGNLPPEGEPEPRPESGGRVRLLKADAEDDDG # GDISMADGADDDGDSGDDNDDEDPAQLEATRQRLEEQARKYLAAQTHEVIIPSFSAWFDMSKIHPVERRALPEFFNSRNRSKTPAIYKDYRDFMINTY # RLRPTEYLTLTACRRNLAGDVCAIMRNNSPYQFLVQVDPETRPATLAPPFTGHFRVILDTPRGLQSLHPGTRPSNPGAAAVNGVNSASQHTDSSTSAS # LKLRNSIYQTTNKSSRPVSASEATTLANGINGTNGSRTQGLYTCDTCGSDCSAVRYHHLKEKNFEICAPCYLEGRFPSNMFSGDFVKLSRAVVHGSTD # DDWTDQEVLLLLEGVEMYDDDWSKVQEHVGTRTAQQCIQKFIALPIEDPYLDSEASMGPLRFGRVPFEQADNPVMSVVAFLAGVVAPSVGAEAAKTAL # HELIKTDKDDQKPAADVTEGVETTDTKMTAAEGPDSEKQDDKMVEDSNEDTETNRPPTDRMSVDPSSTSANLPSPSSSKHSVPHSKVVRAAHLALNSS # AKAAASLASAEDQQIKSSLSKLVNLTLTKLELKMTQFEELEEILEDERKGLESARLALVQERLGIKRSLEYVRGEIAKFQGMGVAAPQTLINAANGAS # LGTTGQGTQPTPVDPTPQLGEAIGPIGDGSLLQLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g308 ### # start gene g309 5 AUGUSTUS gene 1797949 1798332 0.6 + . g309 5 AUGUSTUS transcript 1797949 1798332 0.6 + . g309.t1 5 AUGUSTUS start_codon 1797949 1797951 . + 0 transcript_id "g309.t1"; gene_id "g309"; 5 AUGUSTUS CDS 1797949 1798332 0.6 + 0 transcript_id "g309.t1"; gene_id "g309"; 5 AUGUSTUS stop_codon 1798330 1798332 . + 0 transcript_id "g309.t1"; gene_id "g309"; # protein sequence = [MECKDIVSEITSITNGGAHSAVVTSASGAGYRQAVDYLRPGGTLMAVGLPGKATLEASIWFTVFKSISILGSYVGNRQ # DAVEAIDIAARGQVKVHFTTKPLKDLENVYEGMKAGKIAGRIVLDLAQK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g309 ### # start gene g310 5 AUGUSTUS gene 1798959 1801667 0.12 - . g310 5 AUGUSTUS transcript 1798959 1801667 0.12 - . g310.t1 5 AUGUSTUS stop_codon 1798959 1798961 . - 0 transcript_id "g310.t1"; gene_id "g310"; 5 AUGUSTUS CDS 1798959 1799635 0.59 - 2 transcript_id "g310.t1"; gene_id "g310"; 5 AUGUSTUS CDS 1799876 1800235 0.96 - 2 transcript_id "g310.t1"; gene_id "g310"; 5 AUGUSTUS CDS 1800866 1801667 0.29 - 0 transcript_id "g310.t1"; gene_id "g310"; 5 AUGUSTUS start_codon 1801665 1801667 . - 0 transcript_id "g310.t1"; gene_id "g310"; # protein sequence = [MSYSPHAAATQLASALRGFDHLFANEISSAKRVFASETDPFHLVGAGCLCFLEASLGLETSKMSEATRLLALAEAGSR # AALKTAAKSKSRASAAFPPGLEYEIANADTVVLLGITHALSESYMGYLQCIYAMNSAHGKFSKLYKTVFPNGLDSHTTPSITPFSWTPSVTPSPAVSP # AITPKTSSSNLSLETSAFTSNSNKPAHPAVKPSLSFFNIAGRWGSGSSSPASSSTSSLSPPTPNGALSVVEAGNPEEIQNLKNLIIAGTAFGGYAGKP # FAPVVDLLCIHMKTGFIQLVFELAWIYLSQRHYVESAEAFIKLTELNSWSHGTYYFIAAGCHISLAHSDEVSPDEKEKYLNQAQRLLDAIPNLLDKRK # MGGKELPTEVLIKKRXAHIKDWSVLSPPVGIDSPYMARPPPTTTPDLDTPDELALRLLLLGIAHRSIGCVGIRIKNNSPASTEPASSSSSYIDTSGAA # PESIVESTSSLSLFEELTPYADNASACLRASRELLSAAHALQSSIKVSTWIGGLAMFELAVLDLKEVEVEENNEKNGNSINPGLSADLKNKWKKALES # ARIKLDAAMALAPNSVDLSSRLDSRVVMLRDEIGMKAEMLGFTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g310 ### # start gene g311 5 AUGUSTUS gene 1804551 1808102 0.8 + . g311 5 AUGUSTUS transcript 1804551 1808102 0.8 + . g311.t1 5 AUGUSTUS start_codon 1804551 1804553 . + 0 transcript_id "g311.t1"; gene_id "g311"; 5 AUGUSTUS CDS 1804551 1808102 0.8 + 0 transcript_id "g311.t1"; gene_id "g311"; 5 AUGUSTUS stop_codon 1808100 1808102 . + 0 transcript_id "g311.t1"; gene_id "g311"; # protein sequence = [MVNNNGVRNLRSPLHFLQPDRLPNKQPDLPMTLYKPLPIESPRDASHQTPAAIPCERTLRQCSALSNLEQNTVSVTAS # GPGSKSLTIMSSALPMPKEKVVVGNLVRQGTHNKMGTKYGYQASKPSLLDRLTVQPEGSPRGETVEVDNNVQGVSSPHHCPGGLEVRMTLGRQDLRNH # STTERGLKRKTLEERLGPSQHEEVIDTHPKKKTRAMTKDEGKNERSGPSRTRAASTGLLMRLSNNPYSHQNTGRSLRRLKTLNSTSMRPSRALSKAES # ILSSPKSSGSQFSVTSTSNSQKCMHWLQPTTTQRHHDRPPTSSQKPSSYPPLPNQHPQKPLLTRLHGAELGEPQQMQSPLHSPTVVPNSLLMKSTLGD # SSMTTSLASTGTSSTTIKPCASSLGLDVISYSTNLNTPKLPGSGQCISSPPEHISQPRLSPHLGQTKGVHALATGPERFAGSSIGETVMAVNEGTSAP # RVESQGTEHKSAEKRPRSDQELAESSTSHPPLAHFWKAAVDFLSSFNDEYEEVEEGSEVKKQRVETGREVEGRKNAENGSVGKGDSPSLPRFMRGLGF # RDNAVALRSRTASFTESDDPLPRPAPVEYEGVAWDTIQKNPHLFQVQTPINIDRLETMLHAHPNQPFVKSVLIGLKEGFWPWATTRLRDEFPITWDNS # WAPLPSEKERDFINLQSELETQLGRHSPPFGPDLLPGMYSTPVIAVPKPHSEDLRLVAHQSAGEFCQNNMVDKSQTKGNRLDSLLVFLPLLLAFVRDN # PGKRFVLWKSDVSNAFRLLPMHPLWQIKQVVTTGMPTRKEAKEGNLSEDRRKRFVDWCACFGNSGSPRIWNSVMGLVVWIAIHILLILLLCCFMDDCF # SIALVGDMELYEPYNQMLPREQVKLLRLWDFLGIPHKPSKQVWGETLTIIGFMVDPNELTVTLPANRKDELVVQVRKFAMSRRRTLQEWQQLTGWINW # SLNVFPLLRPALSNVYDKMKGKSNQSAQIFVNKAVRDDLTWFAEHVETSSGVYLFANIDWLPLDEFDLVIYGDACLQGMGFWVPSRNLGFAGKTDPSS # PTALLIFYWEALTVLAALQWLVSSPEYQGTVARPTRLTFRSDSSNTVDMFNSLRAQPKYNPILIAVVNLLIDSHVDLRVVHISGRQNSVADALSRFDF # ERVRELQPNISILPLKTPRLTLGETKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g311 ### # start gene g312 5 AUGUSTUS gene 1814118 1816133 0.95 + . g312 5 AUGUSTUS transcript 1814118 1816133 0.95 + . g312.t1 5 AUGUSTUS start_codon 1814118 1814120 . + 0 transcript_id "g312.t1"; gene_id "g312"; 5 AUGUSTUS CDS 1814118 1816133 0.95 + 0 transcript_id "g312.t1"; gene_id "g312"; 5 AUGUSTUS stop_codon 1816131 1816133 . + 0 transcript_id "g312.t1"; gene_id "g312"; # protein sequence = [MQSTSRSQTPRFNSAYPPTPDSIPSTSSVSSELTRQLSASPALSSISSHSHRSQRLIQQQQPQYQMSMSPASSAISPS # AYGFHLPGPQPNSLLPSSSSQPPSNPVISRPYAKPKQRKQRLFNVDRKAICEYHLAHPNEKQELIARQYGVERSTISKILKHKEKWLNIELGDARGCG # TNGTGLPLRLAKHRPSKFPPVELEMQRWLVEISDKYYASLPDPSTYPFDPQNPPPLHGPLSDASLREKARAIARSHGITPEQFKASSGWVENFKNRHG # IKNGFWGGYLRNVQGRNAMAARGMGLSFPSTTPAPPPLASALASKLPTKEYRYISNYPKAEDIEESDSEEEEDEESDLMDLPYPQPPSSLSHLRDSTF # PRPPWSTDSSSTSASGESLMSPHPVPGSHIYGIAPWSSTSTASQPPTPTEPLPEHYSRQHRRSVSGLSVATVELQSPYEHSQSPLEHGHTQPVPDSLM # SHNQNHVHHAQNMIEESQTRDSHQHHQEQVQAHYPTNSHQTTFTYTTTVDHSAPNGSDQNASSTVGLHSYQSEYSASNLSQPQNQVSHNNSYDHQHSS # VHAEVEHNPPTPYEQGMHLQPEVHMQTVIEAPIPPPPPISDNSIPTLSECEEYLTKLSRYVDEGPGQGMLSLRRRDWLRKLKVVFFEAGSGIPITPDS # DEEAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g312 ### # start gene g313 5 AUGUSTUS gene 1822700 1824460 1 - . g313 5 AUGUSTUS transcript 1822700 1824460 1 - . g313.t1 5 AUGUSTUS stop_codon 1822700 1822702 . - 0 transcript_id "g313.t1"; gene_id "g313"; 5 AUGUSTUS CDS 1822700 1824460 1 - 0 transcript_id "g313.t1"; gene_id "g313"; 5 AUGUSTUS start_codon 1824458 1824460 . - 0 transcript_id "g313.t1"; gene_id "g313"; # protein sequence = [MLASPPPPSSDNTNSNIHDTSGAPPPSSINAPKSKKRRVTISGAPALNTDVRIAADQTNSTPISPVVIGFTVQRDNPS # EVEQIRSMLTVKQQQQALIEQRRGSTSGIMSPTIAAGPSAAAGEGHPKSSLQGTRSVRRSPNSGTNNRRHTVIIQAGTNRPLSPNSNIVHTQAPPASV # ASHSLPPPPISFARRRANQIGGGKKKPADIMISPRDAHTPDQFAPSIQSAPPIPHAGQQGSGLVGRFPMALPRLPSVMGDNVRRTVGGNVPPTPTRFS # AQRMAISQGVSHPITGISGRSPPNASVPISSTLVPSTPSALHNPGYTGEKSAFLAPFESFYDALNDSKQLKTWLSEQLQRSKVLIQNLTQQQDKLHET # VDSLVEKKVAGMRTEIVGLNRRVEELEDALRVATSSRRPSIEGPASGNKGKQTVRNGNLLGTSITEGYTFPPIATIDRERLRSESSEHRMSPGWTHDK # DSRDTQDSEHGSPVLYESRRLSLSSSRLEPRAQSMESVVRPFASPSLPFREVPSVSHPPPTSSKLSRGGRPLGPGRHHSSPRLPGPVQDSLVTSSPRR # EESRRSSIVDGSIDDRES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g313 ### # start gene g314 5 AUGUSTUS gene 1825924 1826988 0.99 - . g314 5 AUGUSTUS transcript 1825924 1826988 0.99 - . g314.t1 5 AUGUSTUS stop_codon 1825924 1825926 . - 0 transcript_id "g314.t1"; gene_id "g314"; 5 AUGUSTUS CDS 1825924 1826988 0.99 - 0 transcript_id "g314.t1"; gene_id "g314"; 5 AUGUSTUS start_codon 1826986 1826988 . - 0 transcript_id "g314.t1"; gene_id "g314"; # protein sequence = [MAPLIRLFYVLPGYSEIEAEHSLKPVNVARPVTHNYQWTYGHPYSQTEIPLPCPRNDIDTDVPRNLGQFIPSFDDDPK # SRFMDEIAYTTGPEGIKSPPRKRARASSSTSHEEGHKLNVTVSNDGDDNGERRDIHIEKDDRPLGELGKVSVDEFWERMSFRQECVAGAVTGFFALGA # TSSRNDPDERSAVSPLKPQPGQVSSKMNKRVITSLMTGVEFSTRERAIRATELIEGTIRGLCEGISVVPAPVIHAPRPRPPTSSSGRGLTNAEHDISL # LAPPRTPPRMASGKRIVPDVSPNPFPEPETSLETYQSFIYGSVNISNPILQNKDALNENKATSTPPVTILTVRRKKKRQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g314 ### # start gene g315 5 AUGUSTUS gene 1831518 1832196 0.78 - . g315 5 AUGUSTUS transcript 1831518 1832196 0.78 - . g315.t1 5 AUGUSTUS stop_codon 1831518 1831520 . - 0 transcript_id "g315.t1"; gene_id "g315"; 5 AUGUSTUS CDS 1831518 1832080 0.9 - 2 transcript_id "g315.t1"; gene_id "g315"; 5 AUGUSTUS CDS 1832130 1832196 0.78 - 0 transcript_id "g315.t1"; gene_id "g315"; 5 AUGUSTUS start_codon 1832194 1832196 . - 0 transcript_id "g315.t1"; gene_id "g315"; # protein sequence = [MISKLKEACGFEYTNKLQRMFTDMSLSKDLTDSFKERMQQNHDDMDMTFSVMVLGTNFWPLNPPSHEFVIPAEILPTY # DRFQKYYQQKHSGRKLTWLWNYCKNELRTNYLNQKYILMTSSYQMAVLVQYNKNDTLSLEELIAATSIPKELMTQILAVFVKAKVLINEETDQYDLNP # GQCWNNRRAKLTPFKASSPRRSVSILISQSRLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g315 ### # start gene g316 5 AUGUSTUS gene 1832322 1833319 0.35 - . g316 5 AUGUSTUS transcript 1832322 1833319 0.35 - . g316.t1 5 AUGUSTUS stop_codon 1832322 1832324 . - 0 transcript_id "g316.t1"; gene_id "g316"; 5 AUGUSTUS CDS 1832322 1833185 1 - 0 transcript_id "g316.t1"; gene_id "g316"; 5 AUGUSTUS CDS 1833314 1833319 0.35 - 0 transcript_id "g316.t1"; gene_id "g316"; 5 AUGUSTUS start_codon 1833317 1833319 . - 0 transcript_id "g316.t1"; gene_id "g316"; # protein sequence = [MKKHTKLAGAVLRLIEQQRNGETIDQGLVKKVVDSFVSLGLDETDTNKACLDVYREHFEGPFITATEKFYKQESESFL # AEHSVSEYLKKAEERLKEEEDRVDRYLNTQTRKALIGKCEHVLIREHAPLMWDSFENLLDFDKDEDLQRMYALLSRIPEGLDPLRKRFEEHVKKAGLL # AVSKLAGEGTTEEALDPKAYVDALLEVHQKNSETVTRSFRGEAGFVASLDKACRDFANRNAATGNSNTKSPELLAKHADLLLRKNNKLAEEGDLEGAL # NRVVSYFVEVGTSTY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g316 ### # start gene g317 5 AUGUSTUS gene 1839709 1840419 0.58 - . g317 5 AUGUSTUS transcript 1839709 1840419 0.58 - . g317.t1 5 AUGUSTUS stop_codon 1839709 1839711 . - 0 transcript_id "g317.t1"; gene_id "g317"; 5 AUGUSTUS CDS 1839709 1840419 0.58 - 0 transcript_id "g317.t1"; gene_id "g317"; 5 AUGUSTUS start_codon 1840417 1840419 . - 0 transcript_id "g317.t1"; gene_id "g317"; # protein sequence = [MSLPTLRRSLARNRNFARCISSSSSSDPQHSKTTSFGFQTIPENAKESMVKSVFDSVASKYDLMNDAMSMGVHRLWKD # QFVGDLKPGRRGPMKCIDVAGGTGDIALRILDFAREKYADRETSVEVVDINEQMLKEGYRRFKKTMYHNSKFYSHGTLTQSLHVKLLAPQISFHEANA # QSLPKEKFRDNSYDLYTIAFGIRNVTSIPAVLDEAYRVLKPGATFACLEFNKVDNPLLGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g317 ### # start gene g318 5 AUGUSTUS gene 1844403 1844843 0.55 - . g318 5 AUGUSTUS transcript 1844403 1844843 0.55 - . g318.t1 5 AUGUSTUS stop_codon 1844403 1844405 . - 0 transcript_id "g318.t1"; gene_id "g318"; 5 AUGUSTUS CDS 1844403 1844843 0.55 - 0 transcript_id "g318.t1"; gene_id "g318"; 5 AUGUSTUS start_codon 1844841 1844843 . - 0 transcript_id "g318.t1"; gene_id "g318"; # protein sequence = [MDRREMFKRETDARADRSYCCKAKHSSLESIMLSVFQTHNTALLSPLAQHVVGIALDGKIIQGTVADVIMNNTILAAK # LIESETGSLKTYSKSFGEEQPMQKELHNSQGALVLAEEMEIGHVSWEACKLLVGCLVHEFIIPQSNCI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g318 ### # start gene g319 5 AUGUSTUS gene 1848782 1850791 0.66 - . g319 5 AUGUSTUS transcript 1848782 1850791 0.66 - . g319.t1 5 AUGUSTUS stop_codon 1848782 1848784 . - 0 transcript_id "g319.t1"; gene_id "g319"; 5 AUGUSTUS CDS 1848782 1849868 0.92 - 1 transcript_id "g319.t1"; gene_id "g319"; 5 AUGUSTUS CDS 1849963 1850048 0.91 - 0 transcript_id "g319.t1"; gene_id "g319"; 5 AUGUSTUS CDS 1850166 1850607 0.94 - 1 transcript_id "g319.t1"; gene_id "g319"; 5 AUGUSTUS CDS 1850700 1850791 0.73 - 0 transcript_id "g319.t1"; gene_id "g319"; 5 AUGUSTUS start_codon 1850789 1850791 . - 0 transcript_id "g319.t1"; gene_id "g319"; # protein sequence = [MPRRPSKKSKSAGKPRNTKRPDAKINKWNDRDQILLNNDEEEDDGDIDDDEVFALQMEDEEDEESEVMEENENQSSRA # SPKAAKSKQKATAKGKGKGKESQLESSDDDDEEEEETWGSGKAAYYSSNAAQIESDDEEALQLEEQEAKRLQAKARDDMNDEDFGLEDSIEANVTGGS # EYKTDPECLALAGDWTDSATTLMKTKQKLEKNDASTLSCVFAIILPNISPLILIQLAETLLTYTTTLAFYLYLRASQKYAQKPELLRSHPVMQRLLKL # KQSLITLEDLNFAVSDDDDSGDEEEEEENEDDIMQDARQLWEREHSNEDEDEDVDSDELDQLLADARSITNSNSNRVIIQPKAPALTHPPKKKRKTDS # ESEKSSLSMFDLVEPEFVSSKTTSSTSPYAAADAFGEATSLQHADAADKSARRKTLRFHTSRIESANARRSNARSNALGGDDDIPYRERKKDREDRLA # REAAARVRTQGGADLDDTEPEPRRPDDNDGDGDEEMEGANGYYDLVKKQVKEKKERKKAEYEASRADRYVVFLLLYPQRGLITCRVALWKKQAMDPGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g319 ### # start gene g320 5 AUGUSTUS gene 1852723 1853142 0.61 + . g320 5 AUGUSTUS transcript 1852723 1853142 0.61 + . g320.t1 5 AUGUSTUS start_codon 1852723 1852725 . + 0 transcript_id "g320.t1"; gene_id "g320"; 5 AUGUSTUS CDS 1852723 1853142 0.61 + 0 transcript_id "g320.t1"; gene_id "g320"; 5 AUGUSTUS stop_codon 1853140 1853142 . + 0 transcript_id "g320.t1"; gene_id "g320"; # protein sequence = [MDVAQVLANLVHNAQQGRTIALPGPSTLTYEYLLDLVSSLTFQPPSRAPVVPKSVALAVAKAAQAVWWPLLSPDEVVR # RYIDDADTPGDWDSVGVTPSEIEQHAIQYVRRYRSAENFSRPNVFPPRPVVSHVYSASTHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g320 ### # start gene g321 5 AUGUSTUS gene 1856980 1857713 0.86 + . g321 5 AUGUSTUS transcript 1856980 1857713 0.86 + . g321.t1 5 AUGUSTUS start_codon 1856980 1856982 . + 0 transcript_id "g321.t1"; gene_id "g321"; 5 AUGUSTUS CDS 1856980 1857150 0.86 + 0 transcript_id "g321.t1"; gene_id "g321"; 5 AUGUSTUS CDS 1857285 1857713 0.99 + 0 transcript_id "g321.t1"; gene_id "g321"; 5 AUGUSTUS stop_codon 1857711 1857713 . + 0 transcript_id "g321.t1"; gene_id "g321"; # protein sequence = [MWIVLFNALDEFGVKELNENDRSGSPPENVQNRGYIEDAMRRVGEEALNGALRIAALKLDPAVVEFHIIAAGHLLARF # GRPEVATCIDGLKQYSHSYEEAGEHAQDIRKTYEQVRNSGVDLNHMAALVKQIAAFPTTTTEPEILPGGHEPMSPSVLGSFQMNGMSNMDGTGILMDV # DEESTAFVAAHKNEVCASQTSRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g321 ### # start gene g322 5 AUGUSTUS gene 1858943 1860202 0.9 + . g322 5 AUGUSTUS transcript 1858943 1860202 0.9 + . g322.t1 5 AUGUSTUS start_codon 1858943 1858945 . + 0 transcript_id "g322.t1"; gene_id "g322"; 5 AUGUSTUS CDS 1858943 1860202 0.9 + 0 transcript_id "g322.t1"; gene_id "g322"; 5 AUGUSTUS stop_codon 1860200 1860202 . + 0 transcript_id "g322.t1"; gene_id "g322"; # protein sequence = [MANEKRRSWRLSISSSTGTECQESDGQHDADISTSPSITSSHKRRWSLTPNFSKNLPLNSIDGPSDHALERISSTQPS # ITKEGSRTGSFGKSLSSMMGGIPGLSNLTLSRTSTKDSVTNNEDARGRSMSKNKHYRSSSHVPSTTETTSKSHSRARSQSPFSFRRFRSQRDSSPVPP # LPLSSTSSEVSLVPDTNPSPNIRPRTAFTDDADVLDYGSGDETETVNGETDGEYTEDEDSGDEIDIFDDVTERNTERNAVVELPAAGALGLYDADADI # DPDPLGEGVNVVVPPEPYFPSTIHSLPSRTPSGTKRNARRRKSTKHHEPLPLNTSRPLFQRDRCTITMIQGDPEGKAATTDRKKKKYIVASDLSEESR # YAVEWGIGTVLRDGDEMLVVTIVENENRGKFHLQFAFIFVKLVLLRM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g322 ### # start gene g323 5 AUGUSTUS gene 1860615 1860938 0.84 + . g323 5 AUGUSTUS transcript 1860615 1860938 0.84 + . g323.t1 5 AUGUSTUS start_codon 1860615 1860617 . + 0 transcript_id "g323.t1"; gene_id "g323"; 5 AUGUSTUS CDS 1860615 1860938 0.84 + 0 transcript_id "g323.t1"; gene_id "g323"; 5 AUGUSTUS stop_codon 1860936 1860938 . + 0 transcript_id "g323.t1"; gene_id "g323"; # protein sequence = [MVARRRLKRPPRKSAHLATHRVHVSLADAGIDRVAAKVDEDVKQMRDQIQRDDAQRSGTVHKDPGAEAALEREAREER # IDEDGDEGDEEVDDEAAGVKVAGTASLQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g323 ### # start gene g324 5 AUGUSTUS gene 1862920 1863273 0.46 - . g324 5 AUGUSTUS transcript 1862920 1863273 0.46 - . g324.t1 5 AUGUSTUS stop_codon 1862920 1862922 . - 0 transcript_id "g324.t1"; gene_id "g324"; 5 AUGUSTUS CDS 1862920 1863273 0.46 - 0 transcript_id "g324.t1"; gene_id "g324"; 5 AUGUSTUS start_codon 1863271 1863273 . - 0 transcript_id "g324.t1"; gene_id "g324"; # protein sequence = [MELDILSSPNGMNASVQSLSRLNRVYNQNDSNHGGITQIPDLQKAPQNAVESTLEYDLGNGDKAISQYKGREYIQLAA # LYWCMFLAGWNDGSTGPLLPRIQEVYNARRQLDVFGIII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g324 ### # start gene g325 5 AUGUSTUS gene 1871832 1872924 0.39 - . g325 5 AUGUSTUS transcript 1871832 1872924 0.39 - . g325.t1 5 AUGUSTUS stop_codon 1871832 1871834 . - 0 transcript_id "g325.t1"; gene_id "g325"; 5 AUGUSTUS CDS 1871832 1872325 1 - 2 transcript_id "g325.t1"; gene_id "g325"; 5 AUGUSTUS CDS 1872393 1872924 0.39 - 0 transcript_id "g325.t1"; gene_id "g325"; 5 AUGUSTUS start_codon 1872922 1872924 . - 0 transcript_id "g325.t1"; gene_id "g325"; # protein sequence = [MSWGSTGSVKASFSVDGYSTSQTFTANTAANNGLTNSTNYPFYSNTSLSSGNHTLTVNVTSVSGNLPFIIDYLTYQPN # FDNIDSKPNFTAQAGIGSSTGPDSNPGSSAGSTSSDTTSKSHAGAIAGGVIGGLLAIAAILGAILLWRRRSRFDKPKYSARGRANVLDSNERLMVETP # GNILYPMQHLAQDLKLVSGPPKALSTEMHSGSDYTSASGATTPTAPGSDSSGPLTVNEKQTELRRRLDEIASLMQQMEVQTSADSSSSAPVKGSGDSN # VLDLQARIDRLTRENERLMETYVVPPAYEGVEGTTTTGESVLGEHVPGNARNEKRILRLAYEPRDSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g325 ### # start gene g326 5 AUGUSTUS gene 1876255 1877202 0.93 + . g326 5 AUGUSTUS transcript 1876255 1877202 0.93 + . g326.t1 5 AUGUSTUS start_codon 1876255 1876257 . + 0 transcript_id "g326.t1"; gene_id "g326"; 5 AUGUSTUS CDS 1876255 1877202 0.93 + 0 transcript_id "g326.t1"; gene_id "g326"; 5 AUGUSTUS stop_codon 1877200 1877202 . + 0 transcript_id "g326.t1"; gene_id "g326"; # protein sequence = [MTVHEPSSKCTLMANTPQADIELLLADSLTSKILQKQSVTLDKDRAHIRLRYSRQMHSLEISQCVTGPQGKEWRKRTL # GISSLDPAIEPALSNFTNAEAEGLSRLSKFLRVCVSLEEEETIYGQEHDTTVLARSLNPDLVANSLVFKNPHVTNRVASSSRTLAQSFSVSSVDLRLA # PRPPKFSSMSKRLAQDDQELEDIITPPEKQFREIDYSTKALSLTASDITPSWYRNGFCSTELIASTQPLQTRYIPSAGWCIRYDSKVSQGGRYKVMFL # DGEILDIDVDEEWVEHIVPDLDGTGKKQRYVFVLSMLLMKH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g326 ### # start gene g327 5 AUGUSTUS gene 1877733 1878173 0.47 - . g327 5 AUGUSTUS transcript 1877733 1878173 0.47 - . g327.t1 5 AUGUSTUS stop_codon 1877733 1877735 . - 0 transcript_id "g327.t1"; gene_id "g327"; 5 AUGUSTUS CDS 1877733 1878173 0.47 - 0 transcript_id "g327.t1"; gene_id "g327"; 5 AUGUSTUS start_codon 1878171 1878173 . - 0 transcript_id "g327.t1"; gene_id "g327"; # protein sequence = [MDLIENVNLATSNQYSLHAGSSSCVQSSSATSNQTGTTTSTNCTVVPSEDENTGCVVEDTQSDSFGAGFAENNGGVYA # VLWDESGIAMWFFNRSSVPSDISSSQPDPTSWSTASAWYPASGCSPSSVFGPQTITLVCVQWTSCYDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g327 ### # start gene g328 5 AUGUSTUS gene 1880460 1881209 0.7 - . g328 5 AUGUSTUS transcript 1880460 1881209 0.7 - . g328.t1 5 AUGUSTUS stop_codon 1880460 1880462 . - 0 transcript_id "g328.t1"; gene_id "g328"; 5 AUGUSTUS CDS 1880460 1881209 0.7 - 0 transcript_id "g328.t1"; gene_id "g328"; 5 AUGUSTUS start_codon 1881207 1881209 . - 0 transcript_id "g328.t1"; gene_id "g328"; # protein sequence = [MLKSTLFWFCALISTIHATLVTDVQGIAFQSPFAGKSVSNVTGVVTAKTSGGFYISGTSSSDVRASNGLFIFSETTTV # LNKVAVGDMVSVTGTVSEFRSSSDPDDLTATEITSPTAANVVVLSTSNTVSPVKLGTDRIPPTQALSALDVGPDGWLSVPNNQSRVDTVNATLVPADY # GLDFWASLEGQLVTVPSPLSVAFPNDFGEFWVVGDWPVTGLNSRGGLSITIGKYDFVPFSLTSNLFLVSNRPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g328 ### # start gene g329 5 AUGUSTUS gene 1887582 1888442 0.76 + . g329 5 AUGUSTUS transcript 1887582 1888442 0.76 + . g329.t1 5 AUGUSTUS start_codon 1887582 1887584 . + 0 transcript_id "g329.t1"; gene_id "g329"; 5 AUGUSTUS CDS 1887582 1888442 0.76 + 0 transcript_id "g329.t1"; gene_id "g329"; 5 AUGUSTUS stop_codon 1888440 1888442 . + 0 transcript_id "g329.t1"; gene_id "g329"; # protein sequence = [MLIQTSYQHSASNDTESIEGWTFIFPAGWSMAFFQQLTYTGTRVAGQRERQTQAFEAGTPYFPSDYPSTSAYKTHISA # RAEKEKAKWARTPAAKRVNYRKLGTRSPWIPDWEVVLGLKEMPDELLDDDDDDEENVDDVEDMQDLITTQREPEQSLEQQREDFLVDDDPAVGPWLLR # GVEISSIVSDLSEDLVPSQSLLATLNRLRAKRSLEPLESTIKPDNLLKSALVSVRITICSKGSPSDLSLVYSIPDPELQEWRKGLTRAGVDPIPAEVE # FVNVSTMIALSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g329 ### # start gene g330 5 AUGUSTUS gene 1888895 1889638 0.87 - . g330 5 AUGUSTUS transcript 1888895 1889638 0.87 - . g330.t1 5 AUGUSTUS stop_codon 1888895 1888897 . - 0 transcript_id "g330.t1"; gene_id "g330"; 5 AUGUSTUS CDS 1888895 1889638 0.87 - 0 transcript_id "g330.t1"; gene_id "g330"; 5 AUGUSTUS start_codon 1889636 1889638 . - 0 transcript_id "g330.t1"; gene_id "g330"; # protein sequence = [MDRIPGSPSPQKVKPPFTTSNAHIPRAPSSPSKLPLPGSSRTRVPSSSTFNPILPAKNPSYPRIVHHTHTSSATYRPP # RKDEQMLSLNGSPLANPFWTDGLLPPDSRSSGDMGEPRTLKRTQSNISIRRDPSFVSGLPPRADSQSSFYPGTSSKPHSRNNSDATLAESTTGPYSGL # PKTSFETPYAPTKKYMVTISTKDGHILEFDPLQTSPKALDALEGITDSAKKQAREEMGRLVEAAVDKWKIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g330 ### # start gene g331 5 AUGUSTUS gene 1890935 1891926 0.81 + . g331 5 AUGUSTUS transcript 1890935 1891926 0.81 + . g331.t1 5 AUGUSTUS start_codon 1890935 1890937 . + 0 transcript_id "g331.t1"; gene_id "g331"; 5 AUGUSTUS CDS 1890935 1891041 0.81 + 0 transcript_id "g331.t1"; gene_id "g331"; 5 AUGUSTUS CDS 1891092 1891926 0.94 + 1 transcript_id "g331.t1"; gene_id "g331"; 5 AUGUSTUS stop_codon 1891924 1891926 . + 0 transcript_id "g331.t1"; gene_id "g331"; # protein sequence = [MDAYNESKQKAEEAVIAANGKDGLLTVALRPAGIFGPGDRQVMAGLYKVYEDGKTHFQIGDNTNLFDWTYVENVAHAH # LLAADKLDVPPPAPPFSTLENIPLEAPPLTEAELEITTRPLPPLDLTVGRRSIPTSEARPLGPYVTPPPDAEKLVAAFEEKREKPEGRPVVRTRFDPL # SEPNLFRAKFDNPDSTPLQVAGQVFYITNGEPCYFWDMPRLVWNHLDTMFPGHRQKRGYTVLSASLGLALAFGAECWGWVIGKEPALTKFKVTYSCVN # RFHNVEKTRRVLGYEPQVGLADGVQRMVDVCACYNYSCA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g331 ### # start gene g332 5 AUGUSTUS gene 1896085 1896741 0.97 + . g332 5 AUGUSTUS transcript 1896085 1896741 0.97 + . g332.t1 5 AUGUSTUS start_codon 1896085 1896087 . + 0 transcript_id "g332.t1"; gene_id "g332"; 5 AUGUSTUS CDS 1896085 1896741 0.97 + 0 transcript_id "g332.t1"; gene_id "g332"; 5 AUGUSTUS stop_codon 1896739 1896741 . + 0 transcript_id "g332.t1"; gene_id "g332"; # protein sequence = [MKLKSLRWLGESTTSPSAKVIIRHSLGAFTQETSDNDNLYTFDALRILYGYRSMVDLIVECIDLFQVVDVQDNDQLDY # LEGQVRACILYSNCRLNFYQMKLDPKIPIPDITVALTLLSAGVIEVPISYDGKTIMLQRDDVLPWILDIYRQSNYDRESELQLPALVWNSLFDWYRDK # VGMEVVRQTLHGYLGAHEEYTSNSILEATQYLSDAIYFRYMD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g332 ### # start gene g333 5 AUGUSTUS gene 1898770 1901463 0.36 - . g333 5 AUGUSTUS transcript 1898770 1901463 0.36 - . g333.t1 5 AUGUSTUS stop_codon 1898770 1898772 . - 0 transcript_id "g333.t1"; gene_id "g333"; 5 AUGUSTUS CDS 1898770 1901463 0.36 - 0 transcript_id "g333.t1"; gene_id "g333"; 5 AUGUSTUS start_codon 1901461 1901463 . - 0 transcript_id "g333.t1"; gene_id "g333"; # protein sequence = [MDVMMSMRAQAVISPTTNTTSPTRSTFSSQDSTGNGYPISPASPTTPTAGSHSVSGHDAASVSSTRSSKRARPSSSHG # KSPSVAGIGSGAVLSLKGLFGSKTAVGHTSGRQRSSSRASGVDEWDDPPNPRGARVERTESVVSVGSSKSSVIPKGNNLISILRATSPPNEGSTVGFI # SSGSGMGVHAPAVDFSALGIHSSPAQTPQSQLDRKILQRPLAHDDHDGSMTARPLLFGNDTAAPFDTAAGGTREDRRTPRTLSVGETFSLQPPPRKRW # TSTSDVHTPPVLNTPSSHQLQLQESPFIKDRRNLDDFDVLGGAPSISRLNTSGSGSLTPEPPTNSSPATKRTSGQSAFSFSFGTPPGSGNLDVEYRPR # SLSSRSARSARSGQSVRSGDTAEEELEELDVPVSGFDGHSSSSRTRRASGGSGFGSSPDVDKRSSMSSGKRNSVGVSQGKRWSRQLPKRLTPPSGPPP # AAPSTPPSSPAHSVIKGTNQSPVKSLPKILPTHPYSGAATEQRASMMTTRSTRSTSSRPSSSHSSVVSNLPSFSKRASASSAMSVLSTTSLQASGTTT # PVSSGTHAVGNGITGHTRPTSSHRSSLAPPPRPAPTFALPPAPGEASVPPMLTPPMSAPVSSTNNKSSFRDSITSRAFRLSLMAPKPPPSGVLPPRPD # ELEHPKSPTSSIASRNTHRRSQSGNNSPLSGGPGSLYSIPGSPVPPSAMDAVHVTRGPLPPTPVSGVPASTPSRGVSIKQRLRILSAPSPSSAPPASP # RSSTRPTTIMAPLTGASPPGTPTFAHGLTHYFENSGSFHAVATPTTPSLPAPKIHHVEDEPDVEPELTSLSPPPRRGSKRISLPEVEAPPAIPEDEPS # PLQRMPIEDNRPNDTNKPFSLSRPASVISFGVVNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g333 ### # start gene g334 5 AUGUSTUS gene 1901555 1902772 0.57 - . g334 5 AUGUSTUS transcript 1901555 1902772 0.57 - . g334.t1 5 AUGUSTUS stop_codon 1901555 1901557 . - 0 transcript_id "g334.t1"; gene_id "g334"; 5 AUGUSTUS CDS 1901555 1902772 0.57 - 0 transcript_id "g334.t1"; gene_id "g334"; 5 AUGUSTUS start_codon 1902770 1902772 . - 0 transcript_id "g334.t1"; gene_id "g334"; # protein sequence = [MSGSTSTPTSPSSKRSSVLSTASSSSRNSALLEFSPFKFGRKKKLPPPRQNPNLRMNLILPDVLEISAANSLSTPPAG # EDADPMEDEETRERVRLREEAAQALGLSIAGHQNHSDDYSESGHSVASNGTLRIREEDRTTEILDQADGELPTLNNNHHYQPSPLTSTTSLHPPLSPT # STHGRNRSGSMPPAFPYHPSALPPSLQQNSNQAPLPLVTAVPSFPSTPRALASFIQTASSGTLPKYYPSSSLRIFAMSKQWKSRHLVLTSPTNVPSGS # NSLPLTFVSGSSTSHVHVSYLHLFKSASPDEREMERLEITEDSVVFISEEEIGGKKGVVQVAGVDVGFVSDGKKAGSSKKDSAKTKDKEQVKGREQAM # WLFHIADPLEKQRWIESIKNKVFGQRCVLSSLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g334 ### # start gene g335 5 AUGUSTUS gene 1904378 1905349 0.31 - . g335 5 AUGUSTUS transcript 1904378 1905349 0.31 - . g335.t1 5 AUGUSTUS stop_codon 1904378 1904380 . - 0 transcript_id "g335.t1"; gene_id "g335"; 5 AUGUSTUS CDS 1904378 1904663 0.48 - 1 transcript_id "g335.t1"; gene_id "g335"; 5 AUGUSTUS CDS 1904967 1905011 0.32 - 1 transcript_id "g335.t1"; gene_id "g335"; 5 AUGUSTUS CDS 1905165 1905349 0.48 - 0 transcript_id "g335.t1"; gene_id "g335"; 5 AUGUSTUS start_codon 1905347 1905349 . - 0 transcript_id "g335.t1"; gene_id "g335"; # protein sequence = [MKDLILADFGKRNSVNIASLTVSEIRDIILGQEIAAPSVQRQQMAELEKSSEAQAQVTAIQTYQLRAAGVQQQVGLAV # ELPSQLPKDDFLLKDLEPLGWIKTQALEIPHLSPTDVTTQAKIMADHPEWTSSSICITASFTPGSVSLSAHSLSVAGFEWGRKNADNSANPPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g335 ### # start gene g336 5 AUGUSTUS gene 1908047 1909003 0.78 - . g336 5 AUGUSTUS transcript 1908047 1909003 0.78 - . g336.t1 5 AUGUSTUS stop_codon 1908047 1908049 . - 0 transcript_id "g336.t1"; gene_id "g336"; 5 AUGUSTUS CDS 1908047 1909003 0.78 - 0 transcript_id "g336.t1"; gene_id "g336"; 5 AUGUSTUS start_codon 1909001 1909003 . - 0 transcript_id "g336.t1"; gene_id "g336"; # protein sequence = [MAGPPQMPNNFLQYRDSATETRHPIRLYSRYVDRLHILFRFTADESRDLIQRYLSANPDPTNNNVIGYNNKRCWPRDC # RMRLIKHDVNLGRAVFWNVKQSLPRSLTTIEWEDTFVSVYSKDNPQLLFSMCGFEVRILPKIRTMSGEQFSLKDAVWNLTNEQTKERTAQAFLRVSDD # GLLIYSFLTLLLTLIQGVQQFNNRIRQVLMSSGSTTFSKIVNKWNTALIGLMTYYREAVIHTNELLDSLVKAENKIQTRVKIGLNSKMPSRFPPVVFY # TPKELGGLGMLSMGHVLIPQSDLRWSKQTDVAGKTHPNFLNVNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g336 ### # start gene g337 5 AUGUSTUS gene 1911276 1912667 0.81 - . g337 5 AUGUSTUS transcript 1911276 1912667 0.81 - . g337.t1 5 AUGUSTUS stop_codon 1911276 1911278 . - 0 transcript_id "g337.t1"; gene_id "g337"; 5 AUGUSTUS CDS 1911276 1912667 0.81 - 0 transcript_id "g337.t1"; gene_id "g337"; 5 AUGUSTUS start_codon 1912665 1912667 . - 0 transcript_id "g337.t1"; gene_id "g337"; # protein sequence = [MSNRKFRNDKRVHLGALKYVPHAVMKLLENIPYPWEQVREVPVLYHITGAITFVNEIPRVIEPVYHAQWSTMWLAMRR # EKRDRRHFKRMRFPPFDDEEPPLDYGDNVLDVEPLEAIQLELDTEEDAAIIDWFYDPKPLIDTPAVNGSSYKYWSLSLPVMANLYRLGRTLLSDQPDR # NASYLFDKKSFFTAKALNVAIPGGPKFEPLYRDMDSFDEDWNEFNDINKVIIRQQIRTEYKVAFPHLYNSLPRSVRISPYHTPKNVYIRTDDPDLPAF # YFDPLINPISNRGTTPKNMPLVSHEDSIFGPNGAEDDEFELPEDITPFLEDKDLENDLTADGIALWWAPEPYSRRSGRMRRAQDIPLVKNWYLEHCPP # NMAVKVRVSYQKLLKCYVLNELRTRPEKAMAKKNLFRQLKATKFFQTTKLDWVEAGLQVCRQGYNMLNLLIHRKNLNYLHLDYNMNLKPVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g337 ### # start gene g338 5 AUGUSTUS gene 1916472 1916765 0.98 - . g338 5 AUGUSTUS transcript 1916472 1916765 0.98 - . g338.t1 5 AUGUSTUS stop_codon 1916472 1916474 . - 0 transcript_id "g338.t1"; gene_id "g338"; 5 AUGUSTUS CDS 1916472 1916765 0.98 - 0 transcript_id "g338.t1"; gene_id "g338"; 5 AUGUSTUS start_codon 1916763 1916765 . - 0 transcript_id "g338.t1"; gene_id "g338"; # protein sequence = [MKFRDSTTSDVVGRVPSETGDEDVPLEGKSAQADEQEDNHSRPSKEGEENEDLHLGASSSEKDPKTRKSTRGIEGFEK # WERDEMEALLGELNGHLGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g338 ### # start gene g339 5 AUGUSTUS gene 1916931 1917908 0.25 - . g339 5 AUGUSTUS transcript 1916931 1917908 0.25 - . g339.t1 5 AUGUSTUS stop_codon 1916931 1916933 . - 0 transcript_id "g339.t1"; gene_id "g339"; 5 AUGUSTUS CDS 1916931 1917570 0.57 - 1 transcript_id "g339.t1"; gene_id "g339"; 5 AUGUSTUS CDS 1917691 1917908 0.25 - 0 transcript_id "g339.t1"; gene_id "g339"; 5 AUGUSTUS start_codon 1917906 1917908 . - 0 transcript_id "g339.t1"; gene_id "g339"; # protein sequence = [MREHLGVDVDAIYEEDLMANEPRKAEHEQEAWDPESQQQYGKEEGVTKLSKAHQRTPAGALLRDGIDGFRQGEDTAGK # ATNAALREERQMFTRDGEKVEGFPSSIVPTLEEKTVMEHRPPGAEADDKPIADKLSEGTLSGSDGKSETEDSSTESSPLKGDSTLQNISNTEVTNRTP # EDPRVDEELLGAPANASISPQTDNQPPQARSHVDDADEQERAAPRARSMIRKQLTSKLGSKWTLPTPRPKVDPQAFDDPICDVFWKDVWVASSVHNVC # AMSILVQPERH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g339 ### # start gene g340 5 AUGUSTUS gene 1920310 1922385 0.74 - . g340 5 AUGUSTUS transcript 1920310 1922385 0.74 - . g340.t1 5 AUGUSTUS stop_codon 1920310 1920312 . - 0 transcript_id "g340.t1"; gene_id "g340"; 5 AUGUSTUS CDS 1920310 1920815 0.77 - 2 transcript_id "g340.t1"; gene_id "g340"; 5 AUGUSTUS CDS 1921374 1922385 0.97 - 0 transcript_id "g340.t1"; gene_id "g340"; 5 AUGUSTUS start_codon 1922383 1922385 . - 0 transcript_id "g340.t1"; gene_id "g340"; # protein sequence = [MAHIDVVDLVDQLKEHRQHESEIENHNEPPAPPQDSPHPSQIDLPHNHAHFRPPPTTPSMRTGPPRSLSYVYSLPNSP # AGSRANSKLESGEPKLTNHEEEEGNGFPFSDSQNTPFRGALETGNGSFSSDRKGKKRESRLLEESWNPMKWFHESPKDENAPDSPFGREDGAQAIPDD # DRIGPSLRRVKTEELAPSPETQKAGRVKWGRLRSLLPQVANQNPSSGPGPSAVTSSAVNITDELITGGLSTLMLRLWFEHDEKGHRRVPVLLHRLRLR # VSDSLHPLQGHKSVFRIECEYANGAARWVIYRQLRDFISLHTHYAVSNAYNRNVDGLPEFPRTNPDFTIERPKRYYRQGLSLLHPDSLSDEKAENDAD # NRRMSVNTDTEHMSLMGSIRGHFSQVLHFGNHTRARTTSNVGRQDDHDDDTSSISSRSSVSSRVATPMLDPSTHVNPLGPAEDENMGEEHPWSNNKKK # KKANVHEVSKHTFFITNSQMRWKLFARNQVCGNDM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g340 ### # start gene g341 5 AUGUSTUS gene 1922767 1923540 0.78 - . g341 5 AUGUSTUS transcript 1922767 1923540 0.78 - . g341.t1 5 AUGUSTUS stop_codon 1922767 1922769 . - 0 transcript_id "g341.t1"; gene_id "g341"; 5 AUGUSTUS CDS 1922767 1923540 0.78 - 0 transcript_id "g341.t1"; gene_id "g341"; 5 AUGUSTUS start_codon 1923538 1923540 . - 0 transcript_id "g341.t1"; gene_id "g341"; # protein sequence = [MLSLFGGDCFAIAQGVGAKLVGDWASCHSTTWDFNAPEIGARDLTNQFTKSGYPLGVMVNGNGERFVDEGEDYRNYTY # ARFGKAILSQPGGFAFQVWDSKMLDILRKEEYGDGVVEKVYADNIEDLARKLAEVGLTDQVKFIETFQVYNAAVTQHKLENPDWHWDPAVKDGLSTQS # SHLSLSPPKSHWAESIDKPPFMAVKVCCGITFTFGGLAIDPESASVLSESGPIPGLFCAGEMVGGLFYKNYPVCRCYYTSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g341 ### # start gene g342 5 AUGUSTUS gene 1923642 1924434 0.71 - . g342 5 AUGUSTUS transcript 1923642 1924434 0.71 - . g342.t1 5 AUGUSTUS stop_codon 1923642 1923644 . - 0 transcript_id "g342.t1"; gene_id "g342"; 5 AUGUSTUS CDS 1923642 1924255 0.73 - 2 transcript_id "g342.t1"; gene_id "g342"; 5 AUGUSTUS CDS 1924350 1924434 0.88 - 0 transcript_id "g342.t1"; gene_id "g342"; 5 AUGUSTUS start_codon 1924432 1924434 . - 0 transcript_id "g342.t1"; gene_id "g342"; # protein sequence = [MYYDCIVVGSGNAGSCAALSAKENGCQKDWVGGNGYFTAGAFRTVHNGLDDLLPIVQNVTPEQAKHIDLNPYSHKDFI # EDIMRLGGRRSDPGLAASVVNNSRDTVDWLAGHQVPFILSFNRQAYEVDGRQKFWGGLVLSVSDGGKGLIAAEHKALGKAGVEIWFDCPLVNLLMRDN # AVSGVVVRKDGSELTIESRAVILAAGGFEASSELRIAHLGVGWEKAKVRMGSYYSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g342 ### # start gene g343 5 AUGUSTUS gene 1931035 1933293 0.9 - . g343 5 AUGUSTUS transcript 1931035 1933293 0.9 - . g343.t1 5 AUGUSTUS stop_codon 1931035 1931037 . - 0 transcript_id "g343.t1"; gene_id "g343"; 5 AUGUSTUS CDS 1931035 1933293 0.9 - 0 transcript_id "g343.t1"; gene_id "g343"; 5 AUGUSTUS start_codon 1933291 1933293 . - 0 transcript_id "g343.t1"; gene_id "g343"; # protein sequence = [MTLQEYISSRPKACHKVHIATLLRLLKEAVKSNNKLAVGYVAADILHLRADPERNRALRHLILDTEHRLIWPNTILAI # LNALAWGSQLDKFTDYHLKTLAHRITVERERTPFAGDFSVLLHSNIMRRLELLHRVPVGARSVSYELPDIVEAAFELLSYLLLLKNESLILELFQALT # EKLFIPPEAVQQAPTTSTDFYYIVSVTLSRACLYWYKRGLAHRLLLRYLPSGVDLTTAIRQKNASLNSPTPSPADEQSIEEPQQSLDPQLLDLITDTL # YATLRNPNLFELELCVDVISRVHLLAPIQGGIIRLVYTAATECNSGNVARRLYAFTREPAIEKEHHYPGPQGRAILFLMAFLTQEKGNTHLARVLANE # VVENDTFLPVNDRPKFLTLVASQSFGKATRTLWERYAIGKDKASVVGYNALLTRIVRLFTRMARLIEADLPDNGEDASDTLQNEQLGDSSINIGWEVN # HAGSNHEASSNASQRGDPNGKPSVAELSERAKDIRLFVQRVIEAFVQVHEPLAHAKHANLSSLARAYFVIGDFTKGFEVFRNLIRRREVPDLHDINIG # LSALAEHNPRSAARMIEVMTQRGIQPNSVTFGTVIHQALVHGDMQLVGDLLQLARQAGNIQLSPQGLFSLTRASVILEDGSGTRKNAPLKDALELFKS # LPDNGRLSSPDMGKFMVFAALREGEPVLAFEFWKLLLKYSSEWDDQEQIFVRRLLRRSIIQTLGSGMSRSNMLNQLWERPPYHAMK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g343 ### # start gene g344 5 AUGUSTUS gene 1936420 1936674 0.45 + . g344 5 AUGUSTUS transcript 1936420 1936674 0.45 + . g344.t1 5 AUGUSTUS start_codon 1936420 1936422 . + 0 transcript_id "g344.t1"; gene_id "g344"; 5 AUGUSTUS CDS 1936420 1936674 0.45 + 0 transcript_id "g344.t1"; gene_id "g344"; 5 AUGUSTUS stop_codon 1936672 1936674 . + 0 transcript_id "g344.t1"; gene_id "g344"; # protein sequence = [MPPLPIHAKPSSSMEYESWSEASGPETAVPGSHTPDRYQMNEEDEDYISPSQETPRRSSPLSHASPPNFKRASNSLSG # TFMNGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g344 ### # start gene g345 5 AUGUSTUS gene 1942783 1943721 0.23 + . g345 5 AUGUSTUS transcript 1942783 1943721 0.23 + . g345.t1 5 AUGUSTUS start_codon 1942783 1942785 . + 0 transcript_id "g345.t1"; gene_id "g345"; 5 AUGUSTUS CDS 1942783 1942927 0.27 + 0 transcript_id "g345.t1"; gene_id "g345"; 5 AUGUSTUS CDS 1943138 1943721 0.52 + 2 transcript_id "g345.t1"; gene_id "g345"; 5 AUGUSTUS stop_codon 1943719 1943721 . + 0 transcript_id "g345.t1"; gene_id "g345"; # protein sequence = [MANIAFKANALFDLTGRIAMVTGGGTGIGYMIARGLAANGAKVYITGRPFLYAYIRAAAKSFVSAGQVGPTSPFLTDP # NAPEVKDGESFGSALFKEDQQGWSDLYSINVFSIFFTTTAFLGLLEKGTKESNIPGYTSSVINITSISGVIKLAQDHVCDMNLDTQKLTFIRHDQFCY # NSAKAAASHLTKMLSTEFALKKIPVRVNSIAPGVYASEMTTDTISAEEVDKIGKGITPVPAQRDGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g345 ### # start gene g346 5 AUGUSTUS gene 1944533 1945374 0.47 - . g346 5 AUGUSTUS transcript 1944533 1945374 0.47 - . g346.t1 5 AUGUSTUS stop_codon 1944533 1944535 . - 0 transcript_id "g346.t1"; gene_id "g346"; 5 AUGUSTUS CDS 1944533 1945154 0.76 - 1 transcript_id "g346.t1"; gene_id "g346"; 5 AUGUSTUS CDS 1945364 1945374 0.48 - 0 transcript_id "g346.t1"; gene_id "g346"; 5 AUGUSTUS start_codon 1945372 1945374 . - 0 transcript_id "g346.t1"; gene_id "g346"; # protein sequence = [MLQSYDSCDLGTYPNQTNKAGTSPEGALTGNSGNPISYLPGQRWSACTCSGGDHPGPSVSTGRGVPEIDIIEAQIDVN # NDFKGQVSQSFQIAPFNYDYQIDNSTTTFYDDTLTEFNSYQGGQYQQAVSALTYIPDTAYGNQTFIKYGYEWWSNPDSRSEGYITWYSNGEESWTLPA # SAIGADSVTEISNRLIPEEPMVCTNIRLDAPSCH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g346 ### # start gene g347 5 AUGUSTUS gene 1945641 1946447 0.87 - . g347 5 AUGUSTUS transcript 1945641 1946447 0.87 - . g347.t1 5 AUGUSTUS stop_codon 1945641 1945643 . - 0 transcript_id "g347.t1"; gene_id "g347"; 5 AUGUSTUS CDS 1945641 1946447 0.87 - 0 transcript_id "g347.t1"; gene_id "g347"; 5 AUGUSTUS start_codon 1946445 1946447 . - 0 transcript_id "g347.t1"; gene_id "g347"; # protein sequence = [MSNPPSRRAPQQQGPSQYAAVPQSPRSSALRPPAPGTRGSQQALTQSVQSGAIGGGYGPYSVCITFSLLLSIFLKLLQ # YNPNQARDAAMYSNSRFSAAPSEHSASSISASAEKAAILATTATVPNYLWDKDPDLDDALHNPDPVRDAKLDRSFTFFSARGWANAGALFILILAIIT # LFAGYPIIDNFAHPQATITGFNLGGINGTGQIPDLPGMPSLIDTDTPSSAYSRTGSDGKTYNLVFSDEFNKEGRTFYPGDDPYWEAVDLHYW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g347 ### # start gene g348 5 AUGUSTUS gene 1948817 1951420 0.26 + . g348 5 AUGUSTUS transcript 1948817 1951420 0.26 + . g348.t1 5 AUGUSTUS start_codon 1948817 1948819 . + 0 transcript_id "g348.t1"; gene_id "g348"; 5 AUGUSTUS CDS 1948817 1950190 0.26 + 0 transcript_id "g348.t1"; gene_id "g348"; 5 AUGUSTUS CDS 1950770 1951420 0.63 + 0 transcript_id "g348.t1"; gene_id "g348"; 5 AUGUSTUS stop_codon 1951418 1951420 . + 0 transcript_id "g348.t1"; gene_id "g348"; # protein sequence = [MSIDLTLDRIERLYRLIQAYTRPTIHIAGTNGKGSVSALTSSILTAAGLSVGRFNSPHLITIYDCIYVNNQEVSPQTY # HEARDNVEGVAHDNSIEISSFEMLVLTALLIFERVKVDIVVMEVGMGGRLDATNVIPDEVVMISALTAVDLDHQAFLGDTVAAITKEKASIARRGKPF # VMGPQKHSEVAEVARMVVQEAGGDFFSAPSALQMPSEDQRRPESYSQFQPPSPCPIELNMPCFRDPFNALLPLHGSHQLENVGLSAFIISVAVDYPSC # SSLGLRDRVTPQVVVRGIANVSWPGRLSFHPIPKNLHDPCSPKALVLADGAHNPASSTTLSRYLMDYCNSPAAPNATTAITYILSLSHSPPKTPLQTL # SPLLPPSLPSNLKVRVAVLRFASPEGMPWVKSVLPSVLYSVVQSLCPKAELWKGDDDRTDNLSAALQWATSSSDPNLVVVAGSLYLLTDLFPALVAKD # PQQDITLIPNEDDAHEAESFFNPAPLKPKNLRNTPKETPVTLISSEEEDEGPSAHLNGSVSGPPDGKHSAWLQKKVSRKLSSPGHSTRSSEVEDISEF # SDSEVKPGQPGKIGYVKEQARKLDRNEQANLNRKMAVARVATVPHLDLKQLPNVKNGMKPRTTVKVRSCIPGCFIRLMIRTAIKANCHRSNCYFLYTV # YKQLEDKQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g348 ### # start gene g349 5 AUGUSTUS gene 1952835 1953611 0.78 + . g349 5 AUGUSTUS transcript 1952835 1953611 0.78 + . g349.t1 5 AUGUSTUS start_codon 1952835 1952837 . + 0 transcript_id "g349.t1"; gene_id "g349"; 5 AUGUSTUS CDS 1952835 1953611 0.78 + 0 transcript_id "g349.t1"; gene_id "g349"; 5 AUGUSTUS stop_codon 1953609 1953611 . + 0 transcript_id "g349.t1"; gene_id "g349"; # protein sequence = [MHWYLAIIHLPELVLLPPPERELPNTRHHTRSSNVYEDLISSVDAPDNALSPAAAAASSNEAEFGSTLSGRRSLISTT # PSGSASRAASPSEASAMLEETKPSSEADAEETFRGLTTMDISVDIQIPSTHEKSPSPCTPLVDEPMDVDGSADERTVISPSFTSLVTSSRDPRDRSLS # MGVEQDQHHGNQGKHISPSRSKTSTVTPASFYAVPARSNKGKEKAINLSDEVSNGDVNPVHSSSRETSGQPMYVGYLIFNPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g349 ### # start gene g350 5 AUGUSTUS gene 1958462 1958908 0.57 + . g350 5 AUGUSTUS transcript 1958462 1958908 0.57 + . g350.t1 5 AUGUSTUS start_codon 1958462 1958464 . + 0 transcript_id "g350.t1"; gene_id "g350"; 5 AUGUSTUS CDS 1958462 1958908 0.57 + 0 transcript_id "g350.t1"; gene_id "g350"; 5 AUGUSTUS stop_codon 1958906 1958908 . + 0 transcript_id "g350.t1"; gene_id "g350"; # protein sequence = [MVEIRFYVPGTQSKLRGADAGSGEEDNDDEEVGAAQVFHDMVKEKASLDQVSDDIVLMFEEVLVLTPRGRYDVVMFKD # FLRLRGKTYDYKIMFAKIARLFLLPKDDQHVLFIVSFEPYRHERYIYHSHPTSLVLPNPSGKGKRDTSTW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g350 ### # start gene g351 5 AUGUSTUS gene 1959336 1960137 0.76 + . g351 5 AUGUSTUS transcript 1959336 1960137 0.76 + . g351.t1 5 AUGUSTUS start_codon 1959336 1959338 . + 0 transcript_id "g351.t1"; gene_id "g351"; 5 AUGUSTUS CDS 1959336 1959624 0.79 + 0 transcript_id "g351.t1"; gene_id "g351"; 5 AUGUSTUS CDS 1959677 1960137 0.95 + 2 transcript_id "g351.t1"; gene_id "g351"; 5 AUGUSTUS stop_codon 1960135 1960137 . + 0 transcript_id "g351.t1"; gene_id "g351"; # protein sequence = [MGAAAARTFDLKIVTKSGPEYTFSSINKEEHEPTESYFKDKKIRIKNEMVPDADLLMAAAVGDDDEDMASVDSDDSGP # RGKPARTGFDDDEDSENDEDFQASSSDEGSPSESDSSEGGADTASDASGDRDFAKKSKKKKTKGKEKESSTSVKKAKKADDSDVDGDEDEDKDKKSKK # KAAPKPKAKKKSSDDEMDVDDKPRPKPKAKPKPKPKDDTMDVDEVRPKPKPKAKKQSGEAVVEPPKKKQKTAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g351 ### # start gene g352 5 AUGUSTUS gene 1961238 1964007 0.44 - . g352 5 AUGUSTUS transcript 1961238 1964007 0.44 - . g352.t1 5 AUGUSTUS stop_codon 1961238 1961240 . - 0 transcript_id "g352.t1"; gene_id "g352"; 5 AUGUSTUS CDS 1961238 1963421 0.89 - 0 transcript_id "g352.t1"; gene_id "g352"; 5 AUGUSTUS CDS 1963486 1964007 0.53 - 0 transcript_id "g352.t1"; gene_id "g352"; 5 AUGUSTUS start_codon 1964005 1964007 . - 0 transcript_id "g352.t1"; gene_id "g352"; # protein sequence = [MPMRPRRSLSLLASVFQSSQSEDSNTAPSTAPSTAPSTPSSEDHFFSSDSSIEIPPISREPAYYDDLRSSNIDILSVS # SASATVEETSLLDSDPFADLSAPPVVIPPTTDRPSLAITRPPNSPLSLSGSASRSRSATLIQSPVRPLYQKRPLHSSPSMPSLSTLATANVKITKKAR # KGKVGAGLPSEPWDLLRDVTVSTPKSEIPSLPHYSSEEDEEDYGKLCSRLSIVDEHPGLGDRLSDEFKLSGVEDDFSPKPSSPIPIKSSNFEDLGRSR # SSSTSSGSSYEPTDWFSQGGTTFPDFDVHSSSITSLHSSQTSIPDAYSLSSSSSSSFSDHSDQSFDPMVISHSYPHEYPSSLPKFSLSLELPTGHSTE # LLDEEEFSALSSSPCQTARQRVDSPYHEEAINMNSLHVSDPLDEAAQFEPGSSASTIRASPLKNNPHMAGIQKLPRSQSRRRRGVLSTEMWIKGNTSS # CEEPAVDGDDYSRGRSASASGLSSSYAGNHGAGGYSGRVYSVGGLGGGGHGLGGHGGDDGDDGNKRNRRVVPGSFATYQSDEDEEDESADEDDYGLPS # GLPPAQTQTQFDDDDVPLARSIPTALKAQQSIRIKDREARDKRRKEREIRALARDQQRQHQAAINSSSIPTQEAAPNVARPARITSASQKPTSSFAID # DLTRKLENVQTRGRPDSRPSPPSADAASRFNAVLSKDVATSAPPIRTLRPMRSFHRPGSSQKVSDTPPLPISAEARLTRSTTRGRARSTASREDPSST # IASQARAIPISTPVDEPGTAKVERKRTVKSADGIKSARTSTEHSRPPPPLPAPAEVIARQNHAKITLTQQRVFIGDRQRFVVVEISSSTSAGEVVRMV # EAQGAFKEWRGSGGWMLFEIAQDFGMGMDACCHPLFAHY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g352 ### # start gene g353 5 AUGUSTUS gene 1968909 1969379 0.78 + . g353 5 AUGUSTUS transcript 1968909 1969379 0.78 + . g353.t1 5 AUGUSTUS start_codon 1968909 1968911 . + 0 transcript_id "g353.t1"; gene_id "g353"; 5 AUGUSTUS CDS 1968909 1969379 0.78 + 0 transcript_id "g353.t1"; gene_id "g353"; 5 AUGUSTUS stop_codon 1969377 1969379 . + 0 transcript_id "g353.t1"; gene_id "g353"; # protein sequence = [MPSQQPQPRLITISSTGLTHSSFALIPFVLKPLYALLSVPHKDKVGAERVIAHCAGWKWEVDSDEEPGDDILGERWLE # RDGLPAAGSFKNVLVIRPALLTDGECKAEKGGKKNAYRVKEGDFSAYTVSRKDVGHFVADAVLNRWSEFENKLVTIGY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g353 ### # start gene g354 5 AUGUSTUS gene 1972760 1973433 0.45 + . g354 5 AUGUSTUS transcript 1972760 1973433 0.45 + . g354.t1 5 AUGUSTUS start_codon 1972760 1972762 . + 0 transcript_id "g354.t1"; gene_id "g354"; 5 AUGUSTUS CDS 1972760 1972775 0.67 + 0 transcript_id "g354.t1"; gene_id "g354"; 5 AUGUSTUS CDS 1972848 1973030 0.45 + 2 transcript_id "g354.t1"; gene_id "g354"; 5 AUGUSTUS CDS 1973126 1973433 0.92 + 2 transcript_id "g354.t1"; gene_id "g354"; 5 AUGUSTUS stop_codon 1973431 1973433 . + 0 transcript_id "g354.t1"; gene_id "g354"; # protein sequence = [MVDTTALNAWHSVNGAQLTVIEETVPVSSALPNALSVVIPSGSSGQVGVGNEGYFGEFPQVISTIRPSSFNGTATVGL # QTSTGEFLGGTNVTLSGSQTSWLQVNTTIQPTITPDSLTNNFTVTVDGAELAGQTINFAMFSLFPPTFKNRPNGMRIDIAEVSRDSAYIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g354 ### # start gene g355 5 AUGUSTUS gene 1977452 1978750 0.28 - . g355 5 AUGUSTUS transcript 1977452 1978750 0.28 - . g355.t1 5 AUGUSTUS stop_codon 1977452 1977454 . - 0 transcript_id "g355.t1"; gene_id "g355"; 5 AUGUSTUS CDS 1977452 1977864 0.64 - 2 transcript_id "g355.t1"; gene_id "g355"; 5 AUGUSTUS CDS 1978081 1978750 0.33 - 0 transcript_id "g355.t1"; gene_id "g355"; 5 AUGUSTUS start_codon 1978748 1978750 . - 0 transcript_id "g355.t1"; gene_id "g355"; # protein sequence = [MSDKAELPSPEPQPEKKIDKDRDTEPPKPQSKRFKLDAKLDRDAITPVKTETAEANIPPYSRSFLSPHTSNSILASNN # LNKNVHTSPDNSVKRNHSPQIRSRPVANHNKDPPAEYTSSLDTDGFIISQPPAHVQQPVSSTIPIALTAPLALRSGFPLLETPRNNNTNTSLTLNQVQ # QMYRALLANTHAQTAAQYQPQAQPSFQAQAQAQLIMQPISNNQNQPRCPNNFQSPTVPLTLVQPPQHDIDPSSFSTPAQFPSTLANDVDGSQPQFYSA # SLDPYNSGVTPFQHLHVLEPILNANRTSQGFLFSPLNTFDVEDVQNLLLPQNTDQVMDRLLDENLVQEDPFQASMGLVWMQRVGLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g355 ### # start gene g356 5 AUGUSTUS gene 1980197 1981408 0.37 + . g356 5 AUGUSTUS transcript 1980197 1981408 0.37 + . g356.t1 5 AUGUSTUS start_codon 1980197 1980199 . + 0 transcript_id "g356.t1"; gene_id "g356"; 5 AUGUSTUS CDS 1980197 1980329 0.37 + 0 transcript_id "g356.t1"; gene_id "g356"; 5 AUGUSTUS CDS 1980396 1981408 1 + 2 transcript_id "g356.t1"; gene_id "g356"; 5 AUGUSTUS stop_codon 1981406 1981408 . + 0 transcript_id "g356.t1"; gene_id "g356"; # protein sequence = [MSKGMERLLKRMLSPNADLRCNADEAMQDIYWAQMQQSNHVNEHPSYTSSIVFEKDWTKLSETKQKTQASSPLATQTP # SCHATDDKDREGSDVPNSRSPPGLESPRNAASRPLAKSKSQGKMVTGMVEGTKSRFQSFAVHTSIDCVHSDVPRKRIAAHIDLSPIKASPPASPAQAR # KNIASHNGASNKPSQRVPFGTVHTRNAENLPTAPHRRLGGKPSIQDLTKRHSKVGMLDELVNGPPGTRKAQGKGWKGKENHVSQRVRDWERERERLRE # ISRLEEIERGRDAEPSNSSDTEPEVVDITPELEQVGTSESAQTDLRSQDKDTESRIPPTAIAGTWLPSLDLGMKSSASRTVPIISEPSTPAPAVDTSF # IPGKSLLLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g356 ### # start gene g357 5 AUGUSTUS gene 1982160 1983128 0.84 + . g357 5 AUGUSTUS transcript 1982160 1983128 0.84 + . g357.t1 5 AUGUSTUS start_codon 1982160 1982162 . + 0 transcript_id "g357.t1"; gene_id "g357"; 5 AUGUSTUS CDS 1982160 1982455 0.85 + 0 transcript_id "g357.t1"; gene_id "g357"; 5 AUGUSTUS CDS 1982600 1983128 0.86 + 1 transcript_id "g357.t1"; gene_id "g357"; 5 AUGUSTUS stop_codon 1983126 1983128 . + 0 transcript_id "g357.t1"; gene_id "g357"; # protein sequence = [MSSFVTSVYASPATGTFPDNTSGTQDLSVPQLQTPSRQRRATVSTRSPDPVINGPVTSFFDVDHGSPSKRKEKSKSHG # NLFQLHIAPAAALGAELDKRESSENLGWNVSVSLSSKPNDESGDELTSSPFRVEPYAPRPTTSSHSIPDTPTQKRVEGVYDRFLMATSGVKRLGKGYQ # SDNVGPVHNTISHANHTKQSHRAFYSVRKPLQMPPPVASEDQAKAVAVDEFGIIGYSTESTGVTVLKDENNGTVALVRRAFKAIVPGKTVNRRLSRMN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g357 ### # start gene g358 5 AUGUSTUS gene 1984941 1986443 0.14 + . g358 5 AUGUSTUS transcript 1984941 1986443 0.14 + . g358.t1 5 AUGUSTUS start_codon 1984941 1984943 . + 0 transcript_id "g358.t1"; gene_id "g358"; 5 AUGUSTUS CDS 1984941 1985064 0.65 + 0 transcript_id "g358.t1"; gene_id "g358"; 5 AUGUSTUS CDS 1985536 1985540 0.57 + 2 transcript_id "g358.t1"; gene_id "g358"; 5 AUGUSTUS CDS 1985579 1985788 0.25 + 0 transcript_id "g358.t1"; gene_id "g358"; 5 AUGUSTUS CDS 1985934 1986443 0.3 + 0 transcript_id "g358.t1"; gene_id "g358"; 5 AUGUSTUS stop_codon 1986441 1986443 . + 0 transcript_id "g358.t1"; gene_id "g358"; # protein sequence = [MTSNDTALITAYQPKTWDLSAFNITDGWLLDSIAQEVDPSTDEYFLTSALSLFDNEGTAWELDSSSSRGLLLDFDASN # NSVSLNKQWIPYNVTVSESQGNVGILDSGNTLIGYIACCAWNLPNSFLLADRAYHYNWTATPNTRPSVFVETDGSNTTVYTSWNGATEVDTWQLSGST # ADSPQLAVPISNTSRSGFETAISVTGTSTNFTYFQVAALNSNKKIIVYSNFTASDGSQQNPAANQTVDSSNSSGSDSPSSGSTQVTVGSRMITFVLVT # LRILFTLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g358 ### # start gene g359 5 AUGUSTUS gene 1987605 1988000 0.88 - . g359 5 AUGUSTUS transcript 1987605 1988000 0.88 - . g359.t1 5 AUGUSTUS stop_codon 1987605 1987607 . - 0 transcript_id "g359.t1"; gene_id "g359"; 5 AUGUSTUS CDS 1987605 1988000 0.88 - 0 transcript_id "g359.t1"; gene_id "g359"; 5 AUGUSTUS start_codon 1987998 1988000 . - 0 transcript_id "g359.t1"; gene_id "g359"; # protein sequence = [MLHFFQDLGKSSNDLLGKDYPFNTTSLEIKTKANDVSFKVAGNNAGGAIIGDLEAKYGNKKHGFTLTNTWTTANVLKS # QIELENQLAKGLKVDILSSLAPEKGTKSAVINAAFKQSGLHTRAALDVFKVCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g359 ### # start gene g360 5 AUGUSTUS gene 1990439 1990666 0.68 + . g360 5 AUGUSTUS transcript 1990439 1990666 0.68 + . g360.t1 5 AUGUSTUS start_codon 1990439 1990441 . + 0 transcript_id "g360.t1"; gene_id "g360"; 5 AUGUSTUS CDS 1990439 1990666 0.68 + 0 transcript_id "g360.t1"; gene_id "g360"; 5 AUGUSTUS stop_codon 1990664 1990666 . + 0 transcript_id "g360.t1"; gene_id "g360"; # protein sequence = [MSQAATTVRPKPRPKPLPKATSSTVFANTSAPGTLSSANKVTYDNVKDNDEMFMRNRGKDGWAKLRKISKGELSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g360 ### # start gene g361 5 AUGUSTUS gene 1991098 1991453 0.49 + . g361 5 AUGUSTUS transcript 1991098 1991453 0.49 + . g361.t1 5 AUGUSTUS start_codon 1991098 1991100 . + 0 transcript_id "g361.t1"; gene_id "g361"; 5 AUGUSTUS CDS 1991098 1991120 0.69 + 0 transcript_id "g361.t1"; gene_id "g361"; 5 AUGUSTUS CDS 1991177 1991453 0.62 + 1 transcript_id "g361.t1"; gene_id "g361"; 5 AUGUSTUS stop_codon 1991451 1991453 . + 0 transcript_id "g361.t1"; gene_id "g361"; # protein sequence = [MQKKLLGQNTLGGDRQSSPDVEDDFEEEDSFVYDPQLAKIAQNVKSQSELLGHTSSSAEPSGGNDTMNIIVRWEPHPL # NEHGKRDTWGFKLDRVCFVKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g361 ### # start gene g362 5 AUGUSTUS gene 1991726 1992244 1 + . g362 5 AUGUSTUS transcript 1991726 1992244 1 + . g362.t1 5 AUGUSTUS start_codon 1991726 1991728 . + 0 transcript_id "g362.t1"; gene_id "g362"; 5 AUGUSTUS CDS 1991726 1992244 1 + 0 transcript_id "g362.t1"; gene_id "g362"; 5 AUGUSTUS stop_codon 1992242 1992244 . + 0 transcript_id "g362.t1"; gene_id "g362"; # protein sequence = [MAAEQLRSEAAAKANKTTTDPPSNIIEIDSDEEDDRIGPSSFMYNNDDDHLNASVALQTGAPAGDDQDEDKFKLVFRS # ALTSKDITLNVRSTTKCGAIVNAFLKKAGLMEKYPALSADGSSLQKKTKSRRSVVGSTINKVPKLSIDGDKVGNDIEIGDYDLEEGDMVEVVDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g362 ### # start gene g363 5 AUGUSTUS gene 1992449 1994617 0.16 + . g363 5 AUGUSTUS transcript 1992449 1994617 0.16 + . g363.t1 5 AUGUSTUS start_codon 1992449 1992451 . + 0 transcript_id "g363.t1"; gene_id "g363"; 5 AUGUSTUS CDS 1992449 1992717 0.63 + 0 transcript_id "g363.t1"; gene_id "g363"; 5 AUGUSTUS CDS 1992813 1993072 0.9 + 1 transcript_id "g363.t1"; gene_id "g363"; 5 AUGUSTUS CDS 1993122 1993319 0.81 + 2 transcript_id "g363.t1"; gene_id "g363"; 5 AUGUSTUS CDS 1993769 1993920 0.27 + 2 transcript_id "g363.t1"; gene_id "g363"; 5 AUGUSTUS CDS 1994009 1994617 1 + 0 transcript_id "g363.t1"; gene_id "g363"; 5 AUGUSTUS stop_codon 1994615 1994617 . + 0 transcript_id "g363.t1"; gene_id "g363"; # protein sequence = [MFKRSKTKPTQRNRGLPEDDIADERSPAAETAGTGTDVDLTTDSESPLLAVKKFKDRTKKSQPKSRLSFGAEEDDEVR # VSNAQESNILRSESSFLTFSVIHFNSKFPDNLDQATISPSRNGPTYDAAYLQELKKSTPSSRAPPQSSVDPYDADMSMSTDVTMDLGDVSMLDVVDIT # GESDTLIHTESAIKNAKERRERLRKSGVSPSEDYISLSVTRKADDQGPHPESRLVREEDELGEGDDAQLTTSHASNTASLNTVAQERDQLDIREKELR # ALVSNAEDKRAWFSSFSEWYPLLEKLESEHIYLLQERFDIITKRRLQDVEDDLSTFLGPLPLTQEDTTPELDEFGREIRRSDPAIARRERQERRSIRY # QRYQDFKAKASDEGYWTDSDLPPPDEAAYQDALASIATRTHDVLADVKSKEFLDPAKGRWGTWRSQYEETYVAAFGGLGVVSAWEFWARLESVGWDCI # QAWFIIFWSHVHDSLTLASDRTPKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g363 ### # start gene g364 5 AUGUSTUS gene 1994674 1995295 0.58 + . g364 5 AUGUSTUS transcript 1994674 1995295 0.58 + . g364.t1 5 AUGUSTUS start_codon 1994674 1994676 . + 0 transcript_id "g364.t1"; gene_id "g364"; 5 AUGUSTUS CDS 1994674 1994874 0.58 + 0 transcript_id "g364.t1"; gene_id "g364"; 5 AUGUSTUS CDS 1994939 1995295 0.64 + 0 transcript_id "g364.t1"; gene_id "g364"; 5 AUGUSTUS stop_codon 1995293 1995295 . + 0 transcript_id "g364.t1"; gene_id "g364"; # protein sequence = [MEGRELGPEGDLVSSMVSTAIIPRLSKIIETGALDVYSSSHVRRAVDLSEELQASVSEVDQGHLKLQIFYKAVIACFT # KAVSENEALLAKFNSAGHGSASTFNPEAIPARKRYLARQLILISNLTRWRKSTGELFGVGQLITKVVDGCMDVADSGWDVGGEEALKKVRLYQRRRTG # TLTCNIFCH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g364 ### # start gene g365 5 AUGUSTUS gene 1995913 1997313 0.63 - . g365 5 AUGUSTUS transcript 1995913 1997313 0.63 - . g365.t1 5 AUGUSTUS stop_codon 1995913 1995915 . - 0 transcript_id "g365.t1"; gene_id "g365"; 5 AUGUSTUS CDS 1995913 1997313 0.63 - 0 transcript_id "g365.t1"; gene_id "g365"; 5 AUGUSTUS start_codon 1997311 1997313 . - 0 transcript_id "g365.t1"; gene_id "g365"; # protein sequence = [MIHSQTISSSMTKFTTSDTVLRLSHVHPLWRETCISVSSLWSHIHIIRASSDEVKRTEMFLERSGTSLLTIEFHARAN # TIPYTPEANRMIQKLFAACERWKGASFSIQAQSIEQVMIALFGENGTPQLDQKFHFPFLETFSFTSRPESQNRRFFDMFQQKSTPRLHNLVIPNYTTF # LPFAFGQITDLTLSKMNKDFPDLSVLCPHLVRLKIGQTFGESNEPTPAHAATTFELPKLETMIVSCSGPGRLWSMLTLPSLRNLALEAITFMPLEHVA # ILNMLRRSGCGLGLRRLTLAYMDITDVDVMSMLSLMPQLEEFVLHETLLRQQKILTPRLLMVLKLPNTNRDLATTVNDSTFVSPAVTRAHFIPNLAYI # ELQVYYFPTFGLDLLFDMLSSRAVISSGDHLSSFSTRQASGILKQIVLCFVLDEVNPPVQIPLELENMVNRLRLVSTSHIQSMVQCGQEWKKEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g365 ### # start gene g366 5 AUGUSTUS gene 2005176 2006032 0.65 - . g366 5 AUGUSTUS transcript 2005176 2006032 0.65 - . g366.t1 5 AUGUSTUS stop_codon 2005176 2005178 . - 0 transcript_id "g366.t1"; gene_id "g366"; 5 AUGUSTUS CDS 2005176 2005830 0.65 - 1 transcript_id "g366.t1"; gene_id "g366"; 5 AUGUSTUS CDS 2005902 2006032 0.65 - 0 transcript_id "g366.t1"; gene_id "g366"; 5 AUGUSTUS start_codon 2006030 2006032 . - 0 transcript_id "g366.t1"; gene_id "g366"; # protein sequence = [MAPPRPPFGTDEPESIYETPNHPQRRIRQPAPVDPNSRTSAYNVYNNYIHDDSNRQSGIDALGAGFMNGSMDDDDDEP # QEKYNPFTSAKEQEASKHAMLAAAIGPRKTPTPPPQYIASPRPGYAASVEALSRPEPAAIPATRQPPNGLSISTSNNPFATPMDHQAFPNGPHMPQPI # AVPNTPHPLQPPMTPITPVFARPTKQQDIRFDEKPIMRGAGEGTSIPSRGEKGDDFWRRFSMVVKEENSKPSQQKQRFVYCPTSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g366 ### # start gene g367 5 AUGUSTUS gene 2008032 2008910 0.98 + . g367 5 AUGUSTUS transcript 2008032 2008910 0.98 + . g367.t1 5 AUGUSTUS start_codon 2008032 2008034 . + 0 transcript_id "g367.t1"; gene_id "g367"; 5 AUGUSTUS CDS 2008032 2008910 0.98 + 0 transcript_id "g367.t1"; gene_id "g367"; 5 AUGUSTUS stop_codon 2008908 2008910 . + 0 transcript_id "g367.t1"; gene_id "g367"; # protein sequence = [MSSHSTQTHNAKFAAQNLFDISNWACIVTGGGTGIGLMIAQAFANNGARVYITSRRKSVLDNAVNTWGSSLAHPKGQL # IALECDITDKKSIQKLVEEVEGREKNIDVLVNNAGISLGTSQVEKGDESAKQLSEELFGEDLVKWEDVYRTNVIGHFFTTAAFIPLLAATATVHPGRT # AAVINTTSMSGITRTSQHHFKYNVSKGAAIHLTTLLAQELRRDGANVRVNNIAPGIFPSEMTTQESDEANKSEIPTGDDYGEKKGIPAGRPGRDEDIA # QAVLMLACNQYAYGQVSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g367 ### # start gene g368 5 AUGUSTUS gene 2011664 2012611 0.91 + . g368 5 AUGUSTUS transcript 2011664 2012611 0.91 + . g368.t1 5 AUGUSTUS start_codon 2011664 2011666 . + 0 transcript_id "g368.t1"; gene_id "g368"; 5 AUGUSTUS CDS 2011664 2012611 0.91 + 0 transcript_id "g368.t1"; gene_id "g368"; 5 AUGUSTUS stop_codon 2012609 2012611 . + 0 transcript_id "g368.t1"; gene_id "g368"; # protein sequence = [MDVDGEGNNRSDIPYFPSYILDLPQSVSSSIHNIIDFVFLPGFHNPTIAVLFNERPTWTGRLEEAKDTCGLIIFSMSN # SFSSWGGISSTFTVITNIPNLPYDAYALVPCISGVAGLVILTSNSIVYVDQATKKLMLPVNGWATRVSDIAAVNVTDVAQTRDLALEGSRAAFISETT # LLLILARGDAYTVTLAMDGKAVSGLSISDKPMVKTTIPSLAMSVTASSPHAGRDVDAHTIPFIFVGSTQGPSVLLKTNMVESEEDDTDREVDNGNDVR # APAGEDDDMYDDDAGKEISYCYTLFVFTLNRHLRSFSYLCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g368 ### # start gene g369 5 AUGUSTUS gene 2013449 2014911 0.54 + . g369 5 AUGUSTUS transcript 2013449 2014911 0.54 + . g369.t1 5 AUGUSTUS start_codon 2013449 2013451 . + 0 transcript_id "g369.t1"; gene_id "g369"; 5 AUGUSTUS CDS 2013449 2013466 0.76 + 0 transcript_id "g369.t1"; gene_id "g369"; 5 AUGUSTUS CDS 2013626 2014168 0.58 + 0 transcript_id "g369.t1"; gene_id "g369"; 5 AUGUSTUS CDS 2014285 2014911 0.8 + 0 transcript_id "g369.t1"; gene_id "g369"; 5 AUGUSTUS stop_codon 2014909 2014911 . + 0 transcript_id "g369.t1"; gene_id "g369"; # protein sequence = [MFDFGPTSKYLTGCFFTDHTGMLEKNVFSPNPKVDLGQRSSDGLNNQWLLLVRPQGVLELWSLPKMTLAFSVAIPFAT # LENVLMDSGEGVASSIPVPAATTVTSATSPSAPPVPPTAPAMLRSQSQTQDVTMTPVESDAGDAGAAMQNKEKPESMNQTKETDGRDTGAIEQVLLAP # LGETRPELHLFVLLRSGQLAIYQAIPAPAPPLHSTAVEALNGVEPTSPTIAATPSTLNSRLVRLRIAFVKVLSKTFELQNSNIAGAGNGPGGVGSMGS # ASGSALTDQKKFTRMFLPFVTPNVSSSLTIPQNKQKKGTTTYSGVFFTGENPSWIISTDRGGVHLYPSGHAVVHAFTACPVLASRDPRIGGEFLIYSD # EVIPSKQSSDITFIFRPIGTYLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g369 ### # start gene g370 5 AUGUSTUS gene 2020764 2022797 0.82 + . g370 5 AUGUSTUS transcript 2020764 2022797 0.82 + . g370.t1 5 AUGUSTUS start_codon 2020764 2020766 . + 0 transcript_id "g370.t1"; gene_id "g370"; 5 AUGUSTUS CDS 2020764 2022797 0.82 + 0 transcript_id "g370.t1"; gene_id "g370"; 5 AUGUSTUS stop_codon 2022795 2022797 . + 0 transcript_id "g370.t1"; gene_id "g370"; # protein sequence = [MAWQSLRFDSFPSEVVAMIFELGTFTELGKLQHSPNQTPFVFESCCKSNDYSYSPHFPILVSHVSRKWRAIALNTPAL # WSTLFFDHASHLERGRVFLERCSPRGNSSPEFCFGYFLDIVIATVPFKRKTTQDDDSISKEELEEIFNLLVPVTVRWRSFCLRVRDNTCKKVARDALG # HNCGRAPNLETLQLYHFEDYNNVDELIEATIRDPVICFANNVPKLKHLSLIGVNLPWAQSPYLEGLDTLELALHPEKIRPPYEVWDRMLRLSPDLRNL # ILHYSGPKEGWDEEGSPSSTLAWQGDDLWRSDLPSGKIILDKLEVLSLTDMDAPYLARILDRIQFPNVQRLVLELTSEEEDSDYSEFLQKCCSAGISN # TESSSVRLFHNSNLSNSSMSTILSVDNLKPPLFPFLPTLTSLTLSALDCKLSVLRSLLVCLPELIELEIDFQRVCVNDMYPESSLAWRMFADEPIAHM # EDRDTGTVLDSLSRPSSQKGPLLLPKLQVFKILRLGGRQVEGIIRNRECVVKDTCESDIRAMPAPTSTIYPDNVPTRQRSMYIIKYTREMEEHDPVLR # KLITSGCCYFPTNCVERRLGGWDTRTEPSDRLVEENPSAVLRRLEPELRDAYGRKVKAEYCSTAPIPINVETNGWTKVMVQAEMINTEESDPAEDEYG # LTDDESGSEWE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g370 ### # start gene g371 5 AUGUSTUS gene 2026092 2026657 0.95 + . g371 5 AUGUSTUS transcript 2026092 2026657 0.95 + . g371.t1 5 AUGUSTUS start_codon 2026092 2026094 . + 0 transcript_id "g371.t1"; gene_id "g371"; 5 AUGUSTUS CDS 2026092 2026241 0.97 + 0 transcript_id "g371.t1"; gene_id "g371"; 5 AUGUSTUS CDS 2026373 2026657 0.96 + 0 transcript_id "g371.t1"; gene_id "g371"; 5 AUGUSTUS stop_codon 2026655 2026657 . + 0 transcript_id "g371.t1"; gene_id "g371"; # protein sequence = [MFSPVGSKATVCAFTSQPGIIFTGHESGKVALFNYKTGEEVDSNERAHGDIHDTKTLDVIKTFTTETPLNSAAIAPNK # PYVLLGGGQEAMSVTTTSLRQGKFETRFWHKVFEEEVGRVKGHFGPINTCVFLLDPIHKKVDGLVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g371 ### # start gene g372 5 AUGUSTUS gene 2029071 2029907 0.27 - . g372 5 AUGUSTUS transcript 2029071 2029907 0.27 - . g372.t1 5 AUGUSTUS stop_codon 2029071 2029073 . - 0 transcript_id "g372.t1"; gene_id "g372"; 5 AUGUSTUS CDS 2029071 2029253 0.87 - 0 transcript_id "g372.t1"; gene_id "g372"; 5 AUGUSTUS CDS 2029371 2029907 0.27 - 0 transcript_id "g372.t1"; gene_id "g372"; 5 AUGUSTUS start_codon 2029905 2029907 . - 0 transcript_id "g372.t1"; gene_id "g372"; # protein sequence = [MKEINTSTTAAKNSIQDLERNIAAEIQRSAQDTQEKRDDFTRRMDEARATVAEQESIIKQLSAANSDILRRAQSAEQD # GQAKQAELEQLKQNIGTVENSLRQLQRDQDNKYSAYGPGMSQVVARIQQMKWYGDEPLGPLGRYVKVKDPDAWADLLAQQLGGSLTAFAVTDPRDRDS # LKRDRFDYSSGEPAPDVLTVLRAVEVRGQIRLLHPDTALSSLFDRLKTRTSNESSLIKPGLRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g372 ### # start gene g373 5 AUGUSTUS gene 2031036 2031683 0.43 - . g373 5 AUGUSTUS transcript 2031036 2031683 0.43 - . g373.t1 5 AUGUSTUS stop_codon 2031036 2031038 . - 0 transcript_id "g373.t1"; gene_id "g373"; 5 AUGUSTUS CDS 2031036 2031683 0.43 - 0 transcript_id "g373.t1"; gene_id "g373"; 5 AUGUSTUS start_codon 2031681 2031683 . - 0 transcript_id "g373.t1"; gene_id "g373"; # protein sequence = [MTHSLNLHDARGPHDRQLTVTTISTMAKRLVSPNSDDEDAQDASPAFKRARTDGASDIEPNNRSQRRGPRNKGKGRAP # GEDGNSSSDDDQEPEVHADHIDDDQFEEQYHERVEKAVDAKRHIVGVSCNDICSFLSSYGSCAAQGVAEHGIIESIEMHQFMCHRFLSFQFGPQINFI # IGELNQQVLLHSLDLEIPRTQREYVLELSALLTSSSSSM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g373 ### # start gene g374 5 AUGUSTUS gene 2032368 2033135 1 + . g374 5 AUGUSTUS transcript 2032368 2033135 1 + . g374.t1 5 AUGUSTUS start_codon 2032368 2032370 . + 0 transcript_id "g374.t1"; gene_id "g374"; 5 AUGUSTUS CDS 2032368 2033135 1 + 0 transcript_id "g374.t1"; gene_id "g374"; 5 AUGUSTUS stop_codon 2033133 2033135 . + 0 transcript_id "g374.t1"; gene_id "g374"; # protein sequence = [MSDVVKKGSDDSSATVTSQVTDSPTIPDVDNYVAYTIKNTKALPPVTWSNLLNELNWLSVYILTIPPLVGFVGAFYVK # LQWETAVWAVAYYFLTGLGTYPFAPLGLRSNITSGITAGYHRLWAHRAFNASLPLQYVLAILGAGSLQGSIKWWSRGHRAHHRYTDTELDPYNAHKGF # WFSHVGWMLVKPRRKPGVADVSDLRHNPVVKWQHKHYLSLILFMGFILPSIVAYVGWGDAKGGFIYAGVIRLVFVHHVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g374 ### # start gene g375 5 AUGUSTUS gene 2035488 2036207 1 - . g375 5 AUGUSTUS transcript 2035488 2036207 1 - . g375.t1 5 AUGUSTUS stop_codon 2035488 2035490 . - 0 transcript_id "g375.t1"; gene_id "g375"; 5 AUGUSTUS CDS 2035488 2036207 1 - 0 transcript_id "g375.t1"; gene_id "g375"; 5 AUGUSTUS start_codon 2036205 2036207 . - 0 transcript_id "g375.t1"; gene_id "g375"; # protein sequence = [MFNPCIDSISSPLTATNAFQSLAKISSDLLPTELQLMKFAGHYLRLSDEIQYFDWDSFLQAVLDYNGKDLVLIYPDGI # AVLTEKGRGGELIKGSSDKPTLGRANEPIIPRDQLSAVSDITDYIVYFVTQVVGVSMDAGAIYDTVLNAFTNLKWASESGFADFSSSSTGTNSSWEYR # ITFSAPYSGSSESFLSFVSTIYLEADITNESSWWGLVSSSKQHFHCDITGLKFQVIKGFQDPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g375 ### # start gene g376 5 AUGUSTUS gene 2037628 2038128 0.42 + . g376 5 AUGUSTUS transcript 2037628 2038128 0.42 + . g376.t1 5 AUGUSTUS start_codon 2037628 2037630 . + 0 transcript_id "g376.t1"; gene_id "g376"; 5 AUGUSTUS CDS 2037628 2038128 0.42 + 0 transcript_id "g376.t1"; gene_id "g376"; 5 AUGUSTUS stop_codon 2038126 2038128 . + 0 transcript_id "g376.t1"; gene_id "g376"; # protein sequence = [MSINAPCFSGRDLLTLLGDDLTFDKYQNNTINQQSATVSIMVDKIVDFLRVVLSVALSEEDISALSKNIETTFTNLKE # AKDNGWADFSTSSSSSNSSWEYRVLFAFPNPDLPNFFYSLVTTIKLEADIQEESSWWGLESSTRKNFAATIDAMELVVLKGFKDPLKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g376 ### # start gene g377 5 AUGUSTUS gene 2040946 2041557 0.68 + . g377 5 AUGUSTUS transcript 2040946 2041557 0.68 + . g377.t1 5 AUGUSTUS start_codon 2040946 2040948 . + 0 transcript_id "g377.t1"; gene_id "g377"; 5 AUGUSTUS CDS 2040946 2041557 0.68 + 0 transcript_id "g377.t1"; gene_id "g377"; 5 AUGUSTUS stop_codon 2041555 2041557 . + 0 transcript_id "g377.t1"; gene_id "g377"; # protein sequence = [MTAIQVMQFSGYFVDLKQPKTFHWDQFLDGINNYKGMSINCVTFFRLRLTLLVLGDDLTFDKYQNNTINQQSATVSTM # VDKIVDFLRVVLSIALTKEDIDALTKNIDTTFRNLREAKDHGWADFSTSNSSSNSSWEYRVLFAFPNPDLPDFFYSLVTTIKLEADIKEESSWWGLQH # SDRRNFAATIDAMELVVLRGFKNPLKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g377 ### # start gene g378 5 AUGUSTUS gene 2042970 2043809 0.8 - . g378 5 AUGUSTUS transcript 2042970 2043809 0.8 - . g378.t1 5 AUGUSTUS stop_codon 2042970 2042972 . - 0 transcript_id "g378.t1"; gene_id "g378"; 5 AUGUSTUS CDS 2042970 2043809 0.8 - 0 transcript_id "g378.t1"; gene_id "g378"; 5 AUGUSTUS start_codon 2043807 2043809 . - 0 transcript_id "g378.t1"; gene_id "g378"; # protein sequence = [MERQPSQYLPTINEKGPPPPPPFFGYPGYTEGQYVRDPMYVSEKYSPTISDYPRTSISWEYIRRNSAERQDNINGSEM # LRQSLRVSMRSSSLNMLSSSNIEKMLDIAARGRASVDALGLHSPRSARSNDSFGFLPVSPPPALHRMSLGDRRAPDVPHNPSFFADSSILVDQSIPLS # ESPESMGSLLRPESGTLSPSSPGAPQSSFSLAQPQRAVLIGVPPSSRSSQPKRSASPRTVSRENSMAKLVGGSRRTASHGSRFSMDSSDLEEGRFYTD # HLNES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g378 ### # start gene g379 5 AUGUSTUS gene 2046980 2047312 0.74 + . g379 5 AUGUSTUS transcript 2046980 2047312 0.74 + . g379.t1 5 AUGUSTUS start_codon 2046980 2046982 . + 0 transcript_id "g379.t1"; gene_id "g379"; 5 AUGUSTUS CDS 2046980 2047312 0.74 + 0 transcript_id "g379.t1"; gene_id "g379"; 5 AUGUSTUS stop_codon 2047310 2047312 . + 0 transcript_id "g379.t1"; gene_id "g379"; # protein sequence = [METRGWWDAQAEEELKTRHRADVLKAFKRAETQSRWELGELFTDIYAGEEPWNIVSDLSLWLQFKLTWDVIQKEQRKE # LGRLLKKYGEDWEPWRRELQKYKNEGRDLIKE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g379 ### # start gene g380 5 AUGUSTUS gene 2048878 2049432 0.6 - . g380 5 AUGUSTUS transcript 2048878 2049432 0.6 - . g380.t1 5 AUGUSTUS stop_codon 2048878 2048880 . - 0 transcript_id "g380.t1"; gene_id "g380"; 5 AUGUSTUS CDS 2048878 2049432 0.6 - 0 transcript_id "g380.t1"; gene_id "g380"; 5 AUGUSTUS start_codon 2049430 2049432 . - 0 transcript_id "g380.t1"; gene_id "g380"; # protein sequence = [MRRSVREVYDDVRMNGRIGKFLAEFVKKIKAKVPEPVKPAKIKRKRNFKEEDDDDKRPLATTSSRRKLLTPDTPTTSS # ADLNMPAPSELPNAAFTKKMKTTVSSASGLNATAPPQPPMSSAQNAPRNHQNDFFQSRMSLSPNSSISRSTDHDIGRSDSRGPLNGRVTLNSHSTDFR # MNGIPSYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g380 ### # start gene g381 5 AUGUSTUS gene 2049723 2050313 0.49 - . g381 5 AUGUSTUS transcript 2049723 2050313 0.49 - . g381.t1 5 AUGUSTUS stop_codon 2049723 2049725 . - 0 transcript_id "g381.t1"; gene_id "g381"; 5 AUGUSTUS CDS 2049723 2050013 0.56 - 0 transcript_id "g381.t1"; gene_id "g381"; 5 AUGUSTUS CDS 2050121 2050232 0.49 - 1 transcript_id "g381.t1"; gene_id "g381"; 5 AUGUSTUS CDS 2050291 2050313 0.76 - 0 transcript_id "g381.t1"; gene_id "g381"; 5 AUGUSTUS start_codon 2050311 2050313 . - 0 transcript_id "g381.t1"; gene_id "g381"; # protein sequence = [MLDLDRDPITGQKYWYKIPQSPNASEKKQQVLPDKLQTMFANKQIRVQQGMALKPSEKLGVLSTIRTGFIRDLLKNYV # TDDTLGSIPWETSRGGDMRCFSHAVYCMERWSENPEEVKDHGTLAKMEKWLAGEGVFCFVSSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g381 ### # start gene g382 5 AUGUSTUS gene 2052185 2053669 0.43 - . g382 5 AUGUSTUS transcript 2052185 2053669 0.43 - . g382.t1 5 AUGUSTUS stop_codon 2052185 2052187 . - 0 transcript_id "g382.t1"; gene_id "g382"; 5 AUGUSTUS CDS 2052185 2053111 1 - 0 transcript_id "g382.t1"; gene_id "g382"; 5 AUGUSTUS CDS 2053466 2053669 0.49 - 0 transcript_id "g382.t1"; gene_id "g382"; 5 AUGUSTUS start_codon 2053667 2053669 . - 0 transcript_id "g382.t1"; gene_id "g382"; # protein sequence = [MNSFKSKLGELNAVRSKLTTEKKELEEKVSALEGQTRNLEATLDSLKTEKESSGSASALPDGAADPDVERLNQRLQAL # NKAREEDAHKATAALEAAVSAAVAKVKDELQTREIPPDDFVAKHQAELKALEVRLIAAHQEELRNATGNKGSSTSGSEIDVQAAVAAAIAAHDKERDV # KIAEEISAAVERGRMEAASKMKLRDSQIVRVQTKLKEYEAQIQTWKQEGILPKDAKVAPLSGKAPPPPSPSTSSNLSTPVTPSTAPAPTTASANASLP # RKPSVPSATPSSSTIVSTPPGIGRGRGGPSAVVRGAIRGAARGAPGTGRGAKPSQPLSGGITIQGAAKRPAPESAADDTLAKRLKPAAGNPVTLRRPP # PPGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g382 ### # start gene g383 5 AUGUSTUS gene 2053912 2055655 0.2 - . g383 5 AUGUSTUS transcript 2053912 2055655 0.2 - . g383.t1 5 AUGUSTUS stop_codon 2053912 2053914 . - 0 transcript_id "g383.t1"; gene_id "g383"; 5 AUGUSTUS CDS 2053912 2054262 0.65 - 0 transcript_id "g383.t1"; gene_id "g383"; 5 AUGUSTUS CDS 2054310 2054553 0.54 - 1 transcript_id "g383.t1"; gene_id "g383"; 5 AUGUSTUS CDS 2054662 2054876 0.92 - 0 transcript_id "g383.t1"; gene_id "g383"; 5 AUGUSTUS CDS 2054930 2055067 0.74 - 0 transcript_id "g383.t1"; gene_id "g383"; 5 AUGUSTUS CDS 2055206 2055655 0.65 - 0 transcript_id "g383.t1"; gene_id "g383"; 5 AUGUSTUS start_codon 2055653 2055655 . - 0 transcript_id "g383.t1"; gene_id "g383"; # protein sequence = [MGVSHITAQTQELSKTREALAIAETSKVHLEERVGDLTKHMKGNEEKLAVYERRGGAYSSMEQSDLTREQQLESEVAG # LRYLQSPYLPYSTLTLSIRSALKVAEFDLTQAKGHVQQFQSISEANETALTEFQSTHEEYIASTDAQIAKSEKQYEDDRVAWSNDKKTLEDTIVDLST # SENDRNSHENDVKQQEQRAKVAEERYSNEVLSHAESIKALDNLKKQLASVQATIRDYQVAAETATSKLATSEGSWQQQKQTLDNETKDLRQRSQAARI # RQAAETTTSTSSEADVNDSSDVKLSEMRSVVAYLRKEKEIVDLQLDLSKQENTRLKSQIEHLYQNLNETRQTLSEEREKAVEAATSGAKHEELIKRIN # QLNILRESNATLRADGEARAKRIKELETKLDLLGNQLEPAKEEARVAKAELQARDTQIKRLEEENRRWQGRNQQLLTKVCHHTIAVHRELTVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g383 ### # start gene g384 5 AUGUSTUS gene 2056320 2058000 0.34 - . g384 5 AUGUSTUS transcript 2056320 2058000 0.34 - . g384.t1 5 AUGUSTUS stop_codon 2056320 2056322 . - 0 transcript_id "g384.t1"; gene_id "g384"; 5 AUGUSTUS CDS 2056320 2057087 0.66 - 0 transcript_id "g384.t1"; gene_id "g384"; 5 AUGUSTUS CDS 2057191 2058000 0.36 - 0 transcript_id "g384.t1"; gene_id "g384"; 5 AUGUSTUS start_codon 2057998 2058000 . - 0 transcript_id "g384.t1"; gene_id "g384"; # protein sequence = [MIDLCSQFKLDSLTQQLQLAQSEVERVNVELTTKSEEYGNYRRTKQAELVALQASLNDMTQNHSSLQANLKALQTSHA # SQTHQLTQALTKVQDLNGQIAEQEATYSTETNSLHRLVEVLEAREKQAKDFVENMERDWAELGERADEREANLKADIEKERRAREEAENRIEQLEKVL # DKMGRGELPIPGRGAAGTPSRRTSGVFDEVHDGLVGLSPTIAMVSKTQKSGKSFTEVYADYVRLQDLYEKKCIESKNMEAAMEDVLAQLEERVSLASE # LAQAISDRDVQYQAAQDNAQKLHKSSREIDLLQQQLDDLGLQVRALLKEIGRRDDPNLPSDEELENVIAAEVVEDVITNNLVLFRSIDEVQLQNQRLL # RIVRGMGEKMEEAEKKQKAKMEAEQAEAIREAHETMENLAAELDRQKKHSDNVIQAYVKERDALKAIIARSNHNEGHTGIPTDSSEIGVSDASSSVAK # ELAEIQSQFDTYRTEMGVDSVKLREDNIAAHREIGQLQAALAKASAKNENQIGMA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g384 ### # start gene g385 5 AUGUSTUS gene 2058135 2058812 0.43 - . g385 5 AUGUSTUS transcript 2058135 2058812 0.43 - . g385.t1 5 AUGUSTUS stop_codon 2058135 2058137 . - 0 transcript_id "g385.t1"; gene_id "g385"; 5 AUGUSTUS CDS 2058135 2058812 0.43 - 0 transcript_id "g385.t1"; gene_id "g385"; 5 AUGUSTUS start_codon 2058810 2058812 . - 0 transcript_id "g385.t1"; gene_id "g385"; # protein sequence = [MVGTRRTSKFPSTTEDEGGPSTTEDSHNSSFIVPIPEDFDIEAFTSLIPNFDIHSPSPESLVNLYQLLLEQSGAVDAA # QRDVDELRAESERKDVELDQALQDREQSSKDLEQQVERLQEELTQVKQERDHLCVLNLPFLYFNWLMHSLIVPVASQNELQTRITGLASSQTTSSREA # EELKHRLEDAEREKRDLINVISRLKQDGSERDGELGFLPNTLYITLIVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g385 ### # start gene g386 5 AUGUSTUS gene 2060281 2062094 0.77 - . g386 5 AUGUSTUS transcript 2060281 2062094 0.77 - . g386.t1 5 AUGUSTUS stop_codon 2060281 2060283 . - 0 transcript_id "g386.t1"; gene_id "g386"; 5 AUGUSTUS CDS 2060281 2061161 0.77 - 2 transcript_id "g386.t1"; gene_id "g386"; 5 AUGUSTUS CDS 2061242 2062094 0.86 - 0 transcript_id "g386.t1"; gene_id "g386"; 5 AUGUSTUS start_codon 2062092 2062094 . - 0 transcript_id "g386.t1"; gene_id "g386"; # protein sequence = [MHTPLTPTHQNSHGHRHHSPARPNGKHSHSDPPTHGLRAQLHNLLPRHSLFHAHIHIHQISSVPLVHGEFAARWKFKN # VQSQTGLLKRVKGKRRGSQKDEKGKAKEVVDEGDDSFGSGEAAADRHSSSSNSIVDDQNVNIPAVVVSGYMSPTAAQTKSPYQELLNPPRADFSRTSS # ALTSSSASYSHSGSSANLPQSLSITPITSNSAPPTPSTAGVESYSNTRGMTPFYKLKDHAVVWDHDLDVIIKMDIDRETSELLPNEFKLVVMQRVIPG # DPDAPRNPRLDERYSESVYVFYRHFNPSEIIITQLTIYLEHSGGDTNYIAPLLPKAEIFNGVADLLDDDVYITRPRALDLWGPYHNQQELEMDLLGGT # SIPELQSAAAEKSRSKSRVRARSKSRLTHTRIPSNGKNSMISAEDMNSDADFYIDEDDSDIEESRYEVPFDVSRLPLAYGPKTTEMLIEAIFNPVRVT # HHDLKGNPFTYYVSPEEVKEEQARKLERLRDKDRTARAPYLGNESPSLYSADDNSSHSGYTENSEVGRGRSGMRGWWSSKKKTPAAVSSTPTGSSRPG # TPGTPVTVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g386 ### # start gene g387 5 AUGUSTUS gene 2062423 2062782 1 + . g387 5 AUGUSTUS transcript 2062423 2062782 1 + . g387.t1 5 AUGUSTUS start_codon 2062423 2062425 . + 0 transcript_id "g387.t1"; gene_id "g387"; 5 AUGUSTUS CDS 2062423 2062782 1 + 0 transcript_id "g387.t1"; gene_id "g387"; 5 AUGUSTUS stop_codon 2062780 2062782 . + 0 transcript_id "g387.t1"; gene_id "g387"; # protein sequence = [MPSDSQYPAEIFVKYLAASPDSQETDKAKGQVDAQNQPGERPGKQYRFPDDLKPVDDVYANGKLYKGSGKLEGKVAWI # SGGDSGIGRATAILFALEGADMTIVFKDGEEKDAEDTRKYM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g387 ### # start gene g388 5 AUGUSTUS gene 2063006 2063320 0.81 + . g388 5 AUGUSTUS transcript 2063006 2063320 0.81 + . g388.t1 5 AUGUSTUS start_codon 2063006 2063008 . + 0 transcript_id "g388.t1"; gene_id "g388"; 5 AUGUSTUS CDS 2063006 2063320 0.81 + 0 transcript_id "g388.t1"; gene_id "g388"; 5 AUGUSTUS stop_codon 2063318 2063320 . + 0 transcript_id "g388.t1"; gene_id "g388"; # protein sequence = [MAGLTASQWEDTFALNIHSYFHITKAALPYMPRGGSIINMASINAFVGRDDLLDYTSTKGAVVSFTRGLSNQVVGEKG # IRVNGVLSLFIYNLTSAVTHFDLNNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g388 ### # start gene g389 5 AUGUSTUS gene 2064570 2065613 1 - . g389 5 AUGUSTUS transcript 2064570 2065613 1 - . g389.t1 5 AUGUSTUS stop_codon 2064570 2064572 . - 0 transcript_id "g389.t1"; gene_id "g389"; 5 AUGUSTUS CDS 2064570 2065613 1 - 0 transcript_id "g389.t1"; gene_id "g389"; 5 AUGUSTUS start_codon 2065611 2065613 . - 0 transcript_id "g389.t1"; gene_id "g389"; # protein sequence = [MSSRSRSATPEIFIPPLESSDPTPAPPTTDPIPVQEQPAYAAAPFWGQPYSGVSYPYFNYYPPQPYPYHSTPYVAPGV # DMWPPPPISTPYAMPQFPQTPAAYGYPTPFNISTAHNTPFPSTPMFAMGPSTPWIPTTPWTVGSPAVRVNPRLAPGGLRWDLLHHPDQARYINDFGAL # KAPKFSDNALTMAPQSSGGPRMKVSKVEITSSSHAVLNYWMSIWGPIPLPHHKVFDVLSAVYNYLAQPLTAQETKLLLDTPQNVGHALRAKEARANDS # WALACVILQEEGYRRIDVIGVHRGFGGISVEKITPTGLPAAAAEGNDEPEQEAEVELTIALSPLPGDADENWM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g389 ### # start gene g390 5 AUGUSTUS gene 2071692 2073131 0.56 + . g390 5 AUGUSTUS transcript 2071692 2073131 0.56 + . g390.t1 5 AUGUSTUS start_codon 2071692 2071694 . + 0 transcript_id "g390.t1"; gene_id "g390"; 5 AUGUSTUS CDS 2071692 2073131 0.56 + 0 transcript_id "g390.t1"; gene_id "g390"; 5 AUGUSTUS stop_codon 2073129 2073131 . + 0 transcript_id "g390.t1"; gene_id "g390"; # protein sequence = [MALAEPCNESLLLDNGKPIKCFEVYSFLNWFGRFIALPGIARYGDAFCEQIADAHPPEDKGSACDGRFYFELKGDDGK # FFVRERGKEGRWFFKFHADFFNIEGNLHGGKHNSTGIMSMSCLNLPLEIREDQAYVYIPGVIQGPREPDARAGAYNHYLQPIIDEILVAYTRGIQCAS # SDDQQTPYERTHRVVVANISMDAKASHPFAGLVDIGLHAYCATCQTWHKAYLNSVNYEDWEAIDDEYLREGAEKWRNAESRVEREKIEHLYGVRYSEF # WRLPYFSPSRQVSIDPMHALKNIFGNFFCDALRLDNPSSTKEPKNKSTTPLSSIAHYYQFMPPPRLSVINSAPITQTDADEQDLLTAVLEWDHLSNDL # CLLRHQRALSLLVNISAYKRELSDIHYLLSLSRPSTDSMQTHLRSRLRNKKWGTLLYVCNDLMVFPAGISDEIARKVSVAKSDIMKDDMVDTLIKWVC # LFICIRTRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g390 ### # start gene g391 5 AUGUSTUS gene 2085048 2085521 0.95 + . g391 5 AUGUSTUS transcript 2085048 2085521 0.95 + . g391.t1 5 AUGUSTUS start_codon 2085048 2085050 . + 0 transcript_id "g391.t1"; gene_id "g391"; 5 AUGUSTUS CDS 2085048 2085521 0.95 + 0 transcript_id "g391.t1"; gene_id "g391"; 5 AUGUSTUS stop_codon 2085519 2085521 . + 0 transcript_id "g391.t1"; gene_id "g391"; # protein sequence = [MSPKRTTPRRTKAASSATQYLNTSIRGHRAITETHSATLTYNSTSSTLNTVFNHGDALASRSPLPIDIDFIHEFPTIP # TGRDEYLERQGGTDELVEGLDTLHAASEKIFKAQKEEIQLRRHQISVLKEQCRVSEWHFVMAHPYKFPSIIRNTRKRSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g391 ### # start gene g392 5 AUGUSTUS gene 2087720 2088400 0.5 + . g392 5 AUGUSTUS transcript 2087720 2088400 0.5 + . g392.t1 5 AUGUSTUS start_codon 2087720 2087722 . + 0 transcript_id "g392.t1"; gene_id "g392"; 5 AUGUSTUS CDS 2087720 2088400 0.5 + 0 transcript_id "g392.t1"; gene_id "g392"; 5 AUGUSTUS stop_codon 2088398 2088400 . + 0 transcript_id "g392.t1"; gene_id "g392"; # protein sequence = [MAQRLCFLRKISFLRVIGPYKYLNRYPSSANSSLHIAAVHNYTMSSHSTLIDLDGTALSLHSIVSAIDATPSESCVMD # SGTILPGIITDADHPARATSPPIANDSNAPMILAEPITPPSHSSTEFENPNFDVVMRGYLANSQSSIDMTVFEFHFLAQLDPRLKGKVLSVLTKAFLD # LKAFDDSEEVFGRLLGSVSHDRGRNYVVALVAAGSALLGALAMFLVLAFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g392 ### # start gene g393 5 AUGUSTUS gene 2097556 2098674 0.93 - . g393 5 AUGUSTUS transcript 2097556 2098674 0.93 - . g393.t1 5 AUGUSTUS stop_codon 2097556 2097558 . - 0 transcript_id "g393.t1"; gene_id "g393"; 5 AUGUSTUS CDS 2097556 2098674 0.93 - 0 transcript_id "g393.t1"; gene_id "g393"; 5 AUGUSTUS start_codon 2098672 2098674 . - 0 transcript_id "g393.t1"; gene_id "g393"; # protein sequence = [MHNGRYEDEVEFLRLRNAELEARVHELEEDLEKILVRVTHVLRSKHQVLLPSFQNQEMDDVASLKEDVHLYYRQYRDS # QLEVMELEEVILELRDNCNQSVTEKPEDEVRTTWTHWFWPFIKSSYSSSLYETNWQNLKSRGQWQTLNKLTKWVTIVLSYCTLISLSQLRVVSVLHGE # NALSGLNLNGPPFSTSTSTLPYPADAPTSGWFFEAFHYLNVALGPQYLALLQKWMNYERKAHWLNPHKLAGFSPEKRPSVLLSWMKNRPRPLPKVDKR # GFFTPTFIEEVAAWWASLQPQWRLLDENGTPTPFDSFGDDMSPLNKHGRNAWLGLLACIKWWEIGLKCYVADDHQVHLNEWLTIIADMTRMLGKLAAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g393 ### # start gene g394 5 AUGUSTUS gene 2101862 2102209 0.95 + . g394 5 AUGUSTUS transcript 2101862 2102209 0.95 + . g394.t1 5 AUGUSTUS start_codon 2101862 2101864 . + 0 transcript_id "g394.t1"; gene_id "g394"; 5 AUGUSTUS CDS 2101862 2102209 0.95 + 0 transcript_id "g394.t1"; gene_id "g394"; 5 AUGUSTUS stop_codon 2102207 2102209 . + 0 transcript_id "g394.t1"; gene_id "g394"; # protein sequence = [MNDSEISSVNTSNRRRRLSSASSEGAQSSSQADDDRPQKVTDVSTPSHSMSSCTDLNILLKFKVRVVERVVEREVVPA # HLTQQLAEKDEQIQLLQQELEAEVQSLFILCSCPLNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g394 ### # start gene g395 5 AUGUSTUS gene 2126956 2128074 0.88 - . g395 5 AUGUSTUS transcript 2126956 2128074 0.88 - . g395.t1 5 AUGUSTUS stop_codon 2126956 2126958 . - 0 transcript_id "g395.t1"; gene_id "g395"; 5 AUGUSTUS CDS 2126956 2128074 0.88 - 0 transcript_id "g395.t1"; gene_id "g395"; 5 AUGUSTUS start_codon 2128072 2128074 . - 0 transcript_id "g395.t1"; gene_id "g395"; # protein sequence = [MHNGRYEDEVEFLRLRNAELEARVHELEEDLEKILVRVTHVLRSKHQVLLPSFQNQEMDDVASLKEDVHLYYRQYRDS # QLEVMELEEVILELRDNCNQSVTEKPEDEVRTTWTHWFWPFIKSSYSSSLYETNWQNLKSRGQWQTLNKLTKWVTIVLSYCTLISLSQLRVVSVLHGE # NALSGLNLNGPPFSTSTSTLPYPADAPTSGWFFEAFHYLNVALGPQYLALLQKWMNYERKAHWLNPHKLAGFSPEKRPSVLLSWMKNRPRPLPKVDKR # GFFTPTFIEEVAAWWASLQPQWRLLDENGTPTPFDSFGDDMSPLNKHGRNAWLGLLACIKWWGIGLKCYVADDHQVHLNEWLTIIADMTRMLGKLAAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g395 ### # start gene g396 5 AUGUSTUS gene 2129934 2130506 0.72 + . g396 5 AUGUSTUS transcript 2129934 2130506 0.72 + . g396.t1 5 AUGUSTUS start_codon 2129934 2129936 . + 0 transcript_id "g396.t1"; gene_id "g396"; 5 AUGUSTUS CDS 2129934 2130506 0.72 + 0 transcript_id "g396.t1"; gene_id "g396"; 5 AUGUSTUS stop_codon 2130504 2130506 . + 0 transcript_id "g396.t1"; gene_id "g396"; # protein sequence = [MGSKRATASAQSARRSIVRTPSASYARRHRMITRSKTSRASETDASMTIPLSSTSAAEDSSSNFGNNRPSATTLLFSS # IASAIASRNDNPNSTPLSSVSVANATANTDPKVVSPLGSATAPTSSFVANSVLPHVALSDDDCDDNFHGEVRTYLDYTSDLLKAQAEEVKLLRREVAS # ARKEKAVSHDGIQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g396 ### # start gene g397 5 AUGUSTUS gene 2131141 2131608 0.59 + . g397 5 AUGUSTUS transcript 2131141 2131608 0.59 + . g397.t1 5 AUGUSTUS start_codon 2131141 2131143 . + 0 transcript_id "g397.t1"; gene_id "g397"; 5 AUGUSTUS CDS 2131141 2131608 0.59 + 0 transcript_id "g397.t1"; gene_id "g397"; 5 AUGUSTUS stop_codon 2131606 2131608 . + 0 transcript_id "g397.t1"; gene_id "g397"; # protein sequence = [MDQPMGDAPATNDSELPLTHDSETPTIARGRRRSRPINHTMNDSEISSVNTSNRRRRLSSASSEGAQSSSQADDDRPQ # KVTDVSTPSHSMSSCTDLNILLKFKVRVVERVVEREVVPAHLTQQLAEKDEQIQLLQQELEAEVQSLFILCSCPLNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g397 ### # start gene g398 5 AUGUSTUS gene 2135023 2135451 0.86 + . g398 5 AUGUSTUS transcript 2135023 2135451 0.86 + . g398.t1 5 AUGUSTUS start_codon 2135023 2135025 . + 0 transcript_id "g398.t1"; gene_id "g398"; 5 AUGUSTUS CDS 2135023 2135451 0.86 + 0 transcript_id "g398.t1"; gene_id "g398"; 5 AUGUSTUS stop_codon 2135449 2135451 . + 0 transcript_id "g398.t1"; gene_id "g398"; # protein sequence = [MSTLLSSIFGLKSRIQKETGQFAEAQEIQPLRDSLAKLQAQHEEDKLANSSAQTRLLTLESQIAIITRERDELNRRVL # ANGNVSNLEDTITKLREQYEREALSLSQKQGRVTALEQQVADLIRERDFIKVYILFSTSLIHLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g398 ### # start gene g399 5 AUGUSTUS gene 2140128 2140577 0.94 - . g399 5 AUGUSTUS transcript 2140128 2140577 0.94 - . g399.t1 5 AUGUSTUS stop_codon 2140128 2140130 . - 0 transcript_id "g399.t1"; gene_id "g399"; 5 AUGUSTUS CDS 2140128 2140577 0.94 - 0 transcript_id "g399.t1"; gene_id "g399"; 5 AUGUSTUS start_codon 2140575 2140577 . - 0 transcript_id "g399.t1"; gene_id "g399"; # protein sequence = [MSQRQYPSRVNIGSDNKGSQSELTRETPYVSHLTKERGKIGKSTARIARQVIRSMCALYVVNDGNGSILGATGNVWDD # GFGVIGLFRLDGRGVPLSFRCMSSKSPPGADIKSKSAAGQLAKIVIESSKGNTRSSHDNGRLVSEDSLILV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g399 ### # start gene g400 5 AUGUSTUS gene 2149657 2150136 0.33 + . g400 5 AUGUSTUS transcript 2149657 2150136 0.33 + . g400.t1 5 AUGUSTUS start_codon 2149657 2149659 . + 0 transcript_id "g400.t1"; gene_id "g400"; 5 AUGUSTUS CDS 2149657 2149690 0.91 + 0 transcript_id "g400.t1"; gene_id "g400"; 5 AUGUSTUS CDS 2149772 2150136 0.33 + 2 transcript_id "g400.t1"; gene_id "g400"; 5 AUGUSTUS stop_codon 2150134 2150136 . + 0 transcript_id "g400.t1"; gene_id "g400"; # protein sequence = [MGLANVVKGNLDGAGQIKMTKDGKVLLSEMQIQNPTAAMIARTAVAQDDQVGDGTTSVVLLVGELLKQADRYISEGVH # PTVIAEGFDLAKKEALAVCSFFSQFEPCLMFTSRIPIPISYVFSSWIPSNNLRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g400 ### # start gene g401 5 AUGUSTUS gene 2152063 2152356 0.99 - . g401 5 AUGUSTUS transcript 2152063 2152356 0.99 - . g401.t1 5 AUGUSTUS stop_codon 2152063 2152065 . - 0 transcript_id "g401.t1"; gene_id "g401"; 5 AUGUSTUS CDS 2152063 2152356 0.99 - 0 transcript_id "g401.t1"; gene_id "g401"; 5 AUGUSTUS start_codon 2152354 2152356 . - 0 transcript_id "g401.t1"; gene_id "g401"; # protein sequence = [MVFAVNPTAAKSFEAFQAAALATGTNSTTTNSTASAATSGTSTASTASGSTVASASAAVASQSAVGAATTANGATALA # SSAIAGLVAVFGVGIGLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g401 ### # start gene g402 5 AUGUSTUS gene 2155068 2155783 0.44 - . g402 5 AUGUSTUS transcript 2155068 2155783 0.44 - . g402.t1 5 AUGUSTUS stop_codon 2155068 2155070 . - 0 transcript_id "g402.t1"; gene_id "g402"; 5 AUGUSTUS CDS 2155068 2155385 0.63 - 0 transcript_id "g402.t1"; gene_id "g402"; 5 AUGUSTUS CDS 2155490 2155783 0.44 - 0 transcript_id "g402.t1"; gene_id "g402"; 5 AUGUSTUS start_codon 2155781 2155783 . - 0 transcript_id "g402.t1"; gene_id "g402"; # protein sequence = [MQNSALPPSLSPKPQTEPETLPEMELDIPPSPPPVEETLASRRAKRQAILAKYTNIGVSVSPSPVTTTGFSSAVQALQ # TPSTVSDHASHDSSLHQQNTDFALAKEDDEKSSELKKQEENVNANVGEQILAAEYDPSLDRREDEGKRIQPLVKVEEEDVEEVVEEEDEDDVDDMFAV # AVNDKPKVKKVKKVTVRPLAMSWVPLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g402 ### # start gene g403 5 AUGUSTUS gene 2155876 2156223 0.79 - . g403 5 AUGUSTUS transcript 2155876 2156223 0.79 - . g403.t1 5 AUGUSTUS stop_codon 2155876 2155878 . - 0 transcript_id "g403.t1"; gene_id "g403"; 5 AUGUSTUS CDS 2155876 2156223 0.79 - 0 transcript_id "g403.t1"; gene_id "g403"; 5 AUGUSTUS start_codon 2156221 2156223 . - 0 transcript_id "g403.t1"; gene_id "g403"; # protein sequence = [MTNIPAGSKRPLDGAGGSSNSESRDRKRPRDDPKDWRDVHLKTSSRKVSPSNRRDSYDRDRRSHHDAERRRRSREHGK # SRRDRDDSRDKRTEPRRLDPTPPRYTPRHDEEKEEGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g403 ### # start gene g404 5 AUGUSTUS gene 2159123 2159989 0.76 - . g404 5 AUGUSTUS transcript 2159123 2159989 0.76 - . g404.t1 5 AUGUSTUS stop_codon 2159123 2159125 . - 0 transcript_id "g404.t1"; gene_id "g404"; 5 AUGUSTUS CDS 2159123 2159989 0.76 - 0 transcript_id "g404.t1"; gene_id "g404"; 5 AUGUSTUS start_codon 2159987 2159989 . - 0 transcript_id "g404.t1"; gene_id "g404"; # protein sequence = [MVPFLTKNRSFQVLKLNNNGLGPAGGQVLANALLDSAKLSKAEGKTSNLRTFICGRNRLEDGSASAWAEAFAAHGGLI # EVRMPQNGIRMDGITALAGGLAENRNLQYIDLQDNTFTFEGGLTGVKAWANSLRAWPDLHTLNLSDCFLSANGEVPELVTVLAEGSNPKLHSLQLQNN # NLEGETSQLLAENIMENMRNLKYLELQWNDFEEEDEHLSALRVSMKQRGGKLSVTDEDEEEQEQEDAEEEAEARAEKEAELEMDLEEKAFQGKTEKYE # ADELANLMSKVEIE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g404 ### # start gene g405 5 AUGUSTUS gene 2162373 2162771 0.54 + . g405 5 AUGUSTUS transcript 2162373 2162771 0.54 + . g405.t1 5 AUGUSTUS start_codon 2162373 2162375 . + 0 transcript_id "g405.t1"; gene_id "g405"; 5 AUGUSTUS CDS 2162373 2162771 0.54 + 0 transcript_id "g405.t1"; gene_id "g405"; 5 AUGUSTUS stop_codon 2162769 2162771 . + 0 transcript_id "g405.t1"; gene_id "g405"; # protein sequence = [MHSPTHSGIEVSEPMAMAYDGMAPMSVHASSVAAATYDVDLGHLGMADGNNNDHGIYEGPSLLPSFRRPSDSTTLVLA # SRNDPFNEEVDPRAEPSRMRSVDRLRVSGELPLHSSLTSSLIANVNVSRGSLGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g405 ### # start gene g406 5 AUGUSTUS gene 2164843 2165939 0.23 + . g406 5 AUGUSTUS transcript 2164843 2165939 0.23 + . g406.t1 5 AUGUSTUS start_codon 2164843 2164845 . + 0 transcript_id "g406.t1"; gene_id "g406"; 5 AUGUSTUS CDS 2164843 2165127 0.7 + 0 transcript_id "g406.t1"; gene_id "g406"; 5 AUGUSTUS CDS 2165264 2165560 0.37 + 0 transcript_id "g406.t1"; gene_id "g406"; 5 AUGUSTUS CDS 2165718 2165939 0.37 + 0 transcript_id "g406.t1"; gene_id "g406"; 5 AUGUSTUS stop_codon 2165937 2165939 . + 0 transcript_id "g406.t1"; gene_id "g406"; # protein sequence = [MSPATQIATTANLFSPIKIGDMLLNHRVVMAPLTRLRTTKTSAVLKVVKEYYSQRASTPGTFLISEGTVISPRATGFQ # PCAPGIWSDEQITAWKESYDPTYDVVSAGDIPMAGGEVPRPITVEEIQASIGDFVQAAINAVHKAGFDGVELHGAYGFLIDQFIQDVSNNRTDKYGGS # IENRARFALEVVDAVAKALKEKQPNLAYLHLIQSRDLDDPKQSNEKFFDMWSPRPLVVADGFTREKALKFAERDGVLIAFGKRFISNVSVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g406 ### # start gene g407 5 AUGUSTUS gene 2167264 2168358 0.16 + . g407 5 AUGUSTUS transcript 2167264 2168358 0.16 + . g407.t1 5 AUGUSTUS start_codon 2167264 2167266 . + 0 transcript_id "g407.t1"; gene_id "g407"; 5 AUGUSTUS CDS 2167264 2167545 0.72 + 0 transcript_id "g407.t1"; gene_id "g407"; 5 AUGUSTUS CDS 2167682 2168050 0.25 + 0 transcript_id "g407.t1"; gene_id "g407"; 5 AUGUSTUS CDS 2168134 2168358 0.58 + 0 transcript_id "g407.t1"; gene_id "g407"; 5 AUGUSTUS stop_codon 2168356 2168358 . + 0 transcript_id "g407.t1"; gene_id "g407"; # protein sequence = [MSPAARVATTTNLFSPIKVGNMLLNHRVVMAPMTRLRTTKTSAVLKVVKEYYSQRASTPGTFLISEGTVISPRATGFP # GAPGIWSDEQIAAWKESYDPTYDVVSAGDIPMTEGEVPRPMTVEEIQASIRDFVQAATNAVHKAGFDGVELHGANGFLIDQFIQDVSNNRTDKYGGSI # ENRVRFALEVVDAVAKAVGDDKTAIRLSPWSKEQGRSRSSLLKEKQPNLAYLHLIQSRDLDDQKQSNEIFFDLWSPQPLVVADGITREKALKFAEREG # LLAAFGRQFISNVSNSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g407 ### # start gene g408 5 AUGUSTUS gene 2171971 2173704 0.75 + . g408 5 AUGUSTUS transcript 2171971 2173704 0.75 + . g408.t1 5 AUGUSTUS start_codon 2171971 2171973 . + 0 transcript_id "g408.t1"; gene_id "g408"; 5 AUGUSTUS CDS 2171971 2173704 0.75 + 0 transcript_id "g408.t1"; gene_id "g408"; 5 AUGUSTUS stop_codon 2173702 2173704 . + 0 transcript_id "g408.t1"; gene_id "g408"; # protein sequence = [MRRPFCRLPPELISTIINLCLDLDPLTVPYSALGSLDQNWKLPISSKPPWYPFSKVCRVVRNAVLGDSMLWGKHVMVI # YSQRSFQGIQSMVEFANRRLQAGKPVDLEFTVPDDKMREKLTLKALESFEIPHTRMATMFNGFLHTRYLTISAPEEYFRELFSLKAPLWPSLERLSIE # VQNPSECSLTVDDYNTPDITTFTNSPKLREVRLVSEAKQNSTPFIPRVALPYSHLTRLILRDGSDKFWPDLSIRIVFRSCAPTLEYCEIRSYGFLDDF # YDSDSESNDEKEQLVTFPHLIDLFLDFGTGKHHRTYNTMSCVMLWNVAFPALKNFRLWTTVPPIIYSNVEMNVGADKSLDETMKILQQRSMFKLQKFQ # LFFAGWHAPGIASFLELVPSLEVLDLRGTYYGWTDTVRSISTRDDYLPNLRCVRVNDRTSFSPGWEEMEPSYGEHATLIRDMISRRCIPVGKLETVVF # NIRRPSPNNFSDGNGPMPRNFKRVIREIEKSRTSMPSEVRIHLEKFPLGQYTDFSWSMPGFPPSWYEHQEDGEKTGQDIADSSEDSEMEPAEIPDLEF # IPMEVDDNY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g408 ### # start gene g409 5 AUGUSTUS gene 2175628 2176296 0.73 + . g409 5 AUGUSTUS transcript 2175628 2176296 0.73 + . g409.t1 5 AUGUSTUS start_codon 2175628 2175630 . + 0 transcript_id "g409.t1"; gene_id "g409"; 5 AUGUSTUS CDS 2175628 2176296 0.73 + 0 transcript_id "g409.t1"; gene_id "g409"; 5 AUGUSTUS stop_codon 2176294 2176296 . + 0 transcript_id "g409.t1"; gene_id "g409"; # protein sequence = [MAESDHWTHSTPSVMPPQSERVHLHSELIYGTGHMLQWNMILPPQTTISGFSNPSSSIAIYSGVSALDSATQDLLHSP # ACPGAAKIIIRHGKNNQALGLWMEKWGPLEVYPSSLTFENEITVFEVLHAVYSYFQVRLSSQATAEMPMESQQRITLARAKRVTFEDQMADKAEWNRP # PKRVDVLALWCVFGGFDVRYNNGDGYTKLDEPGWRVVELEMRLRSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g409 ### # start gene g410 5 AUGUSTUS gene 2183138 2183461 0.72 - . g410 5 AUGUSTUS transcript 2183138 2183461 0.72 - . g410.t1 5 AUGUSTUS stop_codon 2183138 2183140 . - 0 transcript_id "g410.t1"; gene_id "g410"; 5 AUGUSTUS CDS 2183138 2183461 0.72 - 0 transcript_id "g410.t1"; gene_id "g410"; 5 AUGUSTUS start_codon 2183459 2183461 . - 0 transcript_id "g410.t1"; gene_id "g410"; # protein sequence = [MGGMDNPKSEVDHKAWGEVKALKDVGLYIDSGMANVDHGNFPVIVMKMVEGVRIQDTREYNYAKLDQKAKLLEEAKPY # VQKEIVHFAVEKGILHVQVAFNLLHVKKH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g410 ### # start gene g411 5 AUGUSTUS gene 2187809 2188855 1 + . g411 5 AUGUSTUS transcript 2187809 2188855 1 + . g411.t1 5 AUGUSTUS start_codon 2187809 2187811 . + 0 transcript_id "g411.t1"; gene_id "g411"; 5 AUGUSTUS CDS 2187809 2188855 1 + 0 transcript_id "g411.t1"; gene_id "g411"; 5 AUGUSTUS stop_codon 2188853 2188855 . + 0 transcript_id "g411.t1"; gene_id "g411"; # protein sequence = [MTGVLFANYDFNSSSSLSSPSRSRPHQEKRPLNSPGPSTNDTPSKGTSSLKSIFGSPSTNELNSPSPSRSEPIFATPS # KAWVPPFPGSPSFSRPQRPLDKSNLGYLAFPTAVSPLAATSNLTSEASDRSHILQSSHSSPSAEETNAPPPPPVDPLEEKHRARLEREEVERVRGEED # WVRSGGILRDSEGKRDFARTEKVREEIRLREWEKEVQERWDGYERRWAELQAKERKGDSKYSFQDIPWPVHVGERDSKTKSRRSGTWATLTLTAKVEL # PDLNRENVEKFLTDGLKVRGCKVTRKERVRASLLRWHPDKMTALVSKVIDDDRKDVESGISAIVRCLQDMNSKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g411 ### # start gene g412 5 AUGUSTUS gene 2189870 2190266 0.71 - . g412 5 AUGUSTUS transcript 2189870 2190266 0.71 - . g412.t1 5 AUGUSTUS stop_codon 2189870 2189872 . - 0 transcript_id "g412.t1"; gene_id "g412"; 5 AUGUSTUS CDS 2189870 2190042 0.71 - 2 transcript_id "g412.t1"; gene_id "g412"; 5 AUGUSTUS CDS 2190152 2190266 0.81 - 0 transcript_id "g412.t1"; gene_id "g412"; 5 AUGUSTUS start_codon 2190264 2190266 . - 0 transcript_id "g412.t1"; gene_id "g412"; # protein sequence = [MTVFIANYPDATDNGVAYNRQKTAIESAIQAYGTDHIGDPNGSVGNQGAAILTPLIDDTKSMLQSLGVTLKVGNADAG # SFFNDKVLADVDYGVSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g412 ### # start gene g413 5 AUGUSTUS gene 2192147 2193010 0.35 - . g413 5 AUGUSTUS transcript 2192147 2193010 0.35 - . g413.t1 5 AUGUSTUS stop_codon 2192147 2192149 . - 0 transcript_id "g413.t1"; gene_id "g413"; 5 AUGUSTUS CDS 2192147 2193010 0.35 - 0 transcript_id "g413.t1"; gene_id "g413"; 5 AUGUSTUS start_codon 2193008 2193010 . - 0 transcript_id "g413.t1"; gene_id "g413"; # protein sequence = [MSSACVSSPPSQPSSAKSQTKTTLLANTRTMNTTEPSPLLITGELLGSKRARTISTSSVDTIRINSGKKKSTSSNKRA # RASEPSSGSGCDQNILEDIRRIRQRKSSTYSADTIRAPESSAVTFPIFCDPPERTSPQSVTPSTAASKKKDPRKVTPPQLNPGKTAPSVAVTSVRHAP # PPPIITNLVRSRVSSIKRSSSRPTSPAAILSNYHPTGFEPLPSHLQEWQPSSTHFMLSDDEGSACDDKASSQVTAWKDQWDHVHPGMSDLAITICFHK # KQPFFDVWDLPDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g413 ### # start gene g414 5 AUGUSTUS gene 2194656 2198636 0.52 + . g414 5 AUGUSTUS transcript 2194656 2198636 0.52 + . g414.t1 5 AUGUSTUS start_codon 2194656 2194658 . + 0 transcript_id "g414.t1"; gene_id "g414"; 5 AUGUSTUS CDS 2194656 2195869 0.55 + 0 transcript_id "g414.t1"; gene_id "g414"; 5 AUGUSTUS CDS 2196161 2198636 0.87 + 1 transcript_id "g414.t1"; gene_id "g414"; 5 AUGUSTUS stop_codon 2198634 2198636 . + 0 transcript_id "g414.t1"; gene_id "g414"; # protein sequence = [MREGKWVVFKDIDRGSNEVLALIKPLIESLGLDKWIGGRASLEVVGRGEVVAADTFVIFATRSALPSRNGTFATPTFY # GAHKLHEVVVASPTAEELTLIVQSRYPRLSSQATSGLIRLWQAVRELGTTVSARDVGLRELEKFCVRAEQLISSYPADGSSTSDEDLPLYSIFPNTSL # REEIFLAARDVFFGSGVTASARAHTGLIAHTVGSQLGLEQERQEWLLSRWMPDFDVETDRDGRRTALRVGRTRLLAKPMKREITSSTPRPFAVHRPAI # LLMSRIVNAIALNEPVLLTGETGTGKTSVITHLAHILHQPLISLNLSNQTESSDLIGGFRPLDARVPALSLQSKFLDLFGETFSRRRNERFEADVRKS # VAQGKWKRAVGLWRESVKLAKDRIMKKQSSDLEILLDEVNLASAETLECIAGLLRNPTASITLTEQGSLEPVPRHPNFRLFACMNPATDVGKKDLPPN # IRSRFTEIDVPPPDADRETLLSIVAQYIGPSAVSDKASIMDVCEFYIAVKDLAETRQIADGANHRPHFSMRTLARALTFASDIASTYGLRRALWEGCL # MAFTMVLDIPSSEKVVALAQKHLLAGVKNVRSALAKEPTLPPSCAPENFVKLGPFFLEHGPLPLDPADDYILTPSVERKLIDLARIILTRRFPVLIEG # PTSSGKTSSVEYLAKRTGHRFIRINNHEHTDIQEYIGSYVPHPVTGELVFTDGLLVRALRSGDWIVLDELNLAPTDVLEALNRLLDDNRELVIPETGE # IVRPHPHFVLFATQNPSGLYAGRKVLSRAFRNRFLEVHFEDVPEAELEIILCQRCMIAPSYGKKIVAVFRELQKRRQTDRVFESKQGFATLRDLFRWA # GRDAVGYQELAENGYMLLAERARRDEDKIVVKEVIESTMGVKINERMLYDFQSRGPEFAQFLDCDPSGASLIWTKAMQRLFVLVARALRFNEPVLLVG # ETGSGKTSVCQVYADITSRRLHGLNCHQNTETADLIGGLRPIRNRASLEAEALQKAGVLSSKISSELDSHDVATLQSQLDMLLKSTTLTSPTRDALEE # IQSKILKSKSIFEWHDGPLIEAMRNGDVFLLDEISLADDSVLERLNSVLEPSRTLVLAEKAADHLHHHPSLVAHESFKLVATMNPGGDYGKKELSPAL # RNRFTEIWVPSIDDPADLHMIISCWWKHKSLQRYTTAVLDFVGWLSQNAGDTSFLNLRDILVRSSRLRKGTYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g414 ### # start gene g415 5 AUGUSTUS gene 2198726 2201179 0.39 + . g415 5 AUGUSTUS transcript 2198726 2201179 0.39 + . g415.t1 5 AUGUSTUS start_codon 2198726 2198728 . + 0 transcript_id "g415.t1"; gene_id "g415"; 5 AUGUSTUS CDS 2198726 2201179 0.39 + 0 transcript_id "g415.t1"; gene_id "g415"; 5 AUGUSTUS stop_codon 2201177 2201179 . + 0 transcript_id "g415.t1"; gene_id "g415"; # protein sequence = [MYLLARRIHLLMKCPQHHAAHMTYLDGLESTPSLSSLSETSLRQMKLAAVARLNELVPCPTSDPFIPQHDPSISYLLG # SFVIPRGSKLVQHHTFSFQVPTTQANAMRVVRACQLAKPILLEGSPGVGKTSLITALAQVSGHELCRINLSDQTDLIDLFGSDLPVDGGKAGEFAWKD # GEFLRALREGWWVLLDEMNLAPQAVLEGLNAVLDHRGSVYIPELGRTFIKHPAFRIFAAQNPLSQGGGRKGLPKSFVNRFTKVYVDQLLPSDLRLVCQ # YLHPEVDTKLLEPMIAFNSSLHHMVSIERSLGKEGAPWEFNLRDVLRWIELLKRPSERQLLPVDHVRTVYSHRFRTSSDRHLALALFERTFGCSFDYS # RNPVWTISSSTITVGQFCSERHNSSTLARPKRLLKSQLSALEALGCAISNSKLSIVTGARDSGKTAVVETLAVLTGNVLHKVHINNTTDAMDLLGGFE # QVDLQTRFKEIAFTAIAAVEQQLRVQADSNIDIEAYLSLRRAVTETSLEESRAIQEIISRLSKGSFSAAVFAQLSLAQTQIKEVLSSEQDRRAGRFEW # IDGVLVRALKAGHWLLLDGANLCNPSVLDRLNSLCETDGFLTLSEQGFIEGKIQTLKPHPNFRLFMTVDPQYGELSRAMRNRGIEIALISSPPMDDTI # LLRDHHRLPTLSDDVSPLVFAAMRLGARQGRGQYSKHRIPSGRILDQDSMLCHLLDVAPSLSNRSDNENALYHFVSRCITPTAVPILHRFLHTQPGND # STPHSYDLISQEILPTAVQTLSRLRDQYGTEEMLAIPHMLAMVSRTCLFWKAY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g415 ### # start gene g416 5 AUGUSTUS gene 2202535 2205752 0.36 + . g416 5 AUGUSTUS transcript 2202535 2205752 0.36 + . g416.t1 5 AUGUSTUS start_codon 2202535 2202537 . + 0 transcript_id "g416.t1"; gene_id "g416"; 5 AUGUSTUS CDS 2202535 2202633 0.37 + 0 transcript_id "g416.t1"; gene_id "g416"; 5 AUGUSTUS CDS 2202714 2205752 0.96 + 0 transcript_id "g416.t1"; gene_id "g416"; 5 AUGUSTUS stop_codon 2205750 2205752 . + 0 transcript_id "g416.t1"; gene_id "g416"; # protein sequence = [MAKLSEYETNLYSQAQLALLNTEQVLSRPEQLAIASCFLAADDLSKRDTHPVTFGQGVDSPALILPELESALAHSVPF # RRAVETYLQPVFASSEHPAEDYLEYVTRLGLCWISAGKLLLDLFIPDAPIDPAAVQNHIFEFWSQRAASLTKEYDLHSELEKSITGNIENGVTAYLRT # SLDAAQEHLANRPTAVFSRDVTRLHMLWSEVLQFQEHILSPTKLDALISDLKTGDRSADLREQVIQRSIVGFMQRVQTVYAEFDDIIFPIYYAILHLQ # TGLRILKQGSILNPVTESAVTALTGFPAIRSAQASVVPQNIGVVPGLQVFQRLLISMAAISLERTSGVEIKCHMSLIENTYEQASRLWHIDQSKEEEY # QKASESLYRQNHTVHAMESDAEIEEREFAELFPSFENVLSDDAPSSGNLNMSSPTHQISETDIKHFVHLHNVLFSGEGFTASSYRSVQLTNLPALITS # MTVFTDTLDYNALPLCISLLAERIEETGEPSKPRAIYNFYADANLHETRKAIKVLTKTKERLHTLIEEWPDQMVLRHLIERCDVILALDLRSPVAKVL # AALEQLLFHTEDWEVYANKENSLRDSRSELIELIVEWRRLELNCWQILFAAETKTFEDRVLPWWFRLYDAIIRGPLDVLENAISSTTELSAYLDDLLP # LLDDFIRGSSIGQFRVRLQLLKSFGDLCYHLKIIHSGLKAETLERILRIVNATVGYFMAFSSSVAAELSTGRATLEVEIRNLIKLASWKDVNVHALKQ # SAQRTHRQLYKLIRKYRELLRQPVSSRLENFSKSSKDEDSVHEHRQLGIVKAPDPTFPGTISDISAPTHLVNLGRTYRRLEQLISKSIAPLITSRSAD # VVEAFAVDIIVTSKELSSISLPPSLSAERREKQQKALLTRKRKAWSDLLKELKRAGFAAHVKPDVLLQNQSTRWIREQPLLIGTSDFNFEKIEMYWNR # LNGLFPLLRANVHLHHADLSTRELQRGVTFLESIFSIATESRARYVLSSRGSVRAKFKFLQIIRFFQWLYSTSTPSPSYAEPSFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g416 ### # start gene g417 5 AUGUSTUS gene 2206113 2207699 0.9 + . g417 5 AUGUSTUS transcript 2206113 2207699 0.9 + . g417.t1 5 AUGUSTUS start_codon 2206113 2206115 . + 0 transcript_id "g417.t1"; gene_id "g417"; 5 AUGUSTUS CDS 2206113 2207699 0.9 + 0 transcript_id "g417.t1"; gene_id "g417"; 5 AUGUSTUS stop_codon 2207697 2207699 . + 0 transcript_id "g417.t1"; gene_id "g417"; # protein sequence = [MDLCVEDESRLRPYIYPIIHWLRSLDLSYSSIARTLPDPTVACNGNEIINVCLATTEVLLAKSSNPPSSVEEDRDHYI # REDYQGVREFTSIFKIDQVIELLNRSLKGFAAGSALDVNRYLPFLELYSNLLHLQLASHDHWTKSLLKLNFVLCSVLDTICRQGFCKPPEPDEDGTAS # GDGVAEVNDGAGMGEGSGANNVSKDIEDESQVEGLQGDKNDANEPRDEQDDDAIEMSQDFDGDMEDVPDDGSQAEEQEEDSQSNPDPEEQVHDLDSSD # PAAVDEKFWGDEKGPEDGDDKANKESSTQQSGESEVVAKEGGNKTDAKEDAKDADSLETNDEAVEPQPDHEDEEAKQETGEEDSTYPDASGAPMDEYV # PEADALELPEEMDMGMENVAEEMETDKMDVDEDENDDGFTDERTPKDGDDHQEHDDEPSSPTAQDGTQEPEDKEATEAELPGQTQQTEDEEYVDENSA # IAQPDIGQGEGDVNGEHSNVEESQDQSHVESGTSMGVAGKAAAAAQKSQHGYVCYAMN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g417 ### # start gene g418 5 AUGUSTUS gene 2207778 2208470 0.92 + . g418 5 AUGUSTUS transcript 2207778 2208470 0.92 + . g418.t1 5 AUGUSTUS start_codon 2207778 2207780 . + 0 transcript_id "g418.t1"; gene_id "g418"; 5 AUGUSTUS CDS 2207778 2208470 0.92 + 0 transcript_id "g418.t1"; gene_id "g418"; 5 AUGUSTUS stop_codon 2208468 2208470 . + 0 transcript_id "g418.t1"; gene_id "g418"; # protein sequence = [MDLDPTAGAAPAGSEQGQQPSRQHDQLSANPLRSLADALKEVQRRFDEIFDSEGQDVPKDQVGASEQPAALEYLRPDD # TDHDMQALGPAQEEQVAKLQELNLVDDETDPNSNMPPLPDIETPSELENQDRQRPPLKQPDSSNDSISRKGELEGAIAQNNRQPLFEDGTLAPNRDDP # NADVDMEDAAGPDVELELRSWQAAGYQISRRTISGVSTNPSPTSSRMPYANNYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g418 ### # start gene g419 5 AUGUSTUS gene 2211904 2212968 0.21 - . g419 5 AUGUSTUS transcript 2211904 2212968 0.21 - . g419.t1 5 AUGUSTUS stop_codon 2211904 2211906 . - 0 transcript_id "g419.t1"; gene_id "g419"; 5 AUGUSTUS CDS 2211904 2212214 0.66 - 2 transcript_id "g419.t1"; gene_id "g419"; 5 AUGUSTUS CDS 2212302 2212526 0.37 - 2 transcript_id "g419.t1"; gene_id "g419"; 5 AUGUSTUS CDS 2212803 2212968 0.82 - 0 transcript_id "g419.t1"; gene_id "g419"; 5 AUGUSTUS start_codon 2212966 2212968 . - 0 transcript_id "g419.t1"; gene_id "g419"; # protein sequence = [MLAKFKQGAQKAGIQATAFAHASGNKIASGSREFVQGFSLPGEAEKAAKILDSFLAGSGLVIARLPDGSWSAPSCIAT # GGLGWGLQIGADITDFVIVLNSEDAVRAFSLGGNVTIGGNVSAAAGPIGTGGKGRFTCSCSIGLFAGVSLEGTVLIERKDANRDFYGSPVPARDILGG # RVPPPEVASRLYEIIEAAEGLDETGLPQEAYVPTDTGDHISINSGHHMVFDADGQHH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g419 ### # start gene g420 5 AUGUSTUS gene 2216017 2216552 0.34 - . g420 5 AUGUSTUS transcript 2216017 2216552 0.34 - . g420.t1 5 AUGUSTUS stop_codon 2216017 2216019 . - 0 transcript_id "g420.t1"; gene_id "g420"; 5 AUGUSTUS CDS 2216017 2216310 0.9 - 0 transcript_id "g420.t1"; gene_id "g420"; 5 AUGUSTUS CDS 2216445 2216552 0.36 - 0 transcript_id "g420.t1"; gene_id "g420"; 5 AUGUSTUS start_codon 2216550 2216552 . - 0 transcript_id "g420.t1"; gene_id "g420"; # protein sequence = [MVGQEPFLLDGTIRENLDITGCKSDDDVWAAIESAQIQLLALARSLLSGKKIILLDEATAALDGETDDSIQEVIRSSF # KDCTCITIAHRIKTIKDYDQVVVLNHGLVEEMGDPAELLQKEGSVFRELAQASEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g420 ### # start gene g421 5 AUGUSTUS gene 2216729 2217994 0.21 - . g421 5 AUGUSTUS transcript 2216729 2217994 0.21 - . g421.t1 5 AUGUSTUS stop_codon 2216729 2216731 . - 0 transcript_id "g421.t1"; gene_id "g421"; 5 AUGUSTUS CDS 2216729 2217376 0.83 - 0 transcript_id "g421.t1"; gene_id "g421"; 5 AUGUSTUS CDS 2217467 2217994 0.29 - 0 transcript_id "g421.t1"; gene_id "g421"; 5 AUGUSTUS start_codon 2217992 2217994 . - 0 transcript_id "g421.t1"; gene_id "g421"; # protein sequence = [MEELPDSTKSIAMRSYMHYCRAASWYCIAVYLLLLLLTVGIQTITPVYLQVWSTYNDSHFSNRKSVVAYLPGYAAIEI # AYTFALCYVFYYMIMILSQNASRNLHEWQFSAVMHAPMSFFDSTQVGQTINRFSQDIAYIDGGLPLALYDFFYQMVRAIGGIIVMIIALPYMAAVVFG # ATSKRVRRLDLASKSPLYTLYQETMMFDALLTVRAAGAEGHFLDSSEILLARSQRPFYLSRNVAAWLVSSIGIMTSIVNTSVVLLAIGTRRSASAGLF # AAAMSQAISLQDMLNTMLTSWTKLEMAAVSLERNLDLVNLVPEDDDDKSQGPGISDDNEWPSRGEIELTNVMAKYRVTPILKDVSFRAPAGSSLGICG # RTGSGKRYVAVSFIIRPLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g421 ### # start gene g422 5 AUGUSTUS gene 2222034 2222606 0.76 + . g422 5 AUGUSTUS transcript 2222034 2222606 0.76 + . g422.t1 5 AUGUSTUS start_codon 2222034 2222036 . + 0 transcript_id "g422.t1"; gene_id "g422"; 5 AUGUSTUS CDS 2222034 2222606 0.76 + 0 transcript_id "g422.t1"; gene_id "g422"; 5 AUGUSTUS stop_codon 2222604 2222606 . + 0 transcript_id "g422.t1"; gene_id "g422"; # protein sequence = [MGRISRTLAELGGDVIGIKPTPFLKYSNGKLPEWGYNELVPDIHTQKARMAELSNGYLFLPGGFGTLEEFCAFRMWRK # LGEYTPYKIPKIFINIAVGIIKAPLVILNFENYYEDLVKWIELGADEGFISENAAAAFSVVQSLDKVSETFSTSSYATDEQLDLSDMAPPCNKEYLGL # PLPISRLATKNLRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g422 ### # start gene g423 5 AUGUSTUS gene 2222905 2223783 0.59 - . g423 5 AUGUSTUS transcript 2222905 2223783 0.59 - . g423.t1 5 AUGUSTUS stop_codon 2222905 2222907 . - 0 transcript_id "g423.t1"; gene_id "g423"; 5 AUGUSTUS CDS 2222905 2223783 0.59 - 0 transcript_id "g423.t1"; gene_id "g423"; 5 AUGUSTUS start_codon 2223781 2223783 . - 0 transcript_id "g423.t1"; gene_id "g423"; # protein sequence = [MESEITTITFIRERTTIPVPEILGYNCTFDNELGCPYMLMNRIRGWPIPDVVALTGGITEAQILKIHAQMAAVTWQLA # LKCTFPVIGQLQAQKNEETSYPLGQIIDRHARQLGPFQSSNDYYIARSVMIYNEAKRKGLDQESIDSAQLHVSASPLTFDPTVDKGPFPLQHPDLHRQ # NVLIDKDWNVVAIIDWSWCSTVPWQSFQPFPFNLAAYITPPDQKLCEIHEELFWKIFKSLDSETEIQGRDDSDVELLSRFSRSKVGRIAKLMNQYAYP # IPRGHDAKILKQVLTISQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g423 ### # start gene g424 5 AUGUSTUS gene 2225878 2226675 1 + . g424 5 AUGUSTUS transcript 2225878 2226675 1 + . g424.t1 5 AUGUSTUS start_codon 2225878 2225880 . + 0 transcript_id "g424.t1"; gene_id "g424"; 5 AUGUSTUS CDS 2225878 2226675 1 + 0 transcript_id "g424.t1"; gene_id "g424"; 5 AUGUSTUS stop_codon 2226673 2226675 . + 0 transcript_id "g424.t1"; gene_id "g424"; # protein sequence = [MAHSSSLTDSEIEILAALALAYSTTSFNYWELENIDLVLRVVDLADEKLLSLTFSLSYTVEQLYKLLHSSWNHSSTEE # LTPAGIIFLGTSDFPPNLDLPNFPDVKFAVSLDNISGKIELHPTSESRFILPRFHSLLSLLHDATPLETVLYELTSVTEHEEKLLLQWGVATPEQQSS # EHEYSAVIHHYIEKVARETPEAVALQFENHTFVRYGELDQQADNLARYLVHELGVHPGDLVLEFFDRSVEMIIAQLAIVSVVLFYVIFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g424 ### # start gene g425 5 AUGUSTUS gene 2227220 2228623 0.47 + . g425 5 AUGUSTUS transcript 2227220 2228623 0.47 + . g425.t1 5 AUGUSTUS start_codon 2227220 2227222 . + 0 transcript_id "g425.t1"; gene_id "g425"; 5 AUGUSTUS CDS 2227220 2228623 0.47 + 0 transcript_id "g425.t1"; gene_id "g425"; 5 AUGUSTUS stop_codon 2228621 2228623 . + 0 transcript_id "g425.t1"; gene_id "g425"; # protein sequence = [MLVDLTGMVNSMNVTFLETTPTLLSLLELDECPSLRFVYSSGEALSPTIHRKFLARKLAQKGKGESELLFANGGAPTE # TTVMSVFGPINIGDDSEQPVYGRPFGGNRLYILDSHGRLCPPGTVGQLWIGGPQVTKGYLGRDDLTAKVYRPDPYAGSGRMYNSGDLCSWLSDGHLRH # HGRSDTQVKIRGQRVEVNEVETTILKVLPVKAVCVIKHAYQSREELLAFVVSNVRPSALYVFQALMIFKQGLVLKNPQQMLSSHLPTYMVPSRFISIS # ELPVTSNGKTDQKKLLRLADDLASQRQISEASSESSRRPMSSAQRILLKAWSTSLSLAPEDIHSSSDFFTIGGDSIAAIRVAAICRAEGYLLNVVDFQ # AYSRFSAQTELLENRPFVGNRPALQQYTPFKLLETGIRDVILSEITEHGYQYSDIEDAYPSISSVAGLVSLAVTDPMVHSMLIFLEYTVSNLLWI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g425 ### # start gene g426 5 AUGUSTUS gene 2228678 2230474 0.52 + . g426 5 AUGUSTUS transcript 2228678 2230474 0.52 + . g426.t1 5 AUGUSTUS start_codon 2228678 2228680 . + 0 transcript_id "g426.t1"; gene_id "g426"; 5 AUGUSTUS CDS 2228678 2230474 0.52 + 0 transcript_id "g426.t1"; gene_id "g426"; 5 AUGUSTUS stop_codon 2230472 2230474 . + 0 transcript_id "g426.t1"; gene_id "g426"; # protein sequence = [MNTAWKLVVSRHQSLRTTFVIASELESSIIQVILKAGQFNLPWNYKAFESDADMDKAAQDYILQSEGFRLGKVPTTVA # LFEGDNSSTLVIQLHHTQFDGWCLPIILEHLQEAYAATTVSEDWIKASPPFSNFIQWVSSQPPADAIDYWRKKLESVAVPKWPNNAPNILLKTPMKGT # TNHSFISTFNDTEQLSTFCAEHEMTLSSLISAALAMVLGLYEDSDDVLFGVVTSGRTGDVPGIEDIVGYCVSTVPCRVHIPTDVSLEAIVKAVHDDLL # GSTPYQFLGLNDIITTAFPIPHDILRVLLTIENLPGLFEENSEFLGQNLRGFAIDVSYPFAVTVFPSPDNRQLKFHFQWDSEFLSRADVDWFQSHMYA # ILHAIIDHPSSQLRKSDFLANGETENILSLGRSVPDPPASVRPFFHQLVDEMGHQYPDKIAIERDNHQGRLTFKEYVARANQVAHALQGKGVRPEYMV # PVLFNQNTTNTDITIAFLAILKAGGAFVPLNSAWPEDRLQYCIHQTRGQILICETGLEGIATKLASLSELPLHVSRIEDLVRGQPSYTPATPTLQMDS # LSCAMFTSGTNGEPKGVLIEHGNIISSISK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g426 ### # start gene g427 5 AUGUSTUS gene 2234528 2238111 0.38 - . g427 5 AUGUSTUS transcript 2234528 2238111 0.38 - . g427.t1 5 AUGUSTUS stop_codon 2234528 2234530 . - 0 transcript_id "g427.t1"; gene_id "g427"; 5 AUGUSTUS CDS 2234528 2236598 0.98 - 1 transcript_id "g427.t1"; gene_id "g427"; 5 AUGUSTUS CDS 2236676 2238111 0.38 - 0 transcript_id "g427.t1"; gene_id "g427"; 5 AUGUSTUS start_codon 2238109 2238111 . - 0 transcript_id "g427.t1"; gene_id "g427"; # protein sequence = [MVADALNAITPSTDTPPYSIWREVQQTAAAGDEELLYSPSVGRFPAVGRVLSDETLGILSLLADDEIQRESSINFVSR # TNSPKEDTDRTGPGQRSTSTSIHARQLSVSSSDTAMPQRPSFNNLGLNLDWNSFSSSGFSQSSPLLTPLAETLLESKDSEVTSPSVTPSRKGSKKSVK # TPPHQSRRSLDVLPPITIPTTPGTWSQLQNDLTTTSGITAKTSSRVTKVELIPLDEGFIDFWNDSLLDPITDVEAWPKFVVCRLKTSIGTQAKKVEWI # VVEQQYIKPAPKILSVARSPTSHSTDTSAHETTVESTSSPKSPAMRASSPRPSLSSVNASVKRFSFWGGSKKDKGEKEDLSPTTKKKVKGVKIGEMGE # ILAQEEPKSPKVASPPKKVVEVPAVVEEEQEVQETKKNLVVAHVKAEIGSESIVSPGVAVAFTGIGAAGVSADIAELAVEVQQKVPHPDMEEQQKNLI # PAAMQAFNDPLIPIERLMNIAPKESSTVKEFSSTIQTDPRAAFDGSTSPELLPQVVASSVVESAPAVEAIEADADVPVELAIDEPAPQVQKETTLEEV # AEQIPDVQELESVVDVPVDEIVEDEPVTLETVTEPTDVQEPVTNVSASDASQSIPEPAQFVKEPAVAPIFVIEPTTTDEPEPMTEETVVNDSWGSARS # IHEPIVQELAEETAEATLVEEPEHARDVSSPQGPISTTVEDAPEPASPEETMPASRAESVLVQEQIDGPQAESQLPPEAAVEEVEDGPASAIASMNLE # SGSADLVVERFGNIKPAEELPVVNEAPAQEAEIITPSTDDLEDSQALALSEASTTIFSSELDPPPPAPIESTLVDLVDASAVSVEATEPATHIAERVH # EISLPEDTAPETEDNIPVAVEQSNDASNTQLPEMEAASEVVVSPPAFETSLPEPSQEVPESAENVKIKPQEPDTSVEPSNNHAPDLMPSIPVESATSV # NPTSEHAKTVNEDAIARENSEPAEDVVEVPEQPATIDDVEAEQNESLVRSEPLRESSPGLENDTVSLSEVPVVNAPVIPPASPSAHPVVIDTHPEELK # GNVPEDISDDDISDDLPDKYLSPAPATVVFAGETVGPALALNSSEIVTAALAGEAGDVDGKGEAVGDEIGADDADDVKESEVGNGTRSYEAMHDEVKS # KHEAERKCPFDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g427 ### # start gene g428 5 AUGUSTUS gene 2239588 2240352 0.56 - . g428 5 AUGUSTUS transcript 2239588 2240352 0.56 - . g428.t1 5 AUGUSTUS stop_codon 2239588 2239590 . - 0 transcript_id "g428.t1"; gene_id "g428"; 5 AUGUSTUS CDS 2239588 2240352 0.56 - 0 transcript_id "g428.t1"; gene_id "g428"; 5 AUGUSTUS start_codon 2240350 2240352 . - 0 transcript_id "g428.t1"; gene_id "g428"; # protein sequence = [MMLWHIYAALEEGLERHATHPVLEPTYNPPLLRRAPSLSSDIAQLLQVSESTWKSHPIHQSLITSPPKAMSTYVNRIH # DISNSGDPTPLVAHAYVRYLGDLSGGQTIRHSLAKAYDLDEASGEGLSFYAFKELSSSKPASLGEMKRIKDWFRNGMNEGAGDNTSVKGIGDLVISFT # RVSYVRCFVLLAVIAQEAKDVFRYNGDLFNAILEDPEQVRKDSPVTPKAQYSSGIAVSSVLAVITAGRSSFKPRPAPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g428 ### # start gene g429 5 AUGUSTUS gene 2245116 2245985 0.53 - . g429 5 AUGUSTUS transcript 2245116 2245985 0.53 - . g429.t1 5 AUGUSTUS stop_codon 2245116 2245118 . - 0 transcript_id "g429.t1"; gene_id "g429"; 5 AUGUSTUS CDS 2245116 2245985 0.53 - 0 transcript_id "g429.t1"; gene_id "g429"; 5 AUGUSTUS start_codon 2245983 2245985 . - 0 transcript_id "g429.t1"; gene_id "g429"; # protein sequence = [MVSSAGREIWQALGIAPIAKVEDDLAAFITPNTLTSLDLTNRDDLFALISNLGFPWHPEKGKHQFVLTFTFIGFLWDL # ELRRVSLPEDKRLKYLFRLQNFLDTSHRCLTPRAKIESIHGTLCHIAFIYTDGKTHLPPFSNFMSSYRNHEVEKGKYPDKIIPEIQWWIKRLSVPHVY # RQLRELGPMQDLGLFVDASTDWGISIIIGGKWAAFHLANDWKIEGRDICWLETVAVEILIYFLESMNYRNTRLLIHSDNQGTIGAIRKSRSPNYWINM # SIRRTCAIIGPLFSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g429 ### # start gene g430 5 AUGUSTUS gene 2246906 2248275 0.46 - . g430 5 AUGUSTUS transcript 2246906 2248275 0.46 - . g430.t1 5 AUGUSTUS stop_codon 2246906 2246908 . - 0 transcript_id "g430.t1"; gene_id "g430"; 5 AUGUSTUS CDS 2246906 2248125 0.85 - 2 transcript_id "g430.t1"; gene_id "g430"; 5 AUGUSTUS CDS 2248218 2248275 0.46 - 0 transcript_id "g430.t1"; gene_id "g430"; 5 AUGUSTUS start_codon 2248273 2248275 . - 0 transcript_id "g430.t1"; gene_id "g430"; # protein sequence = [MQITRQGPLPNDPSIISANYSHASRRERVFEGNDDVSDVSSYLSIPEEEYDKMLKDQDYFDKVKAWLSAHTISWLVDR # RKSLRSRPREGDDASAEASGTQPSKRFRSNDDLNEIDPTSPPNVFFDQAFLDLGLYGYHIPLALFTNKNIEFLNNNSISFHRTKISHIEGKPQILDLA # DVIKKVKGSREGGPTQDSAMEHFEWIEATANFFVYQSLLYAEGDEANEPQFYRKHFGFFENQTDSVKLFDLWKDIELELRQKHQNKKTHFDLFDYRTE # WSRVKSRLDSLEASSSSNSSQPQSNRRSHIPNFRSTKIAAHDSPPTTSSNSFPLGNKDKASREPCCIICGGVGHTFFTHSDSTHGPAKWALRDGKELL # HPSSKVRLCTYWNIFSTCSKKCSSASHICTFCGGSHPALRWDPSCTVSRPAGY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g430 ### # start gene g431 5 AUGUSTUS gene 2252025 2252714 0.29 - . g431 5 AUGUSTUS transcript 2252025 2252714 0.29 - . g431.t1 5 AUGUSTUS stop_codon 2252025 2252027 . - 0 transcript_id "g431.t1"; gene_id "g431"; 5 AUGUSTUS CDS 2252025 2252714 0.29 - 0 transcript_id "g431.t1"; gene_id "g431"; 5 AUGUSTUS start_codon 2252712 2252714 . - 0 transcript_id "g431.t1"; gene_id "g431"; # protein sequence = [MEYDQMYDRHPSQSYQQHHPVTSLRPLHHRASFSSSYQENDRGSHSTSMNGWYDQRHREDYDMHTQNNHPPTISIPPA # PASSSIDERSPHQPMQFNYSYDRSSRSGPSPVATASTYSWSPHSPYPSRHSSSPVRLSHPQYGPSSSQMPSDTPMHSFHNPPPPTQMYSGPGVTGFGP # PIPPHSLPMHPPGNAALADLGLASRDSRLDERWSSFMQDSGLLDEVNFSQGNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g431 ### # start gene g432 5 AUGUSTUS gene 2253512 2253754 0.24 - . g432 5 AUGUSTUS transcript 2253512 2253754 0.24 - . g432.t1 5 AUGUSTUS stop_codon 2253512 2253514 . - 0 transcript_id "g432.t1"; gene_id "g432"; 5 AUGUSTUS CDS 2253512 2253754 0.24 - 0 transcript_id "g432.t1"; gene_id "g432"; 5 AUGUSTUS start_codon 2253752 2253754 . - 0 transcript_id "g432.t1"; gene_id "g432"; # protein sequence = [MVREFPLPEGFGDRGAGSSAKEAGGVPNTFPTASKYANPPTAESECQDSDMSFSFMKCVLDHIRETGEPSAGITLGIN # NK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g432 ### # start gene g433 5 AUGUSTUS gene 2254329 2255570 0.46 - . g433 5 AUGUSTUS transcript 2254329 2255570 0.46 - . g433.t1 5 AUGUSTUS stop_codon 2254329 2254331 . - 0 transcript_id "g433.t1"; gene_id "g433"; 5 AUGUSTUS CDS 2254329 2255287 0.71 - 2 transcript_id "g433.t1"; gene_id "g433"; 5 AUGUSTUS CDS 2255375 2255570 0.46 - 0 transcript_id "g433.t1"; gene_id "g433"; 5 AUGUSTUS start_codon 2255568 2255570 . - 0 transcript_id "g433.t1"; gene_id "g433"; # protein sequence = [MDEASSGGGLRRRSRDKRGTGDVIDALGTLSISNHGISRFFGPTGGSESLLIVSNSHHVAVQPALMFERESSSLSPPS # SHKSQTTNASTQPSADSVFSSGTTLSSGSTRTIDPRITLFSHRFPFTPLALPSAQIQELIESYLPTYERAREVINIYFEQVAWIFRGVTREQLDGEMV # GAIYARKYAKDRGEIVGEGNYDSDEHFVNLSNSRGRQLKHGSEEVPESTSIPGPLPPLGVDYSGPHDLALLFMVFALGALLEPIPSNGHSSDSPSGSS # PNSNISTGAASRPSPNALGEHYHQLAQAALSLQPVLEKPSIVTIQCLHVMSIYNAMSGEGTANPSSDTDSAGNNLTGESKTGQSETSMEMTWSLITMA # AHLSQTVRIRFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g433 ### # start gene g434 5 AUGUSTUS gene 2262910 2263814 0.26 + . g434 5 AUGUSTUS transcript 2262910 2263814 0.26 + . g434.t1 5 AUGUSTUS start_codon 2262910 2262912 . + 0 transcript_id "g434.t1"; gene_id "g434"; 5 AUGUSTUS CDS 2262910 2262946 0.52 + 0 transcript_id "g434.t1"; gene_id "g434"; 5 AUGUSTUS CDS 2263077 2263109 0.42 + 2 transcript_id "g434.t1"; gene_id "g434"; 5 AUGUSTUS CDS 2263180 2263425 0.52 + 2 transcript_id "g434.t1"; gene_id "g434"; 5 AUGUSTUS CDS 2263485 2263518 0.89 + 2 transcript_id "g434.t1"; gene_id "g434"; 5 AUGUSTUS CDS 2263577 2263814 0.69 + 1 transcript_id "g434.t1"; gene_id "g434"; 5 AUGUSTUS stop_codon 2263812 2263814 . + 0 transcript_id "g434.t1"; gene_id "g434"; # protein sequence = [MEPPSLCSLTPAGSVNGVWLVLVLPEQAYSAYLQFFQVYANPSVVSASQSSSNPAGQGLIGLGPNSGSNVYAEFNNNT # GASVCDRIFIQNTSSPNYITVNLGRTDDPSADFPGNITIGETLDGLGNITSEPKLEVTTVSIHDTGDQHFQILIDSDGIIGPDNQSISYTTEVDSTSN # SKQATAVLDTGFSLSQVPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g434 ### # start gene g435 5 AUGUSTUS gene 2266843 2267694 0.37 + . g435 5 AUGUSTUS transcript 2266843 2267694 0.37 + . g435.t1 5 AUGUSTUS start_codon 2266843 2266845 . + 0 transcript_id "g435.t1"; gene_id "g435"; 5 AUGUSTUS CDS 2266843 2267694 0.37 + 0 transcript_id "g435.t1"; gene_id "g435"; 5 AUGUSTUS stop_codon 2267692 2267694 . + 0 transcript_id "g435.t1"; gene_id "g435"; # protein sequence = [MFQKLRVSNNDGIIAGRHLWKRGKWSIYPKDPPDAGIHRDLKPLRIPLHSKRSKRCPACTHILIKPEQKAQSVRYKIK # LVAANYLPAITVALPHQIEMLGHISAEAAKRSTKAPVDDDKDTRGGLQAGKTYPFHMSLTNPLYDPIQVRLSVQRMHVAAAVSSGEGGTIDKARRPPF # AISIPTTPFSVAPFAEAWEYEDDEEMFGLDDDELEARLSGREKEPKPRSKTVGILEKRANVTVVGGEVALGKEARGEVKVSLLDFDGLISLCSSIAVQ # HAGCVYVSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g435 ### # start gene g436 5 AUGUSTUS gene 2268943 2269956 0.74 + . g436 5 AUGUSTUS transcript 2268943 2269956 0.74 + . g436.t1 5 AUGUSTUS start_codon 2268943 2268945 . + 0 transcript_id "g436.t1"; gene_id "g436"; 5 AUGUSTUS CDS 2268943 2269956 0.74 + 0 transcript_id "g436.t1"; gene_id "g436"; 5 AUGUSTUS stop_codon 2269954 2269956 . + 0 transcript_id "g436.t1"; gene_id "g436"; # protein sequence = [MVSITASSSSAPSSSDAISTEEMRPRAGPLPSKRGEIGFREDLEKEETVQGEDSSSSLPERHPADRDSPPTSNPAADA # PAAIPTTFPGSPASTSDDASTSALKKPKTLLSFLKRKKFGGIQLGTLNVFAIQLFITFGTIGAWTVAGLFLSGKAQSRSSDSTMSAASATIFVHVIFA # VAFLSQCLFLERRIYVMRAQRYAFLHPGEILPFSRRGQPVDDSVAFSPWNRPPLPTYAAALAQSGVGTGDVEDHLIAAPPPPAYGNTRGSTLLLSGFL # NANLRAQRPISVRTEISQHHQDRPVSYVSDDEEWEVIQNADRARRLEETLTTLERPGNRNSRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g436 ### # start gene g437 5 AUGUSTUS gene 2272289 2273382 0.45 - . g437 5 AUGUSTUS transcript 2272289 2273382 0.45 - . g437.t1 5 AUGUSTUS stop_codon 2272289 2272291 . - 0 transcript_id "g437.t1"; gene_id "g437"; 5 AUGUSTUS CDS 2272289 2273289 0.93 - 2 transcript_id "g437.t1"; gene_id "g437"; 5 AUGUSTUS CDS 2273355 2273382 0.5 - 0 transcript_id "g437.t1"; gene_id "g437"; 5 AUGUSTUS start_codon 2273380 2273382 . - 0 transcript_id "g437.t1"; gene_id "g437"; # protein sequence = [MSWFPTWLQKRITDAGHIFISPDYRLIPSGSTTGHDILEDVLDIFKFIVNVFVDIAPEQTEQNPRPVQYRVDPKRIAV # SGSSAGALCAYLAAMHATPKPKAVLSLYGLGGNFLIPQYYTPKHSVFFRGREMLDPALFSDFLYPKCLSPSSRVITDSLNTYFPPDAPADVVAIPGLE # TNTGPPGFPSNRRMFLGRLYLQLGEFLNYYTGEYDPGLSLALRKKAEDIELTRSDSDSSSANDLEEILARRIPEKHRSLFPSLCPPDAYASWPPVYFF # HGSLDSAVHVQESQHLHNLLIKAGIRSILNIAEGMEHSFDYQPDADVIHAEAFNEIGSWLDEILRETS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g437 ### # start gene g438 5 AUGUSTUS gene 2276127 2276471 0.88 + . g438 5 AUGUSTUS transcript 2276127 2276471 0.88 + . g438.t1 5 AUGUSTUS start_codon 2276127 2276129 . + 0 transcript_id "g438.t1"; gene_id "g438"; 5 AUGUSTUS CDS 2276127 2276471 0.88 + 0 transcript_id "g438.t1"; gene_id "g438"; 5 AUGUSTUS stop_codon 2276469 2276471 . + 0 transcript_id "g438.t1"; gene_id "g438"; # protein sequence = [MNEHLTKPTKYDIEDSNIALLGSDVCSSFPTFVDLLNKFATCSSKSAFENTVEIRKQHGMKLEPPQAYKFGVLKSFMW # FPGPQRRREGSTMVIHTSYFMCVEFCARFAGMAHLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g438 ### # start gene g439 5 AUGUSTUS gene 2276600 2277547 1 + . g439 5 AUGUSTUS transcript 2276600 2277547 1 + . g439.t1 5 AUGUSTUS start_codon 2276600 2276602 . + 0 transcript_id "g439.t1"; gene_id "g439"; 5 AUGUSTUS CDS 2276600 2277547 1 + 0 transcript_id "g439.t1"; gene_id "g439"; 5 AUGUSTUS stop_codon 2277545 2277547 . + 0 transcript_id "g439.t1"; gene_id "g439"; # protein sequence = [MSTNLWCIHSLEFCADLQGVPVQYREVQGYESDQFLSHFPHGFVCLKGGISTGFHHVSDMPPVDTHKLYRISITPNLH # PSKSHAHLVAIREVPFSGSSLVEGDAFVLDKGTKVWQLNTKESAGKEKFRAAEFVRSLSGNRRGGCQVTVFGEQYMRSWISPESMLIDHADEGGHGTG # IFLAEFGEGTIIHHDTAQSHSPDGSTPTLNLYRLSDFSGTPSFSAIEPPITFSSLSSSDAFILDNTLTKTSSAALYVWLGAQSSLTERRLAVQYAQRY # LHDKIGDNTTKSRNVVAIPIVKMQEGHESDAFLALLRGEDH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g439 ### # start gene g440 5 AUGUSTUS gene 2278073 2285002 0.86 + . g440 5 AUGUSTUS transcript 2278073 2285002 0.86 + . g440.t1 5 AUGUSTUS start_codon 2278073 2278075 . + 0 transcript_id "g440.t1"; gene_id "g440"; 5 AUGUSTUS CDS 2278073 2285002 0.86 + 0 transcript_id "g440.t1"; gene_id "g440"; 5 AUGUSTUS stop_codon 2285000 2285002 . + 0 transcript_id "g440.t1"; gene_id "g440"; # protein sequence = [MGGAGTDGAKGKSSDIQFTQNSTATDSAKDSAAQDKPSSYDEVCSSHPLRDAAIPHTVSTANASKAAVGTVGSISVAH # KGQTTGVGPGLVSQGGNNPTGSANADEVSSEDVNRSNVDEINENSSGLSSAPDSEDDGQGPWTTVQSRRSKSLDNLKTRKDFFKPDKLTKEQKATVKA # AEQRMTSAQREIINNRNIAIQKQQQARSYSKPQEVGPSSYVTKGKFVDHNNEVCDAELNIEVQKAELNHWNTAHGSIGAKNISSDVESEISDKSRRRL # RKNYHHKNGSQRRKSRNSKSEHSNSGTDDSANEHKKTKTSSRSIFKDVESLKPISSRFAKKIKDIAKGHQTMSKSTTHHGRHLSTQPVDQLPQDSLLA # RMIKTKKRSKKSIKNHESSSDSDADSESSDSESRSESMSSNGSSSSSSEELDSSDESVQCRKRHRHRSRSHSRKRGGRKSKKRTYNRIIKPVPPSIWN # GEADAEVFQRIVLEGYQFCKEGKIPKNERVFLISHYLSGKAYQFFALKVAKNHSKWSLQESYEGLFNYCFPVNHREQMRTKLRKCYQNGRTVSEYVHE # LESIMDHVGIMSQREKVLKLWDGLSPGMRYELKRARVSKEVHSWRRIVREAELIELAGFEKDPSPRFAPKQSDRPRDDGIYFNKRDKNGRFRQRYHNS # STREKSEPIRTAPQSTPAPPSSSAPRNSARSDHSVRHNKNDYQSGRGRPQTNHDRTSRTTRKPDSDGNCYKCGQPGHFARNCPSNNIVHSRNNGPPGI # SARGMQFPLHDESSEMLAQLVETTEQPGVLTLNMMHFTSFVNDVSEDSAFEYMSEDNISLTPISNADSVLEDGLLPLPSNLSCSEIPDNDYDSLPDLE # SVSDSDIEADDIPDLQDVSDSEYDDDDMFDSLSTFEIDLLESDLWPQCSDSDPEGEESINLESDSETLYQTEISSETPTMSGNESDSISESSETPEFS # FASDAKEVFGYPTTNWSDFFLHKTLEPGWWPRAIDDWMCLALTFVLNHDAPYPFDFMLWGAEGSYRFHVRNLDDGNYGITDENAPYDELTLPAQLLND # TTFKPRAWYAEQQTNLLNYPFDAGHWQDISTHLGDVYMQGMKFVLTCGIPAYPKSAFPALHDPFERFMIYKASGDDEDEYYFKDRENHLFSKHLPISL # LRNTKFNLVGWWCKQLTKSLHDIEVRLERKRIATHRKAFRKAKRSTWTCQKQGEIIAHAVAECLELNQPFPGDPELLERFYCRFDTWMTSDNLTICIL # DLLRKIRCDVSMEKAIQPGFKPGELWNEVCARISDVPEFIDMDYSRIGHLLETTARNKLARHVPFIPAIEAPGYSSRDNYSVYIDPEDSSQFIIADEG # RDFKTRISVNLLIRPQFNLPAWYRKRLENAENELLQRLRGPVECEFLPRLLFGTPTDEFELELDQLVGFSDHYLHLLLGNLSWEERNGLVHVTSLANA # YIEPKTYPGLQRNSGIAKEVGRLVPRPIVIVVRINDRPVRALIDSGSLGDFMSTQLSDQLKVTKQFHKTPIPLHLAIQGSRSKIHCGTTVNLRYQSIH # ADHYFDIANISNYDLILGTPWLFQYQVRIGLNPTTIEVGSDVPTAIQGDNVAEVRAQSMSIDGDDLEGTRNVLLQYAQPICKTAAETPLPPLRRINHT # IPLIDENKIYPWRPSRCPEAYRPQWDQKRNDYVRSGRWIVTNSRNTVPMLLIPKAGQKDSLRVVFDLCARNANTYKMASPLPNIEGILRRVAKCKYRS # IVDGKDAYEQIRIVPEHVPRSTVTTPDGNMDSQVIQQGDCNGGATFQTVMNDLFSSMIGVFMDVYLDDIVIYSNTLEDHIRHVKMVIDILQREQFYLN # AKKLNFLPRELKILGQIVDDAGIRMDPDKVDSILKWKVPTSKEMLSGFLGAVGYLTDNLPGIRGPMGILHARTGAAVPFQWTFTEQRAFEDIQRITHQ # WQNHSRVPLDYSTGHKPIWIVTDASSASIAGFVCQGTNWRRSKIAAFFSAKLNSAQQNYAVHELEMLAGVETMLRHWDILQGTNFTWITDHKGLVHLL # KQKNLSGRQARWMEKLGEFDFTIEYVPGEENILSDALSRIYLNDAPGTVRAASEYTLFDDNSDNSHLGLHSVSMPVFTGQEARNKRVRKPVETADTGR # PETSKEFAARMKGRVRFLTPRKRGQEGAGTTGILLTTKSDKKSDFNMDYIENNVSVDVESQPKPPSSNGKLTIKLPARPKVPAHRSQREKADGHTQEH # VSKANSTSGTNPGLPAGEAPDSVNSITELDSGLSDATLISVLSKTNDNFDLYSALKGRYKEDPLFKKILESPKDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g440 ### # start gene g441 5 AUGUSTUS gene 2288128 2290428 0.66 + . g441 5 AUGUSTUS transcript 2288128 2290428 0.66 + . g441.t1 5 AUGUSTUS start_codon 2288128 2288130 . + 0 transcript_id "g441.t1"; gene_id "g441"; 5 AUGUSTUS CDS 2288128 2290428 0.66 + 0 transcript_id "g441.t1"; gene_id "g441"; 5 AUGUSTUS stop_codon 2290426 2290428 . + 0 transcript_id "g441.t1"; gene_id "g441"; # protein sequence = [MTSYSTQYYGSIYLQNDLEKQGRLKPTRTSSFRVGDYHNFEVINDLIYLKQRETRVLCIPRIIINGRSIQEIITAEAH # SLLAHLGASKTLDYLRDHVWWKDMVADTKSFCESCHVCKLSKPDNTKSYGKLHPLEIPSYPWEAIGVDFVGPLPQSKNCDSSFDSICVIIDLLTSMVH # LVPCKTTYTARQVAELMFEHVYKLHGLPKRIISDRDSLFTSIFWKRLHELIGVNLHMSSAYHPQSDGATERANRTVTQMLRQCVSATQKDWVSKLPAI # EFAINCARSESTGYAPFILNNGRMPRSMVWSSDLSNEYPSVRTFARLRRLAIMAAHDSILEARVKQTRAANRKRRFDSFKEEDLVYVSTKNLTFEKGL # ARKLIPKYIGPFKITKDFGNHSFRVSLPNHFIQRGVHPVFHSSLLRIHVPNDDRRFPGRLDTQLHESPVAQPQWRIEKILSHTGSRRHAIFQVQWSTG # DITWMPFAEISQLPCLPEYLELLGLQTIDQLPKGAGTVPEEVSIEMGIASIWFQVFDLCDGFENMKFSPSSSSYNSDSLSNPFPPSVYQHSLPASPHI # SHSSLPILPHPIMAPLEFQHIERQSHSKFALVAKNDDGDKIVFSAQQVRLYVYFDKNLRRMQKRIGYTPIGYHSFASEFNKEDLPYKFAYWDHASFHK # PTITNLNTQSPPMSIFGIEEWECFAPNKAVRPGYEEVLSTEYRELCSMALEQARGATRGRRKAEVRKQEKKNAAAAAEHKKTGTLHFHSGPKNAGSSS # RS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g441 ### # start gene g442 5 AUGUSTUS gene 2296061 2297227 0.92 + . g442 5 AUGUSTUS transcript 2296061 2297227 0.92 + . g442.t1 5 AUGUSTUS start_codon 2296061 2296063 . + 0 transcript_id "g442.t1"; gene_id "g442"; 5 AUGUSTUS CDS 2296061 2297227 0.92 + 0 transcript_id "g442.t1"; gene_id "g442"; 5 AUGUSTUS stop_codon 2297225 2297227 . + 0 transcript_id "g442.t1"; gene_id "g442"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEEHSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHIAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASLTPTSASAPVAATPSPPNQDFSNQIGQIRELLD # RVNAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g442 ### # start gene g443 5 AUGUSTUS gene 2297596 2298753 0.55 + . g443 5 AUGUSTUS transcript 2297596 2298753 0.55 + . g443.t1 5 AUGUSTUS start_codon 2297596 2297598 . + 0 transcript_id "g443.t1"; gene_id "g443"; 5 AUGUSTUS CDS 2297596 2298753 0.55 + 0 transcript_id "g443.t1"; gene_id "g443"; 5 AUGUSTUS stop_codon 2298751 2298753 . + 0 transcript_id "g443.t1"; gene_id "g443"; # protein sequence = [MDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPELEPPAENP # HIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLP # AHQPWDHAIDLVPGAPATMCTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRL # QGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLDDTPKCWLDVYIVN # CDIFTYRFVSRGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g443 ### # start gene g444 5 AUGUSTUS gene 2303500 2304554 0.68 + . g444 5 AUGUSTUS transcript 2303500 2304554 0.68 + . g444.t1 5 AUGUSTUS start_codon 2303500 2303502 . + 0 transcript_id "g444.t1"; gene_id "g444"; 5 AUGUSTUS CDS 2303500 2303796 0.68 + 0 transcript_id "g444.t1"; gene_id "g444"; 5 AUGUSTUS CDS 2303976 2304554 1 + 0 transcript_id "g444.t1"; gene_id "g444"; 5 AUGUSTUS stop_codon 2304552 2304554 . + 0 transcript_id "g444.t1"; gene_id "g444"; # protein sequence = [MSHSRTQTITTPSSTAAGPSRSRLLNPPPADPVNDDDEALEEDDDEAIRQAEETVRRMKARKAAAAARRKAEEEAAKK # AAEEAQRKKEAAARELEERRRPVGGDPDDGDDGDDDDDDEDDRTPCERCRSKRIPCLQQAGKRSSTTCKPCHDAKVRCSHSNRPPTVKKEVASHPTGE # RLAVLESQVAQLLADNRVLREGQIKSNTYDRHIIKKLEWLMRDAARRRDSPPEMPEPGPSRLPKKRRRVVDSEEEEEDRIVGTEDGEGEEEVEEEEGI # EPAPKKARSEKGKEREE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g444 ### # start gene g445 5 AUGUSTUS gene 2304841 2307209 0.61 - . g445 5 AUGUSTUS transcript 2304841 2307209 0.61 - . g445.t1 5 AUGUSTUS stop_codon 2304841 2304843 . - 0 transcript_id "g445.t1"; gene_id "g445"; 5 AUGUSTUS CDS 2304841 2305638 0.83 - 0 transcript_id "g445.t1"; gene_id "g445"; 5 AUGUSTUS CDS 2305761 2307209 0.7 - 0 transcript_id "g445.t1"; gene_id "g445"; 5 AUGUSTUS start_codon 2307207 2307209 . - 0 transcript_id "g445.t1"; gene_id "g445"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGASWIWDSSC # QEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHNKELLAIFEAFRAWHHYLEGSGDPVDVV # TDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASII # MDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRD # YVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGFTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSD # RGSEFVSAFFRALDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRIS # HPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIKVDGEEEYNVAEIL # DSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHSLDLDHTKNIYSFPPFFAMLRRSLLRVFRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g445 ### # start gene g446 5 AUGUSTUS gene 2330380 2331492 0.55 + . g446 5 AUGUSTUS transcript 2330380 2331492 0.55 + . g446.t1 5 AUGUSTUS start_codon 2330380 2330382 . + 0 transcript_id "g446.t1"; gene_id "g446"; 5 AUGUSTUS CDS 2330380 2331492 0.55 + 0 transcript_id "g446.t1"; gene_id "g446"; 5 AUGUSTUS stop_codon 2331490 2331492 . + 0 transcript_id "g446.t1"; gene_id "g446"; # protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE # VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDISKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDI # VESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRCERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIR # RTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMSPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g446 ### # start gene g447 5 AUGUSTUS gene 2331754 2333208 0.42 - . g447 5 AUGUSTUS transcript 2331754 2333208 0.42 - . g447.t1 5 AUGUSTUS stop_codon 2331754 2331756 . - 0 transcript_id "g447.t1"; gene_id "g447"; 5 AUGUSTUS CDS 2331754 2332181 1 - 2 transcript_id "g447.t1"; gene_id "g447"; 5 AUGUSTUS CDS 2332263 2332398 0.95 - 0 transcript_id "g447.t1"; gene_id "g447"; 5 AUGUSTUS CDS 2333041 2333208 0.7 - 0 transcript_id "g447.t1"; gene_id "g447"; 5 AUGUSTUS start_codon 2333206 2333208 . - 0 transcript_id "g447.t1"; gene_id "g447"; # protein sequence = [MPIHQKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHELLNRRSTPYPTTGSNKGSNKEEKS # AVNDVPPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKS # RQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g447 ### # start gene g448 5 AUGUSTUS gene 2334316 2336867 0.56 - . g448 5 AUGUSTUS transcript 2334316 2336867 0.56 - . g448.t1 5 AUGUSTUS stop_codon 2334316 2334318 . - 0 transcript_id "g448.t1"; gene_id "g448"; 5 AUGUSTUS CDS 2334316 2334843 0.95 - 0 transcript_id "g448.t1"; gene_id "g448"; 5 AUGUSTUS CDS 2334968 2335005 0.94 - 2 transcript_id "g448.t1"; gene_id "g448"; 5 AUGUSTUS CDS 2335101 2335135 0.56 - 1 transcript_id "g448.t1"; gene_id "g448"; 5 AUGUSTUS CDS 2336344 2336867 0.59 - 0 transcript_id "g448.t1"; gene_id "g448"; 5 AUGUSTUS start_codon 2336865 2336867 . - 0 transcript_id "g448.t1"; gene_id "g448"; # protein sequence = [MASTSSQTRAVASTILLPSSLAEAQELLAGIKSKSSLPSFFDSSEYQRLLDGKYVPPILSSQNSPDYDGLSALPIFLY # PRALVSFSFPQDSQFPLSVASGLDLFCCARMIIRSLQASVESSGDSDEIYEAIEEAAPFLVRSYSSFLSLLFINFHFRIISMIFGLDVPTVLYLPNFL # QFLRRLAFQLYVDLAMDALNALHELRTQLDRLGSLFDQARQSFLQSFRDLQQAGQDPIVVLEALKAADPQRKSLSVEDWTVLATLFQWSSPFNLNGLN # FDNRTPAEWIDLLRGLHSGASSATVTADGHLVDDSQPPAAAVEVSEALDPQGSLPNTVVEKASGVEDLASLSEGSPIQTELDLPQIESLTEPTLSPEK # GI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g448 ### # start gene g449 5 AUGUSTUS gene 2339608 2340192 1 - . g449 5 AUGUSTUS transcript 2339608 2340192 1 - . g449.t1 5 AUGUSTUS stop_codon 2339608 2339610 . - 0 transcript_id "g449.t1"; gene_id "g449"; 5 AUGUSTUS CDS 2339608 2340192 1 - 0 transcript_id "g449.t1"; gene_id "g449"; 5 AUGUSTUS start_codon 2340190 2340192 . - 0 transcript_id "g449.t1"; gene_id "g449"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTARIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNVIKYAAPIIFLFSPSR # RLYLYDTSSHHCQTPIDY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g449 ### # start gene g450 5 AUGUSTUS gene 2342358 2342997 1 + . g450 5 AUGUSTUS transcript 2342358 2342997 1 + . g450.t1 5 AUGUSTUS start_codon 2342358 2342360 . + 0 transcript_id "g450.t1"; gene_id "g450"; 5 AUGUSTUS CDS 2342358 2342507 1 + 0 transcript_id "g450.t1"; gene_id "g450"; 5 AUGUSTUS CDS 2342611 2342997 1 + 0 transcript_id "g450.t1"; gene_id "g450"; 5 AUGUSTUS stop_codon 2342995 2342997 . + 0 transcript_id "g450.t1"; gene_id "g450"; # protein sequence = [MRFLYKYPQRRYLYKELVTKNQNRSRDIAEYEILDSDAFDEDRYWDVFMEPLMPSLTAHNRSGIDYITAKHPDQPKTH # LYCPPSLPPVGPDGNFDVDPETEAVEPELLFTENNTNFSRLYGGQNETPYLKDAFDDHVIPSHRPPPPEGNEDFFSYKIRSRARVYSTAGSEFDEHVF # YY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g450 ### # start gene g451 5 AUGUSTUS gene 2345873 2346295 0.93 + . g451 5 AUGUSTUS transcript 2345873 2346295 0.93 + . g451.t1 5 AUGUSTUS start_codon 2345873 2345875 . + 0 transcript_id "g451.t1"; gene_id "g451"; 5 AUGUSTUS CDS 2345873 2346295 0.93 + 0 transcript_id "g451.t1"; gene_id "g451"; 5 AUGUSTUS stop_codon 2346293 2346295 . + 0 transcript_id "g451.t1"; gene_id "g451"; # protein sequence = [MEAKYAPPDDPALQLTPPEFQVLADTVYASLGSPVITLNNLWGVYSDMLEGLRLLREAQTESFQTVLQGSDAAFNCEM # PLIPGLEELREGLEIVPGGPRYMGGINLGEGVVFDIQEQESESGDDEDHREYADWTDLEDEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g451 ### # start gene g452 5 AUGUSTUS gene 2347359 2348780 0.55 + . g452 5 AUGUSTUS transcript 2347359 2348780 0.55 + . g452.t1 5 AUGUSTUS start_codon 2347359 2347361 . + 0 transcript_id "g452.t1"; gene_id "g452"; 5 AUGUSTUS CDS 2347359 2348780 0.55 + 0 transcript_id "g452.t1"; gene_id "g452"; 5 AUGUSTUS stop_codon 2348778 2348780 . + 0 transcript_id "g452.t1"; gene_id "g452"; # protein sequence = [MIVVPGVHINIGVHALKALAFSKILPMWQQWSSNHPLSICDVSMKDKNWLEFEPLNIHDTDAIKAQYYSNPKKANAPP # AFKKDHKASILLHVPNRIIGEVEYQKATKTCEQDQESTGTPTRSPSPTVGSSRLFKPSTPPQESYKKARKGEIPSVYRSPDREKLAAALRAEKMPKTT # NNIAIREHRSFVLKHYNSLYLMLVRESAIPVRVFHAKNLHLDQLILLAGRNAAWSEYCEEGTPSTLFVDLSEKKAAKGEFKMTSLGQSEPPVFDGPEV # AVKQLFFTKTSINSKPSKTSENISKGRETTVVKHFYPCDPENQHRALVMELKVIQYGQALLNLVYAYIQSVNPSENVDRFIEILKFRFVQTALAVEQV # PLSTPGTRPRVFLLEEDLLAMNKGPFKKYMSNMPHIFMIFDNSEDAVRADFLRFTQHVMYWKTGKIAYVSDYQGRYCRTTMLLLVDNFILQGIARHSL # TVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g452 ### # start gene g453 5 AUGUSTUS gene 2356488 2357498 0.8 - . g453 5 AUGUSTUS transcript 2356488 2357498 0.8 - . g453.t1 5 AUGUSTUS stop_codon 2356488 2356490 . - 0 transcript_id "g453.t1"; gene_id "g453"; 5 AUGUSTUS CDS 2356488 2357498 0.8 - 0 transcript_id "g453.t1"; gene_id "g453"; 5 AUGUSTUS start_codon 2357496 2357498 . - 0 transcript_id "g453.t1"; gene_id "g453"; # protein sequence = [MSNDNRLPVSDDIIDRILLFSPTFTSLQATILTCKSFYHVFQTHPKSIVRAVASNITGPALPQALECIRHPDIAKCSH # RFRPPTHWGESDEEDEDEEDGGGGGGGGSEHFSDDDDDDDDSARAKRLESVVQEANEQRSRSEENNTRPVGDDTGDIQSAPITIEETYKILANAKVVA # RLEDLFSFRQVNILTSGCSKFNQPTNPPFPPFARYINRSFSTSQLSATESRDFRVAVYHFMLYSSIFHPGTWNLSSDSEDNDDDDDDNDNDNRTTANA # VAKNREMLEKRKQFLSRFSTPDLLQMHSVAEFLKEILSWCVRASGYPPGAYRRASCTSPEPD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g453 ### # start gene g454 5 AUGUSTUS gene 2360427 2361020 0.96 + . g454 5 AUGUSTUS transcript 2360427 2361020 0.96 + . g454.t1 5 AUGUSTUS start_codon 2360427 2360429 . + 0 transcript_id "g454.t1"; gene_id "g454"; 5 AUGUSTUS CDS 2360427 2361020 0.96 + 0 transcript_id "g454.t1"; gene_id "g454"; 5 AUGUSTUS stop_codon 2361018 2361020 . + 0 transcript_id "g454.t1"; gene_id "g454"; # protein sequence = [MSHHHVVVKSLPFTSALGRTKPVSHFRHIVEHDRSRAQKFMAGLHPHGPNPFVEARKRRHGHHHHATGGSGAATTPSG # DSNSDSIDVTDSAVTYLMDVTIGGQDFSLLIDTGSSNTWCGANTKFKPNSSVESTRESVNVSYGSGSFSGTEYTGPVVLGGSSGLSIPNQSFGVASTA # QGFSDTDGILGRLQYWILIII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g454 ### # start gene g455 5 AUGUSTUS gene 2367174 2367527 0.45 - . g455 5 AUGUSTUS transcript 2367174 2367527 0.45 - . g455.t1 5 AUGUSTUS stop_codon 2367174 2367176 . - 0 transcript_id "g455.t1"; gene_id "g455"; 5 AUGUSTUS CDS 2367174 2367527 0.45 - 0 transcript_id "g455.t1"; gene_id "g455"; 5 AUGUSTUS start_codon 2367525 2367527 . - 0 transcript_id "g455.t1"; gene_id "g455"; # protein sequence = [MSVAVKKSPLFNDRKSFKRPRPSWAHNAEDERKRKTPVKANGSSPNNYHQNSSDTPKSMKTRKPLPKKQNNAVSLGSS # PSIVSLKQIALQEQRSKLPIAKGTRIYDVFGYVKFLILR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g455 ### # start gene g456 5 AUGUSTUS gene 2370622 2371107 0.9 - . g456 5 AUGUSTUS transcript 2370622 2371107 0.9 - . g456.t1 5 AUGUSTUS stop_codon 2370622 2370624 . - 0 transcript_id "g456.t1"; gene_id "g456"; 5 AUGUSTUS CDS 2370622 2371107 0.9 - 0 transcript_id "g456.t1"; gene_id "g456"; 5 AUGUSTUS start_codon 2371105 2371107 . - 0 transcript_id "g456.t1"; gene_id "g456"; # protein sequence = [MGRVLFMTFEHEALHAETLLYMLLQRAGSGTIPPHGFAIPEWNSLASSWKSIPPLVEDTVTLGPAVVELGHDDAEGED # ELKDYKFNVEDREFGWDNEHPKRHIDVQEFRISWRPITNGQYYDTFKKNKDKFHVPASWVEEDGEIRVKFLHSLVQNRAEMIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g456 ### # start gene g457 5 AUGUSTUS gene 2372142 2373178 0.52 - . g457 5 AUGUSTUS transcript 2372142 2373178 0.52 - . g457.t1 5 AUGUSTUS stop_codon 2372142 2372144 . - 0 transcript_id "g457.t1"; gene_id "g457"; 5 AUGUSTUS CDS 2372142 2372778 0.55 - 1 transcript_id "g457.t1"; gene_id "g457"; 5 AUGUSTUS CDS 2372889 2373178 0.8 - 0 transcript_id "g457.t1"; gene_id "g457"; 5 AUGUSTUS start_codon 2373176 2373178 . - 0 transcript_id "g457.t1"; gene_id "g457"; # protein sequence = [MPAEIVDVQTSENLRAIQLQILDGLQRPAGQKNLPTMLLYDERGLRLYDDITTMAPEYYLFGAEEDILKKHATDIVMA # MHNTTGCIPGETVIELGAGPSRVPPITYYALDLEKRELERTLNAIAISDIGSDLKGKVETKGMWGTYDDGLKYLKSTGLYAPTAIDRPSRLEASMRFD # ARDLSPSSTTSGSDSSGAHVFDVSPPSTPEEVQAPLHIMFLGSSLGNFNRKDGAAFLHSLPLRPGSGDTLLLGLDHANEKDLIEEAYNDPRNHTKKFI # MNGLRGAGRALGNETLFLEDKWDYVNVCFLVIKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g457 ### # start gene g458 5 AUGUSTUS gene 2385487 2386368 0.96 - . g458 5 AUGUSTUS transcript 2385487 2386368 0.96 - . g458.t1 5 AUGUSTUS stop_codon 2385487 2385489 . - 0 transcript_id "g458.t1"; gene_id "g458"; 5 AUGUSTUS CDS 2385487 2386368 0.96 - 0 transcript_id "g458.t1"; gene_id "g458"; 5 AUGUSTUS start_codon 2386366 2386368 . - 0 transcript_id "g458.t1"; gene_id "g458"; # protein sequence = [MSTSIAPKRSASPLEDDRPTKAARPPWQELPNTGKADRQLTDSEYQNLKSSLDTERYNVFIFEAAHICMANGSTGKSV # VVSQIVSAMGKWLSLLDTKAANYERTVVYLQQWTSKPRNTQENYFIEKGKTRGKGKGEQKKNGSKATERTMIRNRREYISLAEVRAGDSPIRRSSRSA # HQEHPRYCIFVYGLSVYRNVDVDKYRSLLQVTDFFADHPREQTMKEVYAMKPFWTAGSSFGFVDMNESFLTTGIDDEYRVDGVHAQTDTSDDETDGDE # TDEDEAGEDETGEDERDKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g458 ### # start gene g459 5 AUGUSTUS gene 2390400 2390801 0.96 + . g459 5 AUGUSTUS transcript 2390400 2390801 0.96 + . g459.t1 5 AUGUSTUS start_codon 2390400 2390402 . + 0 transcript_id "g459.t1"; gene_id "g459"; 5 AUGUSTUS CDS 2390400 2390801 0.96 + 0 transcript_id "g459.t1"; gene_id "g459"; 5 AUGUSTUS stop_codon 2390799 2390801 . + 0 transcript_id "g459.t1"; gene_id "g459"; # protein sequence = [MILRVVVLATLGCLTAHAANPDLLRLGPQGVNFWKLDQLHDSQQLPVNGLILQDSSEAPLQLPHEPNNKPEFTAQWFE # QPLDHFGSSTNDTFMQRYWVNKRHYQPGSSVVFLLDGGETSGEARLCGSILLSFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g459 ### # start gene g460 5 AUGUSTUS gene 2394212 2395321 0.46 + . g460 5 AUGUSTUS transcript 2394212 2395321 0.46 + . g460.t1 5 AUGUSTUS start_codon 2394212 2394214 . + 0 transcript_id "g460.t1"; gene_id "g460"; 5 AUGUSTUS CDS 2394212 2394778 0.93 + 0 transcript_id "g460.t1"; gene_id "g460"; 5 AUGUSTUS CDS 2395127 2395321 0.54 + 0 transcript_id "g460.t1"; gene_id "g460"; 5 AUGUSTUS stop_codon 2395319 2395321 . + 0 transcript_id "g460.t1"; gene_id "g460"; # protein sequence = [MTSLDDLASHSPSLQEQKLTADSDDGDTASQRSISLSSPAVSARNSVQVDHPQLRQSKSYESSNTSRYKFHDVDDPLS # SDTLSKRESRPYTLDTDFSSDADDMSYASHDMVQHESPNTSASGSILDEPKAPSPMLSPPTYPPRRHSDVESIAESFASGSSKKARPESILLQPPPGK # LVLGIALVDFNHLIAASALLVKTPDVTRSTVQKAVVVLASKPVFGPIKDKLGVVTTALFQQRYTFLDLSLCCHHQQF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g460 ### # start gene g461 5 AUGUSTUS gene 2396789 2397367 0.45 + . g461 5 AUGUSTUS transcript 2396789 2397367 0.45 + . g461.t1 5 AUGUSTUS start_codon 2396789 2396791 . + 0 transcript_id "g461.t1"; gene_id "g461"; 5 AUGUSTUS CDS 2396789 2397367 0.45 + 0 transcript_id "g461.t1"; gene_id "g461"; 5 AUGUSTUS stop_codon 2397365 2397367 . + 0 transcript_id "g461.t1"; gene_id "g461"; # protein sequence = [MTTSEEPELVTKPDPDSSLSNSASSSTSSFMQPTLLKHTSIDSIASRSSASTDTSSGSSSPARLTSWGAGIGSFMSSR # VGRFSLSKSPSATPAPPPAALPLPTPPIPPSTLIAPDITPVFIEPLTPRRAVTSPQIVDPVDIDRAPMSPIDSLLHTLDAPPQPVRDKEEHSGHVLDD # NEDESEEGYSAVAMAM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g461 ### # start gene g462 5 AUGUSTUS gene 2397752 2401219 0.12 - . g462 5 AUGUSTUS transcript 2397752 2401219 0.12 - . g462.t1 5 AUGUSTUS stop_codon 2397752 2397754 . - 0 transcript_id "g462.t1"; gene_id "g462"; 5 AUGUSTUS CDS 2397752 2399063 0.98 - 1 transcript_id "g462.t1"; gene_id "g462"; 5 AUGUSTUS CDS 2399182 2399573 0.85 - 0 transcript_id "g462.t1"; gene_id "g462"; 5 AUGUSTUS CDS 2400484 2400960 0.3 - 0 transcript_id "g462.t1"; gene_id "g462"; 5 AUGUSTUS CDS 2401040 2401219 1 - 0 transcript_id "g462.t1"; gene_id "g462"; 5 AUGUSTUS start_codon 2401217 2401219 . - 0 transcript_id "g462.t1"; gene_id "g462"; # protein sequence = [MPRPGQPPPSTLRNRNRITNKTRLKIIHGDIDVDQIIPDEDEEKNRLLQSVAGVDQEDANEHHLQAVLSQAASQAASG # KATKDNEQLAAFIPIPEHSGFAENYTSLYPADRWKDPVSYIQSSSVIDEYTAAALADGCTYYMDERDKEWLDRNNEEARGEGTSAQGSVLTSSGRVSG # RSAKGKGKEYEDAQPSLMSEDEFELVMGLFEKITQEKTEFLHHIGYVQPTITPYGSRLFKYISAPSELGQPSTDADAAAGLVPKRSIRLRYGRGGRTF # IDRRPHSSQGNFKRCRRIMTSDDDEDAMEVDDVESHEEADRRLSERWRFDADDGPPYGPNGAEEQDRVLVDDFDSNIPVIKDGKRESYTPYRLGMTPP # MMPIAPRTSSQPQVPVQGVTPVSQQVHAHQSVPISQQLKLPSSVSTQQARASGSNQPTVSQPPTALSTVQSSASRPSAVIPSPQVIHNGRPAMNMPRV # DMMKLAFNHSLPSALQSKIEPISQSDVGNYTKSQPDEQHQLVRSKSQQQQVAQSSQPDQSQVQISTTTAVNGLHPTYAALANANPSAYNISHYMPHYP # ANPVSSGLNNQQLQHLKSVFNSANAGGSQNYNSALFTQMQMPKNSSAVANGTSGTPAVNGSSNIHNFTAPPVRPMQRVQSGSTVNGSSSSPPRPASTV # NGIQHDPSASPSPRMMHALVPGEHIPARTSSANGSRTGFRPPSNGMQNGAQIVYGPNSIQQQQMLQMHSQSPPQPVYNSPQAYSLSPSPPKMQPVSMP # NAGSPLLQQQQQQVVGNSQGVY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g462 ### # start gene g463 5 AUGUSTUS gene 2408596 2409208 0.5 + . g463 5 AUGUSTUS transcript 2408596 2409208 0.5 + . g463.t1 5 AUGUSTUS start_codon 2408596 2408598 . + 0 transcript_id "g463.t1"; gene_id "g463"; 5 AUGUSTUS CDS 2408596 2409002 0.51 + 0 transcript_id "g463.t1"; gene_id "g463"; 5 AUGUSTUS CDS 2409100 2409208 0.57 + 1 transcript_id "g463.t1"; gene_id "g463"; 5 AUGUSTUS stop_codon 2409206 2409208 . + 0 transcript_id "g463.t1"; gene_id "g463"; # protein sequence = [MTLSFASLITPSPGPFTSPLHLPPQASTENVNGISVGIILGEVNRLVNTTWISPVISNLDFALFRSVWTAFLAALWTL # KDFLEPDTGKVTEIVVVGTGSSPLELIPTSVSRVPASADTLMSLGCPCLSTEHKSERAGDEPEHNVGSETDLETHIDGTGISTQNLEVGRESS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g463 ### # start gene g464 5 AUGUSTUS gene 2410641 2411132 0.67 + . g464 5 AUGUSTUS transcript 2410641 2411132 0.67 + . g464.t1 5 AUGUSTUS start_codon 2410641 2410643 . + 0 transcript_id "g464.t1"; gene_id "g464"; 5 AUGUSTUS CDS 2410641 2411132 0.67 + 0 transcript_id "g464.t1"; gene_id "g464"; 5 AUGUSTUS stop_codon 2411130 2411132 . + 0 transcript_id "g464.t1"; gene_id "g464"; # protein sequence = [MVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCKFIRVSG # SELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRGESGSGGGDSEVQRTMLELLNQLDGFESTKNIKVIMATNRIGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g464 ### # start gene g465 5 AUGUSTUS gene 2415791 2416204 0.8 + . g465 5 AUGUSTUS transcript 2415791 2416204 0.8 + . g465.t1 5 AUGUSTUS start_codon 2415791 2415793 . + 0 transcript_id "g465.t1"; gene_id "g465"; 5 AUGUSTUS CDS 2415791 2416204 0.8 + 0 transcript_id "g465.t1"; gene_id "g465"; 5 AUGUSTUS stop_codon 2416202 2416204 . + 0 transcript_id "g465.t1"; gene_id "g465"; # protein sequence = [MTTAPSGSNSTDYFSSQDSDFLEALAQAILPGDIGYDSQLNSPELRRNEEVDEIREFSPPPPNQQALKVPLKRKLEDE # VHQHDKDIQNEEIYGAARFGDFGQYMRRKRAKLQIQNKDIAGKAGIFHGISIYVSIAAN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g465 ### # start gene g466 5 AUGUSTUS gene 2416389 2417048 0.6 + . g466 5 AUGUSTUS transcript 2416389 2417048 0.6 + . g466.t1 5 AUGUSTUS start_codon 2416389 2416391 . + 0 transcript_id "g466.t1"; gene_id "g466"; 5 AUGUSTUS CDS 2416389 2417048 0.6 + 0 transcript_id "g466.t1"; gene_id "g466"; 5 AUGUSTUS stop_codon 2417046 2417048 . + 0 transcript_id "g466.t1"; gene_id "g466"; # protein sequence = [MKVVRPEWLVDSANRGVLLPWREYIWKPINRSEGTQGLRSATQSALHPVNPTPKPNLETPSVASTSDKLKEQGVPSYA # AQESNPFAQRAMRNSDWRAAHTSVAPDFIDGFYKNSRLHHLSSWKAELKELLREAQERAESGQEEQYSKNAEEAGIAPQVIGQGLSMRGAGIVLQSPT # KIKQNRSKLEATMSKERVEPWSLPRSSASSCIAISTVSSSLQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g466 ### # start gene g467 5 AUGUSTUS gene 2418286 2419575 0.93 + . g467 5 AUGUSTUS transcript 2418286 2419575 0.93 + . g467.t1 5 AUGUSTUS start_codon 2418286 2418288 . + 0 transcript_id "g467.t1"; gene_id "g467"; 5 AUGUSTUS CDS 2418286 2419575 0.93 + 0 transcript_id "g467.t1"; gene_id "g467"; 5 AUGUSTUS stop_codon 2419573 2419575 . + 0 transcript_id "g467.t1"; gene_id "g467"; # protein sequence = [MSLFEPGGRPIATGDEKIIADHAWRLLKTLNFDPKELRGLGIQIQKLESKDASNVNSHYSDNKGQGMFPFLKNKVGGD # DTTNSNSRSAHPVETTGLDVSRRDEPNDLPSFSQVDLSIFDALPQEIKQELESEYKRRSISPFVYAPPDPAPDQPAGKIVPFALGAARREKPPTIPLF # PRKASGGPDVRRITAQLDPRRSSLSPRKPKYNRYTKLPGLASWKVPASELLKLDIDPDVFAVLPKNVQREQITAARMLKSLGYIPQRADERVDLRPVE # PDPGEVTYLPPPRARFVQPPTLKQAGSIPGDKLYFVDTDDVQRVIEQWVFRFKVYSPNKQDIAFFAKWLVKSVDRAQAGDEGLLRAVAVMKWWLVLLK # RWWGKYEYGFGYDGGDEDPEEERRANIGQAWWNAFREVKEQMDVVARRRFGGKLSLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g467 ### # start gene g468 5 AUGUSTUS gene 2420066 2422081 0.98 - . g468 5 AUGUSTUS transcript 2420066 2422081 0.98 - . g468.t1 5 AUGUSTUS stop_codon 2420066 2420068 . - 0 transcript_id "g468.t1"; gene_id "g468"; 5 AUGUSTUS CDS 2420066 2420390 0.98 - 1 transcript_id "g468.t1"; gene_id "g468"; 5 AUGUSTUS CDS 2420442 2422081 1 - 0 transcript_id "g468.t1"; gene_id "g468"; 5 AUGUSTUS start_codon 2422079 2422081 . - 0 transcript_id "g468.t1"; gene_id "g468"; # protein sequence = [MLPFTKSANVQGSVDTQASQAHDTGGAKDDGTVEPGATTSLLSYGDVDCRLADTRPEEYTFHGTSADVAEESLGIDDP # QISLIPSVSHEPKTIEVNPPEQPSPHSKETPPVPPRTVVINTTGASWNRPKNSFGEPVNLSMQSPRIPGLAGTPTKSVYPILAQHTKSQMEPPLKKRK # SEVANEDDTDEEISGEDNRKRQGQKKKPSSSGHSVNAKVARLVSTSPQAKFPDNSARKTNRQEMRSQIAGFARSGSRVVYESSDTGEDEQEKEAEVEK # IEDCSNQNPEEEEDNTEEMQIDKTTQALFLPDDDEDENENENSIIVDTSDDLFIASARSIRKTSSSSTLSVSTRITTPPASSLILDVNDKTSEMIDLT # LDENNYSLLSSDDNHLQTQNEPIHRPEVIRTEASQSSVGDVKLRLDVPKLAERWATLHPNLHGEKSKRELVNKLEKTSSSSLSDDAGVSATDTQTSEA # ALSRVISKEDFKEMEVLGQFNLGFIIVRRWKKSGTEQESEESLLDDLFIVDQHAADEKYNFETLQQTTNIESQKLLHPRPLELTASDELVALENLDVL # RLNGFELEVVSDAQEEEEDIEMVDDNPQSRVHRKLRLIAQPVSKSTVFDMRGESVHQCLFTFSNRDSDQNHVNHFFRFRGTHSTVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g468 ### # start gene g469 5 AUGUSTUS gene 2424025 2425226 0.84 - . g469 5 AUGUSTUS transcript 2424025 2425226 0.84 - . g469.t1 5 AUGUSTUS stop_codon 2424025 2424027 . - 0 transcript_id "g469.t1"; gene_id "g469"; 5 AUGUSTUS CDS 2424025 2424767 0.99 - 2 transcript_id "g469.t1"; gene_id "g469"; 5 AUGUSTUS CDS 2424839 2425226 0.84 - 0 transcript_id "g469.t1"; gene_id "g469"; 5 AUGUSTUS start_codon 2425224 2425226 . - 0 transcript_id "g469.t1"; gene_id "g469"; # protein sequence = [MRNRPIGIGVQGLADAFMALKMPFDSPEAKELNTKIFETIYHGACEASCEMAKTDGPYETWMGSPAQQGQLQFDLWGV # TPTDLWDWNTLKESISKYGMRNSLLTAPMPTASTSQMLGFNECFEPYTRLVCEFQVVCPWLLRDLVDLGLWDDAMKNMLIAHHGSVQNIPAIPDNIKS # IYKTVWEISQKKVLDLAADRGAFICQSQSLNVHLASPTMGQLTSMHFYGWKKGLKTGMYYLRTKPAAQAIQFTVDAAVLKDAKMHQAKAAAEKKVNLI # PSKPIAVASAPAEHNFASSSSSGTSTPSMSMSSVSVSPSPITSASDVSPSLETLSLDETQKKAAEADPEFAAALLRQKEREYEEAKLLCSIENKEACL # MCSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g469 ### # start gene g470 5 AUGUSTUS gene 2434410 2434919 0.5 - . g470 5 AUGUSTUS transcript 2434410 2434919 0.5 - . g470.t1 5 AUGUSTUS stop_codon 2434410 2434412 . - 0 transcript_id "g470.t1"; gene_id "g470"; 5 AUGUSTUS CDS 2434410 2434919 0.5 - 0 transcript_id "g470.t1"; gene_id "g470"; 5 AUGUSTUS start_codon 2434917 2434919 . - 0 transcript_id "g470.t1"; gene_id "g470"; # protein sequence = [MYSTVKAMPTVQYAQQVASEVLKPKPRAWFWLANMTTVSWLLNTFFPKTLLVCILDAEFLLAEAYFSFTTQDKIMARQ # FGLNEFATRSVQKNIVLSPNVKRTVLITGCSAGGIGHALAKEFHSRGTHDISELVYERSGALVFHLQGNVSLPQPETLNRWWNWRDLGLPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g470 ### # start gene g471 5 AUGUSTUS gene 2444882 2446786 0.8 + . g471 5 AUGUSTUS transcript 2444882 2446786 0.8 + . g471.t1 5 AUGUSTUS start_codon 2444882 2444884 . + 0 transcript_id "g471.t1"; gene_id "g471"; 5 AUGUSTUS CDS 2444882 2446786 0.8 + 0 transcript_id "g471.t1"; gene_id "g471"; 5 AUGUSTUS stop_codon 2446784 2446786 . + 0 transcript_id "g471.t1"; gene_id "g471"; # protein sequence = [MKRVEAASGAKYSYQQNTHSLSSSSGSAAPAVQQKPQQIPKIAPNVGSGYKPVGKVDMAALRNQQPPALPTTKRPVPQ # QTQTAGSLYGSARQSAPEDAWPEEQVQQQRGQPPPPLPATSRPTTTTTTTTRSGFGSMSLGGGAAAPTSRLSPPPSSAPPPSSISSTVPTKPTAQDDL # IAPVGTAYTPVSLPKPGKLRNPFERMAAAGQESTTTPARATGGGGGGAGKLTWSQRQAMAKKEQQQAEEDTPPPPPAPAPASRPAAAVSSFTRPIPAA # TRAPISPAPTSSPASAAASNVPRTFGAMKLGGGGASAIRQPPPVLAQDEEEEEETWEAPPAPVSRSVPPPPAPGPPAVPVTARPAQPPASGGPPPPPP # PPPPPPALPAASGGPPPPPPPPPPPPPPVVSGGPPPPPPPPPPPPMASVVPHVPEPEPEPEPEYTPEDTEPQTQTHPTPIHGHGICAAVLYSYEATED # NELSLNEGEMVQGIEELDEGWWSGFVVGEDGKREGMFPANYVEVVESVEPEDGGGAPPPPPPPPPPPPPPPPAAPAAPPAPIPPPRSPSPTPAPTSHE # PETETETDGYTAIALYDYEAAEDNELTFKEGDVIVGIEAVSDEWWSGRVEGGTEVGLFPANYVETR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g471 ### # start gene g472 5 AUGUSTUS gene 2447674 2450293 0.45 - . g472 5 AUGUSTUS transcript 2447674 2450293 0.45 - . g472.t1 5 AUGUSTUS stop_codon 2447674 2447676 . - 0 transcript_id "g472.t1"; gene_id "g472"; 5 AUGUSTUS CDS 2447674 2449529 0.58 - 2 transcript_id "g472.t1"; gene_id "g472"; 5 AUGUSTUS CDS 2449786 2450293 0.46 - 0 transcript_id "g472.t1"; gene_id "g472"; 5 AUGUSTUS start_codon 2450291 2450293 . - 0 transcript_id "g472.t1"; gene_id "g472"; # protein sequence = [MSQANSTDQIDEEQKAPDSLGITISSQVSILLRLISLIAEVEVLPSQSTLKGKMKEDVNEIGAGEEILVILGANNHNA # TSPAPAPVQSIIFSPLEPEHSRPSDDPIPPSQENIKKKETSPPLLGMSSYQSPYTGNLFVILRERVHQLKFEQEGGHLIIPRNMLMNLWVRMEQVQIL # RAAGNTTAINAIPKSSVDLQNASVATDDLWINGLFLASLSLALVTALLSVLVKQWLQAYSSILAGSAQQKALIRQFRYNGLVKWKVPEIVGILPLILH # TSLALFLIGLSLYISELHSSLSWIVVTVTSLAFAFYLGSLLMPQVWLECPYRIPLLFVPAGYIIYLSKALIWLSKWIIARLQDIIQTCRGKQPSYDPW # TNSKKKNSFPSLLQASLKDVELVHLKNEDSHRSILEDILVWLLSLESNQSIQEILDQPIVRFLLCNWRSEYSKLENHADRAARAIWATLSKLPKSDLP # KPNIEFPFHSPAFLSSKVGDSFMKGTTDHWNHLVSNNKSEIISKYFKCSKSKYLKELGITNKWKDDALLKAASNKDFEMTKVLVENGADVNAQEDKYW # GNALQAAACGGNLDVIKFVVENNADVNAQGGQYGNALQAAAFQGNLDAVRFLVENNAEVNAQGGLFGNALQAAAWRGELDIVKYLVEQCAEVNAQGGL # FGNALQAAAWRGKLDMVKFFVVKNADVNAQGEQYGNTLQAAAAGYKDSPDMIKFLVEHNAQGGCYGNTLQAAAYWGKLDIVKYLVEHGADVMAQGIHG # TALQAAECGTYDEIAKFLERCTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g472 ### # start gene g473 5 AUGUSTUS gene 2454485 2457050 0.38 + . g473 5 AUGUSTUS transcript 2454485 2457050 0.38 + . g473.t1 5 AUGUSTUS start_codon 2454485 2454487 . + 0 transcript_id "g473.t1"; gene_id "g473"; 5 AUGUSTUS CDS 2454485 2454764 0.7 + 0 transcript_id "g473.t1"; gene_id "g473"; 5 AUGUSTUS CDS 2454817 2454983 0.41 + 2 transcript_id "g473.t1"; gene_id "g473"; 5 AUGUSTUS CDS 2455032 2457050 0.85 + 0 transcript_id "g473.t1"; gene_id "g473"; 5 AUGUSTUS stop_codon 2457048 2457050 . + 0 transcript_id "g473.t1"; gene_id "g473"; # protein sequence = [MKLVQVKKYPFILSANKCNANSAPAPVPSTISSPLEPEHSRPSDNPIPPSTDTAVQGDADIPAQKQASSQVNIKKEET # APPLLGISSYQSPYTGGRTFNYKEKYPDDEPLGEELNDNSRVFKVYLDEAENFDDDLMRGFRDTIDSLLVFAALFSGVVTSFVIATISALQPDYSQIT # AVLLVEQVQILRAAGNMTAINAIPKSSVDLQNASVATDDLWINGLFLASLSLALVTALLSVLVKQWLQAYSSILAGSAQQKALIRQFRYNGFVKWKVP # EIVGILPLILHTSLALFLIGLSLYILGLHSSLSWIVVTVTSLTFTFYLGSLLMPQVWLECPYRIPLLFVPAEYIIYPSKVLLWSFRWIIVKFQDVTQT # AKKRNDSPEHWGLNSNSKKKDSFPSILQASLKNTELEHLTKEDKKKSIMEDILVWLLSLESNQSIQEILDQPIYGFLRYLEHYKYYKLENYADRVAKA # FWTTLPKFKRHNSQKLNSQVPLVLHEFIFSYEARELLKKGTVAHWNYLMSNWKLDIISKYFKYSKSRLTEMDFEKLGITQEWKDNALLEAVSDFYWEL # VKVLVENGANANAQGGKYETILQAAAFDGNLNAVRFLVENNAEVNARGWLFGNALQVAASGANVNMVKFLVENNADVNAQGGLFGNALHVAVSRADVN # MVKFLVENNADVNAQEGPYGNALQAAAFGGNVDIVKFLVQNNANVNAQGGQYGNALQAAAYEGNVDIVKFLVQNNANVNAQGGKYGNALNVAAYFGYL # DIVKYLVEHSADIMAQGLYGTALQAAKHGKQPDIANFLEPYTIQASKIVNSLAGTLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g473 ### # start gene g474 5 AUGUSTUS gene 2460348 2462039 1 + . g474 5 AUGUSTUS transcript 2460348 2462039 1 + . g474.t1 5 AUGUSTUS start_codon 2460348 2460350 . + 0 transcript_id "g474.t1"; gene_id "g474"; 5 AUGUSTUS CDS 2460348 2462039 1 + 0 transcript_id "g474.t1"; gene_id "g474"; 5 AUGUSTUS stop_codon 2462037 2462039 . + 0 transcript_id "g474.t1"; gene_id "g474"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFNLDTGDHEDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPDGPGGPGGPGGPGGPGGPRSPNSPDIPNEQRAMLDLLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGVYDAQGEAEDALGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLAAYRLEVLRIDNRYWKREETKKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSANSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g474 ### # start gene g475 5 AUGUSTUS gene 2462372 2465935 0.96 + . g475 5 AUGUSTUS transcript 2462372 2465935 0.96 + . g475.t1 5 AUGUSTUS start_codon 2462372 2462374 . + 0 transcript_id "g475.t1"; gene_id "g475"; 5 AUGUSTUS CDS 2462372 2465935 0.96 + 0 transcript_id "g475.t1"; gene_id "g475"; 5 AUGUSTUS stop_codon 2465933 2465935 . + 0 transcript_id "g475.t1"; gene_id "g475"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHFDSPQTSVPSAVNTVDAKVAV # PLPELSPSVSPTILETPPGDSLRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSATPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVAGLELTKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWNSISMDFIEQLPMSNGFTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEANGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g475 ### # start gene g476 5 AUGUSTUS gene 2472790 2474559 1 - . g476 5 AUGUSTUS transcript 2472790 2474559 1 - . g476.t1 5 AUGUSTUS stop_codon 2472790 2472792 . - 0 transcript_id "g476.t1"; gene_id "g476"; 5 AUGUSTUS CDS 2472790 2474559 1 - 0 transcript_id "g476.t1"; gene_id "g476"; 5 AUGUSTUS start_codon 2474557 2474559 . - 0 transcript_id "g476.t1"; gene_id "g476"; # protein sequence = [MGNSQSNQSQQQPSSAYSPTGSRRFGSPRPRTSSAATAASSPKRSSSLRSATKPTRAQSPSSFTPSSNTRSGSTRVRS # PQPQPSSSSSSSQYQQPTSPSPSNRVRSPIPIGSRLAPREREIRDAWEREIKEREAREVKEREKIAKEKEKFQPPYVHRSLQTKKKSLELPDLALTQV # TTPTPSSASAVAQAIPIPERQPGAGYQYSTPIHIRSRSSSRPPDLPNPQSTAGPVAGHDYPRIVVRSSIPLPANLLIAEAKAAQATQAKLVLAESDSE # EINNSNAVAQSPSLLIPPISPPAHRVNPQPSEGEPTYLVKISWHGGGKEVFLTRAGDDDWNGRKKMEKEVEEEEGSEENSEKQTHESIIAGKGPTQVC # HTGTTFSTIIALPRGTHHLRFLVDGQARVADDLPTAVDDNGSLANYVAVGLGSVGDAAAGDAAGDIASGDSPTTLVVAEGVDGAEVVAVAVDDVDVVV # AQPEKTPRPGDDHISEFVVPDIHPHPTRVDSHSSFWSENEYTESHPPSLSSSPQTVISPLTSIDPNASATVNNLQTPIRIRKVPYAPRWTREIPLELL # EAAADEESYLSYENELENAHA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g476 ### # start gene g477 5 AUGUSTUS gene 2478051 2479609 0.96 + . g477 5 AUGUSTUS transcript 2478051 2479609 0.96 + . g477.t1 5 AUGUSTUS start_codon 2478051 2478053 . + 0 transcript_id "g477.t1"; gene_id "g477"; 5 AUGUSTUS CDS 2478051 2479117 0.97 + 0 transcript_id "g477.t1"; gene_id "g477"; 5 AUGUSTUS CDS 2479201 2479609 0.99 + 1 transcript_id "g477.t1"; gene_id "g477"; 5 AUGUSTUS stop_codon 2479607 2479609 . + 0 transcript_id "g477.t1"; gene_id "g477"; # protein sequence = [MVQIDDNYPTPTSVSQKSTVALLVRPSPSSPSEKPTPIQSGILDTNLHLGFLGRHLLQGLPARYTSQDASQPWLLFWS # LQSLSLLKVELDQGNKDKAAEGILAMQNPNEGGFGGGPGQAAHLLPTYAAICTLAIVGAPDPSSKPDSDSVKSITPWTRIDRRALYRLFLSLKHPDGS # FRVSSNGEVDVRGVYCLLAVAKLLNMMTEELVRGTKEWVRGCQTYEGGFASAAIGIGEGRWAPLGEAHGGYTFCALAAWVLLELEFPSSSSSSEKKLN # FRNLRRWLVQMQGGEDELYGFRGRTNKLVDGCYSWWVGGCFALLDKLEERDGDVIWNPEGLKEYILYAAQHPAGGLRDKPPKSPDMYHTLYNLAGLSS # AQYASQPQTSSPTSSDQSSPSSSSSESPAPAQGAPSDSSITSSTPLSSSSSSSTVSDSASSTQAQPSSTPRATPTTPKTAASPPPAITLNGTDPLFNL # TKTHAEAMMKWFREEEREDFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g477 ### # start gene g478 5 AUGUSTUS gene 2480034 2482403 0.85 + . g478 5 AUGUSTUS transcript 2480034 2482403 0.85 + . g478.t1 5 AUGUSTUS start_codon 2480034 2480036 . + 0 transcript_id "g478.t1"; gene_id "g478"; 5 AUGUSTUS CDS 2480034 2480286 0.92 + 0 transcript_id "g478.t1"; gene_id "g478"; 5 AUGUSTUS CDS 2480440 2482403 0.85 + 2 transcript_id "g478.t1"; gene_id "g478"; 5 AUGUSTUS stop_codon 2482401 2482403 . + 0 transcript_id "g478.t1"; gene_id "g478"; # protein sequence = [MNSNHPDSNPDSDLSLPGDKEGSLHSHNADTNKALHVTASSTTPSNVTSNAKEPKIGEKRSGEEHNPSDTHERVLKKP # KVAENLSQDGVITIDPAPQTQTHSGASASISSSLSSNPYAIYLTNNRGSTGAAPVYPQFVNPYYFLTLPPGAMSMPPHMHHGMPMMPPMYAYPPHVPV # PAPIPRPQPAVSPSAPLLSSAGSLPESTMSPAQLQTEAPPAADSSVEQETTNQPSSSSSKPRRLKSHAVVSKHHSIPTIPRDKHGQPMLPLNVGIMTV # VSLGTICLRDHFHSERYIFPVGYTVTRRYLSTLDPNSDVVYHCTILDGGDGPKFQIVPADDPDKPIMASTATGAWSSIVKKANEIRKRQHSNSVSGPD # FFGLGQNTIRHLIQQMPGAERLAKRGTRTGEPEKEKEQEDGKNSADNNRKRRVNGKYVWHNYVERVNGIYVWQHYIEGGPLGGRHAAVIPALPEEYES # KHRSAGTGHPSRNTSGIVEGGSVSGQPKGDPPVSDFASAPSPNGTGTASTMVTSPSAGPSGTSKGTGLSYYPPHVMAQAEVQSQSQGHGYPHTAHLYS # TRYSTHHVFQPAYALSQQPQHLQPVMPHTQSQENAHVQTTFASLLNSLTREQSEASTIVSGVSSAPPTTSSTSSTPFVSVPTTPASDKGPTSAQSYEN # NEDSSNEGIDENHKEGGEDNAGCAEEMQIDPKLVERVVNPALAGSQQNQYYESDQQQQAQVKLDQRGNPETS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g478 ### # start gene g479 5 AUGUSTUS gene 2491962 2492615 0.57 + . g479 5 AUGUSTUS transcript 2491962 2492615 0.57 + . g479.t1 5 AUGUSTUS start_codon 2491962 2491964 . + 0 transcript_id "g479.t1"; gene_id "g479"; 5 AUGUSTUS CDS 2491962 2492615 0.57 + 0 transcript_id "g479.t1"; gene_id "g479"; 5 AUGUSTUS stop_codon 2492613 2492615 . + 0 transcript_id "g479.t1"; gene_id "g479"; # protein sequence = [MLTVTISAHYLDITMYETLLRPYDIQQTSSLPTIGEISDKLKQSEIRREEKRLKQIASGHRGGSDSTSPANGNSQKNV # SASGGGYESSSSHGEKRKRDGTDGEDAGLLSDEPAGGKRAKTEEEDIIDVESQVIEDSQNFLTKDVSMDGGLLLVKAEEVLDEGNRVKMEKPPLAQPM # KINLSKVMPEVRGHTSYLTFACLLPPLPTIGVVEDESLEQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g479 ### # start gene g480 5 AUGUSTUS gene 2492794 2494880 0.14 - . g480 5 AUGUSTUS transcript 2492794 2494880 0.14 - . g480.t1 5 AUGUSTUS stop_codon 2492794 2492796 . - 0 transcript_id "g480.t1"; gene_id "g480"; 5 AUGUSTUS CDS 2492794 2493902 0.97 - 2 transcript_id "g480.t1"; gene_id "g480"; 5 AUGUSTUS CDS 2494014 2494163 0.59 - 2 transcript_id "g480.t1"; gene_id "g480"; 5 AUGUSTUS CDS 2494262 2494299 0.33 - 1 transcript_id "g480.t1"; gene_id "g480"; 5 AUGUSTUS CDS 2494402 2494880 0.21 - 0 transcript_id "g480.t1"; gene_id "g480"; 5 AUGUSTUS start_codon 2494878 2494880 . - 0 transcript_id "g480.t1"; gene_id "g480"; # protein sequence = [MPTSIIGFKDHPLYVLPRHLKQNETIYPPPAPALGAGFDSSMPLDPSGSRSHTPELGKFRGEPVYPRSSVVPLKTPEN # WLRSEGRSIKEGAAPMKYVKLRASTIGRRREIEMIKEGMKDIQEKTKGANGVIGIHVDELVDEERAGTSGNADTGGEIMQGLESFPKINLGTLTFKGV # AKIARKLQIDFAEAVVSNLSNFYPFVTYMLMAYRLASSSESVKPHLSEREALEKAQLKQKERVLKQWTRLIHGLRIRQRLQEQYADRPGGGEGTNNLT # THDIAVIESNKKEQNTVNEYITQGDQGDQNLTGVISCYEKGESMEEQERQTPDQDVHHLTPAAAGFIVQAGDVVQPFRLPKLPKLDSDLVNYSSLGRL # PNSNSELDLPSDDALPMPDFETYDIDVVDDGELTLTFKDPPTTIPKTMHELAQVAETIRAPVIKADDSEDQTPTARSASRSETVSQPFSAQKKHTRNH # PAQPSVPATGSGIAVVSPSENGTSRRKNGRGKQEETNKASPVSARRRSVRLTTRKRKLRRADSDSDDDVSDEEDDNAGRMSSSLTKRSRQSVRTPSAP # GAGGEEAGTPSSTRVLRSSVAKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g480 ### # start gene g481 5 AUGUSTUS gene 2495352 2496188 0.82 - . g481 5 AUGUSTUS transcript 2495352 2496188 0.82 - . g481.t1 5 AUGUSTUS stop_codon 2495352 2495354 . - 0 transcript_id "g481.t1"; gene_id "g481"; 5 AUGUSTUS CDS 2495352 2496188 0.82 - 0 transcript_id "g481.t1"; gene_id "g481"; 5 AUGUSTUS start_codon 2496186 2496188 . - 0 transcript_id "g481.t1"; gene_id "g481"; # protein sequence = [MIHSSKVPEAALRGRMFESSVSRLAEWWSQDFFEVTDEGHIRNITFDTMKQRLIKFVPGFAEQFEDAVDPPEAERDNS # RFRLKYKGKGKEKEKQPPSTTPLIDSSDLDLLEDILDNSIETIKSPKSLMKHALMQSGSRDTSAQLFTALCRALAIPARLVVSLQSVPWKAAIGREAK # KYPKKTSHVSKGKVEVVENEGNTAPAVSSPMKGGQGHRRDDQPVDKKGKAKAKEEAKPAVKLRKSKSKGDVLGSAQSTSASNKPKKPKHDGKTFFVQS # VYSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g481 ### # start gene g482 5 AUGUSTUS gene 2496833 2497189 0.65 - . g482 5 AUGUSTUS transcript 2496833 2497189 0.65 - . g482.t1 5 AUGUSTUS stop_codon 2496833 2496835 . - 0 transcript_id "g482.t1"; gene_id "g482"; 5 AUGUSTUS CDS 2496833 2497189 0.65 - 0 transcript_id "g482.t1"; gene_id "g482"; 5 AUGUSTUS start_codon 2497187 2497189 . - 0 transcript_id "g482.t1"; gene_id "g482"; # protein sequence = [MDIPVQFDPTEGSVSAESKAALDLLSKMNSDARKTRMTEAQRPSKKSRTSRKYMFTDVSGCIDTDHADGGNEVEDPEG # KVLNVRKAVRFASKGRGGAALGREREKAGKLGKSGKGKRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g482 ### # start gene g483 5 AUGUSTUS gene 2497521 2498641 0.25 - . g483 5 AUGUSTUS transcript 2497521 2498641 0.25 - . g483.t1 5 AUGUSTUS stop_codon 2497521 2497523 . - 0 transcript_id "g483.t1"; gene_id "g483"; 5 AUGUSTUS CDS 2497521 2497740 0.7 - 1 transcript_id "g483.t1"; gene_id "g483"; 5 AUGUSTUS CDS 2498547 2498641 0.31 - 0 transcript_id "g483.t1"; gene_id "g483"; 5 AUGUSTUS start_codon 2498639 2498641 . - 0 transcript_id "g483.t1"; gene_id "g483"; # protein sequence = [MPQSSLAELARNSVIQSGFEMEIKRHWLGQQXTKPLPKIKPLTKWEQFAKAKGIQGKSKEKREKKVWDEERQEWINRW # GKDAKNKQVEEQWITEVPMNAGEFSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g483 ### # start gene g484 5 AUGUSTUS gene 2500553 2500999 0.63 - . g484 5 AUGUSTUS transcript 2500553 2500999 0.63 - . g484.t1 5 AUGUSTUS stop_codon 2500553 2500555 . - 0 transcript_id "g484.t1"; gene_id "g484"; 5 AUGUSTUS CDS 2500553 2500999 0.63 - 0 transcript_id "g484.t1"; gene_id "g484"; 5 AUGUSTUS start_codon 2500997 2500999 . - 0 transcript_id "g484.t1"; gene_id "g484"; # protein sequence = [MFQSLQKCLELRDKYMTKSRQRLGDNPRDYDGDFMGLNDECAGVSGVRPDANFAANQPPPWSPERWAIYPPPPPPHWH # WTDMQQVISSDGRRSPEGEFNFKECHIPEGDSKEFAIDDTGVYQVYDNAAKSLFILSPVCSWRQLTFSLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g484 ### # start gene g485 5 AUGUSTUS gene 2502664 2503887 0.78 + . g485 5 AUGUSTUS transcript 2502664 2503887 0.78 + . g485.t1 5 AUGUSTUS start_codon 2502664 2502666 . + 0 transcript_id "g485.t1"; gene_id "g485"; 5 AUGUSTUS CDS 2502664 2503887 0.78 + 0 transcript_id "g485.t1"; gene_id "g485"; 5 AUGUSTUS stop_codon 2503885 2503887 . + 0 transcript_id "g485.t1"; gene_id "g485"; # protein sequence = [MDYKFGGKYLLEQEIANGGCGTVFLGTHHIAGKQVAIKLEPATEGRQSMRRSKSQPELQSKSKKQTIDPYPGLSPLTL # ESQIYKRLMGAPGVPFLLHSGKSGPYNVLVMDLLGPSLEDLSRRCGRRFSLKTTCMLAVQCLDRLEYVHSRGVLHRDVKPANFVMSRTTPSIVNIIDF # GLAKRYRQPLNGEHIPYSQHPDALHGVGTSLYASLNTHFGVETGRRDDLESLAYMLIGFVRGGLPWRKVRATVDPPPNWPSKEWNPITQTWNLIREEK # VKAEVALLSTSKDRRQHNHAPTSSSDPATLLAGLPEEFGVLYRYARTLQFTDLPDYEGLRQLFRGLAEREGFLDADGEYDGVWDWHGVDIPAPLASSS # ASAVHGQGRFCEACNKRAAEAAGVGSLGKRRKEWV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g485 ### # start gene g486 5 AUGUSTUS gene 2504686 2505144 0.37 - . g486 5 AUGUSTUS transcript 2504686 2505144 0.37 - . g486.t1 5 AUGUSTUS stop_codon 2504686 2504688 . - 0 transcript_id "g486.t1"; gene_id "g486"; 5 AUGUSTUS CDS 2504686 2505075 0.61 - 0 transcript_id "g486.t1"; gene_id "g486"; 5 AUGUSTUS CDS 2505133 2505144 0.37 - 0 transcript_id "g486.t1"; gene_id "g486"; 5 AUGUSTUS start_codon 2505142 2505144 . - 0 transcript_id "g486.t1"; gene_id "g486"; # protein sequence = [MLETDIWIAVTPQVHETIVIDLSSEGEDEELEENPHQELESHNAQVKELETELIRAKKKASQKLPSLTEQLNYADSRL # ESFMQHGHRVDLTNDTHSQLVEFEEKKQLKQENERLHKEITGKPKIPMLSLSLFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g486 ### # start gene g487 5 AUGUSTUS gene 2510795 2511840 0.29 + . g487 5 AUGUSTUS transcript 2510795 2511840 0.29 + . g487.t1 5 AUGUSTUS start_codon 2510795 2510797 . + 0 transcript_id "g487.t1"; gene_id "g487"; 5 AUGUSTUS CDS 2510795 2510953 0.29 + 0 transcript_id "g487.t1"; gene_id "g487"; 5 AUGUSTUS CDS 2511022 2511840 0.88 + 0 transcript_id "g487.t1"; gene_id "g487"; 5 AUGUSTUS stop_codon 2511838 2511840 . + 0 transcript_id "g487.t1"; gene_id "g487"; # protein sequence = [MQCSREVAEHRWRLQQTMGLNELDLGVKLDMEKKLVSNGNASGNEIVLSAGPDSNKPQNLQTSVVHNPLPSSSSSKKL # PRPDPGPDPNSFPQSMQLITHAPGLLSLFTQKYTEIQQQLQIFQARNNELVKENQKKGIKLAALEAELAFTRNISETHTRLGLTVAGNISKQVMKEGE # ARPHPQYLHEHIQRSSNSSRDGQTKHQIISLEGQSADQNASSKTLTPQSMEDAPARLQSLVLKHTQTIRELDAQYDTRLEDLVRQKGELETKLSSLQI # QYDETIKCMELLKDSHVDALFEKERSLSACEKSLVQAREDNRMLSERLRGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g487 ### # start gene g488 5 AUGUSTUS gene 2512592 2513926 0.47 + . g488 5 AUGUSTUS transcript 2512592 2513926 0.47 + . g488.t1 5 AUGUSTUS start_codon 2512592 2512594 . + 0 transcript_id "g488.t1"; gene_id "g488"; 5 AUGUSTUS CDS 2512592 2512763 0.58 + 0 transcript_id "g488.t1"; gene_id "g488"; 5 AUGUSTUS CDS 2512913 2512953 0.47 + 2 transcript_id "g488.t1"; gene_id "g488"; 5 AUGUSTUS CDS 2513030 2513926 0.96 + 0 transcript_id "g488.t1"; gene_id "g488"; 5 AUGUSTUS stop_codon 2513924 2513926 . + 0 transcript_id "g488.t1"; gene_id "g488"; # protein sequence = [MLCLSGRHLFYLSTLTYFFNVGLDGRTAVWAQKLRKPVTNVDLGLYAVQELIELLLIRGDTMYEMCHRRTTKRKPNIA # KTQSSQSFDPHSLIEEILSSAAYTLPSDTTIVHDIIVSLANYARSVDNELKRLRKAMMGDESSLTLGNPSSQPFGSSPSDTNMSGEDSSSDDDDVNEE # TFKKITLGHSNVRHFGKSSNMRFIHDIITNATKNNQPLDFTQHDLYLARFKRPEYWGLDMVSDMLRAFIFDLIMAQWKFQPGIAAPIYTFPEIDLLWD # LLRIYFTEVAPYFPLLHRPTFEKAVINGRHLLDHSFGALLLAVCAVAARDSQDPRILKQDTKITAGWQWFSQIRLVRPNFVEPTSMHELQLYCVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g488 ### # start gene g489 5 AUGUSTUS gene 2515333 2517239 0.13 + . g489 5 AUGUSTUS transcript 2515333 2517239 0.13 + . g489.t1 5 AUGUSTUS start_codon 2515333 2515335 . + 0 transcript_id "g489.t1"; gene_id "g489"; 5 AUGUSTUS CDS 2515333 2515751 0.25 + 0 transcript_id "g489.t1"; gene_id "g489"; 5 AUGUSTUS CDS 2516380 2516714 0.57 + 1 transcript_id "g489.t1"; gene_id "g489"; 5 AUGUSTUS CDS 2516791 2517239 0.64 + 2 transcript_id "g489.t1"; gene_id "g489"; 5 AUGUSTUS stop_codon 2517237 2517239 . + 0 transcript_id "g489.t1"; gene_id "g489"; # protein sequence = [MRRDDMDDMDDSSVELNFESQLNIPEIEQRRLAGTQRVASYMTNSQIMIDPSEVSVLSDFHFESAEGKSTSGFIGAQT # PRSSFTSAIPASLATDPATLGAHEETLQIQTAHFTDTYGQFLLELGINDLPPFFNIFHIYSHREEFYSTEIDFVASPKGYNFQDAQAISPYLEHPKKG # PTSQFCSELAGRLKCYVFAGYPEKLTDEEAPLSKEESTSEAGNSQTVGANSAVLYGPNGEWVGHYRKTNLFVTDKSFATFLLPSPLRTLSFGICNDLN # VSDSDIWTPEDGPYEIADYALSQNANILVLLNAWLDSGKDEFEDTDWDTLNYWAARLRPLWVNNLAGPNTNEIVEEDNENANGKEMIVVVCNRTGEEN # GNSLFLVLVDIFITVHRRKDIRRLLRNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g489 ### # start gene g490 5 AUGUSTUS gene 2519767 2520237 0.73 - . g490 5 AUGUSTUS transcript 2519767 2520237 0.73 - . g490.t1 5 AUGUSTUS stop_codon 2519767 2519769 . - 0 transcript_id "g490.t1"; gene_id "g490"; 5 AUGUSTUS CDS 2519767 2520237 0.73 - 0 transcript_id "g490.t1"; gene_id "g490"; 5 AUGUSTUS start_codon 2520235 2520237 . - 0 transcript_id "g490.t1"; gene_id "g490"; # protein sequence = [MATPIRKKRNFKALQLTTAPAPQIADTAAQPIPTRQAPPASGKKRPPPMTLKAPKLPPSTTSATIEDGNLLTVQSSST # SAPNTAVTPSAKRNTYHTTLSNTLAILDSNAEVKYDLRNEDLKDLQELGQGNGGSVKKVEHTPTGTIMAKKARIFKGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g490 ### # start gene g491 5 AUGUSTUS gene 2520786 2522575 0.59 + . g491 5 AUGUSTUS transcript 2520786 2522575 0.59 + . g491.t1 5 AUGUSTUS start_codon 2520786 2520788 . + 0 transcript_id "g491.t1"; gene_id "g491"; 5 AUGUSTUS CDS 2520786 2520815 0.82 + 0 transcript_id "g491.t1"; gene_id "g491"; 5 AUGUSTUS CDS 2521200 2521742 0.62 + 0 transcript_id "g491.t1"; gene_id "g491"; 5 AUGUSTUS CDS 2521820 2522575 0.87 + 0 transcript_id "g491.t1"; gene_id "g491"; 5 AUGUSTUS stop_codon 2522573 2522575 . + 0 transcript_id "g491.t1"; gene_id "g491"; # protein sequence = [MLVPITTGSSSRPRRSSSHSRHSSRSISAHLILTNERLTQANARNIALETQKEELLVRFVALAKDKASVEADLRTTQE # SLQLYQAQLELAQKEVNRATDVVRKVDQARVQAENEVARLRSRVRQLETEKSTRRGWEEGWDIGFQEGIERAQAETSLMDRFVPRRRRSSTRMRDGET # DDGGGEADDSRASSSLISTRNRKPFIPEDDSYVVSPVSSGAQPAQQSPLLSRTRQRARSIASRLRSRSPPSSEPHPSRPQSRSSRAQTYVSSTNQSQT # SSPEVIHPLPIPRPPSSLSHHSLVPPDNYIPTMTPTDHFIPMPPPHELSNPVPSATQAPSEPDTVREQFANQRELGRNSWRSRAASTGSRASTRISEY # DLVSPPTRERAEAPRPPPNFDVDRGSSPTGDTGSRRMVEEWRDIVTTPPPNRGEPDGESRPEPEVGHTSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g491 ### # start gene g492 5 AUGUSTUS gene 2524954 2525748 0.35 + . g492 5 AUGUSTUS transcript 2524954 2525748 0.35 + . g492.t1 5 AUGUSTUS start_codon 2524954 2524956 . + 0 transcript_id "g492.t1"; gene_id "g492"; 5 AUGUSTUS CDS 2524954 2525748 0.35 + 0 transcript_id "g492.t1"; gene_id "g492"; 5 AUGUSTUS stop_codon 2525746 2525748 . + 0 transcript_id "g492.t1"; gene_id "g492"; # protein sequence = [MFLGRMVFFRLHESPRYLVHAGRPQEALESLQMISKFNGSDLSLALEDVDDQKPQTPSSPRDCDNSEQHGEDSVPFLP # HKSLDGAGDDADSQHANSNEDLRKTGDTIFDAGITHYSSTGESSTPLGAHVFAAPTVEYALPPSLTREISDLANAKFDANSERDGPTPTVDQSSHVTV # DVDSVPRHRPLTHARRRSHRLSRRASSIYERKVCRMLPHWLRRPIWAWWDRVMLVLAPEWLSTTLLVWAAWWAMSLGVLVVDPYKTQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g492 ### # start gene g493 5 AUGUSTUS gene 2526733 2528159 0.48 - . g493 5 AUGUSTUS transcript 2526733 2528159 0.48 - . g493.t1 5 AUGUSTUS stop_codon 2526733 2526735 . - 0 transcript_id "g493.t1"; gene_id "g493"; 5 AUGUSTUS CDS 2526733 2527097 0.82 - 2 transcript_id "g493.t1"; gene_id "g493"; 5 AUGUSTUS CDS 2527162 2527436 0.55 - 1 transcript_id "g493.t1"; gene_id "g493"; 5 AUGUSTUS CDS 2527513 2528159 0.77 - 0 transcript_id "g493.t1"; gene_id "g493"; 5 AUGUSTUS start_codon 2528157 2528159 . - 0 transcript_id "g493.t1"; gene_id "g493"; # protein sequence = [MPNQTIGNAGIPFLTMSSTKSKSDRKSALKNVAPALTTNKRSQIKEAPSVVEKEEDEIDLETDESEGSEDDGGIDDEG # IERLMKALGDDGLDEFEQAQLEAALGDPEDESEEEDGEDANTEEENSDQDEEVEKVENDGTEGGEEDDQFIQLEDVEAIVDDAVPFQKVEINNEIALA # RIRESLQLDPSIPWTETLAVSYPHTIDVDVNDDLNRELAFASHAHQIATKSYPNFPWTRPSDYFAEMVKSDVHMERIRQRLLDEKAGIKKSEEKRKER # EGKKFGKQVQIEKLKDRERGKKEMEERLKGLKRNILDNPDGNDDAFDVAVEDAISDRPAKRGRGGPAGGSRLSRQGRDKKFGFGGAGRRSKQNTSAST # DDFDSRSRKGSGGGGRGGRGTRGGGRGGRGGGGGRGGGRGGSKRLGKSKRMDARSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g493 ### # start gene g494 5 AUGUSTUS gene 2529268 2529720 0.87 + . g494 5 AUGUSTUS transcript 2529268 2529720 0.87 + . g494.t1 5 AUGUSTUS start_codon 2529268 2529270 . + 0 transcript_id "g494.t1"; gene_id "g494"; 5 AUGUSTUS CDS 2529268 2529720 0.87 + 0 transcript_id "g494.t1"; gene_id "g494"; 5 AUGUSTUS stop_codon 2529718 2529720 . + 0 transcript_id "g494.t1"; gene_id "g494"; # protein sequence = [MIQVTVVSSSAAHLDDIGLPQEHTWDVEKFVELHLIKRKVLSLMHSASGPLQAKLHEISSDLEDAAASHLPQANESVK # MARGDEVNTARKQHGPEKRLKSQSDDEENGVAPRKKRKMREEDQDQDDDNSSVGSAIFVKRVAPKKRNHLPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g494 ### # start gene g495 5 AUGUSTUS gene 2535237 2535551 0.67 + . g495 5 AUGUSTUS transcript 2535237 2535551 0.67 + . g495.t1 5 AUGUSTUS start_codon 2535237 2535239 . + 0 transcript_id "g495.t1"; gene_id "g495"; 5 AUGUSTUS CDS 2535237 2535551 0.67 + 0 transcript_id "g495.t1"; gene_id "g495"; 5 AUGUSTUS stop_codon 2535549 2535551 . + 0 transcript_id "g495.t1"; gene_id "g495"; # protein sequence = [MVVTKPYNSAASLSKPFKAPSMNGSGSLAIAAPKKVISSSSSRSSEQRQPQNGPPSRGAKNGEARLELEKDSIFGAEL # GSDSSVLTSSQDMAKNSDGELCHLIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g495 ### # start gene g496 5 AUGUSTUS gene 2537207 2537977 0.97 + . g496 5 AUGUSTUS transcript 2537207 2537977 0.97 + . g496.t1 5 AUGUSTUS start_codon 2537207 2537209 . + 0 transcript_id "g496.t1"; gene_id "g496"; 5 AUGUSTUS CDS 2537207 2537977 0.97 + 0 transcript_id "g496.t1"; gene_id "g496"; 5 AUGUSTUS stop_codon 2537975 2537977 . + 0 transcript_id "g496.t1"; gene_id "g496"; # protein sequence = [MIILSFAHSPFLGGIGFLSAEHGFGSDNIQNYEVVLVNGSIINANQKQHSSLYWGLKLGSTNFGVVTRFDMFTFSQGP # VWGGSQFFAIKDAPNLLERLVTFTEKLAEDPKGFFGLSLAWNPEAKDYIIWTLQTYLKPEAYPALWSGFESLTPLVDMMGIKNLTDITEEFQEADPGK # HGRSRWLTMTYKANAQFHLDLYARGVELFEPYHGHAGVHWAVSVQPVPARLASAGIENGGNPTCLKESEGNLWGQYPQKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g496 ### # start gene g497 5 AUGUSTUS gene 2538009 2538326 0.93 + . g497 5 AUGUSTUS transcript 2538009 2538326 0.93 + . g497.t1 5 AUGUSTUS start_codon 2538009 2538011 . + 0 transcript_id "g497.t1"; gene_id "g497"; 5 AUGUSTUS CDS 2538009 2538326 0.93 + 0 transcript_id "g497.t1"; gene_id "g497"; 5 AUGUSTUS stop_codon 2538324 2538326 . + 0 transcript_id "g497.t1"; gene_id "g497"; # protein sequence = [MLITTDWLDPSDDHIMNTSAEALLKWAEDEAKRRGLFSPFIYMNYASGSEAVMVRSTDGQTLKKMIQVKKMYDPQGDL # DKLWHGGFKLPQTEEHGPVTNYDRSEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g497 ### # start gene g498 5 AUGUSTUS gene 2538859 2539776 0.77 - . g498 5 AUGUSTUS transcript 2538859 2539776 0.77 - . g498.t1 5 AUGUSTUS stop_codon 2538859 2538861 . - 0 transcript_id "g498.t1"; gene_id "g498"; 5 AUGUSTUS CDS 2538859 2539776 0.77 - 0 transcript_id "g498.t1"; gene_id "g498"; 5 AUGUSTUS start_codon 2539774 2539776 . - 0 transcript_id "g498.t1"; gene_id "g498"; # protein sequence = [MAGPVRKGEQRVPWASRPDSSASSRSSLSPITSRAPISDTILEEPNSPSSQENPASPPARNFFPARENRLVEASPVPV # SPPSVPPQQSSQTSVASAPAELGTLHHRITMSTPSVKLSLDNRWKPKLHSAQAHFHSASQEDFELDESAPFRAIRSESSGNRLDEDLSRIRLNSVEEV # EERTEDLEKVMDGKPETWGEPFKVEWLCTDRLPFFRTRHLRNPWNHDREVKVSRDGTEIEPSVGEQLLQEWSKLVEDGSHQDSDPAPSNAASVAKPAS # KRSGSSSKLAPANPGPKGAKDREPGLSTSRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g498 ### # start gene g499 5 AUGUSTUS gene 2539824 2542022 0.25 - . g499 5 AUGUSTUS transcript 2539824 2542022 0.25 - . g499.t1 5 AUGUSTUS stop_codon 2539824 2539826 . - 0 transcript_id "g499.t1"; gene_id "g499"; 5 AUGUSTUS CDS 2539824 2541652 0.3 - 2 transcript_id "g499.t1"; gene_id "g499"; 5 AUGUSTUS CDS 2541902 2542022 0.27 - 0 transcript_id "g499.t1"; gene_id "g499"; 5 AUGUSTUS start_codon 2542020 2542022 . - 0 transcript_id "g499.t1"; gene_id "g499"; # protein sequence = [MVESVASDEILRNITPKPSLQLGGDAIGKCHVYLIAPDLVELASPHNLGASAALMPGDASSRGMSDHVGGSNRRASSY # SQSNQPRRPPHNTTAHSQFSLENPPGSTHGPSPHYPPPSQYGHRSGFFGQYTMSPQPPMAMAPSNPTYGYPHGFQNLPENAMIPQNIHASYQSMLPPA # PVYSYQRHGSEGTSPGFSSQPIFSHPSQGNSPSPPMSSPSTSQNTTPPYPNHGQFHSLRYPSSMSPSPYPYSHHSYSSSPVYQSQYAPAPYPPHFTSP # AEIEGQGTWWYLPHATPNAPSYPGHYPMNYSPVHQELENPYTATPGASVPASYPISPVRSPASINSARKPPSSLAASGEESPAHPSPGPIASSSKSVS # GERPSAARRPYHPNPPSYRSEWVMWAGNVPSDATHDELWRFFSQSDDTASSSGVISIFLISRSSCAFVNYENEAKLHAAIAKFNGVPLRSHDPRCPRL # VCRVRKVDDDLKAGVGGQRGVGMHAKWLRDQREMAKGKKKATDLSDHSDLDDSNSSIAALSASVSSDDDTRLPFVKGTHSNSSGSYASTNSSLLTRHF # PKRYFILKSLSQVMIYFSPFLKFCTDISLFSQYDLDLSVRENLWATQKHNEGILDQAYRTSNEVYLIFGVNKSGEFYGYAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g499 ### # start gene g500 5 AUGUSTUS gene 2549752 2550651 1 - . g500 5 AUGUSTUS transcript 2549752 2550651 1 - . g500.t1 5 AUGUSTUS stop_codon 2549752 2549754 . - 0 transcript_id "g500.t1"; gene_id "g500"; 5 AUGUSTUS CDS 2549752 2550651 1 - 0 transcript_id "g500.t1"; gene_id "g500"; 5 AUGUSTUS start_codon 2550649 2550651 . - 0 transcript_id "g500.t1"; gene_id "g500"; # protein sequence = [MESEVQNFEESILFFADAFQIHGPGSRRASPVTLNSDSAVDSEAATPSLTPGSSATSSRASSFAFDSSRRPSFVGRLS # NALMMSAVPEADIVDQYDPDFEDPCMVEDHLSAVEDQWIEKSKIHQLEAWQIEAAAVDRSVRILPGVKKMIDSIPAGRYAVATSGAKTYGSYGSFVKR # RIFDSNYFLFVFIAYGCMTRVGIIPPPVTITADDKRLKAGKPAPDPFLLAASCLGYDPKKCVVFEDSPSGIRAGVASGATVIAVCTSHERSKIENCGA # HFVVENMEKVKCELVDEQLHFTILQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g500 ### # start gene g501 5 AUGUSTUS gene 2553478 2554323 0.99 + . g501 5 AUGUSTUS transcript 2553478 2554323 0.99 + . g501.t1 5 AUGUSTUS start_codon 2553478 2553480 . + 0 transcript_id "g501.t1"; gene_id "g501"; 5 AUGUSTUS CDS 2553478 2554323 0.99 + 0 transcript_id "g501.t1"; gene_id "g501"; 5 AUGUSTUS stop_codon 2554321 2554323 . + 0 transcript_id "g501.t1"; gene_id "g501"; # protein sequence = [MINASHLKAFHAAFTDDPPNDDDDDDDNYNGNGEDDTARLNRRHSLKSVSVNENTMAIQRALTLKERTRLTIDKLSSY # SRNTPSPSAHTRSSDSSSSTSRHRLLEQHHSGSETERELIDSDARPSTPKLHRTRLVSAPASPGKALLSIKQSNSTSSSSSESPARSRKRVSMAASDF # AEVTSGRRMRSPDEYKVSQTSRRFPDVAQAALAAVASSRGRISPTANSKKRQPLPKEFFEASASASTTSASRGGSSSSSNPIDNTESDYENGRVRLFF # IVFIPLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g501 ### # start gene g502 5 AUGUSTUS gene 2554367 2556691 0.95 + . g502 5 AUGUSTUS transcript 2554367 2556691 0.95 + . g502.t1 5 AUGUSTUS start_codon 2554367 2554369 . + 0 transcript_id "g502.t1"; gene_id "g502"; 5 AUGUSTUS CDS 2554367 2556691 0.95 + 0 transcript_id "g502.t1"; gene_id "g502"; 5 AUGUSTUS stop_codon 2556689 2556691 . + 0 transcript_id "g502.t1"; gene_id "g502"; # protein sequence = [MSRPSSTMKFLQLSPRQQKNLNNTLTHSSFRHPFSDPRPNLQRSSTLRRHQTGGRWVSEDMSVASSHRTDGEADEDYE # DVPNPQGRRQTLRTGGSADSALTVGVGRSLVGEGLKAAGLKGGAVGRRGDIFDENTPLREKVIRDRERAQRLERIERSISRTGIRSQSRLGWEHENDE # DEGHFSNIRSRGNGSDIRTRAGTVVGPRASTSMAIRDREREGVGGEPEPRTAPPHLRSYKSSYDLVLSQEALSRHEIDLGRETAQDREDRAPSSLSRH # VPSPFGSTRRSIPNLLSNDGEVSHLNIPRSNHNRLLHDSLHMFETHVTRLPSTSSATTSDLLRNAQNIAGAAEKLNLMTRVAMTKALDAQINAEVDGG # TGDEAADIWRTVGADYRDQMRVSDELVRSVTDFLLGVGRAVKDMTGGGDSHGRSVSLDEVGGRLTRNSLGSDGGSTGSGRRSEESRRSWGDDVKRLST # GPKRSESALSGRPSSVLNARDHETPISLRSRQSNESTNVSRAQESDRGNLVTFDSQETLHAVAFDPSPTPASRAQLNRNQERPGATLDRARTLPPLSI # PKPLAQLPSESLTRRQTQTPASSTRHRPNTGSNTVRGPFPLSSPNIPTTALTPHTVSNSQRQDFPILRSDSGSGSGKSSGATPRSTVTFSRSSTVSAL # TGLQQQQQLAEQQRQRKRTQSNSSASGAESAERVSRVTRTESRSETERGPARTIGRQGDRSRMSLDGSRTLNGNVHPADRSAATSILPISKPRERRKT # VVDMWPRAGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g502 ### # start gene g503 5 AUGUSTUS gene 2557588 2558683 0.48 + . g503 5 AUGUSTUS transcript 2557588 2558683 0.48 + . g503.t1 5 AUGUSTUS start_codon 2557588 2557590 . + 0 transcript_id "g503.t1"; gene_id "g503"; 5 AUGUSTUS CDS 2557588 2557882 0.5 + 0 transcript_id "g503.t1"; gene_id "g503"; 5 AUGUSTUS CDS 2558025 2558683 0.81 + 2 transcript_id "g503.t1"; gene_id "g503"; 5 AUGUSTUS stop_codon 2558681 2558683 . + 0 transcript_id "g503.t1"; gene_id "g503"; # protein sequence = [MGKRSTGFSGLSRFLQAEKITPDIPVDVRNGTKRSLNSSAESQSSKKKRKSDGESTEDMETSRTKLVQKYDMSGSIPV # FETMQEVPDNLKKCEYVLLKTERCRCDTILDAFCGVGGNAIAFAKTCQRGSWSTRGSSSLAQLTDSPVIALDISPTRLALARHNAQIYGVAQHIEFIL # ADYISFAEMYLSSPKAAASRKIDVVFLSPPWGGPSYLSGSGSPSDSNSSPNENMPAPFALSDIQPIHGVDLFKLSNRITPNIAYYLPRNTDLDEVSAL # VKNDNSKDDIQEFIEVEEEWMGRKLKALTCYFGGLTAGQSELF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g503 ### # start gene g504 5 AUGUSTUS gene 2564140 2565257 0.32 + . g504 5 AUGUSTUS transcript 2564140 2565257 0.32 + . g504.t1 5 AUGUSTUS start_codon 2564140 2564142 . + 0 transcript_id "g504.t1"; gene_id "g504"; 5 AUGUSTUS CDS 2564140 2564224 0.32 + 0 transcript_id "g504.t1"; gene_id "g504"; 5 AUGUSTUS CDS 2564329 2565257 0.72 + 2 transcript_id "g504.t1"; gene_id "g504"; 5 AUGUSTUS stop_codon 2565255 2565257 . + 0 transcript_id "g504.t1"; gene_id "g504"; # protein sequence = [MDARFEGEGKKEAIPALGERAFAPETIPTSTEVGIMADNELLIVASTSSSASSTRQGSNAFMSDDDGEEINPYSSPHP # QDEPMTQSSFWSPFSYFPRHLINGPEMTTQAAASGLSASSSPFFSTPPPPLPSHSKALSESLPPPRSDYPTPPPSESPCESPTRIPTFNYYGNSLNKL # LASHLDDLPPNAPSVLYEPQARSIGKMKMKTHSLPATLANMMEVEVEEGITFGSLESGPSIEVQSEEGQGSNGITLVASAEEDIIMRDNVSESGSTVS # VNVVNRSKQGRESSRNALAEGVMDPDAKVESELCPEEVGVQNEEFTDDEDYVLNHYDLVYPSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g504 ### # start gene g505 5 AUGUSTUS gene 2565527 2567418 1 + . g505 5 AUGUSTUS transcript 2565527 2567418 1 + . g505.t1 5 AUGUSTUS start_codon 2565527 2565529 . + 0 transcript_id "g505.t1"; gene_id "g505"; 5 AUGUSTUS CDS 2565527 2565847 1 + 0 transcript_id "g505.t1"; gene_id "g505"; 5 AUGUSTUS CDS 2565901 2567418 1 + 0 transcript_id "g505.t1"; gene_id "g505"; 5 AUGUSTUS stop_codon 2567416 2567418 . + 0 transcript_id "g505.t1"; gene_id "g505"; # protein sequence = [MSTTADTEVNTTREEADSSVTHVDGQEHEVVNSETEKDVSSSEESVEELQDDSEGVEQDSDEEEEEEEEEEGEEEEPA # LKYERIGGELPALLKKDSASALAISNKFMALGTHAGIVHLLDLNGGRIKSYKSHQASIVDICVDETGDFIATASIDGQVIIISLSSRESYSFDLRRPL # RTVALEPFFAHRSSRAFVCGGLAGTLSLREKRGFFGVGHTEIVLHSSEGPIWLVRWSPSGRLIAWANDLGVKIYDMSNKSTIAFIDRPKDAPRPDLFP # VTLVWQDEQTLLLAWADFIKVARVRTRETGFMVEVIKVFQLDSMIAGIMPHPMPIAIASAPGSRPQSIVSTTSSSRSNNTNGLLKPNSSQPNNPPPLT # SFLLLTFSPPETALLDLDVLLTSDTDRTKQAKALSERPELRIISRGGEELAADALSVSGYQAWTCGDYKLAGPISADAELARTLDPASAKSPTVNLTD # WYVVLSPRDLILVRPRDEHDHVAWLVERERYGEALEALEVIEHSLGSSKKNEEGDSANGFSEKVVNGVKLTSVDVGQKLAESLISEGESVSFIDYLFT # HFYHRTLGSFPKAAELLPKICVRDPKRWEDWIFVFAEKRQLQVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g505 ### # start gene g506 5 AUGUSTUS gene 2573549 2574576 0.53 - . g506 5 AUGUSTUS transcript 2573549 2574576 0.53 - . g506.t1 5 AUGUSTUS stop_codon 2573549 2573551 . - 0 transcript_id "g506.t1"; gene_id "g506"; 5 AUGUSTUS CDS 2573549 2574364 0.89 - 0 transcript_id "g506.t1"; gene_id "g506"; 5 AUGUSTUS CDS 2574466 2574576 0.53 - 0 transcript_id "g506.t1"; gene_id "g506"; 5 AUGUSTUS start_codon 2574574 2574576 . - 0 transcript_id "g506.t1"; gene_id "g506"; # protein sequence = [MTKLAILEEREEDKYDYLTSVRCWDCDTFVTDESSSKIPSLISSILTSPSSARQSEVQAWEEEILPCEHTLTLDQLPL # SAQPIAEAGHATCSSCDLTSNLWLCLTCGSLGCGRAQFGVTNGGNGHGLAHYQATRHPVAVKLGTITPEGNADIYCYLCDDSKLDPSLSNHLAIFGIN # LSAQTKTEMSVTEMQIEHNLKYDFSLTNENGKALEPIHGKGLTGLRNLGNSCYMASVLQTIFALPEFKERYYALESARAQDHAEICPEPLPADCVECQ # MRKIADGLLSGRYTNPAPSHINASSHAGVTDPSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g506 ### # start gene g507 5 AUGUSTUS gene 2576730 2577687 0.44 + . g507 5 AUGUSTUS transcript 2576730 2577687 0.44 + . g507.t1 5 AUGUSTUS start_codon 2576730 2576732 . + 0 transcript_id "g507.t1"; gene_id "g507"; 5 AUGUSTUS CDS 2576730 2576778 0.45 + 0 transcript_id "g507.t1"; gene_id "g507"; 5 AUGUSTUS CDS 2576837 2577687 0.7 + 2 transcript_id "g507.t1"; gene_id "g507"; 5 AUGUSTUS stop_codon 2577685 2577687 . + 0 transcript_id "g507.t1"; gene_id "g507"; # protein sequence = [MTSMAKGRKYRLWLISTDPDSFISTHEIFKRGDVVGVVGTPSRTKKGELSISPSTMVLLAPNLHQLPSSHFGLKDQET # RYRKRYLDLIISENTRRIFVTRSKIINYIRRFLDDLGFMEVETPITSLLAGGATAKPFITHHNDLDLDLYLRIAPELYLKELVVGGLDRVFEIGRVFR # NEGIDLTHNPEFTICEFYMAYADMYDVMDITEAMVEGLVKYLTGGETKLIYHPDGDKDQEGAKTLELNFQRPWKRYDMIETLEEKLGVKFPPGDTLHT # DEANKFLRELCTKVCDSYCLVFVHK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g507 ### # start gene g508 5 AUGUSTUS gene 2583269 2584865 0.77 + . g508 5 AUGUSTUS transcript 2583269 2584865 0.77 + . g508.t1 5 AUGUSTUS start_codon 2583269 2583271 . + 0 transcript_id "g508.t1"; gene_id "g508"; 5 AUGUSTUS CDS 2583269 2583701 0.77 + 0 transcript_id "g508.t1"; gene_id "g508"; 5 AUGUSTUS CDS 2583791 2583932 0.95 + 2 transcript_id "g508.t1"; gene_id "g508"; 5 AUGUSTUS CDS 2583995 2584865 0.96 + 1 transcript_id "g508.t1"; gene_id "g508"; 5 AUGUSTUS stop_codon 2584863 2584865 . + 0 transcript_id "g508.t1"; gene_id "g508"; # protein sequence = [MQTSLGNDRTAHIIESLHAILKPFLLRRLKSDVETSLPPKKEYVLYAPLSITQREAYDKVLDGTLRAYLMQSKEENKG # ADELLPEVDGPRKLRTQTNKGRPSYLVEEDDDVYFKNLETGENERQQAEREADLTQLRETHRKDLALMQLRKVCSHPFLFDWPVDPTTLQPILNDELV # AASGKMMVLDRLLTELGKFHAVNTSSTIMAHSLPSQDWARELKGWIICRIDGSSSPVERREQMSAFQTGGDSPGAPHLFLLSTRAGGLGINLVAADTV # IFYDQDWVCSHSSILLSISERPSKNPQMDAQAQDRAHRIGQTKPVLIYRLVSAHTIETKIMQRATEKRQLEALVIAKGHSFWVLSLMAFSYSFLGKFR # MPSAAAQRGGKSETIAEMAASLLRLEGEKIDVVPNTNEGKANVLTDEDLDSLLDRSPEVFTDRGKGWTSANPPGKSVVESSKKAAFAVYDAPADEGND # ALAMMLGEDDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g508 ### # start gene g509 5 AUGUSTUS gene 2585908 2586372 0.5 - . g509 5 AUGUSTUS transcript 2585908 2586372 0.5 - . g509.t1 5 AUGUSTUS stop_codon 2585908 2585910 . - 0 transcript_id "g509.t1"; gene_id "g509"; 5 AUGUSTUS CDS 2585908 2586372 0.5 - 0 transcript_id "g509.t1"; gene_id "g509"; 5 AUGUSTUS start_codon 2586370 2586372 . - 0 transcript_id "g509.t1"; gene_id "g509"; # protein sequence = [MLNLSECILIFRSKFWDAHNIRLKSCHLRHRRGILSILGLSDSPDLTRNHVQKAFLQWDADAFEEKAAESGMCAFVSR # TFEEWDRHPQGLALKNVPPVTVTKIADAPKRQISFLSSYEHPLQNVKVLDLSRVLAGPVAGRTLAGQTYAFYTGFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g509 ### # start gene g510 5 AUGUSTUS gene 2587435 2588022 0.81 - . g510 5 AUGUSTUS transcript 2587435 2588022 0.81 - . g510.t1 5 AUGUSTUS stop_codon 2587435 2587437 . - 0 transcript_id "g510.t1"; gene_id "g510"; 5 AUGUSTUS CDS 2587435 2588022 0.81 - 0 transcript_id "g510.t1"; gene_id "g510"; 5 AUGUSTUS start_codon 2588020 2588022 . - 0 transcript_id "g510.t1"; gene_id "g510"; # protein sequence = [MYLVYIPSSSVSNLQDQIKAQQSAFYTGVDNSVAQQLASLVNSGWNLLSIAAPDDSGSTGSSSSDSDTGASSSDNKSK # EDAIIGVTASLGGIAICVLGFLIYRSYKRRKELAHRRLSEPTGTAGYRPEGREFDQDSVGGQRRRSFYFAEDSLRGYQGDRVDDSHFDARTGQMSQRR # NVMPAAISAPILRESSMNW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g510 ### # start gene g511 5 AUGUSTUS gene 2588118 2590659 0.25 - . g511 5 AUGUSTUS transcript 2588118 2590659 0.25 - . g511.t1 5 AUGUSTUS stop_codon 2588118 2588120 . - 0 transcript_id "g511.t1"; gene_id "g511"; 5 AUGUSTUS CDS 2588118 2590353 0.27 - 1 transcript_id "g511.t1"; gene_id "g511"; 5 AUGUSTUS CDS 2590499 2590659 0.25 - 0 transcript_id "g511.t1"; gene_id "g511"; 5 AUGUSTUS start_codon 2590657 2590659 . - 0 transcript_id "g511.t1"; gene_id "g511"; # protein sequence = [MKPLLPLIYFSALLFSLLVSPVDAVHSSTEHSFARRSMSHAKRRTVLGSSSSSFGVGDLLGATSTTTSSSPTSASSAP # TASTSTAGSSPAPVASSSSSSDSSSSSSSSSSTNVNSVSPSSSSSSTSSSASSSASPTSSSSSSTSSSTSSTVFSNSLPTTSVLDATSTTAVPSTSVV # SATSSDSGLLPSILSSLLPSVTLPSTTTSAAESDSTTAASTSPVDSDPTIAASTTSAADSDTATSTASTTDPGLLSSILSSLLPSVTLSPSITTSASD # SDSSTASTTGATDTDSVVTSPTASSTTVLSATSTTDPGLLSSVLSSLLPSVTLFPSTVSSVADTSSSSVALTSTSTTSEGLIPTLFPTTDSGTSSSTD # SNGITLTTASSSSTSTSTSDSDGLTPTTTSDFSSSPVTTSADSTSAVLSISISLFPTTTDSSVSSSTDLFSSSAATSTSGDTTTATSGSLSLSLPVSI # PTISATTSDSALPSSIISSLSSVSTSTTDTSPNSLSTTVSGSQSSFSASTIDSASITSSTDSASDTTTTGSASIFSTTGSASVSSTTGSASISSTTGS # VSVSSTTGSDSASVTSSTGSASILSSTGSASVTANSTSIPASVSQSSFSVSGSTTVSLSASSTVTISFPSGSVSSTATVNGTTTVVSTSVTTALTVVS # VPSDLSFVLTQTTLEVASVSSSATSQTLSNPDQATTTFSQTTLSASAPLATAALPSSLPYRILPQDQLASNEDLSGYTLVSLLFDLQLNWPFVVSSPD # SSSQLFAYMPVILQNSLGLTGLSLLRFKNSNINA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g511 ### # start gene g512 5 AUGUSTUS gene 2596615 2597944 0.59 + . g512 5 AUGUSTUS transcript 2596615 2597944 0.59 + . g512.t1 5 AUGUSTUS start_codon 2596615 2596617 . + 0 transcript_id "g512.t1"; gene_id "g512"; 5 AUGUSTUS CDS 2596615 2596712 0.59 + 0 transcript_id "g512.t1"; gene_id "g512"; 5 AUGUSTUS CDS 2596810 2597944 1 + 1 transcript_id "g512.t1"; gene_id "g512"; 5 AUGUSTUS stop_codon 2597942 2597944 . + 0 transcript_id "g512.t1"; gene_id "g512"; # protein sequence = [MSTTSNSSSLFTSSSTSKSHSNNISASTSGSSSDVESYPDSSLPNTKRHLRTTTNNNLNAAAVERKLAILQTNCAELE # KKVREKDQRLDLLEKDRRWLNDRETEEREAREREGKEAREREVKLKNELAAAKISLSNLEVSHAELQDAHSKLERSRNHEVSLLKTQLEETQKQAMFL # EARVEEEKNAAKIAASNIASASSSTPSLSQSTSSIPDTDNRLLTAELKRQATYLRQLESTNTRLNADVVVLKSDNAILRDRNATVEVLKEEKRGLESR # LKMKEVEVEKLVREVVRRDHRSSSSKRSSLPLNPSTLATHLGLDQDDVDASVGVNDSLKDLPHPTVKEISELAALRLEHAALLDQHGTTLSELAALRG # EKEALLQQTSSRGNLAVPEVHSQNIIVRIDDYLLHIRH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g512 ### # start gene g513 5 AUGUSTUS gene 2598408 2598851 0.77 + . g513 5 AUGUSTUS transcript 2598408 2598851 0.77 + . g513.t1 5 AUGUSTUS start_codon 2598408 2598410 . + 0 transcript_id "g513.t1"; gene_id "g513"; 5 AUGUSTUS CDS 2598408 2598851 0.77 + 0 transcript_id "g513.t1"; gene_id "g513"; 5 AUGUSTUS stop_codon 2598849 2598851 . + 0 transcript_id "g513.t1"; gene_id "g513"; # protein sequence = [MNSSSCTSALDTVEQELFDLRGEVAGGRHIPPNTRVLEMKDNPHAEWEMSHTAVLERLKGENQALLKRLIDIEAVLKE # AGAAQASQASETKSDVSVSTLVPRESLDIAVKDKEDLEDVLKQKEKRLLRLQQVIYPFKYFHNRIKHMQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g513 ### # start gene g514 5 AUGUSTUS gene 2602412 2603161 1 - . g514 5 AUGUSTUS transcript 2602412 2603161 1 - . g514.t1 5 AUGUSTUS stop_codon 2602412 2602414 . - 0 transcript_id "g514.t1"; gene_id "g514"; 5 AUGUSTUS CDS 2602412 2603161 1 - 0 transcript_id "g514.t1"; gene_id "g514"; 5 AUGUSTUS start_codon 2603159 2603161 . - 0 transcript_id "g514.t1"; gene_id "g514"; # protein sequence = [MPINRLKPKNPPLPNNGDAIPILDKLRYDDVHAKAFQQVFGKTCICKDLTVAAAYVKSHGINTITLDGDKVDRKGALT # GGFHDIRRSRIEAIKAVTSWRTKYEEDTKKSKETKTAIVEYDQKITQLAGKMSVLSAQQNQIREARERLLAEGVMLTKEKEKLSGRLGKLEIDVQELE # AELASLQTKHTGYEAELKTPMMQSLSAEEQKLIETLGVEVEQKRRELVELAKAKTSVSILYGSPCTALNFDFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g514 ### # start gene g515 5 AUGUSTUS gene 2603455 2604515 0.98 - . g515 5 AUGUSTUS transcript 2603455 2604515 0.98 - . g515.t1 5 AUGUSTUS stop_codon 2603455 2603457 . - 0 transcript_id "g515.t1"; gene_id "g515"; 5 AUGUSTUS CDS 2603455 2604195 0.98 - 0 transcript_id "g515.t1"; gene_id "g515"; 5 AUGUSTUS CDS 2604246 2604515 0.98 - 0 transcript_id "g515.t1"; gene_id "g515"; 5 AUGUSTUS start_codon 2604513 2604515 . - 0 transcript_id "g515.t1"; gene_id "g515"; # protein sequence = [MAETDAKRTKISELLEYIESRLEELEEEKEELKEFQEKDKERRCLEYALYQRELLDVGEALEELEEERKSEVHGANLR # REKWNEREKEVQNLERALSEAKHDLEALSLARQDVQSELTDSIRSRTELRCVIDDLRNAGIREGGRRVNLETELTKINSDIADRQGALAVLLPDWETR # RATEATEKRKLDETNGQLQALYAKAGRATRFRTKAERDQFLKQEIESMKTHRQTQEHNLQFSRSQIEETKRSVVELDQQILDVQKKIDDGRQRVTDLS # EEHSRLREQHSKLIEERKDLWREDTKLESLVGRAADEMRTAERQLASMMDKVGTPHLSPHSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g515 ### # start gene g516 5 AUGUSTUS gene 2605404 2606225 0.98 + . g516 5 AUGUSTUS transcript 2605404 2606225 0.98 + . g516.t1 5 AUGUSTUS start_codon 2605404 2605406 . + 0 transcript_id "g516.t1"; gene_id "g516"; 5 AUGUSTUS CDS 2605404 2606225 0.98 + 0 transcript_id "g516.t1"; gene_id "g516"; 5 AUGUSTUS stop_codon 2606223 2606225 . + 0 transcript_id "g516.t1"; gene_id "g516"; # protein sequence = [MSDSFADLWNSAVPSKPTPQPQKLGSLSSQSNPPYPRQTQNDVFAQLASRGSSVSNSRSATPPSAIPASSHKGFAKPS # SQNSNGDAFSGLFGAGSSLASNRSTANMTIAERAALVEKERLERSIQQRQVPNPTHSTAWDGLDSLGSKTFATSPTNSHLPLDHDWTLTAPSVLKSVV # LPPVLKPEDDWGLANLANTSAPATTSKPSHSGAVWDLDEFSTLDSTSRGLGPGKWDGVTANDGPDDILGDLSRPIEAIQREKHENSRRNVVVSIAQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g516 ### # start gene g517 5 AUGUSTUS gene 2606346 2608061 0.98 + . g517 5 AUGUSTUS transcript 2606346 2608061 0.98 + . g517.t1 5 AUGUSTUS start_codon 2606346 2606348 . + 0 transcript_id "g517.t1"; gene_id "g517"; 5 AUGUSTUS CDS 2606346 2608061 0.98 + 0 transcript_id "g517.t1"; gene_id "g517"; 5 AUGUSTUS stop_codon 2608059 2608061 . + 0 transcript_id "g517.t1"; gene_id "g517"; # protein sequence = [MGFSITQARTALASTDSGQNVQAALDILISNGAIGPGEDYGDEAGSFSGRNNSQNQRTPSPQEEPKPRLRRDRQIIQE # RQRERNTSSPSELGGLQADKILAQASEIGFSLFNRANAAWKEGKERVQKVYEEKVAATAEGSTSRRGSGRSTPLAMATKPKWMQDNEGLPDTMIDHTK # KEARPVEKPSFSTHTEVVDLFSDTSSPESSTSQLTSQPSTLSVGSSNGVYVSKFRHAKPKVSDTTSGSASLSPHPITLVSAPESTIALSQESKASGAH # FYKLGDFPAADTAYTRAIEALPAGHALLIPLYNNRALVRLKVGDVQGVITDTKKVEELIGGVGTVREELRKGDLGKIPVKGSKQGSGDDVVINMPDAL # IKAWKRRAEAMEGREKWEDAGKDWEKVASAEWAGKAVRAEGASGAGRCRKMQQGGSSHHTPKFKPSPPIRPPSHQVPSIPSQALNALRAANEAAEVED # SHRYRLKDGVDARLQSWKGGKENNIRALLASLDTVLWPELGVQKLSMAELLNKGQVKVKYMKCIAKVHPDKLNEGNSTLEQRMIAAGVFGALNEAWNA # FKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g517 ### # start gene g518 5 AUGUSTUS gene 2609684 2612313 0.42 - . g518 5 AUGUSTUS transcript 2609684 2612313 0.42 - . g518.t1 5 AUGUSTUS stop_codon 2609684 2609686 . - 0 transcript_id "g518.t1"; gene_id "g518"; 5 AUGUSTUS CDS 2609684 2610912 0.87 - 2 transcript_id "g518.t1"; gene_id "g518"; 5 AUGUSTUS CDS 2611074 2612313 0.44 - 0 transcript_id "g518.t1"; gene_id "g518"; 5 AUGUSTUS start_codon 2612311 2612313 . - 0 transcript_id "g518.t1"; gene_id "g518"; # protein sequence = [MGQSQSDSNDSRNRRVQTSPLSADILSAGDSTDGRRFLAQPQLTPSGKTTVRSSGLTRRRKAVQRRLSSIVKPKLEPE # ATSSRARVNEGRQLAQTDIPEASGHRSAWRRSVRFVKSRRWNKASDHNKDDGRERISISDSNATLPISISSPQSSSSNSTVSIPACGSDSVTTSQPPE # TSVPNSDTAILGSADIPTILTPALSVPPLSGEESSSDPLAVHTESIAALSSPQAAGEMETTDQFAVATAENPIVVASNANSGPTSENVTVLLEPNSTS # TATATVPVSPARPQFPPSGTLVVVQGVVHTSDVQMPTETSAPLLSQTQNHNPNPTPPSSVIAEAPQTTDDFRTVQRVPSSVSSGPRGRLSALLRRTHR # SPSSSRARSVSSAFDSSSTHSANEASTDIRQSTVDAADIQSTAATAASLLTGSSDSTSSTGLAHPSLVTTGTPSSTSIPSADTPALDVPSSLAFSSPY # PSTSRRPLSTQINTTNTESVGARDRAERISQLWSAVRSRLGIGHGQPNSQRTDPDSQLFTNPFGSDASANAATVDARDGPGAGPVMDAHSARERMLNE # ISRAFNLGFSSPSSSAPPTNFTTDAGDTSQGPTFGRAEDGNSDLGLPSEGTFERFLLDLQVDLRNVLTGEGDGRTTREHGEPAILETDNSVTSRDERL # PRPLREPEPEDDTAEDSIPSLHDVSDSDDDTESNNSQGSSLDSFASVSPADEAAQHPFNVSESPNDPSIPRPRINYWRLHRFPPIPAARAHAAADNVA # QNMRSGLGGLTRAATLASTPTSRSVTSTPLEKILGQEPRHHCREIRWYKTHPIQGAQM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g518 ### # start gene g519 5 AUGUSTUS gene 2614536 2614982 0.4 - . g519 5 AUGUSTUS transcript 2614536 2614982 0.4 - . g519.t1 5 AUGUSTUS stop_codon 2614536 2614538 . - 0 transcript_id "g519.t1"; gene_id "g519"; 5 AUGUSTUS CDS 2614536 2614982 0.4 - 0 transcript_id "g519.t1"; gene_id "g519"; 5 AUGUSTUS start_codon 2614980 2614982 . - 0 transcript_id "g519.t1"; gene_id "g519"; # protein sequence = [MGIVLLDHSTSDILFLLKGADTVMAPLVQRNDWLEEETGNMGREGLRTLVVARKKVGKEVWAAFESEYAVASTSVGGA # GGGSGDATTDGAVSRAEAQAQVIAKYLEKDMELLGLTGVEDRLQDEVRSTLELMRNAGVKVWMLTGDKVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g519 ### # start gene g520 5 AUGUSTUS gene 2621034 2621768 0.79 - . g520 5 AUGUSTUS transcript 2621034 2621768 0.79 - . g520.t1 5 AUGUSTUS stop_codon 2621034 2621036 . - 0 transcript_id "g520.t1"; gene_id "g520"; 5 AUGUSTUS CDS 2621034 2621768 0.79 - 0 transcript_id "g520.t1"; gene_id "g520"; 5 AUGUSTUS start_codon 2621766 2621768 . - 0 transcript_id "g520.t1"; gene_id "g520"; # protein sequence = [MLDYARSDTHFLLYIYDNLRNALLDRAVSPSEDNLEIEGTSYPQAQALLRQVLAKSEVTASRVYEKECYDMERGSGGN # GWDTLAKKWNKIHLYVNSPSSKQKDIYRSIHMWRDEVAREEDESVRHVSISLVRNINETFELRYILPNHYLIQLAEHPPADMAAMLKIFHFVPPVLKR # RAKELLNIIREVIERYDTSGEAKSLQDVVVLEAPPDAMVVEQQSSPIPTESLWTLGKWCAIHRYARLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g520 ### # start gene g521 5 AUGUSTUS gene 2622820 2623191 0.44 - . g521 5 AUGUSTUS transcript 2622820 2623191 0.44 - . g521.t1 5 AUGUSTUS stop_codon 2622820 2622822 . - 0 transcript_id "g521.t1"; gene_id "g521"; 5 AUGUSTUS CDS 2622820 2623191 0.44 - 0 transcript_id "g521.t1"; gene_id "g521"; 5 AUGUSTUS start_codon 2623189 2623191 . - 0 transcript_id "g521.t1"; gene_id "g521"; # protein sequence = [MNLQGSPANHGLNEIDSQIQASALKAARNSMLLPSDIHFHRTMDAEFSKDLDIFSSRILSVANQVLALMGTADISTKG # QSKLETEDDVVDNFHSIVVDTMDRMMEKTVRNIPYQVEKSYTSWH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g521 ### # start gene g522 5 AUGUSTUS gene 2625568 2626023 0.35 - . g522 5 AUGUSTUS transcript 2625568 2626023 0.35 - . g522.t1 5 AUGUSTUS stop_codon 2625568 2625570 . - 0 transcript_id "g522.t1"; gene_id "g522"; 5 AUGUSTUS CDS 2625568 2626023 0.35 - 0 transcript_id "g522.t1"; gene_id "g522"; 5 AUGUSTUS start_codon 2626021 2626023 . - 0 transcript_id "g522.t1"; gene_id "g522"; # protein sequence = [MVHQHGLSFNLKPFSSQDIPIIARDATFLISLAAEEFIKRLCQAGQKAAEKERRTTVQHKDLGEHRLLESISMLFPTN # NLDPATVVRRADEFMFLDGSSSSQKIHLHSHGPNIHFNSRNYFTQPTRTSETSSKSSGSQWHSVTSWFWANAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g522 ### # start gene g523 5 AUGUSTUS gene 2630128 2631096 0.99 + . g523 5 AUGUSTUS transcript 2630128 2631096 0.99 + . g523.t1 5 AUGUSTUS start_codon 2630128 2630130 . + 0 transcript_id "g523.t1"; gene_id "g523"; 5 AUGUSTUS CDS 2630128 2631096 0.99 + 0 transcript_id "g523.t1"; gene_id "g523"; 5 AUGUSTUS stop_codon 2631094 2631096 . + 0 transcript_id "g523.t1"; gene_id "g523"; # protein sequence = [MFNVSGTSRPAWQTEELEDEWIEAEAEGGEYEDEDQFNGTRSISFTAPLSTQIHTITNTSSPVSSPEPMGTFLVHQSI # PSVPLLPKTPGRNKKANIKDFFSPMPLERMFEPPSPPQPSSPQRPPRSPGEDKIDEIMETDIPNMVSFDGRKPSVGCQFTFSAPRDVFLNLDNRPQAE # STPGNPTVRTTNAPPSTDPPLRLFQFQYDTYTRDHLSAMVDSIAINPALGSGATNSPASLDQGLSRVSEATGISSLNSHLRSAKRVKLSPKSDFLGNG # NSPRPKLLGKDYVGESRSLMQQIKQARDFSTISTVASAQERDTSDMGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g523 ### # start gene g524 5 AUGUSTUS gene 2631227 2632579 0.23 + . g524 5 AUGUSTUS transcript 2631227 2632579 0.23 + . g524.t1 5 AUGUSTUS start_codon 2631227 2631229 . + 0 transcript_id "g524.t1"; gene_id "g524"; 5 AUGUSTUS CDS 2631227 2632579 0.23 + 0 transcript_id "g524.t1"; gene_id "g524"; 5 AUGUSTUS stop_codon 2632577 2632579 . + 0 transcript_id "g524.t1"; gene_id "g524"; # protein sequence = [MAQIKNDMKGSKRIFSGDSESYVTAAESTAPNLPRQSPRRSKPRLNPNLRKSTIRREEDDLAPHFSQISISSCRPQDI # PQLPHIHISSESSMHDMAPSAPSSSSSRLSPLDNDLKRYVSSSTTSSGTTLTTSSVPSYVKHSGPAHIRTIAPSEVPPLDRLGNMMFDRVMMKWVKSS # APLDEDHSLLEEISEDPFGDIESLKDDSGPTAEDSTAALEEHVDLNHSELSLVEELSEIDDTEEMELTSFETDHPNSRLVHAMSDFITNDGAETSDSE # NDTVAHEPFNPIEYDSECEEDEQTNEQSRAQEDKEEDDDANGLIIAAPQPSMIPAISRSPGTPDRPISSPSSMRSAMKTPASVLKDVSVARYRTPQRK # SKHRRSVSFSDGKRDGPIRGLNKNAEFDDVPGGSRIGFVPSVRSRRIANMLVALEDSGKCHVICRPYFQPRILILRYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g524 ### # start gene g525 5 AUGUSTUS gene 2635499 2636551 0.93 + . g525 5 AUGUSTUS transcript 2635499 2636551 0.93 + . g525.t1 5 AUGUSTUS start_codon 2635499 2635501 . + 0 transcript_id "g525.t1"; gene_id "g525"; 5 AUGUSTUS CDS 2635499 2636551 0.93 + 0 transcript_id "g525.t1"; gene_id "g525"; 5 AUGUSTUS stop_codon 2636549 2636551 . + 0 transcript_id "g525.t1"; gene_id "g525"; # protein sequence = [MSSSGTSTADTDSSIVSRAEKRPMTPSDSPEPKKSRPALDVDPSNWEIKSEDAKVQLPSIFTTFEDDNTLRPPANEFR # RASLPTLTSDRIRHSPYPPPSLRQSYAPTTQSSLAAYTFPPSNPADDDKNRSKVSTDLSYSITAGYDSYPTPGLSTGITSSNYGSPSDFNPGAYPDAD # SNWHSSPSGIVRPNSTPGQLSAPAVKYDESLRHASFSAPTQAHMFAGSARISGHQDRRSFSAGIKTEWNFPNPDFLPPSVPQYTSPQMPPAPSSASRP # SQSVSTSTLVDRPQRKRGKLPKETTDFLKAWLHRHSDHPYPSEEEKKQLCHATGLSMSQVSNWMINVSDTDLPLIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g525 ### # start gene g526 5 AUGUSTUS gene 2640727 2642559 0.4 + . g526 5 AUGUSTUS transcript 2640727 2642559 0.4 + . g526.t1 5 AUGUSTUS start_codon 2640727 2640729 . + 0 transcript_id "g526.t1"; gene_id "g526"; 5 AUGUSTUS CDS 2640727 2642559 0.4 + 0 transcript_id "g526.t1"; gene_id "g526"; 5 AUGUSTUS stop_codon 2642557 2642559 . + 0 transcript_id "g526.t1"; gene_id "g526"; # protein sequence = [MKKRKVGMFVEVSSPRKKSNLGNIGIDNHDASQIPSTPSKLRQKLASSSAPSIFPKTPSSIHSLALSVPMTPSTTGLL # TPQSARASSLLSTNSLKRKTLTLDSIESLPALQKPFITPTTGGRTKKAGLHHANTSDFELEDDEDELNLTSSPLKPLLYDSALKSKHKAGRDGHLTHD # RDERSPLDKLISLIQEIFEAEDGLPADPDATDLSQGGVFNPDSQDPSKPQLSARIIRKLTMHFGQIRGARGAGKGVHSSPTKGRGSRNGKLNDIGCDV # LGRLLRIIARSVKIGGEADPFGLLSGTRGDSLMSTHKTPKKKQSGTPVGKGGPDVVESEEKLETLGTLAVERGQSKEPKTPKKDKWKGKSSAGCSIEQ # PSAVDLDVLIRKLTQSRDGVLAAESIIALLGGESVKSSKGGEMLSKQLYSEEIILDCFDVVKSALEGGIYPFVEACSGVGSGLLMYLVNGATTSASGQ # SSSPYSNRPPSTSTQSTSAKAEASRHLLSEIFAALSATLPRISVLVGGAGTVKDNEIPMSDAVVIKAVYVGIGPFFVSSDEGSHTLKQERDRDEDDRG # KGKARIRGKKVLGGSLLTATFGKSAMRGLRMDALGLIRSVSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g526 ### # start gene g527 5 AUGUSTUS gene 2642855 2644891 0.21 + . g527 5 AUGUSTUS transcript 2642855 2644891 0.21 + . g527.t1 5 AUGUSTUS start_codon 2642855 2642857 . + 0 transcript_id "g527.t1"; gene_id "g527"; 5 AUGUSTUS CDS 2642855 2643409 0.36 + 0 transcript_id "g527.t1"; gene_id "g527"; 5 AUGUSTUS CDS 2643616 2643890 0.5 + 0 transcript_id "g527.t1"; gene_id "g527"; 5 AUGUSTUS CDS 2644216 2644348 0.93 + 1 transcript_id "g527.t1"; gene_id "g527"; 5 AUGUSTUS CDS 2644403 2644891 0.82 + 0 transcript_id "g527.t1"; gene_id "g527"; 5 AUGUSTUS stop_codon 2644889 2644891 . + 0 transcript_id "g527.t1"; gene_id "g527"; # protein sequence = [MESQQSQMNNGNNGGFLDEEDRAVIKLHSAALASPHKAASTIIHFLTSRSGKTKTTKNSNEAEYRAIFDALIQDCLSV # WCWPEWPSASILLSVAVKGMVRSLEEENRDKNSTPGDKDKDSPSDNSVGKSMALDHLGVIAARVRSLVQKVQSQEKEYKEGSHLLPSNREGTARAKKQ # IKSLRALTQSAQELCAATLGQDLAAALQKVNQWIEDDSANNRAPRQKVKDVEHIVDDGNNSKSQSRSLPRDHIKLRVFGEQLKSALREVWKERGIDLF # DIGGIEGHLLDSSPAVRDAAVELIGRYMIDSPDVAADYYPKIADRIADTGLSVRKRVIKLLKAFYHVCDSVERQTDISTKLVLRMMDEDDTVKDLAIK # AIEELWFSMSSPNVCAPIPRNSKPAITTSQWSSESLQNRVVVIMSVSANFRDRQSPLEDLLHNIMSAKEEGSAEALALHATYEEICGVLIDGLVDASD # LPGFVSNYFLCRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g527 ### # start gene g528 5 AUGUSTUS gene 2705226 2709473 0.98 + . g528 5 AUGUSTUS transcript 2705226 2709473 0.98 + . g528.t1 5 AUGUSTUS start_codon 2705226 2705228 . + 0 transcript_id "g528.t1"; gene_id "g528"; 5 AUGUSTUS CDS 2705226 2709473 0.98 + 0 transcript_id "g528.t1"; gene_id "g528"; 5 AUGUSTUS stop_codon 2709471 2709473 . + 0 transcript_id "g528.t1"; gene_id "g528"; # protein sequence = [MSSTTISTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ # VPIKAHQEDPIRMWSILEKQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALI # RALPEEYRHLSSNLLMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPSNPHNKRKG # IQANKAKVTEVDDDGVTESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRNWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEAR # QVLFSRVLHVPSLNNNLLSVLYLTKHKGFTVQILKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYG # DVSKLSKNKMVEGFKLESSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFK # RFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQDEGIEVQRTARNRPQQNGVAERLNRTLAELLTAMLLESGLPKTFWVECLAALVYVLNRCPTSA # VPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVP # PETTPKQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDELPIAIRRPARNRKPPGEWWKTKPSSSRVPA # PNDDSDDSNDDYYGDAELASISTQQVEPRNYREAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLPPGEKAIGSTWVFRIKHNADGSIERFKARLCAQ # GFSQRPGFDYLETYASTLRWSSLRLVLALAAIDDMELRSVDISHAFINSDIDTTIYMKQPEGFKQGGPEKVCRLNKSIYGLKQSPRLWSEKLCSVLVK # LGFKRLESDPCVYLFQRGNIKVIVPVWVDDITLACKDPGVLDKFVIELSKELKLRDLGETTFLLGIGIRRDRPNRKLYLNAKQYIIRKLEEFSMQDSK # PVKTPLNPTVSLSKEDSPKTPEDKEAMINIPYMSAVGSLLFLAMILRADIAFATGVLTRFNSNPGPAHWLAVKHLLRYLKGTIDYELELGPDPTAPDL # ITAISDADLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVASPTIIHVDNQSSIQVAKNPEHHG # RMKHLDRTFYWLREQVTHGKLAPSYLPTEDNPADLLTKALVKQKVEKFRTMIGLVKPSTSDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g528 ### # start gene g529 5 AUGUSTUS gene 2713075 2714019 1 - . g529 5 AUGUSTUS transcript 2713075 2714019 1 - . g529.t1 5 AUGUSTUS stop_codon 2713075 2713077 . - 0 transcript_id "g529.t1"; gene_id "g529"; 5 AUGUSTUS CDS 2713075 2714019 1 - 0 transcript_id "g529.t1"; gene_id "g529"; 5 AUGUSTUS start_codon 2714017 2714019 . - 0 transcript_id "g529.t1"; gene_id "g529"; # protein sequence = [MDLNKLDDLVLFLQSHAIEQSTKNNYSTGARDYVRFCTSHNLSLDPTPSTLSRYIAFTSRHKASGPKYLTGARHYLKD # VYPHFDESRSHPLVQATIRGSKKVRADPVKRKPPLRTSHLQQFLELKTKSYNHLLFATLISCCFYGCHRVGELTFPNQKSLRDWRKVIKRSTLKFEAG # RAGYHLPYHKGDPFYQGTDILFCSQQVADPVTLLKEYATVRDKLHGARPALFILEDGNVPTRGWFDSMFFAVLSKEFGGHSGRAGGATFYAGLGLQEM # IIMALGRWSSSAWKIYIRDNPAVRAELELAAIRRHQSSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g529 ### # start gene g530 5 AUGUSTUS gene 2714070 2717643 0.43 - . g530 5 AUGUSTUS transcript 2714070 2717643 0.43 - . g530.t1 5 AUGUSTUS stop_codon 2714070 2714072 . - 0 transcript_id "g530.t1"; gene_id "g530"; 5 AUGUSTUS CDS 2714070 2716205 0.69 - 0 transcript_id "g530.t1"; gene_id "g530"; 5 AUGUSTUS CDS 2716264 2717643 0.43 - 0 transcript_id "g530.t1"; gene_id "g530"; 5 AUGUSTUS start_codon 2717641 2717643 . - 0 transcript_id "g530.t1"; gene_id "g530"; # protein sequence = [MAPERSTSPDPLASYDISPSAPQIALDKAQIASDKPLQRSQTLPSTSSTQISLDKGKGRAQPAQSTSYIASRPSPELR # SVRIRPRTLQERLQVIPEAGTAPQVTGSEHREASIALSTHSHHSSHQIPLEDRISAAPTPPDALEQVRLTAEALGQVVEQYRNNELSPNDAFRALRSL # TDDPTVVRDFIGQIQEIQRDHLRASRERVAAAKAARVAAAAASKSRISDGPLVSTEKAVNEAAWALMERELAENALQLAAAEAEADQMEQDAHQDRSN # SLQQALLKLVGQTQSSSSPGTSSGLPPSLLEAAPHLSALTSSDILSPTVSETWKLRMLFTVDSHVDTTVSLLSAQPFTDPLPQSLLKLIVKDRYVDFE # KIHASITSYTSIFDDSTTFGSEYKLVKKEHSIRSLPVTSEAQWLRVFDAWLAPVLKIYPHRQSELSAYKASIMEFFRAAPSDPSIAFRKTSDSCCLRN # FSVLENVPAPLLALLLLQSARILLVSFGMKGNALPHVQIAASMASVVSVESPTKQLTPNPAMRSLSTVDQRVKTALAGPRSLTGTKRAAPESNSGSSN # SIPRFRRGYLWSTSSSSSEIIPPSIQSTYTAPPLPSPPEHLLNNPQIQSTLKAMAPYIKVETPFNVDRLESLLASHPNQPFVASVMRSLREGFWPFYE # AEWEVESKQKLDNYVSEPQDFAALRAHRDQEVAAGRWSEALPEDFVLLPGMKVSPMFVVWQKGKPRVVMDHTGSGLNDNIPKAEGKVKYDDMHTFGQV # LNDILKEHPDEELILFKSDVSKAFLNLPGHPLWQLCQVVEVDGRYHIVRRLVFGTRTSPRCWCSLSSLMCWFGSEKLGIIGLHVYMDDFYGWDFKRNL # LLFHDQLRPKRQVQLLVFWDMILCPYEDKKQEHGVTLKIIGFWVDIVKGSISLSSESIQGLVADITSFLSSPKRQAALRDWQHLAGSLNWSLNVLPWA # RPALTEMYRKMSGKTLQFRAIPINGEVYRDLTWFSDLLQTAIGIRFVDAQRWHDSEADFVGWTDASNIGLSYVYAGNGFCYQLHPTEGSPVVDIFFRE # LLSILCLFHHIASKPSPPQHVLIYSDSLDSVQVLNSLSTRESSHNSILLAIAAIVLKTGIDIRVRHIAGKSNIRADLLSRLLLDDYKLQFPSERVRLF # EPPRELLPARWRGCF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g530 ### # start gene g531 5 AUGUSTUS gene 2718485 2719061 0.67 + . g531 5 AUGUSTUS transcript 2718485 2719061 0.67 + . g531.t1 5 AUGUSTUS start_codon 2718485 2718487 . + 0 transcript_id "g531.t1"; gene_id "g531"; 5 AUGUSTUS CDS 2718485 2718643 0.67 + 0 transcript_id "g531.t1"; gene_id "g531"; 5 AUGUSTUS CDS 2718738 2719061 0.84 + 0 transcript_id "g531.t1"; gene_id "g531"; 5 AUGUSTUS stop_codon 2719059 2719061 . + 0 transcript_id "g531.t1"; gene_id "g531"; # protein sequence = [MVGQVEQQQLDVFMCTIEVMNTDLIAVVYLLFAEASRNAPYPWNPPSCRVMMSYAQHFQAAEFEFNANLVKTYATRAR # IAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTPMEIAVPVIKTVERAITPFTCGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g531 ### # start gene g532 5 AUGUSTUS gene 2721187 2722898 0.92 + . g532 5 AUGUSTUS transcript 2721187 2722898 0.92 + . g532.t1 5 AUGUSTUS start_codon 2721187 2721189 . + 0 transcript_id "g532.t1"; gene_id "g532"; 5 AUGUSTUS CDS 2721187 2721204 0.97 + 0 transcript_id "g532.t1"; gene_id "g532"; 5 AUGUSTUS CDS 2721357 2721360 0.98 + 0 transcript_id "g532.t1"; gene_id "g532"; 5 AUGUSTUS CDS 2721427 2721458 1 + 2 transcript_id "g532.t1"; gene_id "g532"; 5 AUGUSTUS CDS 2721558 2721599 0.99 + 0 transcript_id "g532.t1"; gene_id "g532"; 5 AUGUSTUS CDS 2721666 2722898 0.98 + 0 transcript_id "g532.t1"; gene_id "g532"; 5 AUGUSTUS stop_codon 2722896 2722898 . + 0 transcript_id "g532.t1"; gene_id "g532"; # protein sequence = [MTRVNILMITRSDEALCNFSALDRALSGLPGQTVVQRFQALEEELRVVKRDRDVALGELSTASRRSSELKTTLMQQQG # LVDKTNALATCQRRRLEELREEIHRTRDRATFVEQIIKEYLDEGFYEVVLPPLSQLEGDLKRAQEDIRRIATFAHCLYRSDPAMVLHHHSHYIGAIIE # AVVTFLRRGLASDDPNVVAYNFQLALDYMQTARGIHGDLYMRSVSSIGWFFNNMVDEDEGLHHLVLEHSRFENDGLFLTAAQHAGFAAPPESSLEPPL # HRRMLALSTAFPHRDGAGRWDDVVATIPSLDELTITWEQLMLDYIHHITDTPLSGLGEPAPMSVEPGVESSDVVVDQLLKETALVEVETHWSALQLTQ # AVCHSAQCTDCQCLNTRLVGWTTSLIVAQYSNKHCRYDRSQYRVRIDLYLSTEVGIQVCLVLYVLETHEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g532 ### # start gene g533 5 AUGUSTUS gene 2723149 2723430 0.64 - . g533 5 AUGUSTUS transcript 2723149 2723430 0.64 - . g533.t1 5 AUGUSTUS stop_codon 2723149 2723151 . - 0 transcript_id "g533.t1"; gene_id "g533"; 5 AUGUSTUS CDS 2723149 2723430 0.64 - 0 transcript_id "g533.t1"; gene_id "g533"; 5 AUGUSTUS start_codon 2723428 2723430 . - 0 transcript_id "g533.t1"; gene_id "g533"; # protein sequence = [MEEESDAPIITTKAYKGVLAAINEHSLAVDMLDNLEEVQDNITIELPRSTLDADEEDDDDDTAESLMDLSDLMKSIKE # VSKGVSEKTSKEYIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g533 ### # start gene g534 5 AUGUSTUS gene 2724358 2726130 0.08 - . g534 5 AUGUSTUS transcript 2724358 2726130 0.08 - . g534.t1 5 AUGUSTUS stop_codon 2724358 2724360 . - 0 transcript_id "g534.t1"; gene_id "g534"; 5 AUGUSTUS CDS 2724358 2724905 0.44 - 2 transcript_id "g534.t1"; gene_id "g534"; 5 AUGUSTUS CDS 2724972 2724975 0.78 - 0 transcript_id "g534.t1"; gene_id "g534"; 5 AUGUSTUS CDS 2725128 2725137 0.51 - 1 transcript_id "g534.t1"; gene_id "g534"; 5 AUGUSTUS CDS 2725236 2725702 0.51 - 0 transcript_id "g534.t1"; gene_id "g534"; 5 AUGUSTUS CDS 2725876 2726130 0.28 - 0 transcript_id "g534.t1"; gene_id "g534"; 5 AUGUSTUS start_codon 2726128 2726130 . - 0 transcript_id "g534.t1"; gene_id "g534"; # protein sequence = [MEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYGDVSKLSKNKMVEGFKLE # SSAKPDPSSNTDEEKSDAFAAFKRFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQDEGIEVQRTARNQPQQNGVAERLNRTLAELLTAMLLESGL # PKTFWVECLAALVYVLNCCPTSAVPDVTPYEVFYKKKLLKETALVEVETHWSALQLTQTVCHPAQVNILMITRSDEALCNVCRKCSITTVCSTIVHHI # IGVIGTATVIEYAVIHSLSMEAQMSICNMSIEAGVHAGVIAPDKLTFSVIIRFPLKAKVGIALLLTGTLNRPNAKLDIKVNIPASDIILTVTWGTSPQ # DVAPITGIVPDPSASEDPVKCASVTRSLNYMGLTPNTPMQDIKINKVFIGSCMNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g534 ### # start gene g535 5 AUGUSTUS gene 2729357 2730839 0.25 + . g535 5 AUGUSTUS transcript 2729357 2730839 0.25 + . g535.t1 5 AUGUSTUS start_codon 2729357 2729359 . + 0 transcript_id "g535.t1"; gene_id "g535"; 5 AUGUSTUS CDS 2729357 2729385 0.25 + 0 transcript_id "g535.t1"; gene_id "g535"; 5 AUGUSTUS CDS 2730383 2730407 0.67 + 1 transcript_id "g535.t1"; gene_id "g535"; 5 AUGUSTUS CDS 2730502 2730505 0.69 + 0 transcript_id "g535.t1"; gene_id "g535"; 5 AUGUSTUS CDS 2730572 2730603 0.81 + 2 transcript_id "g535.t1"; gene_id "g535"; 5 AUGUSTUS CDS 2730651 2730839 0.9 + 0 transcript_id "g535.t1"; gene_id "g535"; 5 AUGUSTUS stop_codon 2730837 2730839 . + 0 transcript_id "g535.t1"; gene_id "g535"; # protein sequence = [MDRSARLESFRNTGLFGLLMITRSDEALCNSTYTAPPLPSPPEHLLNNPQIQSTLKAMAPYIKVETPFNVDRLENLLA # YASFHSGEVCLAKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g535 ### # start gene g536 5 AUGUSTUS gene 2734717 2735196 0.62 - . g536 5 AUGUSTUS transcript 2734717 2735196 0.62 - . g536.t1 5 AUGUSTUS stop_codon 2734717 2734719 . - 0 transcript_id "g536.t1"; gene_id "g536"; 5 AUGUSTUS CDS 2734717 2735196 0.62 - 0 transcript_id "g536.t1"; gene_id "g536"; 5 AUGUSTUS start_codon 2735194 2735196 . - 0 transcript_id "g536.t1"; gene_id "g536"; # protein sequence = [MWELFLRSILDLQNAGEDPIVILEALKTAEPNRRVITLNEWTLMATLFHWPSPFNLSGLDFDNRTPGEWIELLCSIHS # GESTAHIDKHGHLVESSPPPDSATEALEGLKEVERGSADEGTSSKVGGSIPMELDLPAIESLAEPALSPEKGAGPVQTLES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g536 ### # start gene g537 5 AUGUSTUS gene 2737322 2739133 0.22 + . g537 5 AUGUSTUS transcript 2737322 2739133 0.22 + . g537.t1 5 AUGUSTUS start_codon 2737322 2737324 . + 0 transcript_id "g537.t1"; gene_id "g537"; 5 AUGUSTUS CDS 2737322 2737847 0.38 + 0 transcript_id "g537.t1"; gene_id "g537"; 5 AUGUSTUS CDS 2738574 2739133 0.55 + 2 transcript_id "g537.t1"; gene_id "g537"; 5 AUGUSTUS stop_codon 2739131 2739133 . + 0 transcript_id "g537.t1"; gene_id "g537"; # protein sequence = [MPHSLGPAPVPPPSQKAQPKPIPVYKGTPAYEQMQILHPKTPCEIDIAAAEQLMAFQNQTLSQTAQRTRRSKPLTADQ # LPLTLDEQVFAGTMGLSKADMLQQREFERQYGLEDMSSEPEEDKDTSQRVSTQRTKQRKRFKSISPAEDNPPSMDLEDFEGVGHTFDDDHDGVSSNTI # HQATVNNPPSCILARLGEKLGHQKHCNAPTLPPPPSVPSVPPQTPLAPAPATDAIAQAMTMVGTVTPLLAMLMNGNRGSREHSPPRTSSSKRHHADSS # PAPASSPYKASPSRNEELLIWLPKVDADVERGKQNASYAQYGGILTERESLILMILFNSLVNALKHLPEWHMGFVIVFSVTLGRIWV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g537 ### # start gene g538 5 AUGUSTUS gene 2745828 2747808 0.31 - . g538 5 AUGUSTUS transcript 2745828 2747808 0.31 - . g538.t1 5 AUGUSTUS stop_codon 2745828 2745830 . - 0 transcript_id "g538.t1"; gene_id "g538"; 5 AUGUSTUS CDS 2745828 2746666 0.87 - 2 transcript_id "g538.t1"; gene_id "g538"; 5 AUGUSTUS CDS 2747075 2747182 0.43 - 2 transcript_id "g538.t1"; gene_id "g538"; 5 AUGUSTUS CDS 2747235 2747808 0.86 - 0 transcript_id "g538.t1"; gene_id "g538"; 5 AUGUSTUS start_codon 2747806 2747808 . - 0 transcript_id "g538.t1"; gene_id "g538"; # protein sequence = [MPPIRLGHSRQRSNCLTNSSFPSPLGNNLAGATSFTHSPPPATPASSMQYDARALSGSAVTNSSFTSPLDGNLVGAAS # PICPLPPPTKFSTDVGPRVTDKVPTSKKKRAEMGPAKRKLACEASSLRSEKLGAAIDDLLEERDLLIDNISKEHNVSSTRVKHLAHQAPGLKAKKKAS # NYNILFYYKNKEINGKLPSGSKINSVEVHAAVRADEDLMHIFHNKEAMDELQKRGKMSVTDIAKDLVCTISRGLCMFNIFVCCHSLLMVIAAEITGIR # DLPMNYVSFESAICVPHKVGVIGWPTNIPWKYPQKLAAEEVRALHASWGDGKTHWYRMTASKHRSLVRRLTTEGKLDPKEWKKHKPSKSTKHTDGDEL # LDTASDSSSDSSSSDDDLSHCQKKSKPSSSISGSSNTRGVGKNVAQKVRTNHPSSKAAGPSAKHTKHLKETHAKGKGAESDRGNKGGKGKGKQSATRR # LGSKKSVRFITDSDEVDSDQREGANRSDGSMSSADS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g538 ### # start gene g539 5 AUGUSTUS gene 2755023 2755620 0.9 - . g539 5 AUGUSTUS transcript 2755023 2755620 0.9 - . g539.t1 5 AUGUSTUS stop_codon 2755023 2755025 . - 0 transcript_id "g539.t1"; gene_id "g539"; 5 AUGUSTUS CDS 2755023 2755248 0.93 - 1 transcript_id "g539.t1"; gene_id "g539"; 5 AUGUSTUS CDS 2755325 2755620 0.92 - 0 transcript_id "g539.t1"; gene_id "g539"; 5 AUGUSTUS start_codon 2755618 2755620 . - 0 transcript_id "g539.t1"; gene_id "g539"; # protein sequence = [MGADAAFHVELPETSPAPEPLGVAKAVQAIIEKQLNSVDMVILGKQSIDDDLGQTGQMLAGLLDWGQATYASKVDLDL # EQKNAVITREIDGGLEQVCVKQHSSEPRYASLPNIMKAKKKPVTKLTPADLGVSFKPQMEVIKVTEPPKRVGGTKVESVDELVEKLKAAGFTAVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g539 ### # start gene g540 5 AUGUSTUS gene 2757070 2757996 1 - . g540 5 AUGUSTUS transcript 2757070 2757996 1 - . g540.t1 5 AUGUSTUS stop_codon 2757070 2757072 . - 0 transcript_id "g540.t1"; gene_id "g540"; 5 AUGUSTUS CDS 2757070 2757996 1 - 0 transcript_id "g540.t1"; gene_id "g540"; 5 AUGUSTUS start_codon 2757994 2757996 . - 0 transcript_id "g540.t1"; gene_id "g540"; # protein sequence = [MASLPGRTSLSKGSSEPQDKILTTSLPEDSRRSNTTSAQDSDAVSITSSKSRVMSPPLIVPQSSLQQKFSMPNLRRKA # FNKEDDVNSPITENETLQVRDMDFELVRPNIPFSPDRSSEDSISPGLGRRSESRATEGVQMHLRAESPAISVSSGISGTSRITTGVSSDSAAFRSKAS # SKASNSEASMDAHRQREQKWMTLITTVPPEQARKNKKVRKLLGEGVPASVRYLVWSLMTNAKSKGVAGVYSQLSKRVRVAAFADMQRDVKRCFGEHPH # LQSTEGPLVCLLQAYLTMVPDVQYSTGKLSLWLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g540 ### # start gene g541 5 AUGUSTUS gene 2758368 2761991 0.52 - . g541 5 AUGUSTUS transcript 2758368 2761991 0.52 - . g541.t1 5 AUGUSTUS stop_codon 2758368 2758370 . - 0 transcript_id "g541.t1"; gene_id "g541"; 5 AUGUSTUS CDS 2758368 2759430 0.96 - 1 transcript_id "g541.t1"; gene_id "g541"; 5 AUGUSTUS CDS 2759485 2761991 0.52 - 0 transcript_id "g541.t1"; gene_id "g541"; 5 AUGUSTUS start_codon 2761989 2761991 . - 0 transcript_id "g541.t1"; gene_id "g541"; # protein sequence = [MTKRNSSAMSSRVKSPTGISPTPTLGSNYRNSSSSTPVSSNPATPLTPAFERATSRDIQNLKQNSSLDAQVTDRLTLS # RSPQNALLSAASETGTASLPLQPTVATSRVAVERSSTHHVHMPSVAHSEASQYSSTSASTVDIDYGLPRVMSPPSMYSEPDLHIRQPSIATVMSSESM # GKQTVRSESDVDQDVVPRRSGSIRSSNASTMRSNSPSSISQSYSPVPGSETSFFREEINDPRGSVASVASDGEVGIGLSLLASLGEGDSDDDSENERG # DERSHDLSRLLSKSIEDNHTDSGSSVGSLSVERRTLSPSPISEDAVAAFPRPPSTQVAVATTSDPINPFGTFGRTITSAGVHGGLDTIFGGRNTRDSH # SSMASSASLGTDSGVSKDTDSSESGGATAIDHFTLQAMVHEQPIELEHTRSPTLASVRSNSVYSSTGQRSPSLQASSPRNLSPPSPAFPPPNFRFPAQ # RPDNISLPAMSSSEILPPHSPTLSHTSGASASEWEGASDIYDNYLYRYSVASKSSRLSQMSMASRSGFNHRNIPSTSTMPPTAIASMASLVNMASNLR # LPSDQVSENANAQLPSPVDDQTEQHTDLEEPLYTSLTAESTDTNATITPSRIPPRYDSLTMQRPSSVVASLRSLSSRRSIVSSHHPESPHHSDESDDE # SIYSRLSSKPSLSLLEAHAASLLAPENKEKVNTTSALNVVKASPSANITTSDRALATVKNDSRRPSPLDLTKDQIRSSERSSGGGMIGPSPLLHTRWG # SPVSSNGMSSGSAYDGRSSGGYPTPPFTDMRGSYDEKNRNQAAGSEDRNFQEPKIDDTVQNDPDSSVSTITRPLVIEDDEELPSHAMDPQEGEADMSL # VTMESAEFRYADDLRNSVHSSSTSKSKNESLGVTLGVTPIVITPSIQTASTGSPSSGIADNFPISPVLPPSSNFPAASASTGQSVPRPSLAELRGYPN # TAVQGQRQSLFLPHPNAPKAPLQSPGPLYIRKVENFPQLEPNLIRQGPDPNKVASNVLRMVLNKPPPPPRPVMLPPPSSIPIRGNIRRNPPAPPPPLP # RGPTIYARVDVDLSTSNGPVPITFSVEPMGPPPPPLLQSQVAIQPDASQHQLPPLTSDQQQDQPQLPHMSTTHVKRSVTVPTTSLPRTEPQSEPGGVI # PRENATPRPLVSRPRSKSFSTGFKSPVVGNSFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g541 ### # start gene g542 5 AUGUSTUS gene 2762780 2763337 0.63 - . g542 5 AUGUSTUS transcript 2762780 2763337 0.63 - . g542.t1 5 AUGUSTUS stop_codon 2762780 2762782 . - 0 transcript_id "g542.t1"; gene_id "g542"; 5 AUGUSTUS CDS 2762780 2763337 0.63 - 0 transcript_id "g542.t1"; gene_id "g542"; 5 AUGUSTUS start_codon 2763335 2763337 . - 0 transcript_id "g542.t1"; gene_id "g542"; # protein sequence = [MTEVGVDGVLGIEKAKAVVGSKEAKSKTGIVQPVEVVEKVQREDGPSVFRGKWKGTQGVLTVSTTATQPLVAFSKVGL # KKDVDSPAETAVWSLLINDILEVRKVGGFGWKGKMIVGWSTGDRVIDGCESQFGNLRRSLLELMVPFVCLVEIIDVNGNVYYITALPRRDELFNRLVA # IGNQRWESC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g542 ### # start gene g543 5 AUGUSTUS gene 2763735 2765208 0.39 - . g543 5 AUGUSTUS transcript 2763735 2765208 0.39 - . g543.t1 5 AUGUSTUS stop_codon 2763735 2763737 . - 0 transcript_id "g543.t1"; gene_id "g543"; 5 AUGUSTUS CDS 2763735 2764802 0.64 - 0 transcript_id "g543.t1"; gene_id "g543"; 5 AUGUSTUS CDS 2764972 2765208 0.39 - 0 transcript_id "g543.t1"; gene_id "g543"; 5 AUGUSTUS start_codon 2765206 2765208 . - 0 transcript_id "g543.t1"; gene_id "g543"; # protein sequence = [MTSQADNLMKSLPPTPSLDSDGPHTTFDDQRATLKPTKHHDRVSEVPTVAEPPALAIGERERSKDPETEDLGWSENPK # YQVFHFRRITNLPPGVLDCNSATTNDSYSPDKLRSALERFYLTIVVGVASALKHIARIRSWTEASRTAWFCAAYFLAWYKDVLTPTILALLLTLVMVP # SSRTVLFPPAPLAAIDTSTGGVKKPLAGQLGSKDSITGAQEQFRGEAAEKEADHFVTGLSTIAVSVAVGKEGQGAGSSSPAEETNSTGEIVDAKVPNI # VDIEGAVDAQRAASTADKPMKDDTGSKQAAISVQQTMWDNLGTLMSALIMIMDIWEMTGKYVPRMRINLLNLNPILSFSALTSSPPFKSLPMRVRIAS # PIALLIVVSLVLPEFWVYKGITLGFGLAFFGQPIFDKLAQKHVLKYLDHWIPMWRQYLDIRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g543 ### # start gene g544 5 AUGUSTUS gene 2767869 2768372 0.43 - . g544 5 AUGUSTUS transcript 2767869 2768372 0.43 - . g544.t1 5 AUGUSTUS stop_codon 2767869 2767871 . - 0 transcript_id "g544.t1"; gene_id "g544"; 5 AUGUSTUS CDS 2767869 2768372 0.43 - 0 transcript_id "g544.t1"; gene_id "g544"; 5 AUGUSTUS start_codon 2768370 2768372 . - 0 transcript_id "g544.t1"; gene_id "g544"; # protein sequence = [MLALLSLPFICSWFGQVLSSLTPFVLHERRSRSPSGWVPERKHDASAVLPIRFGLKQSNIQNLEEYLYDISDPDSSNF # GKHWTPLEVAKTFAPSAESVKVVHEWLIDNGIPKDRLRITPSQGWIEVDATVEEAEHLILADYYVYKHESGQEHIGAYNYTSFICKRVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g544 ### # start gene g545 5 AUGUSTUS gene 2768997 2769533 0.78 + . g545 5 AUGUSTUS transcript 2768997 2769533 0.78 + . g545.t1 5 AUGUSTUS start_codon 2768997 2768999 . + 0 transcript_id "g545.t1"; gene_id "g545"; 5 AUGUSTUS CDS 2768997 2769533 0.78 + 0 transcript_id "g545.t1"; gene_id "g545"; 5 AUGUSTUS stop_codon 2769531 2769533 . + 0 transcript_id "g545.t1"; gene_id "g545"; # protein sequence = [MSRDSISKASELYESQAQSSASPVPSSSARYSAVEMLDNVGEHEASGFLEKLPPNADVNGKEELELQLSDNDETFDGV # TMLQQGISSLSMSPRFHGRSSNSKLVSDIFEHRRQTTEYSASPSKQLPLPTLLYKRPEFWSSFPVGHFTLSFLCTFFSLFSSSNVVGIRAGDIPQSLY # VS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g545 ### # start gene g546 5 AUGUSTUS gene 2770221 2770572 0.75 + . g546 5 AUGUSTUS transcript 2770221 2770572 0.75 + . g546.t1 5 AUGUSTUS start_codon 2770221 2770223 . + 0 transcript_id "g546.t1"; gene_id "g546"; 5 AUGUSTUS CDS 2770221 2770388 0.76 + 0 transcript_id "g546.t1"; gene_id "g546"; 5 AUGUSTUS CDS 2770444 2770572 0.77 + 0 transcript_id "g546.t1"; gene_id "g546"; 5 AUGUSTUS stop_codon 2770570 2770572 . + 0 transcript_id "g546.t1"; gene_id "g546"; # protein sequence = [MHSFDLDYPIDCDDEFWLLSDPEESFKQPPGKPSKIAFIISFIEVSFILSYALRTIYSINKSKVFLGYTGQGWEERLV # TQLDSKINSWEAKIPAHCKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g546 ### # start gene g547 5 AUGUSTUS gene 2773236 2773649 0.53 - . g547 5 AUGUSTUS transcript 2773236 2773649 0.53 - . g547.t1 5 AUGUSTUS stop_codon 2773236 2773238 . - 0 transcript_id "g547.t1"; gene_id "g547"; 5 AUGUSTUS CDS 2773236 2773649 0.53 - 0 transcript_id "g547.t1"; gene_id "g547"; 5 AUGUSTUS start_codon 2773647 2773649 . - 0 transcript_id "g547.t1"; gene_id "g547"; # protein sequence = [MWPLDLDGDAGVGQARGRALELVLKPQREGGGNNVYKEAIPEFLVSLPPRERPAWIAMELISPPLGLKNYLVRAGSEE # CVETEVVSELGIFGWSLFGEGKVINEKEAGWLVRTKGKDSNEGGVATGFSVLDSLVLVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g547 ### # start gene g548 5 AUGUSTUS gene 2775001 2776521 0.38 + . g548 5 AUGUSTUS transcript 2775001 2776521 0.38 + . g548.t1 5 AUGUSTUS start_codon 2775001 2775003 . + 0 transcript_id "g548.t1"; gene_id "g548"; 5 AUGUSTUS CDS 2775001 2775297 0.63 + 0 transcript_id "g548.t1"; gene_id "g548"; 5 AUGUSTUS CDS 2775394 2776521 0.39 + 0 transcript_id "g548.t1"; gene_id "g548"; 5 AUGUSTUS stop_codon 2776519 2776521 . + 0 transcript_id "g548.t1"; gene_id "g548"; # protein sequence = [MSIHFHPTDPIIEDDHDANLPSSDEDEDETWDDWISDSSTQRGDCRSLFDNKTGNVEDIIAYDKAAHGFDLNEACARL # CSFFLLNLGIVRGSYNSSALDKPAPANITSLTGKESFFTSDDFLRPVVEDDPMLRESSTYLTRSKIFQHALGYQPDDWTDSEDEDSLSTDRRIRLLEQ # KLTETKRDFQEYRKIVNQRFNLGQTAEPSGLPPKRDDDSHYFESYGANDIHAVMIQDKVRTSTYARYILGTPSVFENAIVLDVGCGTGILSLFAARAG # ARKVFAVDASDIAMKAEKIVKANDLDSVITVIRGKVEDIQLPEGVKVDVIISEWMGYALLYESMLDSVLVARDRFLKLDGVMAPAHSKMMLGLCDASE # IVKDRITFWNDVYGGYYLFDASKTVFESAVIGFDMSVMAEGLYHEAVIDVVGSHAMLSTPSVVKVVIPFCLWFVRIILTLTLRNSISPRLLPASSTSY # LRSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g548 ### # start gene g549 5 AUGUSTUS gene 2779941 2780357 0.62 + . g549 5 AUGUSTUS transcript 2779941 2780357 0.62 + . g549.t1 5 AUGUSTUS start_codon 2779941 2779943 . + 0 transcript_id "g549.t1"; gene_id "g549"; 5 AUGUSTUS CDS 2779941 2780357 0.62 + 0 transcript_id "g549.t1"; gene_id "g549"; 5 AUGUSTUS stop_codon 2780355 2780357 . + 0 transcript_id "g549.t1"; gene_id "g549"; # protein sequence = [MVIPKCEPSSLHHLIRLTPITSLSLLSDHAAKMHELPDEYLADALPIAKKIALAQGAENYNILQNNGALAHQVSSTSN # IVTDHICPVYICSSIQVVQHVHFHVIPKPNEEEGLIVGWPAKEVPKEELQKVYEELKGKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g549 ### # start gene g550 5 AUGUSTUS gene 2783440 2783868 0.61 + . g550 5 AUGUSTUS transcript 2783440 2783868 0.61 + . g550.t1 5 AUGUSTUS start_codon 2783440 2783442 . + 0 transcript_id "g550.t1"; gene_id "g550"; 5 AUGUSTUS CDS 2783440 2783868 0.61 + 0 transcript_id "g550.t1"; gene_id "g550"; 5 AUGUSTUS stop_codon 2783866 2783868 . + 0 transcript_id "g550.t1"; gene_id "g550"; # protein sequence = [MTSKVPASTSSTSLVSNANTISSRVPLNPRQTPQKDYAAAFGDLQSRYGVAASHNPISTPVVKKKQAKDSTQALAAQS # APGTSEGAPSDGSTGRFDGPSPDGLKNKKRGISRFFPWIGLIIFMWVNDIVLMTIRQMKARRFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g550 ### # start gene g551 5 AUGUSTUS gene 2796496 2797032 0.45 - . g551 5 AUGUSTUS transcript 2796496 2797032 0.45 - . g551.t1 5 AUGUSTUS stop_codon 2796496 2796498 . - 0 transcript_id "g551.t1"; gene_id "g551"; 5 AUGUSTUS CDS 2796496 2797032 0.45 - 0 transcript_id "g551.t1"; gene_id "g551"; 5 AUGUSTUS start_codon 2797030 2797032 . - 0 transcript_id "g551.t1"; gene_id "g551"; # protein sequence = [MLISTLLRSRWRQLRARRLEAEEAADIKSRRFEEQEAENLRRESEDFLARQMDEMQALAEEQRKAGLLLDDGGLVKLN # VSLAPAPAKEGGKEKATTVFAEEEDEEEEIKKRKVPLVKLDFSVAESSEKMKERLERIKESVPHDTESLFKAKVRWDGLSDVSFIYHSFIEVFLTNLL # ST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g551 ### # start gene g552 5 AUGUSTUS gene 2800497 2801831 0.79 - . g552 5 AUGUSTUS transcript 2800497 2801831 0.79 - . g552.t1 5 AUGUSTUS stop_codon 2800497 2800499 . - 0 transcript_id "g552.t1"; gene_id "g552"; 5 AUGUSTUS CDS 2800497 2801831 0.79 - 0 transcript_id "g552.t1"; gene_id "g552"; 5 AUGUSTUS start_codon 2801829 2801831 . - 0 transcript_id "g552.t1"; gene_id "g552"; # protein sequence = [MHRSIINFLVTSQGCTDCSTNERALVSEDYGYFIDPDCSKIALDEPLTIMYGAGWLKKTYKKKSRFQITNFDIFDSHH # GTDPRASHFALFLALLFASMFDGFTQVSNAFTISGISTPLLEAKLVTFTRIGPRLEARDVHFTDHTPDRLVLLATTPEEALCWFKHEREEPFCALQYS # SSTSATLVFCLQFSDARTSWVFVRVPSTFQNKEDTDFARDIQDLHPTEIFRDQVRKPLNPSLSIYSPPLQLEVASLLNQIPDLCLDAGPSGMLRISGS # FWVEKATEESIPYELYPSGILNIEGLSGAAKSISEDMLMRRLSRVFSQRNEVTVAPPVSATEAPQEQGRKRGRSTTIDDDAGTATSGTSRSKTKQHAK # STRSDHAASSGSNTQARKTRKGAGRSLRSRRIPSKISNVATGRASASAPRSDRVEPTASSSSHTSPYNLRKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g552 ### # start gene g553 5 AUGUSTUS gene 2804701 2805639 0.25 - . g553 5 AUGUSTUS transcript 2804701 2805639 0.25 - . g553.t1 5 AUGUSTUS stop_codon 2804701 2804703 . - 0 transcript_id "g553.t1"; gene_id "g553"; 5 AUGUSTUS CDS 2804701 2805639 0.25 - 0 transcript_id "g553.t1"; gene_id "g553"; 5 AUGUSTUS start_codon 2805637 2805639 . - 0 transcript_id "g553.t1"; gene_id "g553"; # protein sequence = [MKEKIKSLCYDYLLRSKLDGWLGKDENDYIAYGFARVKNAGVRTLIRIDEPLVMMACAMWLNGSSESDAHSLYKYVAN # RIQDHNPSTGRNGFEEFICFYLQQVFQKPRRLGQVFDLPDKENPKKDSVLAQKRATLVTLHIDEIGSKRKLMEGTTDIQNIGEAKLPGALGLGIQSMD # ECIPLINWVKLKAHTAFCFPMNEMGPDIMCFLRLEDDKGKPEDFTYICLAIQCKFHQVDGELEPSTLRDAIATVTPRKFFAPRHVSQISLRVTANSTF # LHRDRSKMKTKQWGVKKNERKHVRVSYPPSKDYLARIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g553 ### # start gene g554 5 AUGUSTUS gene 2808981 2809630 0.62 - . g554 5 AUGUSTUS transcript 2808981 2809630 0.62 - . g554.t1 5 AUGUSTUS stop_codon 2808981 2808983 . - 0 transcript_id "g554.t1"; gene_id "g554"; 5 AUGUSTUS CDS 2808981 2809432 0.71 - 2 transcript_id "g554.t1"; gene_id "g554"; 5 AUGUSTUS CDS 2809612 2809630 0.62 - 0 transcript_id "g554.t1"; gene_id "g554"; 5 AUGUSTUS start_codon 2809628 2809630 . - 0 transcript_id "g554.t1"; gene_id "g554"; # protein sequence = [MSISTLAVGPVPKSAKRWARTAHLHEVKSPAPLIATANNKVAKDDSKNLEKKSSEVVSNARSMTTLLTTQDKAKSLDD # SDLFLEAPGRSTRRSNRYSFATSDIDKPMIPAGKRWTSSSDSSCDGDGGDLWVDTDATDTSVDGDSGGFSGFSFEEGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g554 ### # start gene g555 5 AUGUSTUS gene 2810206 2811847 0.61 - . g555 5 AUGUSTUS transcript 2810206 2811847 0.61 - . g555.t1 5 AUGUSTUS stop_codon 2810206 2810208 . - 0 transcript_id "g555.t1"; gene_id "g555"; 5 AUGUSTUS CDS 2810206 2810968 0.71 - 1 transcript_id "g555.t1"; gene_id "g555"; 5 AUGUSTUS CDS 2811096 2811847 0.61 - 0 transcript_id "g555.t1"; gene_id "g555"; 5 AUGUSTUS start_codon 2811845 2811847 . - 0 transcript_id "g555.t1"; gene_id "g555"; # protein sequence = [MALFAVLPAAFLALVFASPVLSAPSSSNDPFRALSAHATRQPEPPVCCLTPLPPIEPVEDEVLLSFEEWKEKQAALQA # SAKVNGKGEPPNHTNAVAGNSAHVNAGREIRSSAAENAVPVTPSEMLDALDSDNASEKLSPHFQVPLTDRFNYAGTDCSARVHLAHRSAKSPASILSS # KRDRYMLSPCNSPKEKQFVVVELCEDIRIDTVQLANFEFFSGVFKDFTVSVSKTYKEDWIVAGTYRAKNIRGVQVNEYYCPISLLRVYGLTHLEEWKW # EIWEAESRAKREGLLEPSAPRQVIADESLSMKLPSSIASEASVKPPVDNGAASVPPSNNSSSTTTDDEGALSFAAQKYSTSHRTLPAFAWEQFATANT # KETEVPQDSHELHTITNDHIAISTSTTLFSPSPLITLPIELSNTTVISSTQMASPVASSSSIVSVMHQVHNPPPAMGGESIYRNIMNRLTALEANHTL # YVRYVEEQTNGVREMIRRLGEDIGRLDGIVSFTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g555 ### # start gene g556 5 AUGUSTUS gene 2812509 2813825 0.95 - . g556 5 AUGUSTUS transcript 2812509 2813825 0.95 - . g556.t1 5 AUGUSTUS stop_codon 2812509 2812511 . - 0 transcript_id "g556.t1"; gene_id "g556"; 5 AUGUSTUS CDS 2812509 2813825 0.95 - 0 transcript_id "g556.t1"; gene_id "g556"; 5 AUGUSTUS start_codon 2813823 2813825 . - 0 transcript_id "g556.t1"; gene_id "g556"; # protein sequence = [MLTGTTTPPRRKSPSLRGSGDEQINARNPGNGKGKEKEVYTSRTSPLRNVTPPGALAEFPIPSLPISRPSTPLRSAMA # STSRFKAPSPSQHIPLANSTSVSSLGKGKRKADEVDGGGEDLTVGGPTLPLEITQQQRRSVHRATFAAEPRSTLRMGLTCFESLTRTLTEYRTSTSSH # TTSHYARRKRARLSSGTSLATNQTVSEHGVRAPSRSESSRRRAPYAASSASRGSHTPTQSLRAGSASSHQQHSVRYVGQPQRARHPSSTRGSSKRGSV # SQVSIPISALISPHAPSISLHPSTTYHMRDPRKPSPVHPTSWSLSFPSAGPHERGWLAGCFNALTWGRFFERAFRRQIKGKEQDIEGQTHQQEEDGGK # FPVVDWTEGGGSPIHAWLFFLGFILFPVWWIAGLFIGIPKTRTLEGRGLEEKSVVLDDPQVEHGTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g556 ### # start gene g557 5 AUGUSTUS gene 2814212 2815618 0.97 - . g557 5 AUGUSTUS transcript 2814212 2815618 0.97 - . g557.t1 5 AUGUSTUS stop_codon 2814212 2814214 . - 0 transcript_id "g557.t1"; gene_id "g557"; 5 AUGUSTUS CDS 2814212 2815618 0.97 - 0 transcript_id "g557.t1"; gene_id "g557"; 5 AUGUSTUS start_codon 2815616 2815618 . - 0 transcript_id "g557.t1"; gene_id "g557"; # protein sequence = [MPSLHLLARIYRKKTTSLDHDGSGPRVTPEPRASQNENTLPRSSLSSPFERRIHPNLNALAAELSSDIQDTRPPNETS # FPPPASPSQIDVNIPFLPLTPWIRTRHSSSSANPTTTQIANTSTRTQEERSEVQEHIPSNRSIDPTTSQSNASPTTSNERPESRTNRIFNRLTGLGAR # ASPTPNPPSAWNTFGRRKSRRHNSIPHASDFGASPDVSLSNSQRSRASSNQTSPWYATETSADTSGSLSVSLQSISQSHSRSQSQSLSFQTPSHTQHP # HSPPSSAFTFGPVGPVYGQTPSPPVLSTYPALRFSLFGGESGVVLDENVDEEHERTGNTSFDNNIEPLFQPRTSVSMPSLSQHRLSELASHHSLSSGA # RPIRPRVQDIFPASSSLEQISQGRQRRRSDRSSRASNSTRRRRNTRKVTRHLEGLPLASAEVPGLSETCASNVSYEEMFLPVLGKFTRVMLSVSSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g557 ### # start gene g558 5 AUGUSTUS gene 2816091 2816894 0.91 + . g558 5 AUGUSTUS transcript 2816091 2816894 0.91 + . g558.t1 5 AUGUSTUS start_codon 2816091 2816093 . + 0 transcript_id "g558.t1"; gene_id "g558"; 5 AUGUSTUS CDS 2816091 2816894 0.91 + 0 transcript_id "g558.t1"; gene_id "g558"; 5 AUGUSTUS stop_codon 2816892 2816894 . + 0 transcript_id "g558.t1"; gene_id "g558"; # protein sequence = [MSTHSAYTIDGQFDVYAQEGAYTKTDLDQSLSFMNSMEDVVAPTTDEFDSDLDALFEGINFDALTVQITNPRAFQFHG # SDSFSLRGPASAFTFSSSESTYVSHSTHSESSYGYSSRDAASDYSLSFDLDSEYQRFSVDTQAQSQGLTLGRLDCIDPTAFNTMPASPYNPSDLALIA # TKSYDSKSSFSDYGPSTANFLNQLASYGTIAGATVSVDQIDSHLSGVYSIALAPSSTDDSRKDNSSKKKYKCTVCTRGKTCYFTSRSKIFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g558 ### # start gene g559 5 AUGUSTUS gene 2823136 2824604 0.4 - . g559 5 AUGUSTUS transcript 2823136 2824604 0.4 - . g559.t1 5 AUGUSTUS stop_codon 2823136 2823138 . - 0 transcript_id "g559.t1"; gene_id "g559"; 5 AUGUSTUS CDS 2823136 2823860 0.49 - 2 transcript_id "g559.t1"; gene_id "g559"; 5 AUGUSTUS CDS 2823932 2824604 0.4 - 0 transcript_id "g559.t1"; gene_id "g559"; 5 AUGUSTUS start_codon 2824602 2824604 . - 0 transcript_id "g559.t1"; gene_id "g559"; # protein sequence = [MQGGFVPGLPTNNHRAATQQTSQGILPPPTFMQQRGQNNFGFGGPLGQHQSVQQSQLNGTSNSLPPHLSQTPSLGNSA # PSVSSTSELGLDPNDFPALGSTSTNNNNGNGNNNGSVASSVTTSYASQAGTGMGGSTPAISGTGGTASNQTRDFTPDDFPALGGQSQSQNNQDSSLPH # PPGLNGFDQQHRQNLLGTLQGTPGMLNLGPQGRNAHTFDADKQQQQRVSHAAWNSPNTPNAQAQPTGGLGAFAATQQQNGTHPSQQNLSSTHLNAPPN # LPPPLLPAGNNPNGPGAATTPYGSNGLGGLDSQQLNATTVNPNPPNPIPNPNATPNPHPNSTQNSLPNSTAHVHQHPQTPAQQILMSAADRWGLLGLL # AMIKNAGSDSDQALSSVGTDLGTMGLDMGYAGSVSPLLRNSIWITEISFVVPGVYTRPSLHHGQISLQHIQLSLIFISQRVTAYNHHHRALEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g559 ### # start gene g560 5 AUGUSTUS gene 2827040 2827543 0.83 + . g560 5 AUGUSTUS transcript 2827040 2827543 0.83 + . g560.t1 5 AUGUSTUS start_codon 2827040 2827042 . + 0 transcript_id "g560.t1"; gene_id "g560"; 5 AUGUSTUS CDS 2827040 2827543 0.83 + 0 transcript_id "g560.t1"; gene_id "g560"; 5 AUGUSTUS stop_codon 2827541 2827543 . + 0 transcript_id "g560.t1"; gene_id "g560"; # protein sequence = [MPESEFQRETDLWQASARGIACTLPTLDFVGWHREHYVVVRNTPVGSSTTACTSLVSVQSTSSCSAPMMNGSFRTPSL # SSAPTSSFTSVPSLASSAKRNFSSINLSCPDVTPAAPSSPSSETTALELKELPPRRRLDCGKGVDLGTEDAAWLERKDVPMDYEEPGLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g560 ### # start gene g561 5 AUGUSTUS gene 2831588 2831884 0.57 + . g561 5 AUGUSTUS transcript 2831588 2831884 0.57 + . g561.t1 5 AUGUSTUS start_codon 2831588 2831590 . + 0 transcript_id "g561.t1"; gene_id "g561"; 5 AUGUSTUS CDS 2831588 2831884 0.57 + 0 transcript_id "g561.t1"; gene_id "g561"; 5 AUGUSTUS stop_codon 2831882 2831884 . + 0 transcript_id "g561.t1"; gene_id "g561"; # protein sequence = [MWFAKTTILTLASTYLLSKSSASPLPDPSETRRQQNNLRARNIVSDSSDIQSSYDFIIVGGGLAGLVLASRLSEDSNH # TVLVLEAGESGDANITQISA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g561 ### # start gene g562 5 AUGUSTUS gene 2832142 2833232 0.7 + . g562 5 AUGUSTUS transcript 2832142 2833232 0.7 + . g562.t1 5 AUGUSTUS start_codon 2832142 2832144 . + 0 transcript_id "g562.t1"; gene_id "g562"; 5 AUGUSTUS CDS 2832142 2832795 0.71 + 0 transcript_id "g562.t1"; gene_id "g562"; 5 AUGUSTUS CDS 2832873 2833232 0.98 + 0 transcript_id "g562.t1"; gene_id "g562"; 5 AUGUSTUS stop_codon 2833230 2833232 . + 0 transcript_id "g562.t1"; gene_id "g562"; # protein sequence = [MYLVRPNEPEINALHSINPNDTDEFWTWDSYYAAMKKSETFGAPSADVAAEAGIQYSASSYGSNGPIHWSYPGETFNL # VGNWTPSLLTLGIPTNPDAASGDNSGAYITTSSINPSNWTRSYSRSGYIDPLPPRSNLDILTSATVTNIVWQSGTSGNLTATGVQWASSSTAAKQTVN # ANKEVILAAGSIGSTQLLQLSGVGPSKYLQAAGVDVQLDLPGSGSLIYSTDAETAGDMHNAGVATAEFLSYINSATAYVNLTTLLGSDNASALISSAQ # AEVDSSVSSFLPLGDSTVAAGYKAIYDTITNQFYSSNSGQIELLLSITSTNVLLQAAIQHPLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g562 ### # start gene g563 5 AUGUSTUS gene 2839208 2839822 1 - . g563 5 AUGUSTUS transcript 2839208 2839822 1 - . g563.t1 5 AUGUSTUS stop_codon 2839208 2839210 . - 0 transcript_id "g563.t1"; gene_id "g563"; 5 AUGUSTUS CDS 2839208 2839822 1 - 0 transcript_id "g563.t1"; gene_id "g563"; 5 AUGUSTUS start_codon 2839820 2839822 . - 0 transcript_id "g563.t1"; gene_id "g563"; # protein sequence = [MTRIFLVVATVISAAYALWPLPTDFSTGTAALTLASDFHIDISAIPNPPQDLLDAISRTKGYLQTDQLEALVVDRGAS # YNQSLQNASSLVSLVLSYDSGVAGEPTSISEEAIDDIDSRVEGYTLTVPEDGSAATIKANSTLGLFRGLTTFGQLWYDLNNTTYTIEAPIAITDSPVF # VSSTPYVWSKIDISIQPYRGFMLDTSRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g563 ### # start gene g564 5 AUGUSTUS gene 2840176 2841697 0.26 - . g564 5 AUGUSTUS transcript 2840176 2841697 0.26 - . g564.t1 5 AUGUSTUS stop_codon 2840176 2840178 . - 0 transcript_id "g564.t1"; gene_id "g564"; 5 AUGUSTUS CDS 2840176 2840819 0.64 - 2 transcript_id "g564.t1"; gene_id "g564"; 5 AUGUSTUS CDS 2840870 2841201 0.9 - 1 transcript_id "g564.t1"; gene_id "g564"; 5 AUGUSTUS CDS 2841354 2841697 0.42 - 0 transcript_id "g564.t1"; gene_id "g564"; 5 AUGUSTUS start_codon 2841695 2841697 . - 0 transcript_id "g564.t1"; gene_id "g564"; # protein sequence = [MPSIYSRFMEKEAKQWRQIYKSLQLLEYLIKNGSERVVDDARAHISTIKMLRNFHYIDDKGKDQGINVRNRSKEIVEL # LSDVENIRTERRKAKANRSKYIGTGSDGLSSSSGGSRSGSYGGGSSSFRDSGSRGFEEYNAGDDEVVATSPTRNNSLTVSSPSSARFAPARKSAAPEP # APAPEVDLLGGLDDDTFSSGTTSNPPFGITEKALPAVGAVPAQTSIGIDDDDFADFQAAPVTPHTTVAPFQAAPAAAHKMNLMEMLNSTSATPARPQS # MSYAQPQAPPMQTQGLVYGSGMGMGSSGMGMAGMATGGMHRPSPSLSNQSSFGGVPTMRPMSTTSVSSSGSTMNRAASVASSKPASSANFDDLWSMSL # GSKPSTPAAGAAVVSKSIKDIQNEKASAGLWGSGPAKPQQPTMGNAFGSFGSSGGATSSSGGDDLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g564 ### # start gene g565 5 AUGUSTUS gene 2854872 2855612 0.17 - . g565 5 AUGUSTUS transcript 2854872 2855612 0.17 - . g565.t1 5 AUGUSTUS stop_codon 2854872 2854874 . - 0 transcript_id "g565.t1"; gene_id "g565"; 5 AUGUSTUS CDS 2854872 2855612 0.17 - 0 transcript_id "g565.t1"; gene_id "g565"; 5 AUGUSTUS start_codon 2855610 2855612 . - 0 transcript_id "g565.t1"; gene_id "g565"; # protein sequence = [MPYLTTPWSTYTVLFFMVFFHLLINYIAVRGVIFRSLNRQRACLAWMAFKSKCDSINTPTYLASLERILISSDTILSL # PSGTAIGRCNMGSSFRACNPDPDVMEIFQQKHYVICLDKKSSLCFGTKPHFHILLKDSYNSADQLHAWILACEVTRLFASMKTRKIGLKTLMQEVLTT # FNEDYLSFLEDLHKNGWITVTVTADESTTKENSEYQPPPLLPGSKIISFTSGAPRNVMISFSSTQYNKKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g565 ### # start gene g566 5 AUGUSTUS gene 2858157 2858549 0.9 + . g566 5 AUGUSTUS transcript 2858157 2858549 0.9 + . g566.t1 5 AUGUSTUS start_codon 2858157 2858159 . + 0 transcript_id "g566.t1"; gene_id "g566"; 5 AUGUSTUS CDS 2858157 2858549 0.9 + 0 transcript_id "g566.t1"; gene_id "g566"; 5 AUGUSTUS stop_codon 2858547 2858549 . + 0 transcript_id "g566.t1"; gene_id "g566"; # protein sequence = [MDSDRKSTVSSFYGGRRGSQDALNNDFPSSSGPSYPNYAQGRGRDDASSFFDPDRTSRNLDGAGRASTAGYNRGSFFL # AGREEPVKGGRDEEGGAGGNGGAWDIYADFNNEGPRYSSAFGSSSTAADAYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g566 ### # start gene g567 5 AUGUSTUS gene 2860163 2862076 0.99 - . g567 5 AUGUSTUS transcript 2860163 2862076 0.99 - . g567.t1 5 AUGUSTUS stop_codon 2860163 2860165 . - 0 transcript_id "g567.t1"; gene_id "g567"; 5 AUGUSTUS CDS 2860163 2862076 0.99 - 0 transcript_id "g567.t1"; gene_id "g567"; 5 AUGUSTUS start_codon 2862074 2862076 . - 0 transcript_id "g567.t1"; gene_id "g567"; # protein sequence = [MSSPPVSVCPSTATLGLYNVPSPVQVVQNYGSPRSPEVVRSYVNSDSDSDESLEVIDVRRDFTQGGGTYHDDEDVVRD # RGRHSLDDHDPPTPITSTQSKRRHMSLSPLRLFAHKPIALQERALSAQPASPYSFHRNVALFRSTTSLKTVSNGSFFRLPLSSSSSTSLVKADRRVIS # KGKERSAEPLETWEVLDPPASLMSAVESLTNPPSPDSGTPSPVQTRIFTFDCHASSSNVACAESNGQGVYCKGPNLDSADRLPSIPTNFRDDSASIPR # RPCSQNVLSHQYISSYIPSNLHDRSNTLASPLPGPGILQNPGTSPPSPSSASKNMTSSLPLSLQSRGAKRLDLNSDTANPLQLALETPLPPTPIDNIM # GEESTNTRLQTVGHHIHAHFQFAPNPNEVLSSYNDTIAGDTTKVLPRSRVHVAPNDRTSGSLKVMYGMPQAAGYNNSVSKTQRPIPSPLQVPFPSVIS # PDPTSTSHIYTQTPTRRHYPGRPLPKTPQPVVSEIARNMVDSLYAPNPENTSNTDTCLGPTFPHGLLIDFDESTPVHSTLSSEMNSPTSTVRLSTYDR # STDGESHRLADKLARTNNKSSETLRALNPKNTGAYSALDISPLGQGEQKNLGESSYDASQFFFFHSPLY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g567 ### # start gene g568 5 AUGUSTUS gene 2865572 2866398 0.8 - . g568 5 AUGUSTUS transcript 2865572 2866398 0.8 - . g568.t1 5 AUGUSTUS stop_codon 2865572 2865574 . - 0 transcript_id "g568.t1"; gene_id "g568"; 5 AUGUSTUS CDS 2865572 2866086 0.95 - 2 transcript_id "g568.t1"; gene_id "g568"; 5 AUGUSTUS CDS 2866158 2866398 0.8 - 0 transcript_id "g568.t1"; gene_id "g568"; 5 AUGUSTUS start_codon 2866396 2866398 . - 0 transcript_id "g568.t1"; gene_id "g568"; # protein sequence = [MPGVNIWHPLWLPKLVVDDFEHRERQRLRESWVSDNGEYSEADSQYKPLWARDEEWGNDCLVTVQSSKWGEFLGVMDG # CDHWEIRGARGLELGVDLPAIPAISLGSSMGGGDSAKDGEQDGWSLKDIGWFLKAWRKDEKVQQEAIARLPQSSGTRQKEREREREKEREKDDAVVKA # STDKLSAVFDWVTERVPSPPLLGTKNISAISESEPKSIYNTISTRDNRKKNELESKEDLERFYVALSRKLYDEGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g568 ### # start gene g569 5 AUGUSTUS gene 2868123 2868992 0.99 + . g569 5 AUGUSTUS transcript 2868123 2868992 0.99 + . g569.t1 5 AUGUSTUS start_codon 2868123 2868125 . + 0 transcript_id "g569.t1"; gene_id "g569"; 5 AUGUSTUS CDS 2868123 2868992 0.99 + 0 transcript_id "g569.t1"; gene_id "g569"; 5 AUGUSTUS stop_codon 2868990 2868992 . + 0 transcript_id "g569.t1"; gene_id "g569"; # protein sequence = [MPTTPITPLLRGSSPSYHDLYSKPLIDCNNQSYFPNTSDECELKEFFFGLYSFKPSPDEPLSPLSSEDSESLSSGSTI # GSDEQDIENVFALDKDSYDFKSQLPPCAVISIQEMLDTPDIYDSQFRDNYKHLNPQAAPFVPSVQSAGPRTRLPSIIRARVLAASASDSIPLLPPPPP # NPLKAIPAWMIILHLASTTTPADSFILAARAKELAHSHFWHPEALAELAQHFCWNASDVNADIDRETMAAFAREVSQALRDAFDEDTADSFVWHLRES # LIGTFKGCWCATVSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g569 ### # start gene g570 5 AUGUSTUS gene 2870978 2872033 0.73 + . g570 5 AUGUSTUS transcript 2870978 2872033 0.73 + . g570.t1 5 AUGUSTUS start_codon 2870978 2870980 . + 0 transcript_id "g570.t1"; gene_id "g570"; 5 AUGUSTUS CDS 2870978 2872033 0.73 + 0 transcript_id "g570.t1"; gene_id "g570"; 5 AUGUSTUS stop_codon 2872031 2872033 . + 0 transcript_id "g570.t1"; gene_id "g570"; # protein sequence = [MNSFLAYKSKRAYVFQDYVWKPEYYSWPQSESFEWPPHTPLNAIIAGPTAGGLWDPGDDAPRSVSEKWFDVVCPREER # RILNTREVKPDIAWLMGDEIFEAWRKVLTEAPERCIEIVPADDDNFPQTFDLWLWGSFRVLPLWKPFSESPISRLLATSPIVNSAVDRNEYLFLPHGP # RPAHPVSHNPYDRMLAMHVRRGDFKDACIGLATWNSTYYSWNLLDFLPDHFEPPAGGSWGWNTPENTEKYMEHCLPTFDGIVKKVKDSKEDYIRAGGS # KGDQRTLDVLYLLTNEESEWLDQLKDTLRKDGWHTIKTSRDLTLDQEQTDVNMAVDMDIARRAAVFIGNGVSGLVIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g570 ### # start gene g571 5 AUGUSTUS gene 2872337 2873262 0.79 + . g571 5 AUGUSTUS transcript 2872337 2873262 0.79 + . g571.t1 5 AUGUSTUS start_codon 2872337 2872339 . + 0 transcript_id "g571.t1"; gene_id "g571"; 5 AUGUSTUS CDS 2872337 2872356 0.79 + 0 transcript_id "g571.t1"; gene_id "g571"; 5 AUGUSTUS CDS 2872530 2873262 0.79 + 1 transcript_id "g571.t1"; gene_id "g571"; 5 AUGUSTUS stop_codon 2873260 2873262 . + 0 transcript_id "g571.t1"; gene_id "g571"; # protein sequence = [MGINLHCLHHHQHDTIKPTTLAPEQENIFTADKGTYDFEQNLSSSVLNNIRAMLDEEDSSSLKFPVEDKTLNPRAHPF # VPGSKNGAGSCASARLVAIDAINRFHQRYDRPLPPLLRPSSGLESSPWLASTRHPPNWRHSLDLAAHTTPMSASSIDEYGRDLVHGQIWSRCGLVDLI # QHVCWKGSEPSFDTHPLSVALLAFSVYNHFKAIGDQKNASTFTDILQRCVKGYFEALWDVEVGAHFARFKVLVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g571 ### # start gene g572 5 AUGUSTUS gene 2878149 2878646 0.38 - . g572 5 AUGUSTUS transcript 2878149 2878646 0.38 - . g572.t1 5 AUGUSTUS stop_codon 2878149 2878151 . - 0 transcript_id "g572.t1"; gene_id "g572"; 5 AUGUSTUS CDS 2878149 2878646 0.38 - 0 transcript_id "g572.t1"; gene_id "g572"; 5 AUGUSTUS start_codon 2878644 2878646 . - 0 transcript_id "g572.t1"; gene_id "g572"; # protein sequence = [MMDWAALHARDRGAETWWKSFTTGKSAETLGGVPHDTYGMTSLSIRQYVLGIYKQLGLKEKDITKVQTGGPDGDLGSS # MSFLRPRFINQLFILLVPDEILLSSDKTIAIIDGSGVLADPAGLDRDELVRLAKLRVPVGHFDKSKLSKDGYLVKVEEQDVKLPCVF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g572 ### # start gene g573 5 AUGUSTUS gene 2880858 2881395 0.24 - . g573 5 AUGUSTUS transcript 2880858 2881395 0.24 - . g573.t1 5 AUGUSTUS stop_codon 2880858 2880860 . - 0 transcript_id "g573.t1"; gene_id "g573"; 5 AUGUSTUS CDS 2880858 2881142 0.63 - 0 transcript_id "g573.t1"; gene_id "g573"; 5 AUGUSTUS CDS 2881225 2881395 0.33 - 0 transcript_id "g573.t1"; gene_id "g573"; 5 AUGUSTUS start_codon 2881393 2881395 . - 0 transcript_id "g573.t1"; gene_id "g573"; # protein sequence = [MPSHLTDASTRSGSSPDSQLSVPGTPRNGSDGLLHRIKNVPGYTTPVFKGKEEQRALGFIPQELVANEVNWFYTNLGI # DDTYFRNESREVICDHIIALFGAKVLAYTKHDPSKLVIDLEKIDENGNGATFIYTSPPGITATEGPGASCEAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g573 ### # start gene g574 5 AUGUSTUS gene 2885580 2887106 0.32 + . g574 5 AUGUSTUS transcript 2885580 2887106 0.32 + . g574.t1 5 AUGUSTUS start_codon 2885580 2885582 . + 0 transcript_id "g574.t1"; gene_id "g574"; 5 AUGUSTUS CDS 2885580 2887106 0.32 + 0 transcript_id "g574.t1"; gene_id "g574"; 5 AUGUSTUS stop_codon 2887104 2887106 . + 0 transcript_id "g574.t1"; gene_id "g574"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRTVKSVQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNG # TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g574 ### # start gene g575 5 AUGUSTUS gene 2887136 2888572 0.98 + . g575 5 AUGUSTUS transcript 2887136 2888572 0.98 + . g575.t1 5 AUGUSTUS start_codon 2887136 2887138 . + 0 transcript_id "g575.t1"; gene_id "g575"; 5 AUGUSTUS CDS 2887136 2888572 0.98 + 0 transcript_id "g575.t1"; gene_id "g575"; 5 AUGUSTUS stop_codon 2888570 2888572 . + 0 transcript_id "g575.t1"; gene_id "g575"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVYIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINNEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSK # GNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g575 ### # start gene g576 5 AUGUSTUS gene 2888851 2889258 0.51 + . g576 5 AUGUSTUS transcript 2888851 2889258 0.51 + . g576.t1 5 AUGUSTUS start_codon 2888851 2888853 . + 0 transcript_id "g576.t1"; gene_id "g576"; 5 AUGUSTUS CDS 2888851 2889258 0.51 + 0 transcript_id "g576.t1"; gene_id "g576"; 5 AUGUSTUS stop_codon 2889256 2889258 . + 0 transcript_id "g576.t1"; gene_id "g576"; # protein sequence = [MTIQFKSYKVVLPSKWRIKPKPVRKKVQKRRFVEPILQKFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKN # SQRTRKRMVRYEVLKRGTESFQRSQPSFEKVRYESGNERKERPRTRRTRRRMFRQMY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g576 ### # start gene g577 5 AUGUSTUS gene 2890070 2890585 0.37 + . g577 5 AUGUSTUS transcript 2890070 2890585 0.37 + . g577.t1 5 AUGUSTUS start_codon 2890070 2890072 . + 0 transcript_id "g577.t1"; gene_id "g577"; 5 AUGUSTUS CDS 2890070 2890585 0.37 + 0 transcript_id "g577.t1"; gene_id "g577"; 5 AUGUSTUS stop_codon 2890583 2890585 . + 0 transcript_id "g577.t1"; gene_id "g577"; # protein sequence = [MTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRF # VWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g577 ### # start gene g578 5 AUGUSTUS gene 2890630 2892906 0.83 + . g578 5 AUGUSTUS transcript 2890630 2892906 0.83 + . g578.t1 5 AUGUSTUS start_codon 2890630 2890632 . + 0 transcript_id "g578.t1"; gene_id "g578"; 5 AUGUSTUS CDS 2890630 2892906 0.83 + 0 transcript_id "g578.t1"; gene_id "g578"; 5 AUGUSTUS stop_codon 2892904 2892906 . + 0 transcript_id "g578.t1"; gene_id "g578"; # protein sequence = [MDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLA # LEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPELNPEDYVDEDGGEPINFIM # GDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFVRNLFPTFDEEFVQNNPYPEAHRSSEGNRLD # ELIPLIGKYLSNPSDESLGEMSKYERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYK # DVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTD # NAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVEST # WLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKG # GSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEDWMSPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g578 ### # start gene g579 5 AUGUSTUS gene 2893174 2894627 0.13 - . g579 5 AUGUSTUS transcript 2893174 2894627 0.13 - . g579.t1 5 AUGUSTUS stop_codon 2893174 2893176 . - 0 transcript_id "g579.t1"; gene_id "g579"; 5 AUGUSTUS CDS 2893174 2893601 1 - 2 transcript_id "g579.t1"; gene_id "g579"; 5 AUGUSTUS CDS 2893683 2893818 0.69 - 0 transcript_id "g579.t1"; gene_id "g579"; 5 AUGUSTUS CDS 2894460 2894627 0.41 - 0 transcript_id "g579.t1"; gene_id "g579"; 5 AUGUSTUS start_codon 2894625 2894627 . - 0 transcript_id "g579.t1"; gene_id "g579"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKEEKS # AVNDVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKS # RQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g579 ### # start gene g580 5 AUGUSTUS gene 2896943 2897633 0.8 - . g580 5 AUGUSTUS transcript 2896943 2897633 0.8 - . g580.t1 5 AUGUSTUS stop_codon 2896943 2896945 . - 0 transcript_id "g580.t1"; gene_id "g580"; 5 AUGUSTUS CDS 2896943 2897373 0.96 - 2 transcript_id "g580.t1"; gene_id "g580"; 5 AUGUSTUS CDS 2897432 2897633 0.83 - 0 transcript_id "g580.t1"; gene_id "g580"; 5 AUGUSTUS start_codon 2897631 2897633 . - 0 transcript_id "g580.t1"; gene_id "g580"; # protein sequence = [MVSSTDLDPFVSLRGRNALSGVPKTVSSPKVPDLISPSPANKAQAVPPRALRRNREIESLKADASSFLASPQSIHSKD # SDNELLRGSPSVDPAPRTSTSTKVPVDSKKPKSKTTIKVVEDSKASISSPAGMAYKRVRLPPRSRKIAPATAKGKSRQVVVSEDDSASNEVESEDEEE # DEDEEEDSAPPPKRLKTTSSISGKISFFISLLMF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g580 ### # start gene g581 5 AUGUSTUS gene 2913741 2914685 0.85 + . g581 5 AUGUSTUS transcript 2913741 2914685 0.85 + . g581.t1 5 AUGUSTUS start_codon 2913741 2913743 . + 0 transcript_id "g581.t1"; gene_id "g581"; 5 AUGUSTUS CDS 2913741 2914685 0.85 + 0 transcript_id "g581.t1"; gene_id "g581"; 5 AUGUSTUS stop_codon 2914683 2914685 . + 0 transcript_id "g581.t1"; gene_id "g581"; # protein sequence = [MLELLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGD # VSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKY # RHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLM # VEDEDEDWMSPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g581 ### # start gene g582 5 AUGUSTUS gene 2914954 2916407 0.32 - . g582 5 AUGUSTUS transcript 2914954 2916407 0.32 - . g582.t1 5 AUGUSTUS stop_codon 2914954 2914956 . - 0 transcript_id "g582.t1"; gene_id "g582"; 5 AUGUSTUS CDS 2914954 2915381 1 - 2 transcript_id "g582.t1"; gene_id "g582"; 5 AUGUSTUS CDS 2915463 2915598 0.86 - 0 transcript_id "g582.t1"; gene_id "g582"; 5 AUGUSTUS CDS 2916240 2916407 0.5 - 0 transcript_id "g582.t1"; gene_id "g582"; 5 AUGUSTUS start_codon 2916405 2916407 . - 0 transcript_id "g582.t1"; gene_id "g582"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKEEKS # AVNDVPPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKS # RQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERATTPFTHGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g582 ### # start gene g583 5 AUGUSTUS gene 2917444 2918101 0.31 - . g583 5 AUGUSTUS transcript 2917444 2918101 0.31 - . g583.t1 5 AUGUSTUS stop_codon 2917444 2917446 . - 0 transcript_id "g583.t1"; gene_id "g583"; 5 AUGUSTUS CDS 2917444 2917991 0.69 - 2 transcript_id "g583.t1"; gene_id "g583"; 5 AUGUSTUS CDS 2918053 2918101 0.31 - 0 transcript_id "g583.t1"; gene_id "g583"; 5 AUGUSTUS start_codon 2918099 2918101 . - 0 transcript_id "g583.t1"; gene_id "g583"; # protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTTRELFLRSILDLQNAGEDPVVVLEALKAAEPNRRAIN # LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLCSIHSGESTAHIDKHGHLVEASPPPDSATEALEGLKEVERGSADEGASSPVGGSVPMELDLP # TIESLAERTLSPEKGAESAQIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g583 ### # start gene g584 5 AUGUSTUS gene 2918719 2919409 0.69 - . g584 5 AUGUSTUS transcript 2918719 2919409 0.69 - . g584.t1 5 AUGUSTUS stop_codon 2918719 2918721 . - 0 transcript_id "g584.t1"; gene_id "g584"; 5 AUGUSTUS CDS 2918719 2919149 0.94 - 2 transcript_id "g584.t1"; gene_id "g584"; 5 AUGUSTUS CDS 2919208 2919409 0.72 - 0 transcript_id "g584.t1"; gene_id "g584"; 5 AUGUSTUS start_codon 2919407 2919409 . - 0 transcript_id "g584.t1"; gene_id "g584"; # protein sequence = [MVSSTDLDPFVSLRGRNALSGVPKTVSSPKVPDLISPSPANKAQAVPPRALRRNREIESLKADASSFLASPQSIHSKD # SDNELLRGSPSVDPAPRTSTSTKVPVDSKKPKSKTTIKVVEDSKASISSPAGMAYKRVRLPPRSRKIAPATAKGKSRQVVVSEDDSASNEVESEDEEE # DEDEEEDSAPPPKRLKTTSSISGKISFFISLLMF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g584 ### # start gene g585 5 AUGUSTUS gene 2921739 2924993 0.97 - . g585 5 AUGUSTUS transcript 2921739 2924993 0.97 - . g585.t1 5 AUGUSTUS stop_codon 2921739 2921741 . - 0 transcript_id "g585.t1"; gene_id "g585"; 5 AUGUSTUS CDS 2921739 2924993 0.97 - 0 transcript_id "g585.t1"; gene_id "g585"; 5 AUGUSTUS start_codon 2924991 2924993 . - 0 transcript_id "g585.t1"; gene_id "g585"; # protein sequence = [MKTPPGYLSFVRNRRRLDNDIENPWGGVATLVRENLDCLLRQDLSSPDLLVVEVNGTLIRNVYIPPESSRTNWQDWSD # INPWDAFVENTHLIMQLDMPSVTGGDINSRIGNLSPHAGHPDRVSSDLTVSTRGRLLLDLCNTHQLTILNGSSSLPGSHSSPTSFQRRCDALGHSITL # KTVIDYFIITPFLFPFVTELNVRPETDWSDHSPIIVNMMAPVTPACTTPLTPAFRRRIVPTPLLTDTDLFQHRILHSEPPSHASQLLTLYGHASPTPL # PLPPLKIYTDGSCSNVGQPNASSGSGIFFGNPSHPLNTAARVTGTQTNNRGELLAVLIAIQKSHSKRRLAIHSDSEYTIRSIVYRAPKEAQSNWTCAN # GDIMCAIARWVASRESPIVFHHVRAHSNNAHNDAADTLAKLGSTLPLPPLASPLDFLSARAPPIFTPATPSNIPKVSTSLPELPPQPAPHIPPNPSPQ # LPSSHRGRNHKRTRQDLIRTKLSAAALAGSATFWRYYKEIRRTLPTTSRVSLQQLTDTFIPRMNPPDPVLSSFDPARIIAEDARANAIPSPSPPASHP # AFNEPLSLDDIASVKSYLKRTNHSNSTGVDLATYDLLIDIDNNLLLPLFQRAIEHQDIPSSWLTSTIIALAKPGKDSTKTSNYRAIALESCVLKFASL # LVHHKLCLALQQSDTVPPSQNGFREGFRTNNNAFILRTIIDKARSRNETIYAAFVDISNAFPSTNQSSLWNKLSDAGLTGKYFDWLRSLYSQMSYTIT # HNGQLSEKFHAFSGVLMGDPSSPTLWNIFLSTFRLALDPEDMELLTIAISHLEHADDIVLISRGPLGLQQHLNTFNSWCRDNALQISADKSWVMLFGP # LPQTLPHFTLSGETLKFRDVVRYVGVFFQSTHRNIFASHYTEKRDCAVGSARAITGCDLLVGNRRMPPSITKQLYTALVDCHLTHGCEIMPDTDPGLL # RILEDIQLRFLRRMLGLSTNSVITPLYTETGIMPIRTRRVSLTLRYLKYLIELPDTHYASLALAENVNLRNSLCPCWLTDLDYAINQLPGNHRLPDLR # ALDNELASFLCERERKESNGHSNQPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g585 ### # start gene g586 5 AUGUSTUS gene 2927727 2929139 0.92 - . g586 5 AUGUSTUS transcript 2927727 2929139 0.92 - . g586.t1 5 AUGUSTUS stop_codon 2927727 2927729 . - 0 transcript_id "g586.t1"; gene_id "g586"; 5 AUGUSTUS CDS 2927727 2929139 0.92 - 0 transcript_id "g586.t1"; gene_id "g586"; 5 AUGUSTUS start_codon 2929137 2929139 . - 0 transcript_id "g586.t1"; gene_id "g586"; # protein sequence = [MEAKLATLKSPGLKSGLPASPTARNFSGSAGPGNRQSLALDNSSNFLSPDSAALPSDPAATLAQQRAKFKASNAAHRI # SAPVLASVGTENRVTWGNTGGSSQLGQVAEQNGGSQDLVINSSRPKSTEFSGTIGSPRVPVSASNNEVTVSNETGSWASMVNTPLIPMFQKDSRMNPS # LDAAATKLNEWSANKNATPGVPRMGDPTIHRRNKNNNDDDNGQYNHGNNRMRNANFGAGAPGAGWSGVGVRSPALPNSASNRLDENGLANAMAGLNGL # GMQMGGGGFGMGMGSPGLGMGMPNLAGMSGMSPIAPFNMQMLAAMGISPEAQLLAAQMAANGFGQQGWMGMHNGPASAGASSRRGPHSARSVKSPSST # AGGATPKGEEDVDPHVLNDVPAWLRSLRLHKYTPNFEGMKWQDMVVLDEAQLEGKGVAALGARRKMLKTFELVRKKMGIEGGPPSSQPPSAVLSLQSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g586 ### # start gene g587 5 AUGUSTUS gene 2930475 2930831 0.98 + . g587 5 AUGUSTUS transcript 2930475 2930831 0.98 + . g587.t1 5 AUGUSTUS start_codon 2930475 2930477 . + 0 transcript_id "g587.t1"; gene_id "g587"; 5 AUGUSTUS CDS 2930475 2930831 0.98 + 0 transcript_id "g587.t1"; gene_id "g587"; 5 AUGUSTUS stop_codon 2930829 2930831 . + 0 transcript_id "g587.t1"; gene_id "g587"; # protein sequence = [MSVELPFQISIPDSKLDLLRQKLALTEFPDELENTGWNYGAPLSDIKRLVARWKDGYDWKLEEAKLNQDLPQFTKDID # VNGFETLNIHYVHQKSSLANAIPLLFVHGCESSLKSKSCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g587 ### # start gene g588 5 AUGUSTUS gene 2932354 2933640 0.9 + . g588 5 AUGUSTUS transcript 2932354 2933640 0.9 + . g588.t1 5 AUGUSTUS start_codon 2932354 2932356 . + 0 transcript_id "g588.t1"; gene_id "g588"; 5 AUGUSTUS CDS 2932354 2933640 0.9 + 0 transcript_id "g588.t1"; gene_id "g588"; 5 AUGUSTUS stop_codon 2933638 2933640 . + 0 transcript_id "g588.t1"; gene_id "g588"; # protein sequence = [MTSTSDVCSHSSLTLIPSQSAFDTGFSWPTAQKRAAAVTLQGRAPLNPSNPAQTLFPAPLVLPEDELSLDPKYPAQSL # RSWTRSKERNRVTKEKRTIYVAELPSVDPNLDAIQQWSQPKVPRVTVMSEPRIQEVLDYLTAFYHGVNVKRLPTKLVYTSWNTGKLPSNIGKKHGHIG # LNIGNECVRIRTRVSKDFFIQQLNLDDLLDAATSLLPNDAYALLLLVSHDIYENEEDDFACGRAYGGSRIAVVSTARYNPVLDVVQNIDREHSWPASH # CSTYIQSCCTQSAKSLRKKRHKKTGTKKELGQSSNDGSGPIHAALAAHRALPSSQSPSACSGLWLARVCRTASHELGHCFGMDHCIYYACAMQGTASL # AEDARQPPYVCPVDLAKILQACSTTRELRYEALLSFCDRYKDVRHFSAFAAWIRSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g588 ### # start gene g589 5 AUGUSTUS gene 2936252 2938847 0.29 - . g589 5 AUGUSTUS transcript 2936252 2938847 0.29 - . g589.t1 5 AUGUSTUS stop_codon 2936252 2936254 . - 0 transcript_id "g589.t1"; gene_id "g589"; 5 AUGUSTUS CDS 2936252 2938667 0.71 - 1 transcript_id "g589.t1"; gene_id "g589"; 5 AUGUSTUS CDS 2938717 2938847 0.29 - 0 transcript_id "g589.t1"; gene_id "g589"; 5 AUGUSTUS start_codon 2938845 2938847 . - 0 transcript_id "g589.t1"; gene_id "g589"; # protein sequence = [MAQTYFPSRVTSPTKELANFSVLSGDRQLRVEDVQEAYIEQKDRLVNAIDATKSILRDVRAFNKDEWIIRYPQYKEAI # ETVSPPPTASRRKSLRRSLTFADDPATETEVVVRKKLQRSVTVSPISENTEEEETDEDATSDFNVLRLDLQLGPNSTVTSLVSQLEKSSIANLLDERI # AASLSHVDKLRLRVEDTSSKVLVTGDLNAGKSTFVNALLRREVMPVDQQPCTTAFCEVHDAAENQGVEEVHIISPGVTYDVNNESTFTRASLSELEDI # VGENEDHERILKLYLADTRTPSESLLNNGVVDISLIDAPGLNRDSLKTTALFARQEEIDVVVFVVSAENHFTLSAREFLTNASKEKAYLFIVVNKFEQ # IKNKEKCRRLVLEQIRQLSPRTHENADDLVHFVDSAAALQPYTANPTFDDLESSLRSFVLVKRSKSKLHPVSTYLNNLLGDIELLAGANSIVANAELD # QARESLAQVKPVLERMKNGRELLEEGLETLEEEGASSASSSSKATLTQALERVGQGKLGVDKPLIPLPSYPGILGVWDYARDVRKALLASLDAAVALA # EDEVRNITSAGVDRIKELGEEHLPVGVERNRRVFMPEAMFSTIRKASKGPTKSRKSLTVVAGGVHGLGIGLAQRSEMLETTFFDLFDVQHQFWLHFSD # GESDNASKEDETTAPTVLGLASVGVGALTMVGGQAVGAKGLIEGIIRVTDLFGNETVRKWAAPVLGAVTIGMTAYLILELPTSIPKTVGRRIRASVVH # LHAEDQISFVDAHASRISRETRKVLRLASWDLRSRFNSAMEERGKEVKVKEEIAKKAIRAMEWFGELGRKSEEIRVNAHLGIDM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g589 ### # start gene g590 5 AUGUSTUS gene 2944660 2945067 1 + . g590 5 AUGUSTUS transcript 2944660 2945067 1 + . g590.t1 5 AUGUSTUS start_codon 2944660 2944662 . + 0 transcript_id "g590.t1"; gene_id "g590"; 5 AUGUSTUS CDS 2944660 2945067 1 + 0 transcript_id "g590.t1"; gene_id "g590"; 5 AUGUSTUS stop_codon 2945065 2945067 . + 0 transcript_id "g590.t1"; gene_id "g590"; # protein sequence = [MATIGSVTRQIAALELSNNKPGKTTTNARPPLHSKQSSQINVAKLLTKYAAPNPAHAPEPSTKLTKATTGTAMPPPAT # KTKTTGTLTHTGNTPAPTISFDIGNYDGGLELENEKRGEKIFGEAAQELALDSSSAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g590 ### # start gene g591 5 AUGUSTUS gene 2947815 2948238 0.61 + . g591 5 AUGUSTUS transcript 2947815 2948238 0.61 + . g591.t1 5 AUGUSTUS start_codon 2947815 2947817 . + 0 transcript_id "g591.t1"; gene_id "g591"; 5 AUGUSTUS CDS 2947815 2947955 0.61 + 0 transcript_id "g591.t1"; gene_id "g591"; 5 AUGUSTUS CDS 2948047 2948238 0.96 + 0 transcript_id "g591.t1"; gene_id "g591"; 5 AUGUSTUS stop_codon 2948236 2948238 . + 0 transcript_id "g591.t1"; gene_id "g591"; # protein sequence = [MLWNTVATECQGDGDLLKNLRIKNVETGEEKDLAVNGLFYAIGKSSATDPDGYIVTVPGTTQTSVKGVFAAGDVQDKR # YRQAITSAGSGCMAALEAEKLIAEEEEELNGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g591 ### # start gene g592 5 AUGUSTUS gene 2949302 2950298 0.39 + . g592 5 AUGUSTUS transcript 2949302 2950298 0.39 + . g592.t1 5 AUGUSTUS start_codon 2949302 2949304 . + 0 transcript_id "g592.t1"; gene_id "g592"; 5 AUGUSTUS CDS 2949302 2949628 0.46 + 0 transcript_id "g592.t1"; gene_id "g592"; 5 AUGUSTUS CDS 2949708 2950298 0.42 + 0 transcript_id "g592.t1"; gene_id "g592"; 5 AUGUSTUS stop_codon 2950296 2950298 . + 0 transcript_id "g592.t1"; gene_id "g592"; # protein sequence = [MEQRLTELPSSHTPIQRYNRAREDFINQCLHSKPEYPVRGISPSIHRYALEPGFECSSIDDIVADEETSADSMSMTTF # NKNLVPRSQLGLLGTANDWGRSWARLTENTQYHLFLRCSILSDNRWAGWESAVADFAGACTKFANYLGKYQGDTLYVLERNMAGPVLASIAGALRLYY # HDVAEKAWLYAQLAPTDASFRDTLTKHLERRPKRKRCVKLEMVLEPLAEVQEDVATDSDTKGGEWGSEPSLQFSVTTTVLCPCASVEIESPRGKKGSG # IGSLRRTAKFLSHRMPARFCERLIALVARSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g592 ### # start gene g593 5 AUGUSTUS gene 2951632 2952660 0.93 - . g593 5 AUGUSTUS transcript 2951632 2952660 0.93 - . g593.t1 5 AUGUSTUS stop_codon 2951632 2951634 . - 0 transcript_id "g593.t1"; gene_id "g593"; 5 AUGUSTUS CDS 2951632 2952660 0.93 - 0 transcript_id "g593.t1"; gene_id "g593"; 5 AUGUSTUS start_codon 2952658 2952660 . - 0 transcript_id "g593.t1"; gene_id "g593"; # protein sequence = [MTVSFHKYTGDFFPGTGKLDDNGYGAGKNFALNVPLLDGIDDDMYLTIFKTIIEDTVASFRPSAIVLQCGADSLGSDR # LGAFNLSIAAHGECVNFVRAFNVPLLVVGGGGYTLRNVCRCWTYETSVLVGVSIPNELPRTVYDSFFADSQWKLHPPLSGRVENQNTPASLQRITISI # RNKLRYLQGAPSVAMQEIPPDIQGFLKDEERSQEEIQEEISTASAGEQRMDTSIARNEYFDGDKDVDHDSSPPTPPPTRVSRGSARRGRGRGGRGRAR # GRGRVSSASVVDEDDDNDDDSPPPPRKSSRGRGRGRGAKTRVAVPELKRTPDPPTEAESDTPGASHDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g593 ### # start gene g594 5 AUGUSTUS gene 2957953 2959891 0.32 + . g594 5 AUGUSTUS transcript 2957953 2959891 0.32 + . g594.t1 5 AUGUSTUS start_codon 2957953 2957955 . + 0 transcript_id "g594.t1"; gene_id "g594"; 5 AUGUSTUS CDS 2957953 2957979 0.48 + 0 transcript_id "g594.t1"; gene_id "g594"; 5 AUGUSTUS CDS 2958280 2958589 0.63 + 0 transcript_id "g594.t1"; gene_id "g594"; 5 AUGUSTUS CDS 2959260 2959891 0.58 + 2 transcript_id "g594.t1"; gene_id "g594"; 5 AUGUSTUS stop_codon 2959889 2959891 . + 0 transcript_id "g594.t1"; gene_id "g594"; # protein sequence = [MANPTTFSVRVDIPVPMYEFSSEDLWKEWYWSERYPSQKELRSYFEHVEKKLDVKKDVCFDTRVTSAHFNASKDRWII # ITENGVTAQAKFLCLCLGFGSKPYIPDLPNLSSFLEITPKGVKTADGIEHELDALILATGYDSVTGGITQIDIRGIDGTSIKEKWQDGVYTYLGLTSA # GFPNLFFVYGPQGPTAVCSGPTCAVSVRDGIKLRTNVRIQETEGDWIVSCIKTMLEHNVTRIEATHEAEVAWRQQVMSEASTRLISTARSWYVGANVK # NKKVEILMYTGGAAKYTQICQEVADGGYEGFTLSSTEGNVDLIRDKLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g594 ### # start gene g595 5 AUGUSTUS gene 2965739 2966929 0.71 - . g595 5 AUGUSTUS transcript 2965739 2966929 0.71 - . g595.t1 5 AUGUSTUS stop_codon 2965739 2965741 . - 0 transcript_id "g595.t1"; gene_id "g595"; 5 AUGUSTUS CDS 2965739 2966153 1 - 1 transcript_id "g595.t1"; gene_id "g595"; 5 AUGUSTUS CDS 2966505 2966929 0.71 - 0 transcript_id "g595.t1"; gene_id "g595"; 5 AUGUSTUS start_codon 2966927 2966929 . - 0 transcript_id "g595.t1"; gene_id "g595"; # protein sequence = [MAEDGTVVHPRFLVLCIGFAAKAYVPDLKGIESFQGISHHTAKWPEEGLDLKGKRVGIIGTGASGVQVIQEIAEDVEQ # LTVFQRTPNYALAMRQSKLDKSGQDKMKVLYPAIHKHRRETSCRCSLILIASSTVQLTGQRESRPNVKLIDLGQSSIVEVTPNGILTADDIEHKLDVI # IFATGFDSVTGGITQIDIRGLGGKSIKDKWAEGIATNLGLATAGFPNMFFMYGPQSPTGENPIVACIKSPVTKFVLLETTAFWCVNIFIKNDINEPLY # PSEPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g595 ### # start gene g596 5 AUGUSTUS gene 2967950 2968603 0.68 - . g596 5 AUGUSTUS transcript 2967950 2968603 0.68 - . g596.t1 5 AUGUSTUS stop_codon 2967950 2967952 . - 0 transcript_id "g596.t1"; gene_id "g596"; 5 AUGUSTUS CDS 2967950 2968603 0.68 - 0 transcript_id "g596.t1"; gene_id "g596"; 5 AUGUSTUS start_codon 2968601 2968603 . - 0 transcript_id "g596.t1"; gene_id "g596"; # protein sequence = [MPSFPSSTFIVTTGGARRTFVYRFKEWVKRLFGVQCPRDTFLVDSWEDLLSRYDSDEQDDEALAGWLEHRLATSHNYE # LPELPDIPDIPKPPTPPDIPGIPDIPDVPDIPDIPDIPDIPSIPSLSLPSLPLPTSTLILRSPPKLPLPPPILEFIRAAKRVSRANRKLFLFERGFID # EGGIKDREWYRHLGVAPGKWLGEVFYLLFWPDALISSSFLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g596 ### # start gene g597 5 AUGUSTUS gene 2968989 2969966 0.2 - . g597 5 AUGUSTUS transcript 2968989 2969966 0.2 - . g597.t1 5 AUGUSTUS stop_codon 2968989 2968991 . - 0 transcript_id "g597.t1"; gene_id "g597"; 5 AUGUSTUS CDS 2968989 2969854 0.53 - 2 transcript_id "g597.t1"; gene_id "g597"; 5 AUGUSTUS CDS 2969906 2969966 0.24 - 0 transcript_id "g597.t1"; gene_id "g597"; 5 AUGUSTUS start_codon 2969964 2969966 . - 0 transcript_id "g597.t1"; gene_id "g597"; # protein sequence = [MAAIPGHVRDEVVIVGCHRDAWVLGAADPVSGTVALLEIVRGLGTLLRSGWKPLRTILIASWDAEEVCLPLLQFLVLS # VALNCASLQYGLIGSTEYGEDFAEWISEHAVAYLNVDVSSAGSRWDAVASPSLAHLIRQTAMDVPHPSEEGKTLWDAKEDEGPFKPFGPVGPDGEFGL # VVLNNGDSDVQGVNTTISSHRILEIGNIHADADVMEAYEATRNIRLGKTEGKDGTAVGPMGSGSDFTVFLQRLGVKSNYSSLIVHPLTDIPRLLVPTK # ASPALLMMHRIIITQFMTVFSGKRSMLILVSRNM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g597 ### # start gene g598 5 AUGUSTUS gene 2970640 2972133 0.23 - . g598 5 AUGUSTUS transcript 2970640 2972133 0.23 - . g598.t1 5 AUGUSTUS stop_codon 2970640 2970642 . - 0 transcript_id "g598.t1"; gene_id "g598"; 5 AUGUSTUS CDS 2970640 2971084 0.65 - 1 transcript_id "g598.t1"; gene_id "g598"; 5 AUGUSTUS CDS 2971823 2972133 0.33 - 0 transcript_id "g598.t1"; gene_id "g598"; 5 AUGUSTUS start_codon 2972131 2972133 . - 0 transcript_id "g598.t1"; gene_id "g598"; # protein sequence = [MNTHYFLDYKDKFFSYYKSYRDQDLNQELNSALQALESERQRNQFEWSSNAAVVNEILAGLIKLGITGVKAVDLVKFL # PTDGMEGALDIMAGVRAYFQGLFFALSVPNTENATAIAKQYSKHPHLAGSLEDYHDALSILEFIQTELSIIKPHSLEQPIYNAGTPKSRAKTIGLTSR # LGPRNPTAWIDVYYPYLNTPLDRSLDILDGTGSSIWSADLREDGNAGDEDAAKYRDYIPPWHGLSAHGEGQGQVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g598 ### # start gene g599 5 AUGUSTUS gene 2972523 2972891 0.98 - . g599 5 AUGUSTUS transcript 2972523 2972891 0.98 - . g599.t1 5 AUGUSTUS stop_codon 2972523 2972525 . - 0 transcript_id "g599.t1"; gene_id "g599"; 5 AUGUSTUS CDS 2972523 2972891 0.98 - 0 transcript_id "g599.t1"; gene_id "g599"; 5 AUGUSTUS start_codon 2972889 2972891 . - 0 transcript_id "g599.t1"; gene_id "g599"; # protein sequence = [MHNTRKDLAQLPKEPSQDPMSDISAMIYSFSSRLSRVLEGTPEAEALLQCIRPAQNAFKREIRKTAPNFRPYEKKYAS # QRNMAHFKFLNNEEDELEWDQDSEDNTESGAPVYIDDVNRRIQE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g599 ### # start gene g600 5 AUGUSTUS gene 2975210 2977072 0.33 - . g600 5 AUGUSTUS transcript 2975210 2977072 0.33 - . g600.t1 5 AUGUSTUS stop_codon 2975210 2975212 . - 0 transcript_id "g600.t1"; gene_id "g600"; 5 AUGUSTUS CDS 2975210 2975486 0.52 - 1 transcript_id "g600.t1"; gene_id "g600"; 5 AUGUSTUS CDS 2975631 2975899 0.35 - 0 transcript_id "g600.t1"; gene_id "g600"; 5 AUGUSTUS CDS 2975957 2976255 0.73 - 2 transcript_id "g600.t1"; gene_id "g600"; 5 AUGUSTUS CDS 2976310 2977072 0.66 - 0 transcript_id "g600.t1"; gene_id "g600"; 5 AUGUSTUS start_codon 2977070 2977072 . - 0 transcript_id "g600.t1"; gene_id "g600"; # protein sequence = [MSRPNGSDELDVLVVGAGFSGIHQLYHFRKLGYSVKVFEAASDLGGVWSHGYPGTLLPPFASQDTFSQYIGCRVDSDH # PLYQLSLPELWEDFIWKERYPGWRELNEYFQYIDRKLDVKRDVSFNTRVVAARFDQEINRWIVTTENGLVVRPRFLVLCVGFASKSYTPEFGGLERFE # GICHHTAHWPQEGVELRNKRVGVVGTGASGVQVIQEVGPEVSHLTVFQRTPNMALPMRQKNLDEKSQEQQKALYPSMFHEVSRTSIGGFPYERYPKTL # FSATLEERLLHWENLWSQGGFHFTVSNFNDILMNEDANREVYNFWRDKVRERIHDTRIQELLAPTIPPHPLGAKRCSLEQSYYEVFNQPNVTLVDLNE # SDISEVTSKGILTKDGVEHEFDVLVLATGFDSLTGSLTQIDIRGVDGVSIAEKWANGVYTNLGMTCANFPNIHMKENDLTAIYPTPEAEAQWRALIMN # TGYRALVNNAKSWYVGANIPGKTVEPLNYTGGVNQYLEIIEGIAERGYEGFGFMSEGGSLQNLDK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g600 ### # start gene g601 5 AUGUSTUS gene 2980364 2981083 0.9 + . g601 5 AUGUSTUS transcript 2980364 2981083 0.9 + . g601.t1 5 AUGUSTUS start_codon 2980364 2980366 . + 0 transcript_id "g601.t1"; gene_id "g601"; 5 AUGUSTUS CDS 2980364 2980588 0.98 + 0 transcript_id "g601.t1"; gene_id "g601"; 5 AUGUSTUS CDS 2980700 2981083 0.92 + 0 transcript_id "g601.t1"; gene_id "g601"; 5 AUGUSTUS stop_codon 2981081 2981083 . + 0 transcript_id "g601.t1"; gene_id "g601"; # protein sequence = [MKFTNTLFAAGAFIVSVSSMPVRRDVDPNLIPQFGLAAGINPDGTGKWNFTFSTKYHELILICLQEIVMELTDQTDLN # ANVAAGHAVNNPSVAVSFPSDNSQASQLARIDAALVTLQNLNGAGVGCPASSTTFVAQQAAIQAGTSDVAAASTSAVAAAAPTSAAAAASSTAPATGG # VDASLVPEFGVTAGQSPDGGISSLYC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g601 ### # start gene g602 5 AUGUSTUS gene 2983584 2984555 0.53 + . g602 5 AUGUSTUS transcript 2983584 2984555 0.53 + . g602.t1 5 AUGUSTUS start_codon 2983584 2983586 . + 0 transcript_id "g602.t1"; gene_id "g602"; 5 AUGUSTUS CDS 2983584 2983679 0.64 + 0 transcript_id "g602.t1"; gene_id "g602"; 5 AUGUSTUS CDS 2983775 2983909 0.78 + 0 transcript_id "g602.t1"; gene_id "g602"; 5 AUGUSTUS CDS 2984340 2984555 0.85 + 0 transcript_id "g602.t1"; gene_id "g602"; 5 AUGUSTUS stop_codon 2984553 2984555 . + 0 transcript_id "g602.t1"; gene_id "g602"; # protein sequence = [MLAILVKDGKGPIDNLYLGEAPTPDPKYGQVIRKGNYPVPPGASDILGVEFSGTVSTLGEGVTKFKMNDEVFGIAGGL # DWLVNIPNGATNGVNYKTQNFAEEVKKITNNKGVDVVIDFVGQNHWNKNIESMAMDGRMTMLALLSGIRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g602 ### # start gene g603 5 AUGUSTUS gene 2991086 2992808 0.89 + . g603 5 AUGUSTUS transcript 2991086 2992808 0.89 + . g603.t1 5 AUGUSTUS start_codon 2991086 2991088 . + 0 transcript_id "g603.t1"; gene_id "g603"; 5 AUGUSTUS CDS 2991086 2991115 0.89 + 0 transcript_id "g603.t1"; gene_id "g603"; 5 AUGUSTUS CDS 2991156 2992808 0.92 + 0 transcript_id "g603.t1"; gene_id "g603"; 5 AUGUSTUS stop_codon 2992806 2992808 . + 0 transcript_id "g603.t1"; gene_id "g603"; # protein sequence = [MPSIRGTALSRISSRSIKVGRFSQPAAQVVANIKTALPAIAARVNGGWDNIQGLGLKTSNSVNLPIWSCSLDDTDGGR # WAGLTAEDEEDEDESEGDEDEDEDESQGEDEDEELEQDESMDSDEADKDVDMDGDDEKSDSPAVMQTGKSKGKKRAADVDEDNQIVASPKRKKSKKSS # DGSSLSARDGTVDVPTTSKKSKLTVSTPAKTVAKDSATSISPSKDVVSASKPRAKKGTALQTPTPAAANTPATTKKATAAVDKKSTKKKSAETTDAAD # AASVTTTIPNTSALKDAPKKDKKKEGKTSPTASGGLTKPAPTPIVAPIATTSTESMSAPANKSKKSLASKTAPVEPLVDVSVSTHGEPPSTQKKGNNV # GVKAKKVESVATVVEEKETSSSKKAKKEKKTAPAVEVSEKIPMVEVEVKDENPKKKRKEKKAKLSSDGALETEVTDVVVAVTENAKEGKEEQQKEKKK # KGKKLIDPAAGPADDAMVMDTAPATDVVEKKSKKDKKSLVSDEKEVPASLSKEELKKKKSDAPGEKKKNKVSKAKGGKSVKDSLLGKKVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g603 ### # start gene g604 5 AUGUSTUS gene 3002725 3004670 0.58 + . g604 5 AUGUSTUS transcript 3002725 3004670 0.58 + . g604.t1 5 AUGUSTUS start_codon 3002725 3002727 . + 0 transcript_id "g604.t1"; gene_id "g604"; 5 AUGUSTUS CDS 3002725 3004125 0.58 + 0 transcript_id "g604.t1"; gene_id "g604"; 5 AUGUSTUS CDS 3004176 3004670 0.99 + 0 transcript_id "g604.t1"; gene_id "g604"; 5 AUGUSTUS stop_codon 3004668 3004670 . + 0 transcript_id "g604.t1"; gene_id "g604"; # protein sequence = [MNVYSCRITGLESESRTLARRISAISMSSAEPADDYSNSTFHYTSTPAPPPPTTTANKKPNQHQQSSSTSSRPGSRSR # THSQPSNVNNANRALSSSRPTSPPNQSVKTNQSRIPLPQRTRSRTGSLSSQSHSQHRTKTPTPGDFAPAAAAAADLWVVHERPSHSRLVNEPAPFPPP # NSSVSSIDVLPEPRPSNDSEERPFEHWYRGEVSRNGGVGEYRVAKRQEMLEIANYGHNIRPKKQNAITDAIDSEKQRRGRPRAGSLGERSSFYLDEEQ # AKEAARVMDENPLTDNGEEDDDGEEEYYDPMEEYYRPEELPPRTTTPRPSRIPTPTQLQRGQSEPPYFPTSSAGASTSALSSSSATPTQRPYATAGAS # NGTPQSKRAGTTSPPSASNKGKIKSYNSTTPSPSSNSRLAASKATQAKLAQNKRQREKEEEYRRSIAAYPDTGDDLMNAIPTWTQPVPKAGNWDDVVL # PVVARKKGLDGHYERADGSPQQRKDEVTIAPAPGTFGFDHSKYRPPREGEENIPMDEFGTKNSAYTERDDEEQEDEDSQPSHSQSRMETAHDQIRLPT # NTIPSKRASSPVPFSSYKPRPSQPEPVGQMNGDVEKGNMKVQRVDADESEDAGKGGCCGCVVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g604 ### # start gene g605 5 AUGUSTUS gene 3005431 3005826 0.8 - . g605 5 AUGUSTUS transcript 3005431 3005826 0.8 - . g605.t1 5 AUGUSTUS stop_codon 3005431 3005433 . - 0 transcript_id "g605.t1"; gene_id "g605"; 5 AUGUSTUS CDS 3005431 3005826 0.8 - 0 transcript_id "g605.t1"; gene_id "g605"; 5 AUGUSTUS start_codon 3005824 3005826 . - 0 transcript_id "g605.t1"; gene_id "g605"; # protein sequence = [MKGKVTFGPLNNRGLSDNENTWAQLAVRALIGEAKNQHDSKHDYHITLDFLNQAKYSGEVGIYEFNVALEGWHWLKPG # AKSRLAGRVHWGSGTQFSGGVVRGKISGSLNYIGPDNAIYFEVNERPVEMTLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g605 ### # start gene g606 5 AUGUSTUS gene 3011580 3012044 0.75 + . g606 5 AUGUSTUS transcript 3011580 3012044 0.75 + . g606.t1 5 AUGUSTUS start_codon 3011580 3011582 . + 0 transcript_id "g606.t1"; gene_id "g606"; 5 AUGUSTUS CDS 3011580 3012044 0.75 + 0 transcript_id "g606.t1"; gene_id "g606"; 5 AUGUSTUS stop_codon 3012042 3012044 . + 0 transcript_id "g606.t1"; gene_id "g606"; # protein sequence = [MHTPITTGMPPIKQKLSKKPMLPVTSLTEDSAIAKYYSRRIVLTKLIILNNCNTVSRPPALKPPPIPVTVLCIGKLPN # MPRESREVVEEAELVAETPEDDLPPIPKDPSDAKEPNPRELTTPPIVLALRPVPTADLGSGTTLVRGLGVGLELED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g606 ### # start gene g607 5 AUGUSTUS gene 3012480 3015474 0.3 - . g607 5 AUGUSTUS transcript 3012480 3015474 0.3 - . g607.t1 5 AUGUSTUS stop_codon 3012480 3012482 . - 0 transcript_id "g607.t1"; gene_id "g607"; 5 AUGUSTUS CDS 3012480 3013376 0.8 - 0 transcript_id "g607.t1"; gene_id "g607"; 5 AUGUSTUS CDS 3013432 3015474 0.36 - 0 transcript_id "g607.t1"; gene_id "g607"; 5 AUGUSTUS start_codon 3015472 3015474 . - 0 transcript_id "g607.t1"; gene_id "g607"; # protein sequence = [MHLYIILEFCENGSLSQIGKRFGKFPEGLVGVYVSQVLEGLCYLHEQGVIHRDIKGANILTNKDGTVKLADFGVASST # AIPSGSSSAEVVGSPYWMAPEVIEQSGATTASDIWSLGCVVIELLEGSPPYSFLDPMPALWRIVQDDCPPIPEGASAVVKDFLACCFQKDPNLRIGAR # KLLRHPWMVGVRARVKEAEAEKKDEQAQSHRHSTDNTSSGEDWTTSSTSSSTSTLHLSKSSSRSPLTTTVDKTRDHIDKSSLLLSKSPTQTVSLSKSQ # LDLGLQRQKTQRQPRKPSQKVSSAKNSARARPSISPSAVTGRVPGTEGRLVSQYGYDEAVQRVQEWNQALSSAANLSSLPSSTSMTIKPQSLAVPVVT # IGIPTSTMSSSGSAGSVPTIRPSPMIPIPMFVPSSSASSASSGSGSGSTSSSSDQGKTIRPVFTRPPSVSSDLLGKKDTHSHTKDMKGKGKGPTLITP # SFNSLGSFNALSGIAGVLTDQRKQLAFVEEEDEMDRDRWDDDFDLGEDDDFAARSKIDATKSKMDFGVKINHSKRDALHGTSNSSGSSSDGEDTTLTS # SSKIKPQPRARDDRTIRASPGASLSRLPSSSNSSPSQSSPVRPISPSRLPVAAVMTRSASDTTSASSSGTTYHAMSEAEEENYDDDFLGGDDDSGLED # GNALLERRVNEFKVIAKLASQRLQNQQGSSNRVGSFSRPLFHPDDIKSALFPPADSGQAITTLSSPSGSTSRPSVHGRTYSASATSSLSSSPFSAPLS # SSPSGARRPQLTLPPSTFSNNHKRISPGPLTAPLPDMAQGNDDVWDADYEDEYDHPGPFSAKHNDLKNGAGGSGSVRRASDAQKGSIGSIEIGGRKGS # VRSTGSGGGRNRGNSDGSEGRSAGYGAKNQRGSIRSLSEKFDKYMEHPGQEVDAEDFDYEDNNDSPSSTVGSGEGGLKPGLLKLNSRLSNRSWLGDED # DNSDEDVFAEVSAIFSYQY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g607 ### # start gene g608 5 AUGUSTUS gene 3021272 3022462 0.55 + . g608 5 AUGUSTUS transcript 3021272 3022462 0.55 + . g608.t1 5 AUGUSTUS start_codon 3021272 3021274 . + 0 transcript_id "g608.t1"; gene_id "g608"; 5 AUGUSTUS CDS 3021272 3022462 0.55 + 0 transcript_id "g608.t1"; gene_id "g608"; 5 AUGUSTUS stop_codon 3022460 3022462 . + 0 transcript_id "g608.t1"; gene_id "g608"; # protein sequence = [MLDRSRLEEQMFAYTVTNQIVDSASEIGWPYAMKIWHIILELIWRKQSDNLLSEELCESPTMESPPDSPISPFRESAI # PQTPKSPFATAFAHLRSFSTSLTLQPSAEDSLLTRALHESTLPSTPSNLSTDYSEMVIQFGYIVLWSTIFPLAPFFALLNNVLEMRKDAFRIANHERR # PIPERTESIGPWLDVLEFLGWGSAIVNVILVGLFCPSSQTDERGKCGYLFDLTEDTGTPIEMISIALSDAVWDSADAAAWRELAFTVLLLVLGASQAW # VVVRGLMRHIIEKVMWEGSTEVENWRNEMKRVKTGFLDGLSDEGVLSHANVSGESSNLHKAQTEKEKIKPNKRRSERKRKSLLTRDEEDLQQAPNLQL # DSPDIFWTYDEGLEEIRRLSGKVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g608 ### # start gene g609 5 AUGUSTUS gene 3027784 3028251 0.79 - . g609 5 AUGUSTUS transcript 3027784 3028251 0.79 - . g609.t1 5 AUGUSTUS stop_codon 3027784 3027786 . - 0 transcript_id "g609.t1"; gene_id "g609"; 5 AUGUSTUS CDS 3027784 3028251 0.79 - 0 transcript_id "g609.t1"; gene_id "g609"; 5 AUGUSTUS start_codon 3028249 3028251 . - 0 transcript_id "g609.t1"; gene_id "g609"; # protein sequence = [MPIDKVKLPEDQNGWHFGAFMDNPLANDDPIAVISLFLDPIPIDHVAAHSACGSSAFWDNGSITGPSEIITVRFRKFA # CKTTMQGQGVGTALFKHAMHFAHSELKAEVFWCDARVSSVAWYSGRGLSQFGHKFYKGAVEYVRMRVRLSETSPRSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g609 ### # start gene g610 5 AUGUSTUS gene 3030027 3031002 0.51 + . g610 5 AUGUSTUS transcript 3030027 3031002 0.51 + . g610.t1 5 AUGUSTUS start_codon 3030027 3030029 . + 0 transcript_id "g610.t1"; gene_id "g610"; 5 AUGUSTUS CDS 3030027 3030304 0.52 + 0 transcript_id "g610.t1"; gene_id "g610"; 5 AUGUSTUS CDS 3030342 3031002 0.66 + 1 transcript_id "g610.t1"; gene_id "g610"; 5 AUGUSTUS stop_codon 3031000 3031002 . + 0 transcript_id "g610.t1"; gene_id "g610"; # protein sequence = [MGVHISFVRCVSCTQSHPYDLTSHVQINKSRLLAARPVTEHESCGNQSATDFFTKHGGQSLLNDADTKKKYSSRVAEL # YKEELAKRVREDTAKLNLMARFPQGIFVEGIETPVAPKENTEDDFFESWSKPSTPKPSAPSTPRISTPPILGRTPSPVTPASSSTSITAPAPRTTTSS # AAARTGKIGATRLNSAASIGSGPKKSKLGLGASKAAKPIDFEEAERKAREEAERIKQLGYDRQREAEEEKVRKEAEAKMAALEIGNKTVSASVSAAKK # VETPKSASFPRFGFGAIPSAGAAAVVQGAKSKCVQLPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g610 ### # start gene g611 5 AUGUSTUS gene 3037633 3039216 0.24 + . g611 5 AUGUSTUS transcript 3037633 3039216 0.24 + . g611.t1 5 AUGUSTUS start_codon 3037633 3037635 . + 0 transcript_id "g611.t1"; gene_id "g611"; 5 AUGUSTUS CDS 3037633 3039216 0.24 + 0 transcript_id "g611.t1"; gene_id "g611"; 5 AUGUSTUS stop_codon 3039214 3039216 . + 0 transcript_id "g611.t1"; gene_id "g611"; # protein sequence = [MHETERTERICKTLVSQPRVAELVEALTIAIEEGEERRGEGEAPAEEDEEEGGGGDDEATDTEENEAQSGVLEPDDQD # ESMELAVALALSLETGSHADVPTTSSSARARLETEENLWPAISDALKKMSRLRHLSIVIDGSFSSPYSGRLAWILTDCPFRLKSFHSDMRWDENLVRF # LNVQDEIEDLYIGDYDEGEEAGEVEESTGLDEKTPVTTRSSGPVGPRASHNSLTLSPTALPHLFTLECTFSEAAIAIVPGRPVSRLKTCFSRTDPEGK # RAEMKVLFEGLGKALVPAKNRSSARGGRAVQEGLTGGSGRGGWYALDIADAEYEENFAMDLLRAVVNLTLVRSGSGGHGRAAGATKSTGSLSLKGTLR # YLGTLVLPVGGREVSHVIQRMIRFLHVTHNFFFFPYFSSNEKNCISYEHLEPIQRLLFYGLLMQLRYLCCVELEISAWNPSPTVVGPVAFRALGNELR # LYCPGVAKIVFVSMNAGEGEDIGERTTVEWITGEGVARVEREVMNGMSGTEGLWRDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g611 ### # start gene g612 5 AUGUSTUS gene 3052184 3054778 0.29 - . g612 5 AUGUSTUS transcript 3052184 3054778 0.29 - . g612.t1 5 AUGUSTUS stop_codon 3052184 3052186 . - 0 transcript_id "g612.t1"; gene_id "g612"; 5 AUGUSTUS CDS 3052184 3053273 0.99 - 1 transcript_id "g612.t1"; gene_id "g612"; 5 AUGUSTUS CDS 3053430 3053672 0.61 - 1 transcript_id "g612.t1"; gene_id "g612"; 5 AUGUSTUS CDS 3053796 3054778 0.4 - 0 transcript_id "g612.t1"; gene_id "g612"; 5 AUGUSTUS start_codon 3054776 3054778 . - 0 transcript_id "g612.t1"; gene_id "g612"; # protein sequence = [MANSSYSGYNPNSNLNIPYSSYDEGRGYGFGRGPRLYSDSSPKNPYEIQEQEQEVMDPHSSSHPENPANNSRHSQHPL # GPSSQDSRVYNPSSELPSSFVFSSLGPTRPAQVPSEREHPHRHHFPQNSHTNDHLNQLKQARDSHNDSISISYVSNRHFSDRYHHHAHDSHEWDHSVF # SGRRQPKVLEEIAGTPRGSGYFDNSKIYCDGSAAALVRPLQGVEASTELRSGSSSSSSSGSAKSNKPLFGHGRRAPSTTRVVPSYTTQQELVHWDETL # HRRSGGSGLGSGSGWSRECVESKMEMGGSNSNLMQTETPRTRTSTLTLTENLIAAAQNPGRRERFRDLFFNENPNKGEKENGDEEKNETDTDIKINRK # DSVNDENLEKSISLRNLALESIEPDHLRFMMNLIVHRCRPGGFASFILQNNAFAIGVGISPLPRESVSASETVKLEDGVLERERAQEEYYARHQKHYA # PFTRSSNSRFKLYFLDIAKIDLRRPGEKNRRGLFNTTSELTSWSGFGNEESFQGGLGHGWSEVTTAAEIPSELLDLKRPPQELLFGFKQGPESNRHTM # AGASSRKFNLVILDDHTSPSSSLTSDLHSIAQLLLGFQSLIQSQSGGGTLVVLLKHPESVITAKILYMLDTLSSTVAAVKPRRMLGDAEDPGCFYAIA # QNVGGGPHGHKVGEVVEELRKLWWKLVMRVVRWKGLVGSVGSDVKVEADAMRDICGLREEDFDFIIYTDELKGSKSDYLVRLVALGEMVWTRQLEMIL # MVGDNRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g612 ### # start gene g613 5 AUGUSTUS gene 3059129 3060810 0.96 + . g613 5 AUGUSTUS transcript 3059129 3060810 0.96 + . g613.t1 5 AUGUSTUS start_codon 3059129 3059131 . + 0 transcript_id "g613.t1"; gene_id "g613"; 5 AUGUSTUS CDS 3059129 3059384 0.97 + 0 transcript_id "g613.t1"; gene_id "g613"; 5 AUGUSTUS CDS 3059456 3060810 0.99 + 2 transcript_id "g613.t1"; gene_id "g613"; 5 AUGUSTUS stop_codon 3060808 3060810 . + 0 transcript_id "g613.t1"; gene_id "g613"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRPIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQGPPVDPDDPGADNNNNDLDDDSGSLPRGEPGDPSGPGGPGGPGGPGGPGGPRPPI # SPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWF # VPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPA # TLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFN # HLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g613 ### # start gene g614 5 AUGUSTUS gene 3061143 3061901 1 + . g614 5 AUGUSTUS transcript 3061143 3061901 1 + . g614.t1 5 AUGUSTUS start_codon 3061143 3061145 . + 0 transcript_id "g614.t1"; gene_id "g614"; 5 AUGUSTUS CDS 3061143 3061901 1 + 0 transcript_id "g614.t1"; gene_id "g614"; 5 AUGUSTUS stop_codon 3061899 3061901 . + 0 transcript_id "g614.t1"; gene_id "g614"; # protein sequence = [MANIAVRFPSGKLLLLPFYVTHLDSSCKAVLGYSFLSCYNPLIDWASRNITFRNTSHLDSPQTSVPSAVNTVDAKVAV # PLPELSPSVSPTILETPPGDSLCSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKRLY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g614 ### # start gene g615 5 AUGUSTUS gene 3062936 3064627 0.99 + . g615 5 AUGUSTUS transcript 3062936 3064627 0.99 + . g615.t1 5 AUGUSTUS start_codon 3062936 3062938 . + 0 transcript_id "g615.t1"; gene_id "g615"; 5 AUGUSTUS CDS 3062936 3064627 0.99 + 0 transcript_id "g615.t1"; gene_id "g615"; 5 AUGUSTUS stop_codon 3064625 3064627 . + 0 transcript_id "g615.t1"; gene_id "g615"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGVYDAQGEAEDALGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLAAYRLEVLRIDNRYWKREETKKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSANSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g615 ### # start gene g616 5 AUGUSTUS gene 3064960 3066954 0.99 + . g616 5 AUGUSTUS transcript 3064960 3066954 0.99 + . g616.t1 5 AUGUSTUS start_codon 3064960 3064962 . + 0 transcript_id "g616.t1"; gene_id "g616"; 5 AUGUSTUS CDS 3064960 3066954 0.99 + 0 transcript_id "g616.t1"; gene_id "g616"; 5 AUGUSTUS stop_codon 3066952 3066954 . + 0 transcript_id "g616.t1"; gene_id "g616"; # protein sequence = [MANIAVRFPSGELLLLPFFVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHFDSPQTSVPSAVNTVDAKVAV # PLPELSPSVSPTIQETPPGDSPRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSATPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGISATPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g616 ### # start gene g617 5 AUGUSTUS gene 3067053 3068522 1 + . g617 5 AUGUSTUS transcript 3067053 3068522 1 + . g617.t1 5 AUGUSTUS start_codon 3067053 3067055 . + 0 transcript_id "g617.t1"; gene_id "g617"; 5 AUGUSTUS CDS 3067053 3068522 1 + 0 transcript_id "g617.t1"; gene_id "g617"; 5 AUGUSTUS stop_codon 3068520 3068522 . + 0 transcript_id "g617.t1"; gene_id "g617"; # protein sequence = [MDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNR # TLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWNSISMDFIEQLPMSNGFTAILVVVDRSSKQAIFIPTHDTITSEQLA # ELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGI # TPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVI # SRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADEL # HADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g617 ### # start gene g618 5 AUGUSTUS gene 3070987 3073278 0.99 + . g618 5 AUGUSTUS transcript 3070987 3073278 0.99 + . g618.t1 5 AUGUSTUS start_codon 3070987 3070989 . + 0 transcript_id "g618.t1"; gene_id "g618"; 5 AUGUSTUS CDS 3070987 3073278 0.99 + 0 transcript_id "g618.t1"; gene_id "g618"; 5 AUGUSTUS stop_codon 3073276 3073278 . + 0 transcript_id "g618.t1"; gene_id "g618"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGASWIWDSSC # QEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVV # TDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLVGPVLRASII # MDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRD # YVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSD # RGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVD # MKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIH # PVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g618 ### # start gene g619 5 AUGUSTUS gene 3073642 3074740 0.24 - . g619 5 AUGUSTUS transcript 3073642 3074740 0.24 - . g619.t1 5 AUGUSTUS stop_codon 3073642 3073644 . - 0 transcript_id "g619.t1"; gene_id "g619"; 5 AUGUSTUS CDS 3073642 3074241 0.77 - 0 transcript_id "g619.t1"; gene_id "g619"; 5 AUGUSTUS CDS 3074342 3074740 0.24 - 0 transcript_id "g619.t1"; gene_id "g619"; 5 AUGUSTUS start_codon 3074738 3074740 . - 0 transcript_id "g619.t1"; gene_id "g619"; # protein sequence = [MSTSQTVTATTRPKTSTAGPSRSRPTPPPPIDLTTHADPDEEEDDILEEDDDEAIRRAEEHVRKMKARKAAAAAKRKA # EEEAARKATEEARRQKEAEARELEERRRKMAEAATARSRRGSSPGGSSVSPRRPVPVGGDPDDGGDGDDDDEDDDDRAPCERCRSKKISCQMQAGKRS # SVICKPCHDAKVRCSYSGRPSTVKREGGNPYGERLAVLESQVAQLLADNRQLRDGQVKANTYHRHMNRKLDWLVTEASRRRRTPPELPEAGLSGLPKK # RRRLADSDEEEEQRRVAQEVGEEEDGEGEEEMEEREEEERDEPAPRKARTEKGKEREE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g619 ### # start gene g620 5 AUGUSTUS gene 3077811 3079589 0.9 + . g620 5 AUGUSTUS transcript 3077811 3079589 0.9 + . g620.t1 5 AUGUSTUS start_codon 3077811 3077813 . + 0 transcript_id "g620.t1"; gene_id "g620"; 5 AUGUSTUS CDS 3077811 3079589 0.9 + 0 transcript_id "g620.t1"; gene_id "g620"; 5 AUGUSTUS stop_codon 3079587 3079589 . + 0 transcript_id "g620.t1"; gene_id "g620"; # protein sequence = [MEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPR # VPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWY # YDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLN # RQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDE # WTRVFTKLDGAVRAQAESLRNLHGEKVLQGWLSRFPGLELAPEAPYKSPLRREREPADVWTSNPKPAATGRFPNRSNWKEGRQRASAAWGEGESYDSE # NREEDEDCCHCRDGGEWTEAVLRAGVTDTGRKWTPEERAEKWRRRRQELCMRCGRKEHWAKDCPNPESLERPVEDQGSSERASKADSTRGRGTANQGG # GRKDDSTRPLERIRAGCHEAAEAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g620 ### # start gene g621 5 AUGUSTUS gene 3080074 3083790 0.93 - . g621 5 AUGUSTUS transcript 3080074 3083790 0.93 - . g621.t1 5 AUGUSTUS stop_codon 3080074 3080076 . - 0 transcript_id "g621.t1"; gene_id "g621"; 5 AUGUSTUS CDS 3080074 3083790 0.93 - 0 transcript_id "g621.t1"; gene_id "g621"; 5 AUGUSTUS start_codon 3083788 3083790 . - 0 transcript_id "g621.t1"; gene_id "g621"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIATGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQEAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKMVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g621 ### # start gene g622 5 AUGUSTUS gene 3083841 3085007 0.72 - . g622 5 AUGUSTUS transcript 3083841 3085007 0.72 - . g622.t1 5 AUGUSTUS stop_codon 3083841 3083843 . - 0 transcript_id "g622.t1"; gene_id "g622"; 5 AUGUSTUS CDS 3083841 3085007 0.72 - 0 transcript_id "g622.t1"; gene_id "g622"; 5 AUGUSTUS start_codon 3085005 3085007 . - 0 transcript_id "g622.t1"; gene_id "g622"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATASPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g622 ### # start gene g623 5 AUGUSTUS gene 3088810 3089457 0.61 + . g623 5 AUGUSTUS transcript 3088810 3089457 0.61 + . g623.t1 5 AUGUSTUS start_codon 3088810 3088812 . + 0 transcript_id "g623.t1"; gene_id "g623"; 5 AUGUSTUS CDS 3088810 3089457 0.61 + 0 transcript_id "g623.t1"; gene_id "g623"; 5 AUGUSTUS stop_codon 3089455 3089457 . + 0 transcript_id "g623.t1"; gene_id "g623"; # protein sequence = [MEHNIRLALDYMQTARGVHGDLHIRSTSSIQWFFNNAVDQDEGLYTLMLENSRFDSDRPFLTAAQHAGFTSPPPDSLE # PPLHRRMLSLSTALPHRGGAGRWDDLVPAIPSDDQLTQDWEQLMLQYMHHITDTPLPVPDPPVPMSSTGPVPESSDETNVEQSFEAPIVPVSSPSGGS # HPPVPLFLSEQESPTSPSPPPRSSVPPSFSGPLPAYPSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g623 ### # start gene g624 5 AUGUSTUS gene 3089823 3090572 0.92 - . g624 5 AUGUSTUS transcript 3089823 3090572 0.92 - . g624.t1 5 AUGUSTUS stop_codon 3089823 3089825 . - 0 transcript_id "g624.t1"; gene_id "g624"; 5 AUGUSTUS CDS 3089823 3090572 0.92 - 0 transcript_id "g624.t1"; gene_id "g624"; 5 AUGUSTUS start_codon 3090570 3090572 . - 0 transcript_id "g624.t1"; gene_id "g624"; # protein sequence = [MAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQEAEVNEYASNLKELHTYLQERIEVANKVYAKYANQKRQEAP # DWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTVLSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGKTEHFVEDILDSK # PKKGRPEEVEYLVKWEGYNDEFNSWVGWEGMVGSIELLRSWHKHHPRKRQPSRLQWASLEREAREDEEEGSGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g624 ### # start gene g625 5 AUGUSTUS gene 3307669 3308124 0.74 - . g625 5 AUGUSTUS transcript 3307669 3308124 0.74 - . g625.t1 5 AUGUSTUS stop_codon 3307669 3307671 . - 0 transcript_id "g625.t1"; gene_id "g625"; 5 AUGUSTUS CDS 3307669 3308124 0.74 - 0 transcript_id "g625.t1"; gene_id "g625"; 5 AUGUSTUS start_codon 3308122 3308124 . - 0 transcript_id "g625.t1"; gene_id "g625"; # protein sequence = [MSATSTERPSSSKLESKKQKSTLSCGNMTQAQKSNQAASSTVIMVAAGQHLMSIPEQSFGDETAGNVRTPEGHQPVVQ # EPPPVDPGMGPPQRRYTSMGYAQPPSSPMGGFTYSPTWGMRGPPPGPVPQLDMESASNAGGRVSSQVAAVERI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g625 ### # start gene g626 5 AUGUSTUS gene 3309568 3311894 0.91 - . g626 5 AUGUSTUS transcript 3309568 3311894 0.91 - . g626.t1 5 AUGUSTUS stop_codon 3309568 3309570 . - 0 transcript_id "g626.t1"; gene_id "g626"; 5 AUGUSTUS CDS 3309568 3311558 1 - 2 transcript_id "g626.t1"; gene_id "g626"; 5 AUGUSTUS CDS 3311612 3311894 0.91 - 0 transcript_id "g626.t1"; gene_id "g626"; 5 AUGUSTUS start_codon 3311892 3311894 . - 0 transcript_id "g626.t1"; gene_id "g626"; # protein sequence = [MKLVQVKKYPLILSANKYNATSPAPVPVPSTISSPLELEHSRPSDNPIPPSTDTAVQGDVDIPAQKQASSQVNIKEKE # AAPPLLGISSYQSPYTGGRTFNYKEKYPDDEPLGEELNDNAHVFKVYLDEAENFDDDLMRGFRDTIDSLLVFVSIDIPIVSPNLIFKQAALFSGVVTS # FVIATISALQPDYSQITAVLLVEQVQILRAAGNITAINAIPKSSVDLQNASVATDDLWINGLFLASLSLALVTALLSVFVKQWLQAYSSIIAGNAQQK # AMIREFRYAGLVKWKVPEIVGILPLILHTSLALFLIGLSLYILGLHSSLSWIVVTVTGVAFAFYFGSLLMPQVWLECPYRIPLLFVPSEYIIYLSKVL # LWLLRWIIVKFQDVTQTAKKRNASPKHWGFNSNSREKDSFPSILQASLKNTELEHLTKEDKRQSILEDILVWLLTLESNQSIQKIFDQPIYGFLRYLK # HHKYSKLENHADRVAKAFWATLPKFQRYDLQNLNSQVSLVLDDFSFSYEARELLKKGTVAHWNHLMSNCKSDIISKYFEYSKSRLTGIDLKQLGITQE # WKDNALSKAVSDFDWELVKVLVENGANVNAQGMGENALHAAAWERNLDVVQFLVQNNADVNVQGGQYGNALHAAVWKQDLNIVKFLVENNADVNAQGG # FFGYALQAAASRGNIDIVKFLVENNADVNAQGGEYGNALNVAAYHGHLHIVKYLVEHGADIMAQGLHGTALQAAKHGEEPDVANFLKPYTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g626 ### # start gene g627 5 AUGUSTUS gene 3315276 3315647 0.87 - . g627 5 AUGUSTUS transcript 3315276 3315647 0.87 - . g627.t1 5 AUGUSTUS stop_codon 3315276 3315278 . - 0 transcript_id "g627.t1"; gene_id "g627"; 5 AUGUSTUS CDS 3315276 3315647 0.87 - 0 transcript_id "g627.t1"; gene_id "g627"; 5 AUGUSTUS start_codon 3315645 3315647 . - 0 transcript_id "g627.t1"; gene_id "g627"; # protein sequence = [MWRWAITLRAWQEQVFKKAFTVNLSLDNLKHKYASFTGFEVSVPKCMIAVFGKEVVTDTVFMLHDKPLQKKKKLKYIG # VHHQTGRGSIYKDILVDKAKNAAGAVLHAKAFVGSDMPLRDMILD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g627 ### # start gene g628 5 AUGUSTUS gene 3316167 3317321 0.78 - . g628 5 AUGUSTUS transcript 3316167 3317321 0.78 - . g628.t1 5 AUGUSTUS stop_codon 3316167 3316169 . - 0 transcript_id "g628.t1"; gene_id "g628"; 5 AUGUSTUS CDS 3316167 3317321 0.78 - 0 transcript_id "g628.t1"; gene_id "g628"; 5 AUGUSTUS start_codon 3317319 3317321 . - 0 transcript_id "g628.t1"; gene_id "g628"; # protein sequence = [METTTGTKVSVPDLRHVTSSGALSPATTTMSPSSPTNTARGRLSQHYGLGLGSPLGSSSIPSSPTSVHSSSSAIFERD # IEGPTTTTTSTTNATRPNPHHIARGHTTESLDQNVPSVLDSAAEILAAGKGDNVLVIESVSVSSGSGWASPRSMGSRSPSPSPLAQGSLLLGVPGAGA # VSTSPPRPTIATSLSSPSKSPPTTIAATSPDDDSASTDEPLTTKRDTVPDYPWSSSHSHSPPHSLSAKRLSFVSYSDLLTSTPTLSLPLSTLTAAANE # PPHIATVGNALEGLAHTHPTHPHHPPISTSPPSSPLSTPTPLGFGYDHASSRSPSLAYQRPSTPGSGSASRNRSNRASAVFLDDLLGGEWQREGLGRG # LEERLEELGGDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g628 ### # start gene g629 5 AUGUSTUS gene 3319074 3320443 0.36 - . g629 5 AUGUSTUS transcript 3319074 3320443 0.36 - . g629.t1 5 AUGUSTUS stop_codon 3319074 3319076 . - 0 transcript_id "g629.t1"; gene_id "g629"; 5 AUGUSTUS CDS 3319074 3319988 0.98 - 0 transcript_id "g629.t1"; gene_id "g629"; 5 AUGUSTUS CDS 3320041 3320204 0.67 - 2 transcript_id "g629.t1"; gene_id "g629"; 5 AUGUSTUS CDS 3320260 3320443 0.48 - 0 transcript_id "g629.t1"; gene_id "g629"; 5 AUGUSTUS start_codon 3320441 3320443 . - 0 transcript_id "g629.t1"; gene_id "g629"; # protein sequence = [MSPHPAPIIIDITDPFSLEPEYKNVQEDVNTPAQKQASSPKNIKKDEPGLLGISSSHSPNPGGRTFNYEEKYADEPLG # EELKENSRVFKVYLDEAESFDDDMMRGFRETIDSLLVFAALFSGVVRSFVIETISALQPDYSQITAVLLVEQVQILRATGNSTVINTVPKSTVNLQNA # SAATEDLWINGLLLASLSLALATALLSVLVKQWIQAYSSMSAGSAKHRALVRQFRYAGLVKWKVTEIVGILPLILHTSLALFLIGLSLYISELHSSLS # WIVVTVTSLAFAFYLGSLLIPQVWLECPYRIPLLFVPTEYMIYPFRALSWVIVILLDAVGIENLKKGKFPSLTQTPLRTTELDYLKNDARKKSVLEDI # LVWLLSLESNQSIQEILAQPICAFVMHDNWHTKYPKLGNYADRVAKAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g629 ### # start gene g630 5 AUGUSTUS gene 3323193 3323816 1 + . g630 5 AUGUSTUS transcript 3323193 3323816 1 + . g630.t1 5 AUGUSTUS start_codon 3323193 3323195 . + 0 transcript_id "g630.t1"; gene_id "g630"; 5 AUGUSTUS CDS 3323193 3323816 1 + 0 transcript_id "g630.t1"; gene_id "g630"; 5 AUGUSTUS stop_codon 3323814 3323816 . + 0 transcript_id "g630.t1"; gene_id "g630"; # protein sequence = [MDAPLTPPSTPPMSPSTISPTPPPPSPSLPPRFSHSNPPPSWTHRARALIDKTQRGSEAKLRTFYRGGWRGLDVDMKA # TTNDAKDMCMNLKNSIPHDESEFDSPNSSASPISSNSSDTDTNSSDYPSSPGTPSTPPTPITPFDESDLTLPTPLTSPKLTTQTQPPPPKWWDLATAT # GTNTRADKTRKTRLEVCRRLVGGMEGVREMC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g630 ### # start gene g631 5 AUGUSTUS gene 3334742 3335149 0.67 + . g631 5 AUGUSTUS transcript 3334742 3335149 0.67 + . g631.t1 5 AUGUSTUS start_codon 3334742 3334744 . + 0 transcript_id "g631.t1"; gene_id "g631"; 5 AUGUSTUS CDS 3334742 3335149 0.67 + 0 transcript_id "g631.t1"; gene_id "g631"; 5 AUGUSTUS stop_codon 3335147 3335149 . + 0 transcript_id "g631.t1"; gene_id "g631"; # protein sequence = [MQSLTWCGNQSSANPSFRDNLEFLQWIKRFWDTNYGGQGYDPVSRRKGVADIPATVGPLSTGGSRTGGLNVGGSRAGG # RTPVSGHRSGSAQPNEAVQHLTAQLKEMSGHFEGLEKERDFYFEKVPQFDLSPSTRC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g631 ### # start gene g632 5 AUGUSTUS gene 3354753 3356015 0.77 + . g632 5 AUGUSTUS transcript 3354753 3356015 0.77 + . g632.t1 5 AUGUSTUS start_codon 3354753 3354755 . + 0 transcript_id "g632.t1"; gene_id "g632"; 5 AUGUSTUS CDS 3354753 3356015 0.77 + 0 transcript_id "g632.t1"; gene_id "g632"; 5 AUGUSTUS stop_codon 3356013 3356015 . + 0 transcript_id "g632.t1"; gene_id "g632"; # protein sequence = [MYTVPAQSILGRFFSNPGVHAEKFSDVPTGRPRIHINDVEGDSSSKSVRGIESIYSASGTQQTLYDDPPLSASLPQSF # PSNSAVSPAAMFLSGFSASPSTLSLPDDEGEAVADYILGPIIGYGGFSIVRRASSISGGVVAIKIVRRSDLSKQGNIVRAQKRLDHETRIWSSLNHEH # ILPLFTSMHNSYADFFVTLYCPAGSLFDILKREGRPALQQDDAGMMFRQLVRGTRYLHEDARIVHCDMKLENVLVDESGTCKITDFGMAKEIGEAIEA # DEEEEEEDRENAGGFVDISYGVHRAASVSYATPLAKPRLPLHDSSIRPSGRGPRHRNSTTTSTPHSLPKRVFQPGSLPYAAPELLLPPSNSEPRLPHP # AQDMWALGVMLYTLLSGRLPFLDSFEPRLQMKIMHGNGFPVNEYLSRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g632 ### # start gene g633 5 AUGUSTUS gene 3356089 3357504 0.31 + . g633 5 AUGUSTUS transcript 3356089 3357504 0.31 + . g633.t1 5 AUGUSTUS start_codon 3356089 3356091 . + 0 transcript_id "g633.t1"; gene_id "g633"; 5 AUGUSTUS CDS 3356089 3357504 0.31 + 0 transcript_id "g633.t1"; gene_id "g633"; 5 AUGUSTUS stop_codon 3357502 3357504 . + 0 transcript_id "g633.t1"; gene_id "g633"; # protein sequence = [MDKDAATRWTVAMVDEVAWGVGWGDEGDSVPVTDEELRQETTVSFNSRSQSRPHVSLSSTSPIAEVESDVPCSAVSDA # SARRSASRAQRSLSRAPVSARSRSLSKRSEIGRRHYPSPPTSAVESSIHSIRSSSTHSSISSAGPLEPDYAPLLSPSPLRGIEEEKRGRRLKKSSHIT # SMSRSPSPSVLPSTPSDVNPPRFISPPPLEERAEGSRASTSSIPRGRLRFPRIAPSHQSKSGTHTPLEQRTTPDVFSAEDEPEWHISSVEDGLLQANE # MAASMAMDQDYLTSSESYFQRNISPPPIQSESRPLFHHRPGSIIQTKSEGHRRSTLADLALETSAVGVPDNVADREPRRGHVSSSLERSHHTSHHHFH # HPYNLKKQMRAGSTPPAPLSSLLDDGHTSTLRFSEHKSHSHSASHTPFSVYSHSHSSSRTSFGLLASEQTGPIRAMPVSAMVTPVVVTGVNVTSAAED # V] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g633 ### # start gene g634 5 AUGUSTUS gene 3357991 3358710 0.43 + . g634 5 AUGUSTUS transcript 3357991 3358710 0.43 + . g634.t1 5 AUGUSTUS start_codon 3357991 3357993 . + 0 transcript_id "g634.t1"; gene_id "g634"; 5 AUGUSTUS CDS 3357991 3358038 0.43 + 0 transcript_id "g634.t1"; gene_id "g634"; 5 AUGUSTUS CDS 3358180 3358710 0.81 + 0 transcript_id "g634.t1"; gene_id "g634"; 5 AUGUSTUS stop_codon 3358708 3358710 . + 0 transcript_id "g634.t1"; gene_id "g634"; # protein sequence = [MSSLTPKEVRKTARAADVDLVVLNNRKYDAEDLKQILVDEDDRFYFVASVNPDATYQVLWFRLGPGRSCKVDILTTGE # STSLNIPRVPVTRVLYIHPYDDLPVMPLLALLLLKLQGWTDHRHSQKSHEQKRVRQDVADIKEMLKIAVEEQVHIDDQESKWMPRLFVEQMSDRVDEY # VRKFPESLNDWENLGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g634 ### # start gene g635 5 AUGUSTUS gene 3362900 3364190 0.68 + . g635 5 AUGUSTUS transcript 3362900 3364190 0.68 + . g635.t1 5 AUGUSTUS start_codon 3362900 3362902 . + 0 transcript_id "g635.t1"; gene_id "g635"; 5 AUGUSTUS CDS 3362900 3363050 0.68 + 0 transcript_id "g635.t1"; gene_id "g635"; 5 AUGUSTUS CDS 3363193 3364190 0.95 + 2 transcript_id "g635.t1"; gene_id "g635"; 5 AUGUSTUS stop_codon 3364188 3364190 . + 0 transcript_id "g635.t1"; gene_id "g635"; # protein sequence = [MAPLWPYAVGAQAGVDGSSPVSIDMQDHTHTSDGGSEDVASAVLWGMDGLIQDSSSTTASSSFSSSSSSSSSSATSAS # SASKISSTSHTGVIVGAIAGGIVIAFIVIAFAVCLTRRRRNQANRPFITGAAGAEAFVGGAGRTSRKFGGKSYASAAPDSPTMVSIPLGSPESFGNNA # NQNPNSMSYYSQGNSSTTSAAYQNDHPRNAISSFSGYGQPVPGSQYGEGLQLYGQPDKGSHRSSQYGSDRPYSSYNSSSAMVSGVAAAATGGAHVGAS # LPGVANGSGNMADSYGAFGGPNPHTDPFLAAPGQIVLSYGGAASDSGVSYFHPIFPSRHSRILSQAGSSSSRSDVYTTKPLTAAAEKRRLALAHREEE # QEEEAPPSYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g635 ### # start gene g636 5 AUGUSTUS gene 3365569 3368100 0.75 + . g636 5 AUGUSTUS transcript 3365569 3368100 0.75 + . g636.t1 5 AUGUSTUS start_codon 3365569 3365571 . + 0 transcript_id "g636.t1"; gene_id "g636"; 5 AUGUSTUS CDS 3365569 3368100 0.75 + 0 transcript_id "g636.t1"; gene_id "g636"; 5 AUGUSTUS stop_codon 3368098 3368100 . + 0 transcript_id "g636.t1"; gene_id "g636"; # protein sequence = [MPKRYVPASPATDLETGGSGIEHVSLSVSGMTCTGCETKLQRALAQIDSIKHLKTSLVLSRAEFDLDLSIGTLEDVMK # RLERATEFKCEKITDQGASIDVITPINAVDFVKQDWPLGVTDMKITSKTSACVHYDPKVVGARNLIERGWAMPLKLAPLLADLNLEAGRKHVRHFGYM # TLLSVALTIPVLVLAWAPLPKKDIAYGSVSLALATIVQIVIAGPFYTKALKSLVFSRVIEMDLLIVLSTSAAYIFSIISFVFLASGNPLSTGEFFETS # TLLVTLIMVGRYVAALSRQKAVQSISVYSLQTPTALIVDEQGVSEREIDTRLLQYGDFLKIIPDSRVPTDGTVISGFSTIDESMITGELKPVEKSVKF # SVIAGSINNSGTLIARITRLPNENTISTIANMVDEAKLSKPQIQEIADRVASWFVPVVMVFTIITFAIWIAVGMVVQGRSGNEAAIQAITYAITVLII # SCPCAIGLAVPMVIVITSGVAAEHGVVFKSAQSIEIAHKAAHVVFDKTGTLTEGKLIVAAEEYMAEEQGVTASLLLGLVGSIKHPVSIAVATHLQAKS # GIVTNVSDIVSVVGKGVEGMSPSGQVLRAGNSHWLGLSSDPRVISILSRGLSAFCFTVDGSLRAIFGLAEDILRPDAISTITQLRTWGIAIHILSGDD # DGPVRAIASQLDVPEDNVRSRCSPADKAAYIKALCTAPVESFAMPYASSNAPVVIFCGDGTNDAVALAQASIGIHISSSSASLAEVSRSVATVILLQP # RLAGILDIICLSRRATQRIACNFVWSAIYNLFAITLGAGAFSAAGGVKIPPALAGLGELVSVLPVVAAAVALRWERIRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g636 ### # start gene g637 5 AUGUSTUS gene 3370260 3370805 0.9 - . g637 5 AUGUSTUS transcript 3370260 3370805 0.9 - . g637.t1 5 AUGUSTUS stop_codon 3370260 3370262 . - 0 transcript_id "g637.t1"; gene_id "g637"; 5 AUGUSTUS CDS 3370260 3370805 0.9 - 0 transcript_id "g637.t1"; gene_id "g637"; 5 AUGUSTUS start_codon 3370803 3370805 . - 0 transcript_id "g637.t1"; gene_id "g637"; # protein sequence = [MHTSTPATVESSKRFSSGGGTACYSPPEEPISKACSRRSDTISGKSSAENHLPKPVAAMVNLASEMWRLGEPGDVEEE # QDSKWPQTFISVRENKREISEQGSGRKLERMCFFADGKQRWMYDDLEKGETEEEQETRKLGLEFRRSYVRYIRTREELRENMIDLDECLLCQKLEERE # EGQVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g637 ### # start gene g638 5 AUGUSTUS gene 3373066 3373702 0.58 + . g638 5 AUGUSTUS transcript 3373066 3373702 0.58 + . g638.t1 5 AUGUSTUS start_codon 3373066 3373068 . + 0 transcript_id "g638.t1"; gene_id "g638"; 5 AUGUSTUS CDS 3373066 3373231 0.58 + 0 transcript_id "g638.t1"; gene_id "g638"; 5 AUGUSTUS CDS 3373281 3373702 0.96 + 2 transcript_id "g638.t1"; gene_id "g638"; 5 AUGUSTUS stop_codon 3373700 3373702 . + 0 transcript_id "g638.t1"; gene_id "g638"; # protein sequence = [MPSLSDVWLLVDDTQMTSAFSGGSWMTAGPGFGPWLGNTSTFIGTPGGDIIVSFQGTSISFTGNTPSATNSPTWFLAG # IDSNTPYNVSFPDVGTQIYTQWYQTPMLPDGLHIVNLSSIVVDLDYVVITAGSTTPFSGSTIVVDDRSPEIAYTGSGWTTSDAEVNFGGSYINGPPLG # NTTHRTNNVGDGFVFPFAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g638 ### # start gene g639 5 AUGUSTUS gene 3378431 3379758 0.36 + . g639 5 AUGUSTUS transcript 3378431 3379758 0.36 + . g639.t1 5 AUGUSTUS start_codon 3378431 3378433 . + 0 transcript_id "g639.t1"; gene_id "g639"; 5 AUGUSTUS CDS 3378431 3378969 0.38 + 0 transcript_id "g639.t1"; gene_id "g639"; 5 AUGUSTUS CDS 3379041 3379758 0.75 + 1 transcript_id "g639.t1"; gene_id "g639"; 5 AUGUSTUS stop_codon 3379756 3379758 . + 0 transcript_id "g639.t1"; gene_id "g639"; # protein sequence = [MSIVAIGLVLALVNLLVAATTVLKPRVTLANSPVDPIDPFAFDPGFDIQSVAGLAISLPSHSWEFGTASEALLELWNP # SLSIFGPEPFQAAASLSRDPLVAMSVPSLVYAQAKIVLGTGANVLADGDGAVGDPASLGVSAVLLGKIAGNETLRDAAEREAEYLLMGAPRFWNGAIS # HRVEADFVYMAPPFLAYYAVETSNPLLLQQTVEQCGLYRQILQKNVSSATSYKGLWEHIIGPVNQDTGVWSTGNAWAAAGMTRVLATVLKAPSRITLT # WKDDAVSQLTQWIKEILDGAIRGKDITLAPNGLLRNYLDDVSGDGHGFGETSGTALLASVSYRVVVLRPDIFYADGSDRTYVDWADGLRKTLAEHITA # NGTATPAVNPLNWSDTTQYTAGSPEGQNFVVLMYAAWRDCKIAEIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g639 ### # start gene g640 5 AUGUSTUS gene 3382104 3382463 0.78 - . g640 5 AUGUSTUS transcript 3382104 3382463 0.78 - . g640.t1 5 AUGUSTUS stop_codon 3382104 3382106 . - 0 transcript_id "g640.t1"; gene_id "g640"; 5 AUGUSTUS CDS 3382104 3382463 0.78 - 0 transcript_id "g640.t1"; gene_id "g640"; 5 AUGUSTUS start_codon 3382461 3382463 . - 0 transcript_id "g640.t1"; gene_id "g640"; # protein sequence = [MCFTKRQRNNFDDQDNKVSKNGIKRATDENKSNPPPTSEPEPTPTDFTAPSTSTTMSSPKIAIVIYSMYGHIAKCKLL # FRIVFCVLTSCSTVAESVKSGVEAAGGKVTIFQSVQILLCP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g640 ### # start gene g641 5 AUGUSTUS gene 3383626 3385451 0.42 - . g641 5 AUGUSTUS transcript 3383626 3385451 0.42 - . g641.t1 5 AUGUSTUS stop_codon 3383626 3383628 . - 0 transcript_id "g641.t1"; gene_id "g641"; 5 AUGUSTUS CDS 3383626 3385281 0.56 - 0 transcript_id "g641.t1"; gene_id "g641"; 5 AUGUSTUS CDS 3385389 3385451 0.45 - 0 transcript_id "g641.t1"; gene_id "g641"; 5 AUGUSTUS start_codon 3385449 3385451 . - 0 transcript_id "g641.t1"; gene_id "g641"; # protein sequence = [MELKKLLNVYMDEWSVDGTIPRSERVIREDDSASPARLTIAQAALLNLRGRDQLRNQQQTGVDAPLIGASRLVHGSAP # TANQVYNDFSSNAHDLSAAAAGAYRGSASDLTSAAQLLAGLNNGPRRGVNLSPYHQTSPLPNVLGQTNQDLTPAMAALLDSLRGNGAPWTGHDDRYTA # PQRQPHTFRNAHSAHSVLGDVDLNLTFTPEYQSRVGGGVAQTRSGYTPAEELILNAHAQRRKSVHIGGDEPSYHQHGQHVDDAGFNVGVRGYRTQAST # MAIQQQPSSYYLSSGNLPVVVESDGDQEAEHPPQSTRYPQSQLNGRSRQVRNSGPRERDIHNNFLSNNHNQQAHVRSTTLPPSSTPSTAAPRHYQHNS # MSVLKSRNITNDIMRTTSSQLQTTSSNQPQAHSKHRSMNSISSSILNNSKIHDDNIHNNTHLYSDASDIRIPDGGSSYTDMTSAHQQQHHYRHNYPTK # IAGDQDPPFGNNNLDSKKNTFDDGSYGVTTHSYTRNPETYDVSQTSPPLVSPALTYSSRGSGATLSPSTPYVGSFTSSTGHEAGGEYQSAQRVETEVG # VGER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g641 ### # start gene g642 5 AUGUSTUS gene 3386382 3386780 0.85 - . g642 5 AUGUSTUS transcript 3386382 3386780 0.85 - . g642.t1 5 AUGUSTUS stop_codon 3386382 3386384 . - 0 transcript_id "g642.t1"; gene_id "g642"; 5 AUGUSTUS CDS 3386382 3386780 0.85 - 0 transcript_id "g642.t1"; gene_id "g642"; 5 AUGUSTUS start_codon 3386778 3386780 . - 0 transcript_id "g642.t1"; gene_id "g642"; # protein sequence = [MCNSDSQDFNNETKFTAQVKPQLTSRSGNVPETGPIDLEALEKDSANATLTFNVNHSAPAHILSSDSDHGTSRSYDAA # DDQQKSPNVYINGLPSHFPEEQLFELAAPFGEIRSVRSFTRHVGEKESGYGFVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g642 ### # start gene g643 5 AUGUSTUS gene 3388146 3389216 0.77 + . g643 5 AUGUSTUS transcript 3388146 3389216 0.77 + . g643.t1 5 AUGUSTUS start_codon 3388146 3388148 . + 0 transcript_id "g643.t1"; gene_id "g643"; 5 AUGUSTUS CDS 3388146 3389216 0.77 + 0 transcript_id "g643.t1"; gene_id "g643"; 5 AUGUSTUS stop_codon 3389214 3389216 . + 0 transcript_id "g643.t1"; gene_id "g643"; # protein sequence = [MFASWDITTRLTFNKENNANNIRRDLQRAAHLRDPENIRSPSPVTSELTIQPEEWEKIRTNPIRFDSLKHLIPDFILE # WMESRKIQEVKDKREREEDTSREAEEEKKKKRRLAEPLVPVVKNPLVPFQASFHDALYEIAHVSPIPLPFFSNDALQFISARAHSLPHKKFKSNDPRK # SGYFIDIEALKKMLRIKYADDDQLEGLNYILFVECVNNYMRFETSRDPAGPAGTRAQFIIQHFSFFLNKHHTAKLYAFWKPAELRIRNEQYLEFTGFI # QSVYDSEWTKVESQVEFEDTMAKARGGSLWYSYPFQSNTTSDISPPYQGSPIGDMPPLSENTITPDHTSVTNTQVVNQDIAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g643 ### # start gene g644 5 AUGUSTUS gene 3390469 3391905 0.57 + . g644 5 AUGUSTUS transcript 3390469 3391905 0.57 + . g644.t1 5 AUGUSTUS start_codon 3390469 3390471 . + 0 transcript_id "g644.t1"; gene_id "g644"; 5 AUGUSTUS CDS 3390469 3391209 0.59 + 0 transcript_id "g644.t1"; gene_id "g644"; 5 AUGUSTUS CDS 3391339 3391905 0.98 + 0 transcript_id "g644.t1"; gene_id "g644"; 5 AUGUSTUS stop_codon 3391903 3391905 . + 0 transcript_id "g644.t1"; gene_id "g644"; # protein sequence = [MSTRQFASPVTRGNFFYGSNFYVEVPGSGGFSKERFTRESSGSLYSLLTYTPPSGPVLTKAGKVAKRQPSPHRDRSGA # FYCAQLIHYGLKQYKTKEAAKKHLLQAFDADHQLKVPESILLVEKELKEEYDKANLEAGRLYEERRLLERERVRKEQEERSRKNAALMKQLKEISETK # VAGTDDSGAMVKRLSDKALRDAIKVMPEGDLRKIVAKAVKDVPELRDAVELQISRSQKTTQKANKGKSALKWSQFLPDELFTLKICKSMKSSHLWGKF # DFGGISGILRSTSSPLPESFPAGFKVEFLWRGEESGEGESSFGKDNKGYLVFLGDGRIKGHMHWMGEFDFAGKYDTEQSQNVVWVKSIPHWKSEWRSY # NQHNYDVANTARWGNWGGETRNEKAADSDTSAGKGSSGSDDEEDFDMEDDSDSGYQGRSNIAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g644 ### # start gene g645 5 AUGUSTUS gene 3399481 3400244 0.29 - . g645 5 AUGUSTUS transcript 3399481 3400244 0.29 - . g645.t1 5 AUGUSTUS stop_codon 3399481 3399483 . - 0 transcript_id "g645.t1"; gene_id "g645"; 5 AUGUSTUS CDS 3399481 3399921 0.6 - 0 transcript_id "g645.t1"; gene_id "g645"; 5 AUGUSTUS CDS 3400068 3400244 0.29 - 0 transcript_id "g645.t1"; gene_id "g645"; 5 AUGUSTUS start_codon 3400242 3400244 . - 0 transcript_id "g645.t1"; gene_id "g645"; # protein sequence = [MLDENVVAGTVTDARNWGPPCIQTPAMVGIGSEDCLTLDIWKPTNASAEDKLPVAVYIHSPQGFPLYDWVSQHPTGLV # GASITYRLGMLGFFAGPDIDGASDNIDLNVGLLDQRAGLEWLKRHVSQFGGDPEDMTIIGESAGGASIVMQVTAYGGTLPLSLLNTPVEFRLILILCR # NEACSLQTCRRRIDWFRTYHDQCSDRGIY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g645 ### # start gene g646 5 AUGUSTUS gene 3401148 3401594 0.56 - . g646 5 AUGUSTUS transcript 3401148 3401594 0.56 - . g646.t1 5 AUGUSTUS stop_codon 3401148 3401150 . - 0 transcript_id "g646.t1"; gene_id "g646"; 5 AUGUSTUS CDS 3401148 3401594 0.56 - 0 transcript_id "g646.t1"; gene_id "g646"; 5 AUGUSTUS start_codon 3401592 3401594 . - 0 transcript_id "g646.t1"; gene_id "g646"; # protein sequence = [MFKSAALAVFAALSIQNTSYSSSSGPFALSWNSTSPYGQSSGLFAMFDGTYGSAMNFTSGTPSSSNLTASYNATSGKL # SLVCAGDDYLTGLVAALVYEPELTPPTYTLQWVDDSDATLPAGSNKTSLVPMDGGIVSTVSVYRPFSRLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g646 ### # start gene g647 5 AUGUSTUS gene 3404550 3404837 0.61 + . g647 5 AUGUSTUS transcript 3404550 3404837 0.61 + . g647.t1 5 AUGUSTUS start_codon 3404550 3404552 . + 0 transcript_id "g647.t1"; gene_id "g647"; 5 AUGUSTUS CDS 3404550 3404837 0.61 + 0 transcript_id "g647.t1"; gene_id "g647"; 5 AUGUSTUS stop_codon 3404835 3404837 . + 0 transcript_id "g647.t1"; gene_id "g647"; # protein sequence = [MLPDGLHFVNLSSIFVNVDYAIITAGATTQLNGSTIVVDDRSSEITYTGNGWATSDTEIILGSGWVNGSPLGNTTHRT # SNVGDGFSFRFAGQSQC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g647 ### # start gene g648 5 AUGUSTUS gene 3406270 3408903 0.3 - . g648 5 AUGUSTUS transcript 3406270 3408903 0.3 - . g648.t1 5 AUGUSTUS stop_codon 3406270 3406272 . - 0 transcript_id "g648.t1"; gene_id "g648"; 5 AUGUSTUS CDS 3406270 3407289 0.53 - 0 transcript_id "g648.t1"; gene_id "g648"; 5 AUGUSTUS CDS 3408311 3408745 0.42 - 0 transcript_id "g648.t1"; gene_id "g648"; 5 AUGUSTUS CDS 3408814 3408903 0.71 - 0 transcript_id "g648.t1"; gene_id "g648"; 5 AUGUSTUS start_codon 3408901 3408903 . - 0 transcript_id "g648.t1"; gene_id "g648"; # protein sequence = [MIIPTKELDDSEYNGKLDDDSPTETGTVRGVEPPPEYSPPNPNYPDKQKKSTYPDVASKPSDDLELKGVNFVYRHIYF # DSIYATYIIDPSVQDLSQSILPGASRDDRRSGSRTGPRKGKTLKNLCLQSECGAINVGVRVLDTEIAAMATEGKRSHLPRKVLLDVRTTFGPIDVRLR # TTFNNIQSVGTSISFAGNTPSSSNSPTWFLVGIDLNSPYNVSFPNPGILQSYTQWYQTPTLPDGLHTVNLSSIVVNLDYAIITAGATTPLSGSTIVVD # DESPEILYNGNGWKTSDSGIDIGGGWVNGLPLANTTHRTSNMGDGFSFQFAGKSKLCSESQNFNLVVGSNISVYGVFEWTATGSVGVDFTLDGVTTSS # SLFVPVGSTISHPEIPNYLHFSSGTLKTGNHTLIMSITESDGNQSFVLDYLTYEPSFSSLVEKPNFTSPASPVASGSEISPSASNTGSPVAMTHKRNI # RAILGGAIGGVLGVFLIFVVLRFSLLRRRIQKANREQRVEGISK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g648 ### # start gene g649 5 AUGUSTUS gene 3409295 3411350 0.44 - . g649 5 AUGUSTUS transcript 3409295 3411350 0.44 - . g649.t1 5 AUGUSTUS stop_codon 3409295 3409297 . - 0 transcript_id "g649.t1"; gene_id "g649"; 5 AUGUSTUS CDS 3409295 3410308 0.85 - 0 transcript_id "g649.t1"; gene_id "g649"; 5 AUGUSTUS CDS 3411204 3411350 0.45 - 0 transcript_id "g649.t1"; gene_id "g649"; 5 AUGUSTUS start_codon 3411348 3411350 . - 0 transcript_id "g649.t1"; gene_id "g649"; # protein sequence = [MGEENTPSRTAKMMATAVTRSIDVVGTQTDEDARREIFREAVELNFTDVDSPPDYEEIEGTDALHESTPISNTSSSST # ATTPIPGPPVSLARPHSARAVTNNASKNSPANNISISHPFGSINCAYTVDPTLTLFPSSSRGTRIQSNVKLRTNVGSIDADLTLMHGAKEDNSTLPSA # TMDISSKMGTVNVTLVSSYWEYALVTHPLITMQRRPSSALPTIRLFASSRAGSLSVRVPANFHGFITAYTKIGRLTLEPSLQSSAVVLKEEIKVKRVF # IGDPNVLRGSADTRLFQTRIRETKNGGWEGDRIVLRTPVGNIELGYIEERHAHTSQYDVLTESRAAYGRGRGHRGHGGRGGRGGGGRGRRGINEDGRG # NNQGVFFAPEPSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g649 ### # start gene g650 5 AUGUSTUS gene 3416387 3417133 1 + . g650 5 AUGUSTUS transcript 3416387 3417133 1 + . g650.t1 5 AUGUSTUS start_codon 3416387 3416389 . + 0 transcript_id "g650.t1"; gene_id "g650"; 5 AUGUSTUS CDS 3416387 3417133 1 + 0 transcript_id "g650.t1"; gene_id "g650"; 5 AUGUSTUS stop_codon 3417131 3417133 . + 0 transcript_id "g650.t1"; gene_id "g650"; # protein sequence = [MAGTFPQSIPRPFTSPGRTNSSTLSPAARFYGYQTDQTDQDNEDEVGLTTNNTAAHQSLAQQPAGSQGISRTTATEAS # STPSTDLGLPRNYTVSGLAQQQQSSPYIQYLYGTLNRGQGYSTTNSARTSYTRVDTTVMGDSPDIEAGIEAQDGNGEGTTPSVTADIAAEGQIQAIPQ # APIVSVCFLMISGKRRVMTFEPETTVGRVKELVWNTWPSGPGRCFPSSSHTTKLIFLTSRLARGTAIHPIPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g650 ### # start gene g651 5 AUGUSTUS gene 3422068 3423517 0.82 + . g651 5 AUGUSTUS transcript 3422068 3423517 0.82 + . g651.t1 5 AUGUSTUS start_codon 3422068 3422070 . + 0 transcript_id "g651.t1"; gene_id "g651"; 5 AUGUSTUS CDS 3422068 3422589 1 + 0 transcript_id "g651.t1"; gene_id "g651"; 5 AUGUSTUS CDS 3422639 3423517 0.82 + 0 transcript_id "g651.t1"; gene_id "g651"; 5 AUGUSTUS stop_codon 3423515 3423517 . + 0 transcript_id "g651.t1"; gene_id "g651"; # protein sequence = [MPTPEKKNPQRDSDGERSGNSKATANGREVTDPITHFPVTIHDNTSIELEQIPPSRSDSKATEDMTAEETDQQQHTEM # ERVVWEETNKGWWEEPNHNRTRTALVVAISVSIGGYTTLIISKILPRISTRSTSGEGFGILDIYIGVVAYTLLAIAAGFLVLRYETKGENNNNQQEKP # WTKPSAQERPESAVWLNSFLDTLWPIVNPALFTAVSDMLEDSLQASLPKMIHAVRVADIGQGSEPLRILGIRWLDGADATQARPGMAAEEGDFVNFEI # AVAYRATSSSSSLKGRSANLHLLMQFWLTGGIVLPVWVDITGIISTARVRIHLTPNPPFLSLMTLTLMGQPKVKLTATPLAKNFLNVMDMPGLSGWLQ # KSIDAAISEYVAPHSLSVDLKTVLMGREKMDTEARGVVWITVKSATGFKNGDGIEIWKSENGRKGDVYVTASWGKWGKPLWSTRSVDQYLIGVF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g651 ### # start gene g652 5 AUGUSTUS gene 3423914 3424369 0.31 + . g652 5 AUGUSTUS transcript 3423914 3424369 0.31 + . g652.t1 5 AUGUSTUS start_codon 3423914 3423916 . + 0 transcript_id "g652.t1"; gene_id "g652"; 5 AUGUSTUS CDS 3423914 3424369 0.31 + 0 transcript_id "g652.t1"; gene_id "g652"; 5 AUGUSTUS stop_codon 3424367 3424369 . + 0 transcript_id "g652.t1"; gene_id "g652"; # protein sequence = [MANKEGENVQDLKSDIAEEAKAKLREAETRKHSEKASEVEQQKKQDLREKTEEIVSGTPPTREWPAGILSVRIEQITG # VEVDNPRQSGSKGTKNGEDGVEEEEGDDMPSPYCTIIINHAKVYKTRTKMKANNPYVSVSADDLQSCSHLDLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g652 ### # start gene g653 5 AUGUSTUS gene 3424416 3425486 0.2 + . g653 5 AUGUSTUS transcript 3424416 3425486 0.2 + . g653.t1 5 AUGUSTUS start_codon 3424416 3424418 . + 0 transcript_id "g653.t1"; gene_id "g653"; 5 AUGUSTUS CDS 3424416 3425486 0.2 + 0 transcript_id "g653.t1"; gene_id "g653"; 5 AUGUSTUS stop_codon 3425484 3425486 . + 0 transcript_id "g653.t1"; gene_id "g653"; # protein sequence = [MIAVRDARMHEVDPLIGVVVLPLQQLFVKRGRSQITDTFPLVGGIGYGRLKCSLVFRSVQIQPSQEYFPKASLGWDVG # TLEVKSETMRASGSLPDDLKSARILLRTLYGRDKALPNSLHDGWHQKKDRPVRLAVKNRFASCLLIQFRKTALGPDKTPAFGTLWLKDLPDLEEVTVR # ISVRRNEGNAMVRGRFNASDDIGEKVGELEMQVRFWPGLSGYHHWLADQDPSLADVMEVLDAAEESEEVSKEMLYEEGLDSDAELMSSSSSSSSSPSS # SSSDESSDVKGGRVKNVKTAIKDYNRRKGDLHRKHRGLMQWGAARKVAWIGRSTENEAKKFKQKLAGKLKHEQRDGGMEKEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g653 ### # start gene g654 5 AUGUSTUS gene 3435167 3435853 0.33 - . g654 5 AUGUSTUS transcript 3435167 3435853 0.33 - . g654.t1 5 AUGUSTUS stop_codon 3435167 3435169 . - 0 transcript_id "g654.t1"; gene_id "g654"; 5 AUGUSTUS CDS 3435167 3435853 0.33 - 0 transcript_id "g654.t1"; gene_id "g654"; 5 AUGUSTUS start_codon 3435851 3435853 . - 0 transcript_id "g654.t1"; gene_id "g654"; # protein sequence = [MASSAPVSSSSTPTTRQGPRHSQHLSPQDKAHLAREWLQYESSGMRLRMAHRFIEWDGWEEGLANSMLGEEEHEESWF # VDVTYYDSNLTSPPMTGNGTHAGSGMQTVGQPFGLDQVAEAAGPSGSGAGPGGGGGDGDQGGESILGSPLTRRKPTSKLKKLPFVSEFEKEQMLDTTG # DICGGRGGELGRRLEAWLTVNGHEPNTSAPIDGPRRRWHNDDVDGVESGEPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g654 ### # start gene g655 5 AUGUSTUS gene 3437234 3437530 0.88 - . g655 5 AUGUSTUS transcript 3437234 3437530 0.88 - . g655.t1 5 AUGUSTUS stop_codon 3437234 3437236 . - 0 transcript_id "g655.t1"; gene_id "g655"; 5 AUGUSTUS CDS 3437234 3437530 0.88 - 0 transcript_id "g655.t1"; gene_id "g655"; 5 AUGUSTUS start_codon 3437528 3437530 . - 0 transcript_id "g655.t1"; gene_id "g655"; # protein sequence = [MEQNLRQLKLDFNEQTEDSPPLEENEGEVLEWDWDIEHADRKAEAKADAALHGALPFEVDRKVLKDVVRENMGAEVVR # IKFLSAGKSSSRYLECRKPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g655 ### # start gene g656 5 AUGUSTUS gene 3440482 3441307 0.69 - . g656 5 AUGUSTUS transcript 3440482 3441307 0.69 - . g656.t1 5 AUGUSTUS stop_codon 3440482 3440484 . - 0 transcript_id "g656.t1"; gene_id "g656"; 5 AUGUSTUS CDS 3440482 3440751 0.98 - 0 transcript_id "g656.t1"; gene_id "g656"; 5 AUGUSTUS CDS 3440821 3441173 0.69 - 2 transcript_id "g656.t1"; gene_id "g656"; 5 AUGUSTUS CDS 3441232 3441307 0.79 - 0 transcript_id "g656.t1"; gene_id "g656"; 5 AUGUSTUS start_codon 3441305 3441307 . - 0 transcript_id "g656.t1"; gene_id "g656"; # protein sequence = [MYVSSVPPNIPEFLEVGYQLAFGDSGQQIRSNLVPTETVNPALASFLNLINLPRIFKKLLSKFYSYKDPIYANLLNVM # HAKTIPEERDLIVKRDQFREAWHEQWAKEGLDFVITVPAPFPAVKHGEGLKASLMTASYSFLFNLLDYAAGSLPVTKVDKNLDALPANFMSSPEYNAM # NMICKTSYTVYDAESMHGLPVGVQIIGQRLEEEKVLEGMKVIQSVLIQKGIAFEGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g656 ### # start gene g657 5 AUGUSTUS gene 3458700 3459353 0.74 + . g657 5 AUGUSTUS transcript 3458700 3459353 0.74 + . g657.t1 5 AUGUSTUS start_codon 3458700 3458702 . + 0 transcript_id "g657.t1"; gene_id "g657"; 5 AUGUSTUS CDS 3458700 3458861 0.75 + 0 transcript_id "g657.t1"; gene_id "g657"; 5 AUGUSTUS CDS 3458955 3459353 0.8 + 0 transcript_id "g657.t1"; gene_id "g657"; 5 AUGUSTUS stop_codon 3459351 3459353 . + 0 transcript_id "g657.t1"; gene_id "g657"; # protein sequence = [MLRDRFKQRCLKRAERARAKAHASKRKSSPNSDVFNVAMDDDMEESDGDLMQDERHAYLRSYYSEVGSSFDPDMEDAA # EWEHELHGMFSLLILFTILDVISVEPEPTQSSFQPVNQDMQEMVEMTPEELEQAELEAYAEECERQAAFADFEDIPYEELFNDEDLLELMTDNKDGRN # QSGDVDMDTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g657 ### # start gene g658 5 AUGUSTUS gene 3461655 3462377 0.83 + . g658 5 AUGUSTUS transcript 3461655 3462377 0.83 + . g658.t1 5 AUGUSTUS start_codon 3461655 3461657 . + 0 transcript_id "g658.t1"; gene_id "g658"; 5 AUGUSTUS CDS 3461655 3462377 0.83 + 0 transcript_id "g658.t1"; gene_id "g658"; 5 AUGUSTUS stop_codon 3462375 3462377 . + 0 transcript_id "g658.t1"; gene_id "g658"; # protein sequence = [MDSWDSSVIDLDEDNFRPTEWINCGKTWPADPPPSLLMARAELLMVPPDAFSPFFPVDPIHISAYHFVNASLPPRSSD # IITGHTDFWFSRDPPSSDVKQLILRSVPPMHFVNQLKVALGSYWLQGNQSIVDPRNGGSDRFPFYVLEFWTQVTEVRETQMRWGQAIKYVERQKHSAP # DSETKVVFDKAWEMLHLIGWNELMPHYNIHTTSFTEFLGPGNELASFLCERERKESNGHSNQPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g658 ### # start gene g659 5 AUGUSTUS gene 3464243 3466159 0.96 + . g659 5 AUGUSTUS transcript 3464243 3466159 0.96 + . g659.t1 5 AUGUSTUS start_codon 3464243 3464245 . + 0 transcript_id "g659.t1"; gene_id "g659"; 5 AUGUSTUS CDS 3464243 3466159 0.96 + 0 transcript_id "g659.t1"; gene_id "g659"; 5 AUGUSTUS stop_codon 3466157 3466159 . + 0 transcript_id "g659.t1"; gene_id "g659"; # protein sequence = [MLLGDSLGKSRPFTFLQKVDLWLRKRFNRKFADKGFLIECGVQRDSFSCGICVANAISHAVFGDTLWCPDLALVHRMQ # WFIDLCADCPSVAAMNSGSPSMSNLLPLTSPLPTQSGSTRLGLADLLNPIASIPSSNYEAGEVSDSDCDADSETAYGSSEDDLAVTGDGQQHNISVSA # TPIVSQHSSRNNSPVSLTLSPFDSRDTSPIPLLPSDVKMRSPSPLSQSHTSSTLKHDRSSSAEIEQEKSKFQKGESRSAVYSSKVRQSQRDGTFVLDQ # VRYTEWKNGLRGLDSAVEYRDNAVDFRHSTCGRWYKAKQAYDLTRARAHIKNCSSKSTKSKAKLAAINSHKVTNFFSSKSSNTPLVGTGLLSKKTMSK # YVVDFLLVPLPHNEHGYSDSARKSVAEVNTPKMVACCGLTAAYDLRIEHYLERTGYPGGGGRSVTEISKELYCQPFSALEESQRRQVIITQELSHTWV # NKHHLTPPTIYSHACTKEIEDTSPQPLLPCIECRAIYKSRIFKNAIRRPKPLDENFIHTNHRYRPAFLGKIYARSIGVRELLEEKSKNTPFVRYALGV # LQGKYDDEVFEGLTRAILMKYNKEERGVGMQNFKYSPAYEDFVNIIRITSPAAYRTFKEWFPAKSVESFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g659 ### # start gene g660 5 AUGUSTUS gene 3466557 3467978 0.8 + . g660 5 AUGUSTUS transcript 3466557 3467978 0.8 + . g660.t1 5 AUGUSTUS start_codon 3466557 3466559 . + 0 transcript_id "g660.t1"; gene_id "g660"; 5 AUGUSTUS CDS 3466557 3467978 0.8 + 0 transcript_id "g660.t1"; gene_id "g660"; 5 AUGUSTUS stop_codon 3467976 3467978 . + 0 transcript_id "g660.t1"; gene_id "g660"; # protein sequence = [MTVQAPRSTPIVLHAMPLGTGLTAEKLEPYTQELIRGLIAWKIQVVSYACDGTEIERKIQALLVEHGDSRIEHIIPPP # KSSGEELKIIIPVFDNQPVAMIQDSKHALKTFRNNLYSGARLLVLGNHTAFYAQAHKLAHDPGTPLYRRDVEKLDRQDDNAATRLFSAHTLQFLADQN # PEWAGIIIYLFVFGELVDAYQSRKINHAERLIMVLRAWYFLNLWDEFLQCAGYKRDLYFLSRQCSDITRIVIEGYISLIFIYRDHLPKLEPLIPHLHS # SETCEHCIGESRKIVKDFCYLDFLYMIPKLHVSVRSAISRAQTANGKARASGYCHTYFDTSGMDPLALASFPDDDQIRADLVPVAFDQADQLMIAVGI # QPSRLRNMRALRQRGVAQIPSISSWYRSETDILLTSEDEHDEHGVGSWNIDSISEAEELQQLLVQSQSDELQWMATQAQLVKIQNLAYAAVALQVDEH # MKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g660 ### # start gene g661 5 AUGUSTUS gene 3468320 3469122 0.31 + . g661 5 AUGUSTUS transcript 3468320 3469122 0.31 + . g661.t1 5 AUGUSTUS start_codon 3468320 3468322 . + 0 transcript_id "g661.t1"; gene_id "g661"; 5 AUGUSTUS CDS 3468320 3468500 0.43 + 0 transcript_id "g661.t1"; gene_id "g661"; 5 AUGUSTUS CDS 3468587 3468685 0.62 + 2 transcript_id "g661.t1"; gene_id "g661"; 5 AUGUSTUS CDS 3468737 3469122 0.63 + 2 transcript_id "g661.t1"; gene_id "g661"; 5 AUGUSTUS stop_codon 3469120 3469122 . + 0 transcript_id "g661.t1"; gene_id "g661"; # protein sequence = [MRNALKEAQEQGLTTGVGRSLRTKALGSKEESPALSGNAANAVAAASSVDKMVSYSGLVYMEARVSSLTPLRVGDFTL # VAANPGDINDIFLAKVLTFYAKGGGKHGKHNAVLDSKSSISAFSYIAVQLFEHSGNNRFTSRTEAGSLLETVSYALLPSIHVLARVQRPDLSSTSDNH # TEVQLGQGDTQLYIDLQGSRDNIFTAIALYKKRSKKDSKENDVEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g661 ### # start gene g662 5 AUGUSTUS gene 3474951 3476051 0.48 - . g662 5 AUGUSTUS transcript 3474951 3476051 0.48 - . g662.t1 5 AUGUSTUS stop_codon 3474951 3474953 . - 0 transcript_id "g662.t1"; gene_id "g662"; 5 AUGUSTUS CDS 3474951 3476051 0.48 - 0 transcript_id "g662.t1"; gene_id "g662"; 5 AUGUSTUS start_codon 3476049 3476051 . - 0 transcript_id "g662.t1"; gene_id "g662"; # protein sequence = [MNKGTSDLASTGDGSTLGVFSVASMGAAPASTYGIFKVSSPSAPATSQAQAGQLLTTDLGMSVASDLVPSVEVTPVED # SRKRNHSEVESEVGPNNSSIGGQAKDTEQVDQHPPPRRKRPSRAKKQEKLEPEEATTHNTYSGYIPPSYMYSSNHMHPSRYYAGYVSTPPNPSAQTAT # TYIPLNSSPASASTSPSNLPTPATPHAAPTYAYYPPHSYMQAPGYHDPYIFSSPSSYPPYTYPYSGLYTYPSHASYTGYGASAYPGYPAYPSQSTEYC # MPDIPLGSNPSKSKSKYAEVLEIRASMKSKEKVGKGNKPLSGEGIAPASDDVPENEVEAKTLQIETRSGPPVTSSAISEVSHIIIAFCFLII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g662 ### # start gene g663 5 AUGUSTUS gene 3476216 3477007 0.98 - . g663 5 AUGUSTUS transcript 3476216 3477007 0.98 - . g663.t1 5 AUGUSTUS stop_codon 3476216 3476218 . - 0 transcript_id "g663.t1"; gene_id "g663"; 5 AUGUSTUS CDS 3476216 3477007 0.98 - 0 transcript_id "g663.t1"; gene_id "g663"; 5 AUGUSTUS start_codon 3477005 3477007 . - 0 transcript_id "g663.t1"; gene_id "g663"; # protein sequence = [MISSSSAGHNEESSTASEVSVDKVETTDAASKNSADKINSPTHTATSVPRDTAVYPYPYPSYHYTTYPHHYTYTNTSA # MSSLVVAPTTVPYSNPYMYPYPYGYHHTSVSSPSSFATSSLPFIISPVPVSASATSVSASASSTKKKRRKVKKEGLAPAEAVASPSSQVVDNDRQDAL # SDATTGTETEAMSGEPQAGSQTSDRRMDVDTNNTSSSQAVCEPSIVDPSEHTAPADDFAFPGSLSRPIPGHPPLPHYQNSLTIQPSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g663 ### # start gene g664 5 AUGUSTUS gene 3477156 3478909 0.43 - . g664 5 AUGUSTUS transcript 3477156 3478909 0.43 - . g664.t1 5 AUGUSTUS stop_codon 3477156 3477158 . - 0 transcript_id "g664.t1"; gene_id "g664"; 5 AUGUSTUS CDS 3477156 3478057 0.73 - 2 transcript_id "g664.t1"; gene_id "g664"; 5 AUGUSTUS CDS 3478126 3478141 0.81 - 0 transcript_id "g664.t1"; gene_id "g664"; 5 AUGUSTUS CDS 3478496 3478909 0.56 - 0 transcript_id "g664.t1"; gene_id "g664"; 5 AUGUSTUS start_codon 3478907 3478909 . - 0 transcript_id "g664.t1"; gene_id "g664"; # protein sequence = [MEKAALIKKILSKDGQGAPSEGSGVGHCATDDAEPSIREEQPETGFPSASPTVISQVPIILDPRILAPQSFPSSSSAL # AGALGPTSFDVNPSEHPAPLNDIHDIPPTPVVNDSVPEPMLATNEGFDTSRCCSVKGCTFSNSHFPDDHVTGILSEGPSDTSDPLLDSSSLGVALNKQ # TMLIPPADMVVSSSTPLPPHMCTVSHCRTVLPGTYLYKRCEKHRVQNRMHGRLRVEREKSGLLPGKGLNHATAHGSEGGIAGETTVDDRDQATDDDDG # DSDNDQIDEDGLDQQLENEDVASINGYNHNTDNGDILDTERRVRQHASKLMMAKIAADRRREKNRARRHKHEAKKVLTGKAPTKRKTATSGAKFDVKE # KDNSNVLTPNIAVSVSVSAEPCTVEEVPNKSKEVLRLEVDVAKTNEMVDSSNDDACTKPSAVSFISNLVAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g664 ### # start gene g665 5 AUGUSTUS gene 3479794 3481877 0.93 + . g665 5 AUGUSTUS transcript 3479794 3481877 0.93 + . g665.t1 5 AUGUSTUS start_codon 3479794 3479796 . + 0 transcript_id "g665.t1"; gene_id "g665"; 5 AUGUSTUS CDS 3479794 3479843 0.93 + 0 transcript_id "g665.t1"; gene_id "g665"; 5 AUGUSTUS CDS 3480002 3481877 0.93 + 1 transcript_id "g665.t1"; gene_id "g665"; 5 AUGUSTUS stop_codon 3481875 3481877 . + 0 transcript_id "g665.t1"; gene_id "g665"; # protein sequence = [MNDRLFSATTLQVCRCITLAQLPPRKHSILFRYDFPFTVQLTLILFVQPSTDFITIDMKPSYSSSGSPYSSGSRSMHE # TSRPYPYFPPRRPIQRSLFADKQNPHTPPESMLFGPLLPQISPTANLHEGTNHTYLPRTNPHHSAKLSPTARATQPQPGNLLSSKASLSQVQPRPQPL # PSPLKSFFDFTVQNLYSGLTHLQSAWNTALYKERKDKEVMRTYLQKMQRERDIALERARDLELKCASASYSVVDAGKAEKRPREDDAEGDYNGCSSNI # QLPTPPASGTFPSSNTVNRHLLNVSPVETDDWCSLVYPNESSVSPSPPPPPISGRQMFFPTDIHLTSSSPDPPPKPLASSFKTPVSNLALPSHSSRPS # RPPSPTGSDQGSVCSSSSSKRRRLSTDSLSSHSSCVTAFETLQDDSLFEGRAPSRSSRDSSAIDMTRRVSNETNSDDSEGECDMDISEDDSNSEMDFG # RESPTPSLGLVGKKLLFNEETVEEVRIPSESLVQGDRTAASFTAVQQKAITSSFKLDIPRLNLQDLNRMYFNYDGIIYCRACWCAILLVPIDLCSVLS # NFYSSRKPHTRWRCSSPLPLMYARQVDLDVLMNHCTSQHPVAYSDVAGLSLDQVFRLQKLLKANVPSNETSTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g665 ### # start gene g666 5 AUGUSTUS gene 3482980 3483180 0.95 + . g666 5 AUGUSTUS transcript 3482980 3483180 0.95 + . g666.t1 5 AUGUSTUS start_codon 3482980 3482982 . + 0 transcript_id "g666.t1"; gene_id "g666"; 5 AUGUSTUS CDS 3482980 3483180 0.95 + 0 transcript_id "g666.t1"; gene_id "g666"; 5 AUGUSTUS stop_codon 3483178 3483180 . + 0 transcript_id "g666.t1"; gene_id "g666"; # protein sequence = [MQAPPLTSFMPLTEKEDGDRELSIDIEFDNEWETLSDWNEDDDEACAEENALCFPDPPGEMAMDLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g666 ### # start gene g667 5 AUGUSTUS gene 3489291 3490149 0.64 - . g667 5 AUGUSTUS transcript 3489291 3490149 0.64 - . g667.t1 5 AUGUSTUS stop_codon 3489291 3489293 . - 0 transcript_id "g667.t1"; gene_id "g667"; 5 AUGUSTUS CDS 3489291 3489538 0.9 - 2 transcript_id "g667.t1"; gene_id "g667"; 5 AUGUSTUS CDS 3489591 3489757 0.8 - 1 transcript_id "g667.t1"; gene_id "g667"; 5 AUGUSTUS CDS 3490013 3490149 0.64 - 0 transcript_id "g667.t1"; gene_id "g667"; 5 AUGUSTUS start_codon 3490147 3490149 . - 0 transcript_id "g667.t1"; gene_id "g667"; # protein sequence = [MDGHRLTPDELADHEHLIMFCLCGKIDGVDHRARIFRAATGVLTGHIEEEEEVASMLSVTNADVSTTSSPPRGSAVQS # PTSSVALSSPTAPVHTTRRYARLSQGIDQQILQSISRPAPYRRRNAFKMLMELDSTNGQGINRAEFMDLFVNCSCGQFMTKWVFDFHVCTPGAGNVID # LTVDDSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g667 ### # start gene g668 5 AUGUSTUS gene 3497697 3501722 0.95 + . g668 5 AUGUSTUS transcript 3497697 3501722 0.95 + . g668.t1 5 AUGUSTUS start_codon 3497697 3497699 . + 0 transcript_id "g668.t1"; gene_id "g668"; 5 AUGUSTUS CDS 3497697 3499133 0.95 + 0 transcript_id "g668.t1"; gene_id "g668"; 5 AUGUSTUS CDS 3499254 3501722 0.95 + 0 transcript_id "g668.t1"; gene_id "g668"; 5 AUGUSTUS stop_codon 3501720 3501722 . + 0 transcript_id "g668.t1"; gene_id "g668"; # protein sequence = [MNIGYFTQHRRASGSALGSHIIHNGLTASPQSANISPVSLHRVPASVGGPNFPGLGPSEGYAARSSVNNEHATHPHMS # PRQTHRAPPAPTSSAQSQHALPTPSKPFVPTPPLTTAQLSQGLHLIPSYPSHPAHLTSSNSASTAATAQTATQAILSTTQRTLEHTWNTILTSVDSEV # AKLHTAHAGQIRVWADYVDGVRKESDAYKLRMESFQRDADRIRREREMYRLKSRDLENQIDEIRRRAESQRRPEVPEPVAHSQIELQEGRRKYEDQED # GSHDTEQTSNDLIDRLRRERDDLKMQVAGLATGSHPQNHSRSHSEHLQKLQNEHLSLSASYNTLLNAHSQLQATHTSLLATHNHLQITHTELRSTYDS # CQTTYTALRREFEDLLEREEKARIKLGIAEESLKGERERAFELDEARKREKKGRKEREKEVEELRGKVYDLERHSTNGVRKETPDTFKETGPEENRTD # SGQSQHEFQIATPIRPPSPQLRRSPHRQDVVNFDADDSVLPISPPPTGPSMLSPQPFSPPVRPTLPTSPPRRVDHPVASTSRQFPETRNDPQNECQDR # RSRSVMSAEDLSGSLHREPESGHDRSAYLRPSSNAPSVVMCPTGSNVPSLAGSKASSPIRDESEIVNSFTKTPSPLLLPVEPVTLVMTPMARKESRSP # FTEYRPLPRSDTQEWQQDLDVYRPLSTPDNPYQKTDFLRQDLNSPTSARGPSLGYGNEEKAPESLFQVPTSRSRPASTSYSQAPSRPQSAAESPRPSS # PSVLLESGLSTVAQGHDDSQKITTTGRSSRSVPRLDMGVLDQNPATNTKSISNPDSGNPMSTSPVVTLSPSSNSSLLHNQWKQLKTEAATRDIGVIKG # QDRQEMTKVDLSDEVEEGEERESARIVENPQRPDSIHRLLSPSPFTITPYGNNSHHDQRQRGSVHVHPDSSSTSSRPWLATSVEHRRTYASSPNSSPR # LHGTHITPYDSGIANGYLSRNSINHLKRKGNGNDERDLSSSASEHLYPRDIDHSHPQPHKLVKVMRDGQVVASPVDFDSRNGMFVERRRDGRMERYGE # LSYPQLHTPSYAYPSVKSQGSTSHMNGMHRLSQRSSTPPQSAIPMSISPVSPSSPVAPAPLSQPNPKSTVEQSHQGHHSTAPPTDSHENLDTPTNAKP # SSKRILITPSHAHPVQPYPGLPMKPVDSAIQLHPGLPKKPFFEPVDTSKQRTNEKARSDGWRNASNSYPGRSGSDGWYTSTIDTNGSGTWKSWATAPP # ISNGHGQDQTDQNTSGPGVAPIKQLSFKHIDLLYETIGGEYVCRECR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g668 ### # start gene g669 5 AUGUSTUS gene 3511412 3512542 0.52 + . g669 5 AUGUSTUS transcript 3511412 3512542 0.52 + . g669.t1 5 AUGUSTUS start_codon 3511412 3511414 . + 0 transcript_id "g669.t1"; gene_id "g669"; 5 AUGUSTUS CDS 3511412 3512542 0.52 + 0 transcript_id "g669.t1"; gene_id "g669"; 5 AUGUSTUS stop_codon 3512540 3512542 . + 0 transcript_id "g669.t1"; gene_id "g669"; # protein sequence = [MQLFDECKDGLILCKLINDSVPDTIDTRVLNKPSGRKPLNAFQITENNNIVITSAKAIGCSVVNIGSSDIAEGREHLI # LGLIWQIIRRGLLAQVDIKLHPELYRLCEDGETIDDLLRLTPDQILLRWFNYHLKAAGWKRRVNNFSRDVSDGENYTVLLHQLQPASCSLSPLQTPDL # RNRAEQVLQNADAIGCRKYLTPSSLVSGNPRLNLAFVANLFNTYPGLEPLDEQEAKDYGVVDDFDAEGEREARVFTLWLNSLGVEPGVFNLFENLKDG # LIIIQAFDKIFPGSVVWRRVSKPKEGAGHASWAPSGDGDDEDVDIGVKPNQSTLSRFKAVENTNYVVELGKGHGMHLVGIQGADITDGQKTLVLGLVW # QLMR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g669 ### # start gene g670 5 AUGUSTUS gene 3517813 3518691 1 + . g670 5 AUGUSTUS transcript 3517813 3518691 1 + . g670.t1 5 AUGUSTUS start_codon 3517813 3517815 . + 0 transcript_id "g670.t1"; gene_id "g670"; 5 AUGUSTUS CDS 3517813 3518691 1 + 0 transcript_id "g670.t1"; gene_id "g670"; 5 AUGUSTUS stop_codon 3518689 3518691 . + 0 transcript_id "g670.t1"; gene_id "g670"; # protein sequence = [MVALTRAQAKRAAAAASTSTTAAADSQTPTKKLGLRNHVISSRTKTSGTPGAGSSQCPTKQGPLASKKKTPRRPATPA # FTAVESSTEPIQHPKTLESETITHIPTETHPFAEPDDAEPFGSEIGWVRIGNSLRRESVLPEGVMSQIQAQQQAKLTHLADEAYKEQTTEMMQQHNLT # YQWYDRMMTEGLQNGQGSNGSVMVMGDTSDIAMKDDHDLVGGFNGNSDEKDCEMEIPYYLAIESDTAEASSFDDTMSGAESDCLNVVLFGKKQLQPCP # PGVRYSLLSTPTEIIPQY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g670 ### # start gene g671 5 AUGUSTUS gene 3524524 3527835 0.91 + . g671 5 AUGUSTUS transcript 3524524 3527835 0.91 + . g671.t1 5 AUGUSTUS start_codon 3524524 3524526 . + 0 transcript_id "g671.t1"; gene_id "g671"; 5 AUGUSTUS CDS 3524524 3527835 0.91 + 0 transcript_id "g671.t1"; gene_id "g671"; 5 AUGUSTUS stop_codon 3527833 3527835 . + 0 transcript_id "g671.t1"; gene_id "g671"; # protein sequence = [MSTGMCLDSCLKDIQPIFYYGAVDSQLLYQLEPEDDAGDVSTNSASSVYPSPYEVDLVNLPPMTFKPGRRTDDFDDFG # SSEVDSDEEIDGRNKVLYLSSFTLLRRFQLISVQPLPAPPASTTLLSPESHGLLASNSPSNISHIPNFSTSTVSSYTTASSTSSVPVTPITPNTPVTP # FLSTSPVFPSSTSLSRASSFSRTQSPTVAYSHSGPGIRSRQPSIVSLAGGYHLPTMVAGKNSPTIGHKSSLPLLNDTDIDADVDPDVDGYFSRVSGET # NRPAARLTRQPSLGSRPGLDFRIPLGSTLSSPLGSEALSAGVMRRYASAGNLFSTSLSRPGSSNSGHQHSYSHPTSFPTASTPLSPYSSAPSPFPDPS # LEIIPSATSRAGSSAVPASDSRNRSRAGSTVLRNAVYIEALDSSEVERRLLNLPSVYDRDHPEKEYSDPSASEREQDNIDFEQSKWSPASSVVDLRSL # GPKISTDVSSNLNWGLPKMMGVHAPPPTPSTPFSASRSGSYIGLADAGGLISPTADDVPKRNYLSLNITKRKSLNAVSASSIPSPSSPSQSQSDLKKS # QGEDMSVPPVTPGRRQRLASFIARMAGNTASQIPPVPLTPSASLPVSPANAAPSVPSAPPSPTKFRTTQYRPAPLDLSLKPKNFSTIDSGSTAGTSEP # STPAYSGSTSSWNDDSGSETETENEEDMEDMDPDLIAVAAGLDLPSAPISPRTPRPRPSSQTSTSVSGERGSDFPSTPTSMDDDTQMVRGSYAQVYGF # RLPKAPSSPLAAQSFTYLPSTHSQIESSVPRGATPTLVGTQSLIGPGDLPPSVGSPKTPRNRKISMINTSTSTTASAVSQPPSSPPRMPPSSPPRQLL # KSPNKVPKTKGGRMSGLISRFTLGSSTSLAVSPHSMSPDSVPPVPPLNVDELGQVVSDPFAKDDLTTINTTAPARTLSSVDSVTLSSVLNSPVVLSNE # VNAGIIITRRERSGTTATATSTFSSSTADSSNSTSNSSPERQSLAKKKRRSLGLTLGTVSIGSMGGMRSPTKGINRGKKRKLVISGIESDDSRAYQAV # KIWCESFGELKKFERQPNGDLVVDWRNRSVSDMVIHPFFCADSKC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g671 ### # start gene g672 5 AUGUSTUS gene 3534121 3534618 0.99 - . g672 5 AUGUSTUS transcript 3534121 3534618 0.99 - . g672.t1 5 AUGUSTUS stop_codon 3534121 3534123 . - 0 transcript_id "g672.t1"; gene_id "g672"; 5 AUGUSTUS CDS 3534121 3534618 0.99 - 0 transcript_id "g672.t1"; gene_id "g672"; 5 AUGUSTUS start_codon 3534616 3534618 . - 0 transcript_id "g672.t1"; gene_id "g672"; # protein sequence = [MSSTTSASNGALQSGGSKVSSPSTSSIPQSAPAGLLSMTQPPQASTSFFKIASGEVVTFAWSFSGVLATPTSLTVNAV # GANSFTYSLTSLPGTASSYIWTPYDYQQSHLATPLAQTTYTLEIFDERGLGATIRPGYLSPNTALTFALYTPQPYTPLASASIFIQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g672 ### # start gene g673 5 AUGUSTUS gene 3536994 3540875 1 + . g673 5 AUGUSTUS transcript 3536994 3540875 1 + . g673.t1 5 AUGUSTUS start_codon 3536994 3536996 . + 0 transcript_id "g673.t1"; gene_id "g673"; 5 AUGUSTUS CDS 3536994 3540875 1 + 0 transcript_id "g673.t1"; gene_id "g673"; 5 AUGUSTUS stop_codon 3540873 3540875 . + 0 transcript_id "g673.t1"; gene_id "g673"; # protein sequence = [MALSVSGLYSPSLEKSNSEFLGSNSTTPSPTSYKSPAELASLVHPNLSETNERQTAAVVSNDYPFHQRSPPPSELKEE # LTRGRRRGQSASARPTLRLHIANPTEPLDNQLNDTQEKAMKSTIQMLQAKAQTAQTLYPRSVVAANSDIHNRRRGETVSDFSRTIHPGSSAPGSGNSL # ITGHMLTNTGSEPAPATVFHSGQVDTRTASSSLIRITTANLNFSAAAVAPTPNSSSPNSTPSSSGSAKNITTKRPYRASPLIGPQAMMSATSGTNSSV # STAPTAIFAEDHYSSASSTSASTVSTPATQESASEFTSRTLSGANVGVSGTRRPLPVPPPSSTIGSTMLSVAPSKAPLSPPIPPPLHPLHIPTRSLTP # SATLSHGPKPLQHGFGHERSSSGDLDLKTNTNDRIAAELAYRMEKRRGKQPMRGETAPNSPTVGIRVREEDEVPYELRSEKWRGKQKMQNNIQDTTSF # PQQFISPNDDNVTDLISPPLRPPNEANILNTHEVGLPPSLSGTLTNQPSRASIASSHSSTRSSGNERGVSKWKGKGKQVLRTLSISSISSLEKDAGGK # LSKYAQSSGRGMEVRKSGDFSSFNANDTFQADSPASSFSASPVVPPPLSMPTPVPSPASINLTSHPSALIPGGYSNIRVNSPRLMGNIGFDSRSTSPR # AVAWAPTPPLPMYVEPPLPLNIRKIISPVTSPTIPLLPPTLPPKDYNYKQQQPILQSNAQDQAPMHIHPFDNDDSDDEGNRLFKDVEAVYVSPTTYSA # RTEATDRPVDMGWGYAEPGYEDDERVYVDDGYDDPNNPGLVDALDREFGFGVSASGQLVNGGGVVQSSSNIAQGSVTHGGFSSSRISIAKERSPSPMR # YARRRRDSLLEDDYDSPESNSVQSPIEFASIPSPGSSQAQSRSLSPAVLEGFVYVENNASPLASTATQILNSLDSRRPLSPPSSSPPALPRSDVDIRG # RQPTRRQNYFDPAQMLGDELEMSFSKNPSPTRYHPTKGVYQVGALAVLAEDKVYVRGKWRMRSPSPGLSPISPTGTNSVAINKAALVSGQGGGLRRYA # SEESLLSAVIPSEKDNHIAGNFNGFAPLRSSGFEEFNLAAPNPGFASKRFVDRVPTPDSDSASFNPNASKKSLSSQDHGNGGGSSSGRHTPILRGPGS # KPEHADDFGFGTGWKTALEHSRPARKSRGPLERDSDKDSIGRGREPGGQGHTSGRRPAKLEKKRSLKRGLSLPRASGGSDNVGGGIEGDMKRSGTSVA # HQRHLQPSEHISYDLWVERGLDQTSAAVKGKKTIPPSKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g673 ### # start gene g674 5 AUGUSTUS gene 3551117 3551545 0.62 - . g674 5 AUGUSTUS transcript 3551117 3551545 0.62 - . g674.t1 5 AUGUSTUS stop_codon 3551117 3551119 . - 0 transcript_id "g674.t1"; gene_id "g674"; 5 AUGUSTUS CDS 3551117 3551545 0.62 - 0 transcript_id "g674.t1"; gene_id "g674"; 5 AUGUSTUS start_codon 3551543 3551545 . - 0 transcript_id "g674.t1"; gene_id "g674"; # protein sequence = [MQRDMGFGECRKKKEVTSDSTLAIVLGMEQLWEGIQPDFGSKKMKDKIPEKMVEAEKIAEGAPESAAEKIVGGAPDFA # AEKIVGGAPDSAAEKIVEGAPHSAAEKIVGGAPDSAGTMLETAKQSQMEELSIECACQVRSTYI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g674 ### # start gene g675 5 AUGUSTUS gene 3552654 3554086 0.27 + . g675 5 AUGUSTUS transcript 3552654 3554086 0.27 + . g675.t1 5 AUGUSTUS start_codon 3552654 3552656 . + 0 transcript_id "g675.t1"; gene_id "g675"; 5 AUGUSTUS CDS 3552654 3552723 0.37 + 0 transcript_id "g675.t1"; gene_id "g675"; 5 AUGUSTUS CDS 3552813 3552934 0.92 + 2 transcript_id "g675.t1"; gene_id "g675"; 5 AUGUSTUS CDS 3552989 3554086 0.67 + 0 transcript_id "g675.t1"; gene_id "g675"; 5 AUGUSTUS stop_codon 3554084 3554086 . + 0 transcript_id "g675.t1"; gene_id "g675"; # protein sequence = [MFRNDCDAKLDTHALEAGAMEESSVIAQSLMRPASEELDDHLLHSPLIGPNALPREPSSPPPAPIQNSSITDRLLPKK # LWAERWIQPPPLGFIPIFFDDERVHAIFKTASEIQREGIVSPGLQVKGTNEQELAAELIVLMRTSIQSGDWTKILSPDRHFMQYVKLSPLPMKIIEPC # YNRVDDQDNYVSSGPGLEQSTMTEVFHQFFEEREDEFCTTLYEDYTTLQCMDLQISPSKHEELVLFGAVTALALVYGHYPGHLNPLLLIYLLNNCDLS # CLHRDLVSSYLPSVSEMLDRWLNLGPTDSIGEFASHFASYHNIQVQYLYRILSMNFMTLIIFYRQVGVLNGRSEAGHQKLASEMLHNVVIGPVGVENA # YFAAFIKGFLLPGATGFTLADVSVTYMDIFSNSMLSFRLCAASLEDLKNLFELPKHQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g675 ### # start gene g676 5 AUGUSTUS gene 3557043 3557294 0.51 + . g676 5 AUGUSTUS transcript 3557043 3557294 0.51 + . g676.t1 5 AUGUSTUS start_codon 3557043 3557045 . + 0 transcript_id "g676.t1"; gene_id "g676"; 5 AUGUSTUS CDS 3557043 3557294 0.51 + 0 transcript_id "g676.t1"; gene_id "g676"; 5 AUGUSTUS stop_codon 3557292 3557294 . + 0 transcript_id "g676.t1"; gene_id "g676"; # protein sequence = [MIAPIVGRTATQCLERYQKLLDEAEAKDNEELGLTGPDGDAGPSADNVRRLRPGEIDPDPETKPAQPDPIDMDEDGQS # ARPYC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g676 ### # start gene g677 5 AUGUSTUS gene 3558355 3558996 0.49 + . g677 5 AUGUSTUS transcript 3558355 3558996 0.49 + . g677.t1 5 AUGUSTUS start_codon 3558355 3558357 . + 0 transcript_id "g677.t1"; gene_id "g677"; 5 AUGUSTUS CDS 3558355 3558996 0.49 + 0 transcript_id "g677.t1"; gene_id "g677"; 5 AUGUSTUS stop_codon 3558994 3558996 . + 0 transcript_id "g677.t1"; gene_id "g677"; # protein sequence = [MSVGSTPLRTPWRDNLSINPDGFPSIGDTPREQRLQAHSAKRALQTGFMNLPKPENNFELLVPEEENEGGDGEERGLL # LSEEDAEERDAKLRRAREEEEKRILSRRTQVVRLGLPLPANFDAATLLEHLSRYDDVEEGELGAAQKLGDAELASLIQHDSLEHPIPGTSRPGGAKST # YEIPNDESIHAAKSLIHLELASLVGFPEANVDQVRKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g677 ### # start gene g678 5 AUGUSTUS gene 3585268 3585972 0.97 + . g678 5 AUGUSTUS transcript 3585268 3585972 0.97 + . g678.t1 5 AUGUSTUS start_codon 3585268 3585270 . + 0 transcript_id "g678.t1"; gene_id "g678"; 5 AUGUSTUS CDS 3585268 3585972 0.97 + 0 transcript_id "g678.t1"; gene_id "g678"; 5 AUGUSTUS stop_codon 3585970 3585972 . + 0 transcript_id "g678.t1"; gene_id "g678"; # protein sequence = [MASSHKSRHSSAPITRTDTPPGELKVPAAPSSFKRTIDLPPDLDDYPCHDPMADLEADDDNIEMQQYLEHIYMTSKLT # PDNSGAARDYGFSESLPIETRSDSRSAHNLKHKLKDGTSKGGSDRHRNHSHRFEAATSSSGSTTTKYATPPTTASWVQGTTWNDEDTNSPQLKGFSSL # LSNQPGELDELDIGLVRPDEQWNYETTTDDHMDIPFPVPLSGSKFDGKRKGKGKDLGW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g678 ### # start gene g679 5 AUGUSTUS gene 3587740 3588954 0.29 + . g679 5 AUGUSTUS transcript 3587740 3588954 0.29 + . g679.t1 5 AUGUSTUS start_codon 3587740 3587742 . + 0 transcript_id "g679.t1"; gene_id "g679"; 5 AUGUSTUS CDS 3587740 3588954 0.29 + 0 transcript_id "g679.t1"; gene_id "g679"; 5 AUGUSTUS stop_codon 3588952 3588954 . + 0 transcript_id "g679.t1"; gene_id "g679"; # protein sequence = [MTVNGLPDNYEGHCKILLNDRSDLVSTRNILILYALLRHGNPPELAAETAVHLMYSAALRSSDSSELFHCIKTVYGDV # MSVYQSPMFVSFISRLSPNDVRKKSFPIRGAGSLSIAQSAVKIFGEPLAMLRATHTLNDSRKAMHDVMLSPHRVDYRDRYLSGLQPSHRLSFLRFRES # GVLLHFADHVGSETFQDPNRYVSFLALSSSSLRLPFFRLLFTASGKWVTMDNANPLSSWDVNEVLKTGQAYGLDHADIYGCLFFHVKAQFTEFARRVE # KFHIDIHVSQLDAHVASGLLQKGELNPDLFGINPAFDRIETSNIADYAGIPSILQDWSAVLNRENKHAVVLVYLMNWVMKRPGASFSMMGEGMGLNLK # GSTNVKVLLERTSSMLVRLNSYEFPILICTIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g679 ### # start gene g680 5 AUGUSTUS gene 3590825 3592250 0.56 - . g680 5 AUGUSTUS transcript 3590825 3592250 0.56 - . g680.t1 5 AUGUSTUS stop_codon 3590825 3590827 . - 0 transcript_id "g680.t1"; gene_id "g680"; 5 AUGUSTUS CDS 3590825 3591028 0.59 - 0 transcript_id "g680.t1"; gene_id "g680"; 5 AUGUSTUS CDS 3591087 3592250 0.56 - 0 transcript_id "g680.t1"; gene_id "g680"; 5 AUGUSTUS start_codon 3592248 3592250 . - 0 transcript_id "g680.t1"; gene_id "g680"; # protein sequence = [MRLLGESLGVPIHVFGPETHITAIVPLALGLVKAGDTAAPKSVSQTAPATPPAKATEIAAENPPVGSIGPDGERTQIN # DQIVHFDSVSTSSAGRPWYRPFDSNTRSFVYGLQPRAIQGMLDFDFSCGRSTPSVAAMIYPFGGHHIQKFYWGTKETLLPVYTSVDEAFKDNKHTDVD # CVVNFASSRSVYSSTMDMLRHPIHSQRIKSIALIAEGVPERHSREILYEAQQKGVLIIGPATVGGIKPGCFRIGNSGGMMDNIIASKLYRAGSVGYVS # KSGGMSNELNNILSFTTNGVYEGIAIGGDRYPGSTFIDHLLRYEKDPECKLMVLLGEVGGVEEYRVIEAVKQGKITKPIVAWAIGTCAGMFKTEVQFG # HAGSLAGSDVETAEAKNRAMAAAGFIVPPTFEDLPDTISKLYQSLVQKGTIVPQVERDPPVIPMDYKWATELGMFFDVPEPIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g680 ### # start gene g681 5 AUGUSTUS gene 3592282 3593502 0.6 - . g681 5 AUGUSTUS transcript 3592282 3593502 0.6 - . g681.t1 5 AUGUSTUS stop_codon 3592282 3592284 . - 0 transcript_id "g681.t1"; gene_id "g681"; 5 AUGUSTUS CDS 3592282 3593502 0.6 - 0 transcript_id "g681.t1"; gene_id "g681"; 5 AUGUSTUS start_codon 3593500 3593502 . - 0 transcript_id "g681.t1"; gene_id "g681"; # protein sequence = [MLLNEETGLLTSEDALPAWTKESGVKFVAKPDQLIKRRGKAGLLALNKSRQEAVTWIKERAGKVQKVESVEGPLTSFI # LEPFLPHPADSEYYVCINSDRSGDTILFTHEGGVDVGDVDAKALKLLIPVPTAAAPQTFPGKKAVINTLLSHVPTQARKDALADFIIRLYSVYVDLQY # AYLEINPLICMENSVGKVEIHYLDMAAKLDQTAESIVGQKWAIARDLAIYEGIASSGSGKVTADRGPPMAFPAPFGRSLTKEEAYIQKLDASTGASLK # LTVLNAEGRVWTMVAGGGASVVYSDAIAAAGFANELANYGEYSGAPTEGQTYEYAKTVIDLMTRGAVNEQGKILIIGGGIANFTNVAATFKGIIRALK # EYKSPLIRAKVSIYVRRGGPNYQEGLKVCTTYNC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g681 ### # start gene g682 5 AUGUSTUS gene 3594908 3595816 0.46 + . g682 5 AUGUSTUS transcript 3594908 3595816 0.46 + . g682.t1 5 AUGUSTUS start_codon 3594908 3594910 . + 0 transcript_id "g682.t1"; gene_id "g682"; 5 AUGUSTUS CDS 3594908 3595816 0.46 + 0 transcript_id "g682.t1"; gene_id "g682"; 5 AUGUSTUS stop_codon 3595814 3595816 . + 0 transcript_id "g682.t1"; gene_id "g682"; # protein sequence = [MYSPLVASAQRTHLLQQNSPLRNSVDISILSEFPLLLSGNLRLNVPVYTVWGACEDIVIMEKFRAKTYEVPNLNILDE # ATTHLLDLGGVKLRLLGLGGAVVPHKMFDNGDGSATIAGGQGTMWTTTLQLGELVDTAQRVHDPSETRLLVTHASPGREGIIAQLALVCKADLTISAG # LHFRYSTSWNEFSVLADYEGFRRKLLLGKETFDKVWESVKAQVDVVVDENQRVLLDKALNVVERIPPPIGPGGAPTGVTTAKEALAAQDEPMWKNCWN # WNLCDAAYGSLILDVREGRVSAELKSQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g682 ### # start gene g683 5 AUGUSTUS gene 3597691 3598155 0.98 - . g683 5 AUGUSTUS transcript 3597691 3598155 0.98 - . g683.t1 5 AUGUSTUS stop_codon 3597691 3597693 . - 0 transcript_id "g683.t1"; gene_id "g683"; 5 AUGUSTUS CDS 3597691 3598155 0.98 - 0 transcript_id "g683.t1"; gene_id "g683"; 5 AUGUSTUS start_codon 3598153 3598155 . - 0 transcript_id "g683.t1"; gene_id "g683"; # protein sequence = [MVILVVGLKPHRKLWTTSARPEESVINYILLNGCPAIVVPVKVGAPLIAWDALTLEQLWDVEIPSTDDAPSASGKFEG # IVNVISEFLDLCVDWGRIEIQGDRDHDLMTGAEQDKDKVRNALRLLVAAATRSKDSKEVKKEVDADRAGIAMWRIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g683 ### # start gene g684 5 AUGUSTUS gene 3601238 3602351 0.57 - . g684 5 AUGUSTUS transcript 3601238 3602351 0.57 - . g684.t1 5 AUGUSTUS stop_codon 3601238 3601240 . - 0 transcript_id "g684.t1"; gene_id "g684"; 5 AUGUSTUS CDS 3601238 3601403 0.99 - 1 transcript_id "g684.t1"; gene_id "g684"; 5 AUGUSTUS CDS 3601456 3601667 1 - 0 transcript_id "g684.t1"; gene_id "g684"; 5 AUGUSTUS CDS 3601717 3601952 0.71 - 2 transcript_id "g684.t1"; gene_id "g684"; 5 AUGUSTUS CDS 3602013 3602215 0.85 - 1 transcript_id "g684.t1"; gene_id "g684"; 5 AUGUSTUS CDS 3602335 3602351 0.81 - 0 transcript_id "g684.t1"; gene_id "g684"; 5 AUGUSTUS start_codon 3602349 3602351 . - 0 transcript_id "g684.t1"; gene_id "g684"; # protein sequence = [MVVLREKLIPACYSIAATGVPVFAWKGETEDEYNWCIEQTIKGFSGGQPLNMILDDGGDLTTMVHEKFPELLPGIRGI # SEETTTGVHHLYKAFREGKLKVPAINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGFGDVGKGCAESLRSYGARVLITEIDPINALQ # AAMAGYEVTTMEDAAPRSNVFVTTTGNRDIITAAHFTVMPEDAIVCNIGHFDIEIDVAWLKANAKSVSNVKPQVDRYTMSSGRHIILLAEGRLVNLGY # VYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g684 ### # start gene g685 5 AUGUSTUS gene 3604655 3605509 0.75 + . g685 5 AUGUSTUS transcript 3604655 3605509 0.75 + . g685.t1 5 AUGUSTUS start_codon 3604655 3604657 . + 0 transcript_id "g685.t1"; gene_id "g685"; 5 AUGUSTUS CDS 3604655 3605509 0.75 + 0 transcript_id "g685.t1"; gene_id "g685"; 5 AUGUSTUS stop_codon 3605507 3605509 . + 0 transcript_id "g685.t1"; gene_id "g685"; # protein sequence = [MSPQQSDVQLASMSWHQSQMSINETSDLSLYPGVAGDIPYHYSSDADHGGFPSGTPSSSTAIYSYDDTTTPIGDATTY # NDSTSHSLASVECLHRKIAELEERHHHDQEHIRVLQAQLASTSSRNTDYPYSPPASAFFKASWAARTTARTKYLCSLNRAGNALCAWHDSRRERRAYP # PRNAPKDTLNCGCTYEEALFEESLSRHKVGSYLPGESVRMDPALRNPLLQLLKHRYGYQDGDFERDPFTGDWVSEDGHEEGHEHWERLLASGVNPRRA # RGEQHRNTPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g685 ### # start gene g686 5 AUGUSTUS gene 3606015 3607530 0.46 + . g686 5 AUGUSTUS transcript 3606015 3607530 0.46 + . g686.t1 5 AUGUSTUS start_codon 3606015 3606017 . + 0 transcript_id "g686.t1"; gene_id "g686"; 5 AUGUSTUS CDS 3606015 3606170 0.53 + 0 transcript_id "g686.t1"; gene_id "g686"; 5 AUGUSTUS CDS 3606273 3606752 0.97 + 0 transcript_id "g686.t1"; gene_id "g686"; 5 AUGUSTUS CDS 3606823 3607530 0.89 + 0 transcript_id "g686.t1"; gene_id "g686"; 5 AUGUSTUS stop_codon 3607528 3607530 . + 0 transcript_id "g686.t1"; gene_id "g686"; # protein sequence = [MDKLVDILAAFDAGKLPSHHQVNNFLEWLKKDIISDGAFSTQGHIVAQRLRDEAIWHLSQGDLSDTSVDVNIKPNTDE # ALKDAQDARESIRTILSIIWSGLSSEGSSLFEDFTSFARLSLADAAEVVENQASRAKDSLREVDEEVQSGKRDTLGRDKERLKQEEDLQVAFEHGMDT # VKGAGSSVIGAGQKSVAKASELSDRTSAKLHNAFYKNDEEYHRSLDTLFSTVQKWISRGFNSATNAASSLDSLVDDNTTDKHITKALQAIETLLSRLA # HTDSLSKLVSTIRKCAVDIRDDQDLRSWFDDFFTHLHRDLDESGYIRSDENKRVRKDLRIRWKDMLDQDSEFGRTWKNDVEAMKGQIQKIQNGLKSDE # DLNRLRDAHLKLGEAIETGLIEVGDQAQTGMQAVVEQLTWFWQDLFRVYLPRALSMMKDVPIPRYSIITPWGTLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g686 ### # start gene g687 5 AUGUSTUS gene 3607624 3608754 0.94 + . g687 5 AUGUSTUS transcript 3607624 3608754 0.94 + . g687.t1 5 AUGUSTUS start_codon 3607624 3607626 . + 0 transcript_id "g687.t1"; gene_id "g687"; 5 AUGUSTUS CDS 3607624 3608754 0.94 + 0 transcript_id "g687.t1"; gene_id "g687"; 5 AUGUSTUS stop_codon 3608752 3608754 . + 0 transcript_id "g687.t1"; gene_id "g687"; # protein sequence = [MYIRNITDIDIVAPASAPDAPVQPESKTQLGTLTQIRIQAIQLAVSDISFYYKDKTATIGPAEYTGRLSLTLPPKGID # VDVKMRLIPASATTTLAPVSSSASRNAKVTPGSSLTNHPVPAPLATATKTVSQRSLHRAFHVIEHLDVRITDEFELDIKDSNHGVMIAMFKPIMALRL # KSALEGFVAEHLRQIFEGLDGLAYDISERAEVFKDTGLGSGASIGAAVWSEVGRMKRLGLDSRRRGQYTDWQATGTGVVAAERQVDLETGEDKERERK # FAMGAEPQILSGEKKGPDGTASESLSKRLRSATGQALDDTGVNVDAEAMPNVTDTKQIAEQAKEIFEEGKDQVKSFKDTVKHKSDVEKHREGWQSSSF # DIKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g687 ### # start gene g688 5 AUGUSTUS gene 3610979 3611689 0.42 + . g688 5 AUGUSTUS transcript 3610979 3611689 0.42 + . g688.t1 5 AUGUSTUS start_codon 3610979 3610981 . + 0 transcript_id "g688.t1"; gene_id "g688"; 5 AUGUSTUS CDS 3610979 3611689 0.42 + 0 transcript_id "g688.t1"; gene_id "g688"; 5 AUGUSTUS stop_codon 3611687 3611689 . + 0 transcript_id "g688.t1"; gene_id "g688"; # protein sequence = [MYAYKDVLELAGVTERLYSLVSSLYAVKPVSTGSNFPSSSGDITNNIIGLEHVDIGTPAQGTSLNESHILSDSAESVH # VKSQSVLIRDLSLWLREGSGEHLMITGSNGVGKTAIARVLAGLWGPSNENGKVFRPQSLMVVPQRVYMPVGTLLDQVIYPDSYADFLEKDMSIEHRGG # GSGNNIRDILESVFLSYLPEREGGWSTRKEWRDVLSGGEKQRVSCAGSVLVIVMEPNVHG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g688 ### # start gene g689 5 AUGUSTUS gene 3615126 3617225 0.67 + . g689 5 AUGUSTUS transcript 3615126 3617225 0.67 + . g689.t1 5 AUGUSTUS start_codon 3615126 3615128 . + 0 transcript_id "g689.t1"; gene_id "g689"; 5 AUGUSTUS CDS 3615126 3617225 0.67 + 0 transcript_id "g689.t1"; gene_id "g689"; 5 AUGUSTUS stop_codon 3617223 3617225 . + 0 transcript_id "g689.t1"; gene_id "g689"; # protein sequence = [MATIHDHIRVKFGAGFSVQEVITGFETPWLYVNNIPSNVSQDEVTQLLSKHGTVQDFRSETGNQRGTLRVRVRFSSDI # EARNANIILNGTRQWGSLISTQLPVNTAHGRGATLQNTAVRIEWEAPSIIGYAGYPTEERAKEAIAIAKTAYYETYISAHMYSGLPQMAAYTVRFLNL # PVHTKKEQMRKYSKPLDMMWDVPNYTSVDEVATFLRRKLESNGIDIISFEVLPPPYRDGRVKAWVHFPTPVAAKAACQLLHLRKPICTGRTRIFAYHV # QSLSYSILLEHYKKIQDDILLFRERLRREVQGTTFTVIPGASSVTIRLSAINGKDLGNLKAEFEHLRGGEVVKHDGEVLWDRFFGLPAGKSYLRRLEI # AHLGIAIREDAMRRRLTLFGQSALREVVKAALTEKHNELLVAEKRCLFLGPLIGPFIHSEFGSLSQRLGPEKVVLDMWNRQLVVSGKDHDFRVALQAV # QKIQRRQHPHLQRDVASCPVCLGEVDCPVTLPQCKHSYCRACLISYLQAAIDGRFFPLTCLGNDDNCSSPLSISLARQVLSSGEFDSLIEAAFEAHIH # ERPEEFHYCPSPDCMQVYRPAPSGNILQCPSCLLRICPQCHVEQHDGFECPDRDGGDHLFNEWARTHNVKNCPSCRVPIERAEGCNHVTCIRCRTHIC # WVCMQTFPRGDGIYNHMRAEHGGIGNAFDDDGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g689 ### # start gene g690 5 AUGUSTUS gene 3619140 3620522 0.99 - . g690 5 AUGUSTUS transcript 3619140 3620522 0.99 - . g690.t1 5 AUGUSTUS stop_codon 3619140 3619142 . - 0 transcript_id "g690.t1"; gene_id "g690"; 5 AUGUSTUS CDS 3619140 3619908 1 - 1 transcript_id "g690.t1"; gene_id "g690"; 5 AUGUSTUS CDS 3619969 3620522 0.99 - 0 transcript_id "g690.t1"; gene_id "g690"; 5 AUGUSTUS start_codon 3620520 3620522 . - 0 transcript_id "g690.t1"; gene_id "g690"; # protein sequence = [MGRRSGGLGLRVNAKRASVSKRLSKSSEVQNFIPENAPVQQDSVLNTTSSAPVTTTVLDTDISKPSADQPSSSLHPDS # TKLNVTVVEPTVVAEAPVQKVVQFIPKFKGAAEMEARRRIRMAGMAARRGFTNGEPAPSVEPVRPDPTLDDTSSEEDVVHIADDDSPDSDFDQVDNDS # MDDGDEFDPDFAATRPVNSDSASDISNSLPSINSSVPLATSARPRLSPVSEGGDTSEAPARSATTDTEAAVTSKVPTVSNPIRRPNAVPFSKIPSHTT # SSGSLSQHSSSNHNLISFSRKPVTPIRPFPSALTAMLGATSNTSNPFAELYAAISGRGEAAATNVSVFFPHAREPRGKAMELNVRKDATVEEVIGFAL # WNYWEEAWLPKLDQGIPEGEEGQQARETRLSAIGWVLRLTEDDGEVDDDFPRMPFIHLLNPNLALAQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g690 ### # start gene g691 5 AUGUSTUS gene 3620959 3622045 0.82 + . g691 5 AUGUSTUS transcript 3620959 3622045 0.82 + . g691.t1 5 AUGUSTUS start_codon 3620959 3620961 . + 0 transcript_id "g691.t1"; gene_id "g691"; 5 AUGUSTUS CDS 3620959 3621246 0.82 + 0 transcript_id "g691.t1"; gene_id "g691"; 5 AUGUSTUS CDS 3621314 3622045 1 + 0 transcript_id "g691.t1"; gene_id "g691"; 5 AUGUSTUS stop_codon 3622043 3622045 . + 0 transcript_id "g691.t1"; gene_id "g691"; # protein sequence = [MASNQLPQHDHRRPAMISELAARASQNDWNENGAFKYFLRLAERYRKEAKEAVARNDLEEAFVAFARSATIVLEILPV # HRDYLTSLSNAQRNNLTLNGQELLENLGHLKRILLERFDDWQAQHPDRGDTPPPTLAQLQQEQQMEHDRTVAEEARRSQQEADLVRRGQVEQPRHPPP # PPDHATNSAVPFAQSAQGISSMELSQRNQRQQEEMQSRSQELMRRKQEEKLRTHASSPSISSTTGTSSGSSMTMPTPSIAATSSAPSLSSSATMYHAA # SKQSAVSFQPPPVSHPNMYRSISQQAPTILPLENPSRFEDDSTDSEQDSRTATQRYATPTKSTRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g691 ### # start gene g692 5 AUGUSTUS gene 3622122 3622736 0.72 + . g692 5 AUGUSTUS transcript 3622122 3622736 0.72 + . g692.t1 5 AUGUSTUS start_codon 3622122 3622124 . + 0 transcript_id "g692.t1"; gene_id "g692"; 5 AUGUSTUS CDS 3622122 3622736 0.72 + 0 transcript_id "g692.t1"; gene_id "g692"; 5 AUGUSTUS stop_codon 3622734 3622736 . + 0 transcript_id "g692.t1"; gene_id "g692"; # protein sequence = [MSPPPPDRIEYPKLMNVHQKTQGYRPSQDSMFTQTWNRDHYSLSDAYSHPQRENYHPLPRPPSQPPYTGPNQSAPAPP # IPTETKPSLTPSGASETSNGLKIVHLPRDCLNRFLTIAKVNTARDRETCGLLLGKDRGSKFVVTTLLIPKQHSTSDTCTMDEEELILQVTEERGLITL # GWVSSKFSCQFRLKLKSPLDSYTSLSVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g692 ### # start gene g693 5 AUGUSTUS gene 3626472 3627344 0.95 + . g693 5 AUGUSTUS transcript 3626472 3627344 0.95 + . g693.t1 5 AUGUSTUS start_codon 3626472 3626474 . + 0 transcript_id "g693.t1"; gene_id "g693"; 5 AUGUSTUS CDS 3626472 3627344 0.95 + 0 transcript_id "g693.t1"; gene_id "g693"; 5 AUGUSTUS stop_codon 3627342 3627344 . + 0 transcript_id "g693.t1"; gene_id "g693"; # protein sequence = [MDNYRLCATVTEHDAKKAGAEVVKQVESPLLSGLLYPGLQALDEQYLDVDFQFGGVDQVRLLASKSFGQLTIICQRKI # FTFAELYLPRLGYRKRAHLMNAMVPGLMGGKMSSSDPNSKIDFLDSPEIVKKKIKGAFCEPGNVEDNGLLSFAEAVIFPISQLKIDQAKGTGVMDEDG # KEALSTDQRSFASDNAPEGTLFTVNTKFDGPMHFSTFEDLRQAFKDEKLHPGDLKPAMVDAINRLLDPIRKAFGESEEFRQTEQLAYPDPNAKQPAKK # KKVGVVSNLWIHILNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g693 ### # start gene g694 5 AUGUSTUS gene 3627800 3628926 0.42 - . g694 5 AUGUSTUS transcript 3627800 3628926 0.42 - . g694.t1 5 AUGUSTUS stop_codon 3627800 3627802 . - 0 transcript_id "g694.t1"; gene_id "g694"; 5 AUGUSTUS CDS 3627800 3628117 0.74 - 0 transcript_id "g694.t1"; gene_id "g694"; 5 AUGUSTUS CDS 3628171 3628216 0.92 - 1 transcript_id "g694.t1"; gene_id "g694"; 5 AUGUSTUS CDS 3628313 3628926 0.62 - 0 transcript_id "g694.t1"; gene_id "g694"; 5 AUGUSTUS start_codon 3628924 3628926 . - 0 transcript_id "g694.t1"; gene_id "g694"; # protein sequence = [MDAATLATTTPNSRKRNRENETPSQRIKREKAAERQRRKRERDRLGIPVNYVHPPPQRNPANSVVVSQPPPPPPPPPP # PAPIADPNLNNGPSNLIEPDLTPEEEARRDRVRAAARERQRKHRALVKQRKMRELGMDMGNDISGSIQAPSSEEQGDMTYPVDAQAGFHATMISPPPP # GIVQQSLNDDNNESSFTHNLATQGHGGQILEPIIADAWDQWDRQRRQQHQQPFDASQYSSQHSFVQNPPNATPQDVSATSAANEFRARFHRSLVVPTP # FQAQAAAAAAAVAQAQANAVAHAAQVAQSTVSGSMNGMTDEDGGPVKGDHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g694 ### # start gene g695 5 AUGUSTUS gene 3630416 3631039 0.87 - . g695 5 AUGUSTUS transcript 3630416 3631039 0.87 - . g695.t1 5 AUGUSTUS stop_codon 3630416 3630418 . - 0 transcript_id "g695.t1"; gene_id "g695"; 5 AUGUSTUS CDS 3630416 3631039 0.87 - 0 transcript_id "g695.t1"; gene_id "g695"; 5 AUGUSTUS start_codon 3631037 3631039 . - 0 transcript_id "g695.t1"; gene_id "g695"; # protein sequence = [MNSPYGTHDHTVSRKRDHGMESVCAFPDGTDGGIYIVKLQLDIEEKGEKLQTYMHQLILIHQVEIHYDEGVNEGQNIS # RAEAEYPTAINLWVGVAEGDAIVCVACKSFKVLFKKEVAFFILIPCISTDEALVEFIERAVPSKLGPWCPKREVGLAMNMTPIKLNSPAKISFLPTVS # PRNNAPATAVQSGERKVRTVASERERNFREK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g695 ### # start gene g696 5 AUGUSTUS gene 3639746 3640402 0.97 - . g696 5 AUGUSTUS transcript 3639746 3640402 0.97 - . g696.t1 5 AUGUSTUS stop_codon 3639746 3639748 . - 0 transcript_id "g696.t1"; gene_id "g696"; 5 AUGUSTUS CDS 3639746 3640402 0.97 - 0 transcript_id "g696.t1"; gene_id "g696"; 5 AUGUSTUS start_codon 3640400 3640402 . - 0 transcript_id "g696.t1"; gene_id "g696"; # protein sequence = [MSNLTPAPTTTTSNIHGKSLLREPSIFDGDKAQFKEWRCTLFAYIHDPRNRIVTDSERINIAVSYMQGPKVSSWVQNY # TDDNFNDDEEEWKVTWKGFKDTLNASFLDKGLTGNAQEKLEHLRQGPNERAENFFKEFEVIMRDAGYAKDAPYIIRLIEMNAKPKLIDQAYGTSNERI # EKFDELKQKIISIDDMWWHREEMQQNWSSRYQWNAGQGPSSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g696 ### # start gene g697 5 AUGUSTUS gene 3644839 3645144 0.91 - . g697 5 AUGUSTUS transcript 3644839 3645144 0.91 - . g697.t1 5 AUGUSTUS stop_codon 3644839 3644841 . - 0 transcript_id "g697.t1"; gene_id "g697"; 5 AUGUSTUS CDS 3644839 3645144 0.91 - 0 transcript_id "g697.t1"; gene_id "g697"; 5 AUGUSTUS start_codon 3645142 3645144 . - 0 transcript_id "g697.t1"; gene_id "g697"; # protein sequence = [MNPSSQQTQPRNTEPPPEVVGEEEEYKVEEVVDAHKYRNGIQYKVKWKGYGPHEMTWESAANMTNAKEAVQDFHKKYP # NKPRPRTLKRIEILIAQFPTELF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g697 ### # start gene g698 5 AUGUSTUS gene 3645260 3646903 1 - . g698 5 AUGUSTUS transcript 3645260 3646903 1 - . g698.t1 5 AUGUSTUS stop_codon 3645260 3645262 . - 0 transcript_id "g698.t1"; gene_id "g698"; 5 AUGUSTUS CDS 3645260 3646903 1 - 0 transcript_id "g698.t1"; gene_id "g698"; 5 AUGUSTUS start_codon 3646901 3646903 . - 0 transcript_id "g698.t1"; gene_id "g698"; # protein sequence = [MAWEWASLEQDVFNQLKDQIIEDVTLIIPREAGKFRVEADSSDYANGAVLSQNVDGKWRPVAFRSRSLNEVERNYEIY # DKKMMAIMDSLSDWRQYLLGAKEPVEVFTDHQNLQYFRKPQKLNRRQARWAVEIAEYHIELFHKPGESMGKADALSRMSGLEKGENDNTNVTLLKPEF # FISQITDQTSAPKDNLLNLIRRKKNQQDKLVQIALESKDKEWLETEDGLAVWQGRIYVPKDKELRGRIIQAHHDAQTAGHPGCYKTIELVTRNYWWPG # ISRDVRIYVEGCKKCQATKTHCTKPVEPLHPHDIPSEPWEIIRTDMIGELPESGGYNAISVFVEHFTKRLRLFPTHTTITSEGMARVYQDKVFPVHGM # PRKIVHNRGPQYHARFMKELYKLLGIESNYTTAYHPQTNGQMERINQEIEHYIHLFVNHHQSDWHEWLLMMEFAYNDWVHSATKVLPFYADNGRHPYK # GTTPRMMSQNPTAQEFANSIKRIREEVGSVLKKAAEDMKRQYDKHRNEATEYKAGDKVWLEGTNITTDHPMKKLGDK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g698 ### # start gene g699 5 AUGUSTUS gene 3647443 3648432 0.86 + . g699 5 AUGUSTUS transcript 3647443 3648432 0.86 + . g699.t1 5 AUGUSTUS start_codon 3647443 3647445 . + 0 transcript_id "g699.t1"; gene_id "g699"; 5 AUGUSTUS CDS 3647443 3648432 0.86 + 0 transcript_id "g699.t1"; gene_id "g699"; 5 AUGUSTUS stop_codon 3648430 3648432 . + 0 transcript_id "g699.t1"; gene_id "g699"; # protein sequence = [MCQGDSEGSSRDIPVSFQTPMSTDGCNVFSSNRFIPSPKRVRTYIDSGASEHCWVDRRDFIAYQTVVNQAGLTAVAGS # SFRIEGVGTVEFLTHVGGKNRIVQLMGVKHTPSFGHNLISLMTLDHKGLRGDWGGRRINVTDSDGNILLTGTGSESNSSAAGGKMYEVEVLEKCSTLV # NSARSHEKAVDIHTWHHHLGHVGIPRILRMSSKNLVDGLKITSKKVEGMCEPCLYGKATRRPFDEKVVHESEVLEQVHIDLWGQSRTKSRGGATWMIL # FTDSRLTLKVPDFLSNKQAATTLKSFHRYCLKAELETGKEVKCIRIDGGRTSTTC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g699 ### # start gene g700 5 AUGUSTUS gene 3648504 3649253 0.62 + . g700 5 AUGUSTUS transcript 3648504 3649253 0.62 + . g700.t1 5 AUGUSTUS start_codon 3648504 3648506 . + 0 transcript_id "g700.t1"; gene_id "g700"; 5 AUGUSTUS CDS 3648504 3649253 0.62 + 0 transcript_id "g700.t1"; gene_id "g700"; 5 AUGUSTUS stop_codon 3649251 3649253 . + 0 transcript_id "g700.t1"; gene_id "g700"; # protein sequence = [MAEQANRTVISGVRTLLDESGLGHSFWAEVAATYCYVDGSVPSSRFPDDIPIKVFTGKRQDVSHLRPFGCEAWATLPE # KRKDGKLSRQSVKGKLIRYMDRRGYRLWIPDWRVVLENRDVRFEEGPAKRTVSRKVENDHGVGDIDVGNNSGITEDLCGLDVEELDVDDMMPERQDPA # AAVPPFPIHRDDAPEILPADENELHNSPPPAIPDLPDLPLPPAPAHPQPLRRSARLKVPSTRYLESQEFENRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g700 ### # start gene g701 5 AUGUSTUS gene 3656095 3657332 0.54 + . g701 5 AUGUSTUS transcript 3656095 3657332 0.54 + . g701.t1 5 AUGUSTUS start_codon 3656095 3656097 . + 0 transcript_id "g701.t1"; gene_id "g701"; 5 AUGUSTUS CDS 3656095 3656241 0.54 + 0 transcript_id "g701.t1"; gene_id "g701"; 5 AUGUSTUS CDS 3656370 3657332 0.85 + 0 transcript_id "g701.t1"; gene_id "g701"; 5 AUGUSTUS stop_codon 3657330 3657332 . + 0 transcript_id "g701.t1"; gene_id "g701"; # protein sequence = [MDLSEDQYNWLMIWYKIASRDGVLPRITKVKNSGTNKVRHFCVSVERTIDSRFRSIDPVPYANMYCSAEQDCESSAGQ # DYESNAEQYYESSAEQDYESNAEQYYESSAEQDYEFNAEQDYESSAEQDHEHIAEQESRPEQEYESSTEHQYRTSPEQVYRSTAQQVYRPADAQTHDI # SAGHVYDLYGSSEEQVYGISAGRVYDSDDSKEKQVHGLSAGHAYGSYDSSTKQVYGTDSEQFNKSSADHAYRPNAEQLHRSSAERVYTTSPEQTYNSN # TISEEWQPMVEYYSKRKFGSTDKGKIDSIVSVHASNDGGVGHILSSVDSRDYDDSIHETLDSMSSRNPSKVSSANNTRTIVQMSSSGCSSFCERF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g701 ### # start gene g702 5 AUGUSTUS gene 3668729 3670102 1 - . g702 5 AUGUSTUS transcript 3668729 3670102 1 - . g702.t1 5 AUGUSTUS stop_codon 3668729 3668731 . - 0 transcript_id "g702.t1"; gene_id "g702"; 5 AUGUSTUS CDS 3668729 3670102 1 - 0 transcript_id "g702.t1"; gene_id "g702"; 5 AUGUSTUS start_codon 3670100 3670102 . - 0 transcript_id "g702.t1"; gene_id "g702"; # protein sequence = [MHPYHVKSPKPLNVLPRDLLPSLRRRFHSTPATPAPSSHPPTLLPPPPVSHKPLPNNSIIPNNFRPNIRARDRLQAWD # TPFTINKRTSISSIYPPEILKLGKKATFAGLADSMNQSYGAGPLRWNQFCDEMSINENLRMPADDTLITAFIGFHMGKVSSSCIKNWLSGLHAWHELA # GAPWPANSRLIRFARAGARIAGTSRKRPQRNPITLAHLLALYSALNFSIPFHCTIWAVASTAFWGCRRLGELTIPSKNKFDPKYHVSRSAGFNFAKNP # DHSRKSVSFKIPWTKTTKELGASVVCTAQHHSLQTLCPYHAIERHMAVNAPIPHTYSLFAYLDDQGLPQHMVKTTFLSFCDRIWNAAGLEHVHGHSFR # IGGAVELLIAGVTPEVVAAIGGWTSLAFLLYWRRFEDILPTHVLKAYNSSQISRLKHSLDDFQKANGLSNSLIDACIMGIDITEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g702 ### # start gene g703 5 AUGUSTUS gene 3670203 3671354 0.63 - . g703 5 AUGUSTUS transcript 3670203 3671354 0.63 - . g703.t1 5 AUGUSTUS stop_codon 3670203 3670205 . - 0 transcript_id "g703.t1"; gene_id "g703"; 5 AUGUSTUS CDS 3670203 3671354 0.63 - 0 transcript_id "g703.t1"; gene_id "g703"; 5 AUGUSTUS start_codon 3671352 3671354 . - 0 transcript_id "g703.t1"; gene_id "g703"; # protein sequence = [MDITKFHRTIPLRPQDKPYMVVRDPDGKFWVDHCYAFGAASASSNSGMVSSAGREIWQALGIAPIAKVEDDLAAFITP # NTLISLDLTNRDDLFALISDLGFPWHPEKGEHQFVLTFTFIGFLWDLELRRVSLPEDKRLKYLFRLQNFLDTSHRCLTPRAKIESIHGTLCHIAFIYT # DGKTHLPPISNFMSSYRNYEVEKGKYPDKIIPEIQWWIKRLSMPHVYRQLRELGPVQDLGLFVDASTDWGIGIIIGGKWAAFHLANDWKIEGRDICWL # ETVAVEILIYFLESMNYRNTRLLIHSDNQGTIGAIRKSRSPNYWINMSIRRTCAIIGPLFILPELTYIESANNPADPISRGILGLQDNRLPLQFQLPD # ELTNIVSYHVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g703 ### # start gene g704 5 AUGUSTUS gene 3672138 3673508 1 - . g704 5 AUGUSTUS transcript 3672138 3673508 1 - . g704.t1 5 AUGUSTUS stop_codon 3672138 3672140 . - 0 transcript_id "g704.t1"; gene_id "g704"; 5 AUGUSTUS CDS 3672138 3673508 1 - 0 transcript_id "g704.t1"; gene_id "g704"; 5 AUGUSTUS start_codon 3673506 3673508 . - 0 transcript_id "g704.t1"; gene_id "g704"; # protein sequence = [MQITRQGPLPNDPSIISANRTRKTHKDAETISRISKLPIESKLRINFNKQTRNASRCERVFEGNDDVSNVSSYLSIPE # EEHDKMLKDQDYFDKVKAWLSAHTISWLVDRRKSLRSRPREGDDASAEALGTQPSKRFRSNDDLNEIDPTSPPNVFFDQAFLDLGLYGYHIPLALFTN # KNIEFLNNNSISFHRTKISHIEGKPQILDLADVLKKVKGSREGGPTQDLAMEHFEWLEAMANFFVYQSLLYAEGDEANEPQFYRKHFGFFENQTDSVK # LFDLWKDIELELRQKHQNKKTHFDLFDYRTEWSRVKSRLDSLEASSSSNSSQPQSNRRSHIPNFRSTKIAAHDSPPTTSLNSFPLGNKEKASREPCCI # ICGGVGHTFFTHSDSTHGPAKWALHDGKELLHPSSKVRFCTYWNIFSTCSKKCSSASHICTFCGGSHPALRWDPSCTVSRPAGY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g704 ### # start gene g705 5 AUGUSTUS gene 3675423 3675899 0.5 + . g705 5 AUGUSTUS transcript 3675423 3675899 0.5 + . g705.t1 5 AUGUSTUS start_codon 3675423 3675425 . + 0 transcript_id "g705.t1"; gene_id "g705"; 5 AUGUSTUS CDS 3675423 3675899 0.5 + 0 transcript_id "g705.t1"; gene_id "g705"; 5 AUGUSTUS stop_codon 3675897 3675899 . + 0 transcript_id "g705.t1"; gene_id "g705"; # protein sequence = [MNVRLLPSIDSEASNGGNTSLTRTGISSNRTSLKRSSTSLTKRNTKARHQSASFLTPLSSHLSMSSQQKAPFQQDSNS # SIRTVIAGGEISYRGDQNEGNSLKAEETIEQLWNVSIQQRKYKTSLPEIMEGKYDGEVLPSRQIVWTERHKDTVEKDEER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g705 ### # start gene g706 5 AUGUSTUS gene 3681971 3682366 0.48 - . g706 5 AUGUSTUS transcript 3681971 3682366 0.48 - . g706.t1 5 AUGUSTUS stop_codon 3681971 3681973 . - 0 transcript_id "g706.t1"; gene_id "g706"; 5 AUGUSTUS CDS 3681971 3682366 0.48 - 0 transcript_id "g706.t1"; gene_id "g706"; 5 AUGUSTUS start_codon 3682364 3682366 . - 0 transcript_id "g706.t1"; gene_id "g706"; # protein sequence = [MCKLRVLPEDEDDMRLLFHTEAVKRADDIDRLAEESRLAEEARELARREEVLRLEKTMEKAKSLADAKKKRLEELRVK # TTKNSSTTPTKRSAVALPTGGLRKSKRLELKKGLADVEVEEGEINEDMFIDFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g706 ### # start gene g707 5 AUGUSTUS gene 3689687 3690439 0.47 + . g707 5 AUGUSTUS transcript 3689687 3690439 0.47 + . g707.t1 5 AUGUSTUS start_codon 3689687 3689689 . + 0 transcript_id "g707.t1"; gene_id "g707"; 5 AUGUSTUS CDS 3689687 3689919 0.47 + 0 transcript_id "g707.t1"; gene_id "g707"; 5 AUGUSTUS CDS 3689974 3690013 0.66 + 1 transcript_id "g707.t1"; gene_id "g707"; 5 AUGUSTUS CDS 3690095 3690439 0.67 + 0 transcript_id "g707.t1"; gene_id "g707"; 5 AUGUSTUS stop_codon 3690437 3690439 . + 0 transcript_id "g707.t1"; gene_id "g707"; # protein sequence = [MLVKTAGVSKLVIVINKMDDPTVLWDKARYNEIKDKLTPFLEAAGCNPKTYMACIPVSACTGLGLGGRMPKTTCPCWN # GPSFLEHMDHMPMIESGHMHKDDRLVLMPNKDQVESAAIYNEIEDEVPDAFYGDNVRIRIRSVDGEDINPGFVLTSPSKPIHAVRQFEAQLAILEHKR # IICAGYSAVMHVHTLAEEVTLVVSIVYVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g707 ### # start gene g708 5 AUGUSTUS gene 3703784 3704167 0.68 - . g708 5 AUGUSTUS transcript 3703784 3704167 0.68 - . g708.t1 5 AUGUSTUS stop_codon 3703784 3703786 . - 0 transcript_id "g708.t1"; gene_id "g708"; 5 AUGUSTUS CDS 3703784 3704167 0.68 - 0 transcript_id "g708.t1"; gene_id "g708"; 5 AUGUSTUS start_codon 3704165 3704167 . - 0 transcript_id "g708.t1"; gene_id "g708"; # protein sequence = [MAVAVGGTDVISSHTLMDCPNKNANHGLDASAQQTPHIANCTDTARNMPAQQLTERMGTWDHSTSTADSDMSLSEDEG # RYHGGTPPNEPFTMNPHSHTRYNSRYVTECQQLVLVMDVTRCYTQENLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g708 ### # start gene g709 5 AUGUSTUS gene 3712300 3712905 0.92 - . g709 5 AUGUSTUS transcript 3712300 3712905 0.92 - . g709.t1 5 AUGUSTUS stop_codon 3712300 3712302 . - 0 transcript_id "g709.t1"; gene_id "g709"; 5 AUGUSTUS CDS 3712300 3712689 0.92 - 0 transcript_id "g709.t1"; gene_id "g709"; 5 AUGUSTUS CDS 3712747 3712905 0.96 - 0 transcript_id "g709.t1"; gene_id "g709"; 5 AUGUSTUS start_codon 3712903 3712905 . - 0 transcript_id "g709.t1"; gene_id "g709"; # protein sequence = [MDCIPLPDLVAFGRTCRQSRIDVTKYKERVFSIQHAYRNFFNVEEIAEFQKLQQSIGLLVSGSIVLEFFNREAYNGDL # DAFCNVQYCKVAAEWLICHGYLYQCKEGQAVEFVDSLSETPIASTTSDADTEEYRFNTVTAVWDFVRNSSKIQLIATCGAPLECIFSFHSSSLTISFV # MTLYTY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g709 ### # start gene g710 5 AUGUSTUS gene 3720386 3721153 0.54 + . g710 5 AUGUSTUS transcript 3720386 3721153 0.54 + . g710.t1 5 AUGUSTUS start_codon 3720386 3720388 . + 0 transcript_id "g710.t1"; gene_id "g710"; 5 AUGUSTUS CDS 3720386 3721153 0.54 + 0 transcript_id "g710.t1"; gene_id "g710"; 5 AUGUSTUS stop_codon 3721151 3721153 . + 0 transcript_id "g710.t1"; gene_id "g710"; # protein sequence = [MCIPEQFSNVRTPEGCQPAVQEPPPVEPGMGPPQQRYTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPVPQLDMGTAL # NAGGRVSGQVATIERIQGENTDSLTVRQQGKLPESRVSPAVCEQSRMSSRRLPTPPVQSLNLPPPRPGSLLSSLLKSPAMNTPNWECTHAIHHSRTNF # PVQLLSEMTMRLEDVIRIQECIPEDIAMVLREVLESMGIEILGDDLEFSDLQVQFLTVGTQLEIDLPKKAQQWLMTPAN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g710 ### # start gene g711 5 AUGUSTUS gene 3723383 3725038 1 - . g711 5 AUGUSTUS transcript 3723383 3725038 1 - . g711.t1 5 AUGUSTUS stop_codon 3723383 3723385 . - 0 transcript_id "g711.t1"; gene_id "g711"; 5 AUGUSTUS CDS 3723383 3725038 1 - 0 transcript_id "g711.t1"; gene_id "g711"; 5 AUGUSTUS start_codon 3725036 3725038 . - 0 transcript_id "g711.t1"; gene_id "g711"; # protein sequence = [MPFGNSPNIPRLPDERQLVGEDNWRLYKREILFAVRSKGLTGYIDGTILRPSTYPGQIYPPTQLQTPLFSLTPCLEEW # EAQDQLVAGAIVSNITDPVGLGVDETKRASDIWQALIKRFEKRYEQHIHRTDTNLRQEKFDPTEGTMEDHEKRMQNLLKKVQHLGGTATNTQFHRITI # SSMPPDWRQDVRRVPGTSSANAFTYIYTLFFLKARERKEDEWDTKRVKALMAANPHGATTTQGKSSITCHNCNKVGHIARKCWAKGGGMEEQWPKQNQ # PKDAGTSIKIAHTDEMDTGPPKETYVMSAKAGNRTSTSRHIHKCKYTTDSMTRQNDPVLGDMSQWETRVEDVVKHMPSHKTVLKSKCTACHGNTHLYL # PSVPMIRTFLDSGTSKHCWVQKSDFVDYTEVRGQAGSSAISGEAGRFAILGTGTVQFVTRINSEERVVQLRGVKHTPSFGHNLISVPTLDSRGMQGEW # GQGMMTVREPNGETVIRGFGRNKMYEVEVLESGGTTVNYSRVCDRPADIFTWHRNPVHNPYGKPEAGRRTEHNRPGGTWNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g711 ### # start gene g712 5 AUGUSTUS gene 3725150 3725769 0.41 + . g712 5 AUGUSTUS transcript 3725150 3725769 0.41 + . g712.t1 5 AUGUSTUS start_codon 3725150 3725152 . + 0 transcript_id "g712.t1"; gene_id "g712"; 5 AUGUSTUS CDS 3725150 3725323 0.46 + 0 transcript_id "g712.t1"; gene_id "g712"; 5 AUGUSTUS CDS 3725401 3725769 0.62 + 0 transcript_id "g712.t1"; gene_id "g712"; 5 AUGUSTUS stop_codon 3725767 3725769 . + 0 transcript_id "g712.t1"; gene_id "g712"; # protein sequence = [MTLTNPGTTIHDKVGTVRQLPGTPTKDRIRGRAMRRKIKSPSSQSLTLVRLKVSQVTIDKCASADSHLTGAALSHFDT # LNRQRLRGEHTCLEDWTEFKWEFGSKFGPIDKADEATRRLAWMKQMPKESFANFFIRFNKYAPLTAFDDKALVTYLKKGVAPWLPLQVVTGREEPRSY # DEWT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g712 ### # start gene g713 5 AUGUSTUS gene 3727137 3727583 0.41 + . g713 5 AUGUSTUS transcript 3727137 3727583 0.41 + . g713.t1 5 AUGUSTUS start_codon 3727137 3727139 . + 0 transcript_id "g713.t1"; gene_id "g713"; 5 AUGUSTUS CDS 3727137 3727583 0.41 + 0 transcript_id "g713.t1"; gene_id "g713"; 5 AUGUSTUS stop_codon 3727581 3727583 . + 0 transcript_id "g713.t1"; gene_id "g713"; # protein sequence = [MRVKLEEVKDKEYESRQPGPHDLFPSDKNLGPDDPILMVINKWLAFVSKSTKQEVEEILEAGQSAMEKVTLQPAKDSE # KAYQKWKSRDTERSSSWPGAKQKVRWRKKRRKHGPYPDLPTLDIESLKIPQIPSRSGFTPKGSIRRNNFQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g713 ### # start gene g714 5 AUGUSTUS gene 3728523 3729278 0.98 + . g714 5 AUGUSTUS transcript 3728523 3729278 0.98 + . g714.t1 5 AUGUSTUS start_codon 3728523 3728525 . + 0 transcript_id "g714.t1"; gene_id "g714"; 5 AUGUSTUS CDS 3728523 3729278 0.98 + 0 transcript_id "g714.t1"; gene_id "g714"; 5 AUGUSTUS stop_codon 3729276 3729278 . + 0 transcript_id "g714.t1"; gene_id "g714"; # protein sequence = [MSKKELKSLKEYIDEMLGKGFIQSSSSPTGAPILFAKKKDGTLQLRVDYRALNKIMKKNRYPLPLIGTLVDQLRKAKI # FTKIDLCAGYNNVRVTQGHEWKTAFRTWYGSFEYLVMPFGLMNAPSAFQFFMNEIFHNMVDVCVVIYLGDILIYSDDKRSHVEHVRKVLERLQPNHLH # AKPEKCAFHIDTVEYLGVIISPQGVSMDPEKVKAVMDWPTPRMVKELQAFLGFANFYRRFIDNYSGITKVFTKLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g714 ### # start gene g715 5 AUGUSTUS gene 3731439 3731843 0.72 - . g715 5 AUGUSTUS transcript 3731439 3731843 0.72 - . g715.t1 5 AUGUSTUS stop_codon 3731439 3731441 . - 0 transcript_id "g715.t1"; gene_id "g715"; 5 AUGUSTUS CDS 3731439 3731843 0.72 - 0 transcript_id "g715.t1"; gene_id "g715"; 5 AUGUSTUS start_codon 3731841 3731843 . - 0 transcript_id "g715.t1"; gene_id "g715"; # protein sequence = [MRSISSIQWFFHNTVDQDEGLYDLTLEHSRFDNDSPFLTASQHAGFVAPPPDSLEPPLHRSMLALSTALPHREGAGRW # DDIVPAIPSDDQLTLDWEQLMLWYIHHITNTPLPAPDVAFSMVVEPDVDLSDMVVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g715 ### # start gene g716 5 AUGUSTUS gene 3732452 3733231 0.55 - . g716 5 AUGUSTUS transcript 3732452 3733231 0.55 - . g716.t1 5 AUGUSTUS stop_codon 3732452 3732454 . - 0 transcript_id "g716.t1"; gene_id "g716"; 5 AUGUSTUS CDS 3732452 3733231 0.55 - 0 transcript_id "g716.t1"; gene_id "g716"; 5 AUGUSTUS start_codon 3733229 3733231 . - 0 transcript_id "g716.t1"; gene_id "g716"; # protein sequence = [MFDEQDKVAADQQELQKFLALQQDKASVAVKQKCTHFPLPVAGHSTKKVRLEVPKKCSGRKSAGVEVVSEPPRCVLLV # VPPGRSSVTATTATTTPVPPRDLPFPMEVSVRDDLVQGSSGLVQLVTIAEAHFVLVNLHASPPAHQVPIKGGGLDIFSCNMPHTPHSTLIPRVLTAHP # YRAENQRLVAQVRLLESQVADSRRENSSFTTALRDTAHALDARQREVEQLRSSSQEFVQNKVEYCCIIDQFLALDRGLSGSAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g716 ### # start gene g717 5 AUGUSTUS gene 3736968 3737603 0.87 + . g717 5 AUGUSTUS transcript 3736968 3737603 0.87 + . g717.t1 5 AUGUSTUS start_codon 3736968 3736970 . + 0 transcript_id "g717.t1"; gene_id "g717"; 5 AUGUSTUS CDS 3736968 3737603 0.87 + 0 transcript_id "g717.t1"; gene_id "g717"; 5 AUGUSTUS stop_codon 3737601 3737603 . + 0 transcript_id "g717.t1"; gene_id "g717"; # protein sequence = [MEAFLQATDVESAMTSDPPAELSPLDTADFDSVKAWKDINTKAVGNICLHLSPSIHILTKEQDSTAKTLWQYLQKTYK # VKCLSAIFDDFAAAMAVKIPYKGNPLAAITNIGMFFTCMEEADIGIPDHLEALILLSKLPSHYFIIVQAISQLGTEKLRKLMLAKVHITVMNTFSSDT # IGNSRPQNANKFFNILHKKNDPKLSQQHHNPSAAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g717 ### # start gene g718 5 AUGUSTUS gene 3738544 3745722 0.82 - . g718 5 AUGUSTUS transcript 3738544 3745722 0.82 - . g718.t1 5 AUGUSTUS stop_codon 3738544 3738546 . - 0 transcript_id "g718.t1"; gene_id "g718"; 5 AUGUSTUS CDS 3738544 3745722 0.82 - 0 transcript_id "g718.t1"; gene_id "g718"; 5 AUGUSTUS start_codon 3745720 3745722 . - 0 transcript_id "g718.t1"; gene_id "g718"; # protein sequence = [MQSLCDTVISLSGNVPLWLLPEHINNCRIYLSKLSTRELINNSTRRVKHSVAVDGVIEALLHFASRSFVVGTEGVCLY # SEVHNQCVLEFGMPVVSVLHAHFQVDIGFSRSDEVLIDSRVLPVVMSIFQQLSEFELVKLRQCLKISERGSSLSPNFCCLSPYGSSEMRSKNLFKLLA # RCFQRDYKHFFNMDDVTLSDKYLYCYGSIFVGMDLRDIIFRLLNVLGYEEKILHSIVCVLPADCVPESRNNIYRKEKRRDIRIQHANEEYDLLHKPSD # IWPEPVSVDVRMQCLRNFRQAVQYSSPLVCACCGCADKLRTGSYQHQSEWCNLSILKVTDPFILANTPQSRFTYICKDLDGLLLDKRGIHSVNIDCSS # FEMYFCRECSNAMQRVAMPRLALNNYLYRGELVESIENISWVEEMACAIYHTTAHVARIYGSSSSGDPLQLHGNVCAHPLDICSIAKRLPWSPVDLND # LITVVFVGKAKLNEGDVKKLKPYFVRRNVIRLFLSDLCRRNRLYTGLYMLDNSMLELYPENGLLPGLQDRIVYDHDSSVDELFGTESNGFDDHPAELL # GGSKQDSVLLERSGVYDPESQDVPARFMTASSIHNIAQSLPVPGADVVLRYDRDPINEYNNPDLFPGMFPTLFPLGIGGFEDRRRFPAVSLEAHVEYL # LDQSSREFRYHHFFSFVALNLIQRRKAHLHTTLWVSSNKFCDVAPMLLSVSPTVLLDLADKLKNEKDKSDFSDEELNAFQLLNNVNIIAAKIPGSQAS # KTATRNQIRSYYGYFGLPHLFLTLNPSAVHSPVFQVMYGEDGVDLAQRYPYVVHPRSERACRVAKDPVAAADFFDFMYHTIFEHLFGWNFKTGKSTSE # GGIFGHLRAFFGCAELTERGCFHGHYLLFLRGGLNPSEIHQKMHEVEGYCSQFLAFFDSIIRYHLPKVDDVLVEGYEPRIEMPPDVPSVGSDGVTFLN # WQRLFEDEHKKIGERFQRHQCRPVCHKGHSSTSNCRFGYPHEVIQNSRFDVKENSIIFARRESDVNGHNPDLLVYTRHNHDIKCILSGKAAKAAMFYI # SDYITKMPLSTDILLSTLSKAVSSITAEELDSDPIISSKKLLHRCLTHFGRKQQLHAQQCARYLRRLGDNMVSHETVILPSGNLMLFVKQIYECTFDS # NNLHNNKSEFDIQVLLGFKDGKMFSYSQIIDYWYRDTLLVDMCFYDFIRYVSLQIQSKSRTVNTSDTRLGVLSRYKLMIGHPLYDTHELIQHTNYKQG # DVGKEFVPVMVGAVPPRKHHKDYHFFVIAHFKPFSNSKMLVEDSIDVDFEHLILSNEHKRILCNWEEIHECVDQRDAERLRKRADFLAQSVQLPDDVH # NALDDDDELSVFVVPGSLKNHDRKSNLDKQELQLLKTDLTCAAWLKEPSVSIKESIMKSSNNMLNLPLLSDVSVQRWINEGKIMADRITSLRYSKHNV # LDQHSQNVENNDLVENNGLYSSKGSGGLNDVDCEKFTPMQLKAKIAKDFELNNEQLIAFEIISSMIIFREILKIPEWIAKQALVMNLTGPGGTGKTHI # ICAVQKVMEYYGMDHTYQALAPTGNAASLVNGKTIHSGLNISVREHKNGRSKRPLGELSENVAVFATVKKNNSLRKEWKDVCLLLIDEVSMVDSILLA # DIDGSLRYAKEKPDEFFGGINVIFCGDPFQYPPVGTPLYIPIRSSGKQTDEELMRRLGRMAWKSINTVVELHQQKRMEGDVEYAAAVGRLRLRQCNNS # DVDLFNSRAIKTQSNPHGVIFDNESQYFASIIVAKNSIRRALNEYKAAAICKGICSPTLLAVVAHDEIQYKNSGESGSKSKKLFPSFYEQAQLLAMDT # SSGKLRAGLPGVLTLYIGMPVILKHENLNTELGITNGARGFLRKLELSSDNNGLTYCKYALVEFPDSKVQLVGLPKGYFPIKSRSWRCSTYIFNKDKK # KVLVSVVRMQLPFEPLFALTGQGAQGHTLAAILCMLHLGGYGAYVSASRPRSREGLFITRKVTIDDLNLPVVPYDLWFEARRFEIMAYNTKIVWGFEE # GILKDVPDAEGEQRLNFSNVHYEFSGYSGKKRKHADSDFDEKVHKSIKINGNEMTSINKSRYADHIVPKGPSWDSNNWSCCFDTALVVLYNCYICMSD # KRRNLWHVQSFSKQIFKHFGELYGSSVKQMYTSVWNVVRDLWRSEIFGVFGNGYLQHGHVLLPISTLIQCHLCEWSGVYLELNGRCDLHGVSHRYIGS # VKCYNLIAKQLEPVYSHEAVITSTQSYIDILHSVNFVDISSDTVCDLHCVSSFIVHDVSTQVIAFELNGVDGIIPSDELNVPVYNTSICLKYRLNSVI # YYGDNHFAARVINTSGMWLYDGQVNEGIFEKDLLFNGEVDMNILELNGRKAHMYVYVLCD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g718 ### # start gene g719 5 AUGUSTUS gene 3754019 3754762 0.92 + . g719 5 AUGUSTUS transcript 3754019 3754762 0.92 + . g719.t1 5 AUGUSTUS start_codon 3754019 3754021 . + 0 transcript_id "g719.t1"; gene_id "g719"; 5 AUGUSTUS CDS 3754019 3754762 0.92 + 0 transcript_id "g719.t1"; gene_id "g719"; 5 AUGUSTUS stop_codon 3754760 3754762 . + 0 transcript_id "g719.t1"; gene_id "g719"; # protein sequence = [MDLVLTKLLLLQLRRVHSLFSVQPASSTASSDPQSIPTQGLLEQDVGPGSPSPNMLPEIPLLSSIHFPSYALMTPVTE # EVQTPCVKNRPRVDSSNTVSSTPKSSSFPSLVVTSNEVSDSVEQGSDSLNNAQAQLGDNSNVKYNKSASEALDIAEVDALLLSSSNLSCSTAEVIQNG # EESLDAAEVDGLLMTFNTTAASNSFDRLSLTSTQASQSVNISNTSTHLSFFTASPSTPSLSSSSVLSSPLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g719 ### # start gene g720 5 AUGUSTUS gene 3758650 3759351 0.96 - . g720 5 AUGUSTUS transcript 3758650 3759351 0.96 - . g720.t1 5 AUGUSTUS stop_codon 3758650 3758652 . - 0 transcript_id "g720.t1"; gene_id "g720"; 5 AUGUSTUS CDS 3758650 3759351 0.96 - 0 transcript_id "g720.t1"; gene_id "g720"; 5 AUGUSTUS start_codon 3759349 3759351 . - 0 transcript_id "g720.t1"; gene_id "g720"; # protein sequence = [MVLRRVGGKEDGGVDLNGWWWLPDGATDTDSTLQLASSNTNDDVQSSASPFKRIRVIAQCKAEKKKIGPKYLRELEGV # VWRYMALEKDDDSGNVPKEPTPVVAVFLSESPFTKSTVLRAMSSQVPFLLVYVPPLADSTHKFEETDSSSASSPGSCIYNPALGASGGLFKGEMEIRW # CWSLPTLTHLPSHSKPAIHRGSHGAPALFFRGKRLRGWVPPGVHERREEVGNSFHDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g720 ### # start gene g721 5 AUGUSTUS gene 3760584 3761255 0.5 - . g721 5 AUGUSTUS transcript 3760584 3761255 0.5 - . g721.t1 5 AUGUSTUS stop_codon 3760584 3760586 . - 0 transcript_id "g721.t1"; gene_id "g721"; 5 AUGUSTUS CDS 3760584 3761255 0.5 - 0 transcript_id "g721.t1"; gene_id "g721"; 5 AUGUSTUS start_codon 3761253 3761255 . - 0 transcript_id "g721.t1"; gene_id "g721"; # protein sequence = [MPHPAVAAIIGSAVGGTIFLILIIALVLWYRHYKRRPRMLKQYVSSSRSWDYGQDETRIEPFPLQPLRRLPLESHSTN # NLNPQRSETSVTYPSTIITGVTGSSYHMTSEGYSSPPALDANFALPATTVRFAENTTTSETSSNSRSRNRRVDTATPSSRAGRSSRRANNGSTATSSS # APSSTHSSRKREIRELRRTVEDLKRQQQEMLARLPPSYTDISNQGLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g721 ### # start gene g722 5 AUGUSTUS gene 3764380 3764829 0.61 - . g722 5 AUGUSTUS transcript 3764380 3764829 0.61 - . g722.t1 5 AUGUSTUS stop_codon 3764380 3764382 . - 0 transcript_id "g722.t1"; gene_id "g722"; 5 AUGUSTUS CDS 3764380 3764829 0.61 - 0 transcript_id "g722.t1"; gene_id "g722"; 5 AUGUSTUS start_codon 3764827 3764829 . - 0 transcript_id "g722.t1"; gene_id "g722"; # protein sequence = [MPTDEELKEAGGQGEDSDIEMDDVDVTISKGKGRAKVTSSRSSRKVKRSLVFHDFIDVDASETDDENEYDDDDMSDFI # VESDDDEEEQEVRKALKKCLGKRKARVILDSDEEESDEEKEVIFGKSNVKKLSPEAIKLLPRFLPSTKMKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g722 ### # start gene g723 5 AUGUSTUS gene 3767096 3768115 0.99 - . g723 5 AUGUSTUS transcript 3767096 3768115 0.99 - . g723.t1 5 AUGUSTUS stop_codon 3767096 3767098 . - 0 transcript_id "g723.t1"; gene_id "g723"; 5 AUGUSTUS CDS 3767096 3768115 0.99 - 0 transcript_id "g723.t1"; gene_id "g723"; 5 AUGUSTUS start_codon 3768113 3768115 . - 0 transcript_id "g723.t1"; gene_id "g723"; # protein sequence = [MHQPRISLVKAEPKEDVFEGSSNSSPSPACQSSSPGIRKRSPSLDTDNLDFLPSPMRSSGSIFPPAKKLKTELTSRAP # LGVSTNVVIVAPTGVIPHAALDVDDIQGKIDNLQAEIFLKQDILDGLLRQDSRTPAELMLIQRYVDELTSLDLLQGEFRSHLPVERSPFMSNVAPHYS # FGEDGEIGHSALPWYAQTAHAPLGLFASSSTTRNHSLPEPVSAPLAAFPVTINSDGVPPCVPPPLQVNAVAGPSRHAQQPAYIPGHILHNYDGGYEDE # SGDAEMDYAGTTETAKANEVAMQFAGTYIPNVARIVQDDHDYDGDGNFRGRGKDHFQGPIAKPDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g723 ### # start gene g724 5 AUGUSTUS gene 3770674 3772759 0.97 + . g724 5 AUGUSTUS transcript 3770674 3772759 0.97 + . g724.t1 5 AUGUSTUS start_codon 3770674 3770676 . + 0 transcript_id "g724.t1"; gene_id "g724"; 5 AUGUSTUS CDS 3770674 3771141 0.97 + 0 transcript_id "g724.t1"; gene_id "g724"; 5 AUGUSTUS CDS 3771197 3772759 1 + 0 transcript_id "g724.t1"; gene_id "g724"; 5 AUGUSTUS stop_codon 3772757 3772759 . + 0 transcript_id "g724.t1"; gene_id "g724"; # protein sequence = [MFSISKRPTVARTPTRSEQVRLLWVDFELWHVAQSQEIENKIKVALKDLDQKWRTKSRRLKKDSKELEEEKTKARLAL # ENTLDGNVVRQEWERRLSNAGLVSEDWVDITDEEQRKVELILGADLEFEEDDHRRFHESYAVVDPNSFHSLDDAWLEVTLRSDDQLSLNASTSSASSI # SEAWNGPAYALWSSEASRSSAQSSQTSSPEWPNKYLASDASSASSSRPSTSTSMSSSSHSRSKSHGHYIGPQLTSDTDEDEEASFEKWKLALRIRKIR # EFHDDAADADTRLTLDLDEARRTKSWSKEDEAQRVRAHEVDMLALRERKEMERKADVDSERQRRMAELRQPPLTERDYNTTAQKFLKTLHLERDSPSI # SDTPTIRQSAFVRTRKQSLSHLQQQEWPESGNDTPTPTARTSTWNFKKENPASAASTLGEAPPLKRLSTAPAHVTSTSGSKVSPPSIFGESVSAGNSK # VTVGPTPGPTAQVSTKNALNTVVSVAASVSSSSKKSKKEKEKAEKEKAKAGKKANTAPVERNESSNAETSPRNNETIPVGMTMPGQWGWGGDLTVAST # SSVAPAVTGKPSSTSNVSFLASTPSASSATTLLSSSHPSPYSHPFGSSSTSNTSLPAHSFSAPPAVSFPITTAPTIKTQASHVHAAVPDNRRVWLPLV # LWKQVRTVKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g724 ### # start gene g725 5 AUGUSTUS gene 3772888 3773892 0.77 + . g725 5 AUGUSTUS transcript 3772888 3773892 0.77 + . g725.t1 5 AUGUSTUS start_codon 3772888 3772890 . + 0 transcript_id "g725.t1"; gene_id "g725"; 5 AUGUSTUS CDS 3772888 3773892 0.77 + 0 transcript_id "g725.t1"; gene_id "g725"; 5 AUGUSTUS stop_codon 3773890 3773892 . + 0 transcript_id "g725.t1"; gene_id "g725"; # protein sequence = [MLDVPMPTHIQKSVSGPPDVSLKVESTVSPAVTAAVPTSSITQGGQPNSRESHSVKPGVKAAHTSSVPPAQPTGSSAP # VGSTALPPSSSLPSSSSKKKSKGKKKVTIEEAQDEESANVSKGKGIERLPVDSRYIIEPISEPEAPKPVVAEPQAQEMFKDIFEYDGLKALPISTSAS # TSSLASENLHQQSGHNVWAPPIASTASSSSSSLPQNDHARWIPNGGAHESFAIPDKQEKKVRWTPNAYTYDAPNVLEQGQQDVFLSALDSLEAIIRDE # NGGDSLDGHSAVMIGAGKRDASKKSQGRGKAESNSDDTFWQHAMASLGRGGSNVLAPSAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g725 ### # start gene g726 5 AUGUSTUS gene 3774694 3775185 0.69 - . g726 5 AUGUSTUS transcript 3774694 3775185 0.69 - . g726.t1 5 AUGUSTUS stop_codon 3774694 3774696 . - 0 transcript_id "g726.t1"; gene_id "g726"; 5 AUGUSTUS CDS 3774694 3775185 0.69 - 0 transcript_id "g726.t1"; gene_id "g726"; 5 AUGUSTUS start_codon 3775183 3775185 . - 0 transcript_id "g726.t1"; gene_id "g726"; # protein sequence = [MNTANTRPQKYPIDGRKIVKGESYRSRFHSPSPSSSSSNSSVDPNTDPDDEDNSVQAQTAPHVESFRSYVLKLIRNFL # DDSSLGTPEVLPSDNHQNEYKSSSSSSGYTSSQLDTQMFLTPSYRSTGSEVVDNHEMITVALVGKVVGKVLSIVALMLVFWILAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g726 ### # start gene g727 5 AUGUSTUS gene 3776933 3777562 0.98 - . g727 5 AUGUSTUS transcript 3776933 3777562 0.98 - . g727.t1 5 AUGUSTUS stop_codon 3776933 3776935 . - 0 transcript_id "g727.t1"; gene_id "g727"; 5 AUGUSTUS CDS 3776933 3777562 0.98 - 0 transcript_id "g727.t1"; gene_id "g727"; 5 AUGUSTUS start_codon 3777560 3777562 . - 0 transcript_id "g727.t1"; gene_id "g727"; # protein sequence = [MSRSPIEAPQHVLALLNKLHKLSIEQEDRIKGDKARFVSTDVSNNADGEGGVTPHKYLNNDSNSKASLDDLMRDKFIA # LDEDKCHFVYQLIRAMGATSIIEAGTSFGVSTIYLALAVRENKKSRDGAKVKPGVIATENEPSKAARARQHWAQCGSEVEAEIDLREGNLLETLATDV # KQGVDLLLLDSESEFVAFGFLPVQINLPHDPEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g727 ### # start gene g728 5 AUGUSTUS gene 3783546 3783965 0.8 + . g728 5 AUGUSTUS transcript 3783546 3783965 0.8 + . g728.t1 5 AUGUSTUS start_codon 3783546 3783548 . + 0 transcript_id "g728.t1"; gene_id "g728"; 5 AUGUSTUS CDS 3783546 3783965 0.8 + 0 transcript_id "g728.t1"; gene_id "g728"; 5 AUGUSTUS stop_codon 3783963 3783965 . + 0 transcript_id "g728.t1"; gene_id "g728"; # protein sequence = [MSKPSYVYKLVSSSSPVPLDALELPEKLPVSSLDRDSGFIHLSTSVQLHNTLKWFFAEDNPVYVLRLPYDRLEEEKLI # RWEDPKAEVCGPRGGEGMFPHLYNGLKLGKDEVDSVKLLEQVDGQWDKSIENAIKDVWLVY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g728 ### # start gene g729 5 AUGUSTUS gene 3784443 3787384 0.84 - . g729 5 AUGUSTUS transcript 3784443 3787384 0.84 - . g729.t1 5 AUGUSTUS stop_codon 3784443 3784445 . - 0 transcript_id "g729.t1"; gene_id "g729"; 5 AUGUSTUS CDS 3784443 3787002 1 - 1 transcript_id "g729.t1"; gene_id "g729"; 5 AUGUSTUS CDS 3787083 3787384 0.84 - 0 transcript_id "g729.t1"; gene_id "g729"; 5 AUGUSTUS start_codon 3787382 3787384 . - 0 transcript_id "g729.t1"; gene_id "g729"; # protein sequence = [MSSSAYPQPYTGAPPIPQGYNVNPSQWNTGYWQRNPQYNPNGAPAQFPQAAWVPGVGWGQPQQQQQQNYNPYKRPVQP # PSAAYLSQKLSDNPLGLSNMITREELYGPGVDGAPPETPWIWNPRSLDDSGSGPDPNSNRQSNNARQSSEPPPSAVHHRSQSQSLSRHASEPPPDNYQ # NHQEPAPAPLARPKKYAVSASAQAASTSAQGYQPQPPATSSASAYASSRAAAAAAAASNANNTTSNAPPAASTPTRQFRPTFSTRIVRTPDHYRHENS # TPTNSNLTRSATMPSSTSGTGQSQTTPTRSRSQSTAHARDISAETSAGASTGAGTVTDASVFVDEPGTLLSPLVMNTPMPPTSKPLGRHHTAPALSTI # QEQASPSERHHHHHRRRSSSRHPDNNNNTPSKMRSGSSSKTPTPGSGAHGESSTNHTSYLASRNNATTGTSSASAAAAAALAASQSQSHVTPPNQTNT # TSFFGNRTPNPLPTPPRIFDNPSFSRANIYSPPNASGTTPGVGSSSTTVAYTAPYNTTTTPVSANKLGSSTTSYGVIPASVSTGISSASAQASRSRSQ # TRDRADTRDLTRDREPSQSRGATPQERSYSRTHSREPSRSRAPSREPSQEPPARRFPDRSRDIDNPYPFIAPDGTPPVPPGPEVEARIIADLAKRYKI # TGEPRRSTQRSGMYNGSGSGGISRASAVSSAPATTTKFEHFPLPTPPESFLEQRRQEAKKEEERLKREKEARDREQQQQQQQNSYHQSASSYQTPKTS # PYSDNVNPSPQRSPSYAPQHSSASRQSSPYASPNNPTQQRTSPYPSPNNNVASTQRSPYPSPNNAPQRSPYPSPYSNSSSTQPSPRPSPSKHAQYAYQ # GGPSGTNTGGRRIRKGYWNSRGDHLTDSGFVVYAPADRANPPELASYPERWVGFQNEYGNIAKFEVGSKELPESIGRDAKMPYDSVSVLSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g729 ### # start gene g730 5 AUGUSTUS gene 3788728 3790929 0.99 + . g730 5 AUGUSTUS transcript 3788728 3790929 0.99 + . g730.t1 5 AUGUSTUS start_codon 3788728 3788730 . + 0 transcript_id "g730.t1"; gene_id "g730"; 5 AUGUSTUS CDS 3788728 3790929 0.99 + 0 transcript_id "g730.t1"; gene_id "g730"; 5 AUGUSTUS stop_codon 3790927 3790929 . + 0 transcript_id "g730.t1"; gene_id "g730"; # protein sequence = [MTARLFTLHPVKDYRPKTFAGHRDAVLGAYFSKDGNTVRSLFSSLRYVELINAQIYTVSRDGAVFTWKGKVEAPNSDS # SDNNEDDDDQPIASTSNGLSSSSSSPLSHKIIHTRWGVHRREYFNVPGSNVSTSSRPAKVITTTYHASSSLLIVGFSTGIFGLWELPAFTNLHTLSIS # QESISSLAVSPSGEWLAFGAAHLGQLLVWEWQSESYILKQQGHFLDLNTLTYSPDGQTVATGGDDGKLKLWSMQSSFCFVTFNEHSAPITGVAFARYG # TNVVFSASLDGTVRAYDLVRYRNFRTFTSPSPVQFNCIAVDPSGEVVAAGSTDTYEVFLWSVQTGKLLDILTGHEAPVSTLEFCPEGTNQLASGSWDR # SVRVWSVFGRSRASEAFTLNADVLALTWRPDGKELAVSTLDGQITFFDVAQSKQTNVINGRNDISGGRLTSSRTSAANSTAGKSFNSLAYTADGRCVL # AGGNSKYVVLYDVREGEGVLLRKFTISENLSLDGTEEFLDSRRVNEAGVNIDSLMIEDEEEDADRRRVDSTLPGAQGGDMSVRKYKRAARTKCVRFSP # TGRSWAAASTEGLLIYSLDSLNTADFDPFDLSLDLTPSSVLSTLHSKSYLPALVMAFRLNEAPLLQTVFEGIPRGDIKLVVRQLPMMYLGPLLRFVGG # VFLKRTPHVEFGLLWVHAVLMIHGRVLRAGGGAVGGYSSSNMGGDMPSVLRVVKAALGECEETLSRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g730 ### # start gene g731 5 AUGUSTUS gene 3791702 3793195 0.65 - . g731 5 AUGUSTUS transcript 3791702 3793195 0.65 - . g731.t1 5 AUGUSTUS stop_codon 3791702 3791704 . - 0 transcript_id "g731.t1"; gene_id "g731"; 5 AUGUSTUS CDS 3791702 3793195 0.65 - 0 transcript_id "g731.t1"; gene_id "g731"; 5 AUGUSTUS start_codon 3793193 3793195 . - 0 transcript_id "g731.t1"; gene_id "g731"; # protein sequence = [MWRQIALSSPALWVTLTVPHLTPQIASNVFQRLGQVKTAIGIPLEFSINLRRSTDVHDEEFQQLSSDLVNASIAHVHR # WKSFSLCCEDELFTAGIHEELFNKVSEAPRLEALKFAFSVQNAEWSPSPWLLSLLHAAPVLRYLQLKLSSLSVRALSPLSLSHLESLTLDLPMVTPAA # LLFLLGDVAPNLKVCHVNVAGLVNFDTDEDDNHSAYVTSMVVHSCLEVFEIRISRGASQEAMSQLFDNLTLPVAREVLLEIGNFQEPSSDSIAFPDDL # ELSWPHESFLGLLERASPSVTSLCLGFDPASPESADNAWGGMGSIGSDLEEEHVRAYLDLNNVGRSLATLHVRRDRPVWPELLEYLTLSASHESSHTC # SLDLSNSVSDALGSQPLRNLENIALDIDPIFQVLQMRDFVKSRWYDNLSSDSPRPITRLRNFSITLCFPDIPNLELESASARKVFQRIAQGEEPEDKL # EVVFHKRRYTMMPMDVPLVTLGSELII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g731 ### # start gene g732 5 AUGUSTUS gene 3793283 3793744 0.22 - . g732 5 AUGUSTUS transcript 3793283 3793744 0.22 - . g732.t1 5 AUGUSTUS stop_codon 3793283 3793285 . - 0 transcript_id "g732.t1"; gene_id "g732"; 5 AUGUSTUS CDS 3793283 3793744 0.22 - 0 transcript_id "g732.t1"; gene_id "g732"; 5 AUGUSTUS start_codon 3793742 3793744 . - 0 transcript_id "g732.t1"; gene_id "g732"; # protein sequence = [MMKAHNHLQRSSEDSNDSDFTEVTAKTSFDTVLSISSISTSVSAHSIPIPSTVETVILQTNDQPSPKEAAEIHAILDT # KRQKLFELERRKEVLDRQREFLDRQRRLLDEELGVMSEEIDQYSGVVGCGMRNMPSDLVSPLLSSFQSSDILSIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g732 ### # start gene g733 5 AUGUSTUS gene 3800866 3805488 0.63 + . g733 5 AUGUSTUS transcript 3800866 3805488 0.63 + . g733.t1 5 AUGUSTUS start_codon 3800866 3800868 . + 0 transcript_id "g733.t1"; gene_id "g733"; 5 AUGUSTUS CDS 3800866 3802295 0.63 + 0 transcript_id "g733.t1"; gene_id "g733"; 5 AUGUSTUS CDS 3802341 3805488 1 + 1 transcript_id "g733.t1"; gene_id "g733"; 5 AUGUSTUS stop_codon 3805486 3805488 . + 0 transcript_id "g733.t1"; gene_id "g733"; # protein sequence = [MSSPLSSASAASRAIRRDPDLEPDEQWKENLKAEIERNLTSMVKDAETQLKENLEKNPDDSERLRREFSVAMDNIRKL # ATEAFKEELERERHQRRWATGHELPPDLAETMKKEQQAILDQIQSGKSSNALGSNDGPIVSSVQENTIVSRGVAPPQSNHVYTDCNHQDSLNRRSSTS # SVSLNLNPTPPPQRSERNQRATLLEPDPEPPSEEDTDEESDTDAARKRHIRSQPIMPPPKFRNDDDSGVKRSSLEAASVNLNRIPRPYSSSSSTPPKI # SPEVWHPPELASDRSQRRNSTASVRSTGSTSTGSRRPTIVDTIPEIRPVVNSNSDISTKVEQERVRTQEVDQAWRDLDAAKERQLGRRRTLDNMKGPS # SSSSAVYVNDPPGTSPTTSNIVSSSPSKTRPPPPPLETKPIYRKASFVQENPAQLYRKTSFVHEAGPRNFDKVPIRTRSTQSHLSLSRPTEPTELYSN # GERYSRRNGRTYSQTPPVSATLAYAQAAEGYNPAYPGSASYIGSTSPLTDQDTDSRIRSRRPSNDPRYIPAPSSVGPVSSPNVQYSPYQGTPSYSSPP # PSHPYSSPSSRPFPQQQAPYSASPYSASHFSSQYPPYQSPSMYTTRTSDDVDATSYGNGSSHQQRAWSGNGPMAAPMSALPDTRHHSMRSSSASQEGW # RLWSQHHPSQPQSLHSSMSNNNLREGKMPDRNQPVPTYTNDLVDDPEGSEEGSETMTDSESEDSHHQPTSTLSSSTSFSSPRHHIPYPTPKPNAKLQR # STVNEPDVDSLEYQQMLARERKMRAAEAAKAVETEEAKKKDLARQAEVSRVEEAKIREESMQREAARAAEEARKQKLADEEEEAARRRKEQETQRKKE # AEMKRKEIARRKEEEKRKREEEERNKAEEKRREEEQRKRAEDEAKRKEEEDIRIRKIEEEEARLAQAKEEARIEEERRERLRRDEDELRRREDEIRKK # EEELQRKLMVEKQREFERLEKEARRKEAEAKKREKIARLREEEAQKREAEIKQRERQLRLAEEELQRREQAAQEEALRREQEKAAQEAEMREEQRLAR # EEQERLAREEQERLAHEEQERLAREEQERLAHEEQERLAREEQERLAREEQERLAREEQERLAREEQARLAREERERLVREEQEREEQERRAKADAEQ # ILLQQRIRKEEQERIESDIAWKEHERRKAEVAKAAALKEEHATANRKRQENERMRIEDEAKRKEHERRRQEEVRKRESEKIAQQEEFRRREEEIRNRK # RQDSAAAWENWTGSTSPGYQSQPNTPLSSANANGGTNTAQRSNSTTSASASGWSTNPAWSKTRSTSSSASASASHTSNPPPSSASSIPTPKPRSGSTG # AAGSTSSSATPITEEQWQRRHEEQFQAQQARFRQEQERKERERMAKSNQVKGPDELIKTFEHHARLWEKLPEYTELRWDVFPWPMLNKPSSPEDITYA # AVYAYLSSPYHPEKDKPQKDRIKEQIRRWHPDRFETKLLPKVIEEDKVKVKEGAGSVVRNLNSLLTKSNTPSFFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g733 ### # start gene g734 5 AUGUSTUS gene 3805951 3807138 0.74 + . g734 5 AUGUSTUS transcript 3805951 3807138 0.74 + . g734.t1 5 AUGUSTUS start_codon 3805951 3805953 . + 0 transcript_id "g734.t1"; gene_id "g734"; 5 AUGUSTUS CDS 3805951 3807138 0.74 + 0 transcript_id "g734.t1"; gene_id "g734"; 5 AUGUSTUS stop_codon 3807136 3807138 . + 0 transcript_id "g734.t1"; gene_id "g734"; # protein sequence = [MPLMKTESNLGTSTSDKDRSMLPSGESYQLGSLGSKLHAALASREARSIRRRLPEPSVLGKQSLIDFTSNDYLSLSTS # PLLRERFLQKITVKERGQILGSAGSRLLVNPDAHHRLERRLESVLSRPSRNEYDTPQVGILFNSGFDANVSFFTCIPQPGDLIILDEYIHASVWDGVK # ASRITQDCVKSFQHNSIESFCAVLESLLNDTNPSNTSASVAERLRSGTSSLFVAVESLYSMDGTLAPLREINRLLAKFLPKRNGYLIVDEAHATGIYG # PPRRPGCGRASQLGLDGGLGSRVGVSERDMDDMEECRVLARLHTFGKALAGSGGQYLYCILARKLLIFFVAILLTTPLLTSYLINYARPLIYTTALAH # PNVVLVEAAFDLMVEGETEQVCY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g734 ### # start gene g735 5 AUGUSTUS gene 3809125 3809541 0.75 + . g735 5 AUGUSTUS transcript 3809125 3809541 0.75 + . g735.t1 5 AUGUSTUS start_codon 3809125 3809127 . + 0 transcript_id "g735.t1"; gene_id "g735"; 5 AUGUSTUS CDS 3809125 3809541 0.75 + 0 transcript_id "g735.t1"; gene_id "g735"; 5 AUGUSTUS stop_codon 3809539 3809541 . + 0 transcript_id "g735.t1"; gene_id "g735"; # protein sequence = [MIFVFSGLDIPSVDVVINYDCPTHSKDYIHRVGRTARAGRSGKSILMASQYDIEFVQRLEKVLDKKLDLYPHDPEEAH # LLRERVDEAGRVAANQLREDKRTKGDARKRRKPLSSGDRDGEEDLDEVNRFAMKKKKRKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g735 ### # start gene g736 5 AUGUSTUS gene 3809931 3812363 0.38 - . g736 5 AUGUSTUS transcript 3809931 3812363 0.38 - . g736.t1 5 AUGUSTUS stop_codon 3809931 3809933 . - 0 transcript_id "g736.t1"; gene_id "g736"; 5 AUGUSTUS CDS 3809931 3812237 0.64 - 0 transcript_id "g736.t1"; gene_id "g736"; 5 AUGUSTUS CDS 3812355 3812363 0.38 - 0 transcript_id "g736.t1"; gene_id "g736"; 5 AUGUSTUS start_codon 3812361 3812363 . - 0 transcript_id "g736.t1"; gene_id "g736"; # protein sequence = [MNRATDIYNPLPSPASSDFTPPLTQSTSGSNNSRSNFGSICQSPPQPSTPPSRYTHAHPNNQTAATHRPRIRYPVDLA # RAGDGRTPLHRRGTSQKYEPFEDLLREAGYKETRIFTPETERTVSGADDGDGSSGGKNKIAGVVEFLSGFIPGSRTSSLRDDSNEARKKHYSPPTSPS # PMSTRRQNQRADPELGREHQKRPIDNDATPRATRTRTSRSVQSLQNTTPSPAIRYTHNNHSYTSIGQSSSSKPMPPSRATAYLRHIASVPDMPGADLQ # RSHSNPTRRRRSNRRSGTNDSRHTDDGEDDDFDSVYEGRTRGNGEGEEDPNVPPLPKGWLETVARAVLFGPGASLASRATFGPSETGSRAVSQPYTNS # QPSSSYVRDVSPALRQLRQTRSVISRTGSLADATTTHIRHPHQHHNLIRTQSARSALSSRSGLSDRTNRTHGYWATMMPSPLSNIKSASADVYGANRP # RPTLMTRLHSSSRSNASEGEIRRARVVCRPASRATSPNPNYLNPSSTTRQVQRKQSTQGRNKGNRSPKKWRSGKVADEPPSLTRTMVELEGDGAGHMD # SWLYSLPHTHEHQQGLNYSSNLRSEPSSESRYLSGWGWDSAQSSALPTSQPDYDSDGIGHFQNPPFSLSISVTNISDEADQPVSEGEESSENEVDLAK # MLRPKPQRQESSNSTKSVSSLRSVRSLRKFLVPGVENHQIPPLPSSNGGGSAIDITPPTSATGRWFLDSEGSYADGNDRYGTKGTRGKRGSLPSGWTG # HDMELAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g736 ### # start gene g737 5 AUGUSTUS gene 3825517 3825708 0.42 - . g737 5 AUGUSTUS transcript 3825517 3825708 0.42 - . g737.t1 5 AUGUSTUS stop_codon 3825517 3825519 . - 0 transcript_id "g737.t1"; gene_id "g737"; 5 AUGUSTUS CDS 3825517 3825708 0.42 - 0 transcript_id "g737.t1"; gene_id "g737"; 5 AUGUSTUS start_codon 3825706 3825708 . - 0 transcript_id "g737.t1"; gene_id "g737"; # protein sequence = [MPMEKTGITVFAGEHEEHEYADKNEWGNIISGYDEVLERHGSDSSITRGRQSSHDKARRSSKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g737 ### # start gene g738 5 AUGUSTUS gene 3826827 3828051 0.37 + . g738 5 AUGUSTUS transcript 3826827 3828051 0.37 + . g738.t1 5 AUGUSTUS start_codon 3826827 3826829 . + 0 transcript_id "g738.t1"; gene_id "g738"; 5 AUGUSTUS CDS 3826827 3827001 0.37 + 0 transcript_id "g738.t1"; gene_id "g738"; 5 AUGUSTUS CDS 3827097 3827121 0.79 + 2 transcript_id "g738.t1"; gene_id "g738"; 5 AUGUSTUS CDS 3827472 3828051 0.8 + 1 transcript_id "g738.t1"; gene_id "g738"; 5 AUGUSTUS stop_codon 3828049 3828051 . + 0 transcript_id "g738.t1"; gene_id "g738"; # protein sequence = [MQADTRPASITRLHTSPERLRADSSGSGYLDRVPEDGSVEFDGRDEEANIEEIDEEFEKDYWFCTHLRVWWVSLGWAA # VEGIVAIKQGYMNIALYRDVLVNDIHEEERIIEIEDGATKLGRIYGATDQITYTVEPPLAPFVVGSSEHTSPIQSVPLRGLTATTISDADASSNLERV # PLLQRESRSSDIDLEASLELQVEDDIDQLMAVRARDELGKYYGIPFIVRFIVAQKNHHTKQWITSGYLPLYLAYSAPMPFYFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g738 ### # start gene g739 5 AUGUSTUS gene 3830732 3831310 0.37 + . g739 5 AUGUSTUS transcript 3830732 3831310 0.37 + . g739.t1 5 AUGUSTUS start_codon 3830732 3830734 . + 0 transcript_id "g739.t1"; gene_id "g739"; 5 AUGUSTUS CDS 3830732 3831310 0.37 + 0 transcript_id "g739.t1"; gene_id "g739"; 5 AUGUSTUS stop_codon 3831308 3831310 . + 0 transcript_id "g739.t1"; gene_id "g739"; # protein sequence = [MDILRFSHTKTPAKLSEEVIKNLHHNGVPASVFIGLLQQRLQQVVDGLTAWEGPDAMPKLWKAVEAAEGVIGARKARV # SPTDSRVRGYGSYEDDEDDEEGMKHETSSQPWWADPFSGCPSSIAETVMELLDSGFTPLNSPYLRDKLKQCVKTKIKTAAAKFNYVLTQSCSAFAVPG # ACGSQHCIDSCGCGER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g739 ### # start gene g740 5 AUGUSTUS gene 3831540 3832785 0.87 + . g740 5 AUGUSTUS transcript 3831540 3832785 0.87 + . g740.t1 5 AUGUSTUS start_codon 3831540 3831542 . + 0 transcript_id "g740.t1"; gene_id "g740"; 5 AUGUSTUS CDS 3831540 3832000 0.87 + 0 transcript_id "g740.t1"; gene_id "g740"; 5 AUGUSTUS CDS 3832074 3832785 0.9 + 1 transcript_id "g740.t1"; gene_id "g740"; 5 AUGUSTUS stop_codon 3832783 3832785 . + 0 transcript_id "g740.t1"; gene_id "g740"; # protein sequence = [MLSAHLELSSVMIKLPLQVTAVQHPALADMVNVVVCSIQGHRRLIDYCGGGDFDGDRLLVIWDESFVKPFTNADEKYS # KAPAGIESCFAMDKEVVAQFCSDMHKMGDQVEGGLQDHLLSSLRDPRYVGDYSRFHENAVYEYGYAHWRSINLAYKFCLVLDSAKTGYRIKSETYLSD # RKLYSHPLGPSYKITEKKASNSSNDLPLQRGEGLPKFIMDSLHIEAAKQRDYWLIEVDNRFSNAPLNLRPDPDLVFPWQNFCNEARERGEKAIVSDLN # VISDHVEAMYKQRVETYVNPASGSFTSQPITVRQDKIRDLSQRFISFPGPRNLKTLMEPTAVARLRASYAYIYAIRRGGPAAQFPFDRAFRELCAIKA # QAVGGYKVCLQSMNDYRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g740 ### # start gene g741 5 AUGUSTUS gene 3835411 3836157 0.8 + . g741 5 AUGUSTUS transcript 3835411 3836157 0.8 + . g741.t1 5 AUGUSTUS start_codon 3835411 3835413 . + 0 transcript_id "g741.t1"; gene_id "g741"; 5 AUGUSTUS CDS 3835411 3836157 0.8 + 0 transcript_id "g741.t1"; gene_id "g741"; 5 AUGUSTUS stop_codon 3836155 3836157 . + 0 transcript_id "g741.t1"; gene_id "g741"; # protein sequence = [MRQFLGPSKSPTPIPTPRAISSPSPSDAYATSPGRAPINPGLSSPVLSARQFHLPFSPSPVNDDHDPLGSCHSSTLEN # QDDTGSSVSSAFPTFAPPSNSGTPNPRESPGHDFVGYLAGFNPEYHFQSSHPAQAQARYSPTTGWNWNDHDDDVSSIDWTQCDTRNETNLNYVDAELD # YVRSHGKNQYEFRKEAGDLEVADESRTGAKNSPSIYTPNTCKKILRQCLAVGSYPGFHHSFFQLTSPIRSCR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g741 ### # start gene g742 5 AUGUSTUS gene 3838196 3838936 0.91 + . g742 5 AUGUSTUS transcript 3838196 3838936 0.91 + . g742.t1 5 AUGUSTUS start_codon 3838196 3838198 . + 0 transcript_id "g742.t1"; gene_id "g742"; 5 AUGUSTUS CDS 3838196 3838936 0.91 + 0 transcript_id "g742.t1"; gene_id "g742"; 5 AUGUSTUS stop_codon 3838934 3838936 . + 0 transcript_id "g742.t1"; gene_id "g742"; # protein sequence = [MASISLSYADRAKNAQNIRSPIENTVLAISVSIPESTSTSSSFSSNASSRSSTSSNPGSSTVISSSSTDVDADITAPT # TSNSSVIVESDGECNGGQQEQKKRREREEEVSRITTRKPSVNVWEQRMNRGSVSSSFTLISSSSKTSTTNSAFIKKDNDPSIAKVRPTSNNWSARPTP # ASPSRPVSLDLRNSNAWPEVGVGLSSPSKDKGKGKLSNEEVSVVQGEYFIFLRLLTLSVLVQQNYHLLLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g742 ### # start gene g743 5 AUGUSTUS gene 3839148 3841842 0.1 + . g743 5 AUGUSTUS transcript 3839148 3841842 0.1 + . g743.t1 5 AUGUSTUS start_codon 3839148 3839150 . + 0 transcript_id "g743.t1"; gene_id "g743"; 5 AUGUSTUS CDS 3839148 3841333 0.13 + 0 transcript_id "g743.t1"; gene_id "g743"; 5 AUGUSTUS CDS 3841386 3841842 0.44 + 1 transcript_id "g743.t1"; gene_id "g743"; 5 AUGUSTUS stop_codon 3841840 3841842 . + 0 transcript_id "g743.t1"; gene_id "g743"; # protein sequence = [MNSVSRSRSRNQSQSRDLSQLMSLTRGTGISDRKSISRSGTTSNPTSSIHSSAGSAHGSPAFPREIGLPPQETEESRS # TAHTMSSSPSNSKAERTPSASTYTVPPFVSSTLPSVFPVQIQQQQQQAKFIASQNLQTGEASPHELPVGVQPVYFSNGHYPSDPIKSPSVSSLSMYSP # STEQNLPQSLAPLTSHSSNLTSSLSTSYTSTYPFHGFPSIARSNAQMYWPVPTGSGHQTPNYGRQVHSSMIYPVEYRPASPINGPTHYPTHFAESHLS # NPSAYVPISAPVSIEVIQPIPTRVVFGNFDGCDTNMNIGSASFTPRSSFYVGAGSRETRSSSLKKRSAQRGKKRAIPQRSAGVTMLNADAEVVDLMER # FTSAKNGRGTSGRWSFGRFGNGEQDLNEDEKECAQTYNHSQQSNNSDLHLVTPPRPSLPPAYVPVGAVPVSAPAPVPPIPLSTLASLAPIHTNFPHPI # PPHPSLTHLGPFSAETGPSTSPTLLMNGPGDARGGRSPEDGGFKPGAFSPHGLNNGSEWVVRDFGYGFGRERKANGMGVKESFAVDQYFSGPNHSYHG # TGHGRRRGSYSYNNPYAGYGGDRGGYSPRRGGRGYGRGFRGSRRGPVHGLYGYDTDRGRENYASSPSEFRPGTYVHPSSQHHQTPFVLTPPPQFQPLP # LPPTDHGLHTYIPLPRGYDSSFQPASPPVSDSDSSFRAPMPAPISRLSVALDPTVYYLLGQLEHVLSIFFSLLQPLMCCQMDSHGWVPIPLIASFNRV # RQITNDESFVRDVLNMSSVVEVQGDMVRMKEGEWERFVLPDAQTSRVDSIHEFPLTPSSGDSTSKVRSFVEEAVMRHVRSDNGDPESEADEIDEEEEE # EEEEEEEEVVFVMGYDPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g743 ### # start gene g744 5 AUGUSTUS gene 3843464 3843799 0.8 + . g744 5 AUGUSTUS transcript 3843464 3843799 0.8 + . g744.t1 5 AUGUSTUS start_codon 3843464 3843466 . + 0 transcript_id "g744.t1"; gene_id "g744"; 5 AUGUSTUS CDS 3843464 3843799 0.8 + 0 transcript_id "g744.t1"; gene_id "g744"; 5 AUGUSTUS stop_codon 3843797 3843799 . + 0 transcript_id "g744.t1"; gene_id "g744"; # protein sequence = [MRAARIDPEAAWPPPISPDENDDDRNVRLEQEREAKRVSDAIDLALNVERENKKKTIHGAKILLLGPSQHISSFFVNL # RNRSSRIREVNDLEEHAGAFWSLPVSIMLRDLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g744 ### # start gene g745 5 AUGUSTUS gene 3848500 3851515 0.43 + . g745 5 AUGUSTUS transcript 3848500 3851515 0.43 + . g745.t1 5 AUGUSTUS start_codon 3848500 3848502 . + 0 transcript_id "g745.t1"; gene_id "g745"; 5 AUGUSTUS CDS 3848500 3849644 0.43 + 0 transcript_id "g745.t1"; gene_id "g745"; 5 AUGUSTUS CDS 3850189 3850292 0.93 + 1 transcript_id "g745.t1"; gene_id "g745"; 5 AUGUSTUS CDS 3850404 3851515 0.99 + 2 transcript_id "g745.t1"; gene_id "g745"; 5 AUGUSTUS stop_codon 3851513 3851515 . + 0 transcript_id "g745.t1"; gene_id "g745"; # protein sequence = [MVFEVLGENLLGLIKRHQSKGVPMGLVKQIGKQILLGLDYMHRCCGVIHTDLKPENVLIAIDDVEGIIQAELAKSKLA # NASATDSSSNPSPARMSGVVGVPPSTGRGGNQTPRSESLIITSSQPLPSPSSSFGSTGFLSSLASAGGNLPKSIYSSTSGSTSSGPVFDKFSFGMSKI # DPEGPGQSTVEGRSNAEEIAEGVGNVSLDKSSTLDDAEDVLEFSTHKSKKVLPKVSLLTQQAPSHSSNASDLPAHSHSNLPPGAQPPPFNGRDMQITK # DGMGRVQDSVSAMAGEMEVEERITVKIADLGNGEIDPYPLIYFHFRGEASHLFEGVSCTVMLTILALLISATWTEHHFTDDIQTRQYRAPEVILGAKW # GTSADMWSLAAASHLSGFLNPMLAGSPEKRAGARDMLIFGCGLADSSTPSQPSNFSNDDQDDSNEPYEITPSAATAVTANALGLPSSYSRRLPPSSGQ # SYHTHSNNSSQSSSHSNPSPSRQSHHGYHPPPSIPSLTGPGASWLAGLVVQGEIDVLERLERMRIKKASEERSRSRSTEKDTERDKGNQIERGRNPQS # VTSSMVSGEKIRGRTKTPTPPSPPTSPSPSRLKAPKLEHRVSDATVTNDDDVVPAPSGPEAQLTPSTVSTASTKAKNSVTAQEQAEVDALKPVGEFEP # ESESNESGGTEPDTGGKGEDAAMDSPVKTTPTLGSAPSTGGKFPVSACLTIVPSSSLISIRAEDHSNILIYQYTQPRQCITYPELSSQRKSGRKRGER # RRRQQIQTWRQGKRRYLNNSKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g745 ### # start gene g746 5 AUGUSTUS gene 3851856 3853419 0.57 - . g746 5 AUGUSTUS transcript 3851856 3853419 0.57 - . g746.t1 5 AUGUSTUS stop_codon 3851856 3851858 . - 0 transcript_id "g746.t1"; gene_id "g746"; 5 AUGUSTUS CDS 3851856 3852358 0.76 - 2 transcript_id "g746.t1"; gene_id "g746"; 5 AUGUSTUS CDS 3852468 3853419 0.62 - 0 transcript_id "g746.t1"; gene_id "g746"; 5 AUGUSTUS start_codon 3853417 3853419 . - 0 transcript_id "g746.t1"; gene_id "g746"; # protein sequence = [MACAYLLSCDELASPPRLERNYSRREWAKIRADETMNAIPDSEDSSPDRLSRAVFAEETSIDSPVPGSVSPGPDQRQK # KSYADALEHVLNLHTSRRMKPSTSDSDKVKQGVSIPSQRRFLYYWSLLLSREAPSHLWATELLVPSPNQDTILSMPVSQKSPRPKVRLTEIKIRMKEI # SNMRANLVRAANVVIDKTNMSKSPAQTDKNTHVWVSLARYDDDFVETLERWERYTRMDSASDQGYMGRREPGKDHFGKESLGELFVDGRWDSKKMVRS # FARMGADEQSFVKDYTEEVSTSAHHDSINLIKMFITGWQNQDIQANSMYDITQNVKEKGVVLDAGREVRVKLYMGQVSDLASALSLLRYPYKVFMGWL # WFIPTFHMSQPPPYSDLSQPQPSNISSKLVLQRKELDFALGIGSSIIDIEISLDWLKETEVETVQPPARVNTEDEETAPEKVKEPAGIGATIEAMAAG # DVVGIVEATQAAED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g746 ### # start gene g747 5 AUGUSTUS gene 3854422 3855252 1 + . g747 5 AUGUSTUS transcript 3854422 3855252 1 + . g747.t1 5 AUGUSTUS start_codon 3854422 3854424 . + 0 transcript_id "g747.t1"; gene_id "g747"; 5 AUGUSTUS CDS 3854422 3855252 1 + 0 transcript_id "g747.t1"; gene_id "g747"; 5 AUGUSTUS stop_codon 3855250 3855252 . + 0 transcript_id "g747.t1"; gene_id "g747"; # protein sequence = [MTRARTQASSLLAENARATATTVASRAKTVETGGEKTSVKRKREILGEVTESNSGKPKASAKGKEKATSGDKAGPTAT # ASKSRLTSKTARAPLREVGGTASIQKPLRSKPVAGDRQILGIIKEDDDRDEVMIDETRAPAPLHATQPAIFKLVPQTSAHKDLLPRAPASLRDDVDRE # PVFKKRITEDREDRQPVARVTPRLPTTLDDSQLDEDRIATELADVHEDEDGAGLWDDLDADDAEDPFMAPEYVHEIMEYMKELEVCLSPFIEIDLMYC # YS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g747 ### # start gene g748 5 AUGUSTUS gene 3858880 3860913 0.44 + . g748 5 AUGUSTUS transcript 3858880 3860913 0.44 + . g748.t1 5 AUGUSTUS start_codon 3858880 3858882 . + 0 transcript_id "g748.t1"; gene_id "g748"; 5 AUGUSTUS CDS 3858880 3860913 0.44 + 0 transcript_id "g748.t1"; gene_id "g748"; 5 AUGUSTUS stop_codon 3860911 3860913 . + 0 transcript_id "g748.t1"; gene_id "g748"; # protein sequence = [MNRLGRRFASASSSAPTSVAQPLSSHCSRRSLLASFFNNSTRSSRWMMSLAGPTSRTFSSSPNTMMRRTPRIGSGGAG # PRWINSSGSGSGKDGKGVGKESDETEDNTSTEEVKASSIEGTNSEGGESDSDSTPPASSSGNNKSLTKPTVPTNYPTVLALPIARRPLFPGFYKAVVI # KNPAVVRAVRDMMARGQPYLGAFLLREEEGKDGQGEALDKDVISSLDEVHEVGVFAQITSVFSANPNPTASSEGNKDVDKSSGEDTEEYLTAVLYPHR # RILITELLKNGTASEPTEARVELVGDDQPPEIQTATPPQTPTDETPTSGRFSPITSFLNSHPVSVVNTVHYPTLPYTKSSQHIRALTAEIVTVFKDIA # QLNPLFRDQITNFSINQVASNVFDEPDRLADFAAAVSSGTSGELQEVLEEVDVANRLGKALVVLKKELINAQLQNKISKDVDTKIAKRQREYYLMEQL # KGIKKELGLESDGKDKLLQKFKDRAAQLAMPTPVRKVFDEELNKLASLEPSASEANVTRTYLEWITQLPWGVYTPTRYSVEAARQVLEEDHYGLKELK # ERILEFVAVGKLRGSLESASSVAQNPDPVVDSSSSLESDKSVPPPPPAQNDRLPTPEGKIILLHGPPGVGKTSVGKSLARAVGREFFRFSVGGLGDVA # EIKGHRRTYVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g748 ### # start gene g749 5 AUGUSTUS gene 3861535 3862006 0.6 + . g749 5 AUGUSTUS transcript 3861535 3862006 0.6 + . g749.t1 5 AUGUSTUS start_codon 3861535 3861537 . + 0 transcript_id "g749.t1"; gene_id "g749"; 5 AUGUSTUS CDS 3861535 3861546 0.68 + 0 transcript_id "g749.t1"; gene_id "g749"; 5 AUGUSTUS CDS 3861602 3862006 0.84 + 0 transcript_id "g749.t1"; gene_id "g749"; 5 AUGUSTUS stop_codon 3862004 3862006 . + 0 transcript_id "g749.t1"; gene_id "g749"; # protein sequence = [MVEKIYRKTALKIVQDLGEEKLPEPPLPADAAAAVTPVTEHSSDAPLTPLTEPDPEHDQKIHPTTIEKRAPLVIPTSV # HVRITADNLKDYVGPPVYQKDRMYEGPGRLVKGVSTGLGYLGNGSGAVMPIETLVSVLLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g749 ### # start gene g750 5 AUGUSTUS gene 3862201 3862676 0.24 + . g750 5 AUGUSTUS transcript 3862201 3862676 0.24 + . g750.t1 5 AUGUSTUS start_codon 3862201 3862203 . + 0 transcript_id "g750.t1"; gene_id "g750"; 5 AUGUSTUS CDS 3862201 3862255 0.24 + 0 transcript_id "g750.t1"; gene_id "g750"; 5 AUGUSTUS CDS 3862360 3862676 0.75 + 2 transcript_id "g750.t1"; gene_id "g750"; 5 AUGUSTUS stop_codon 3862674 3862676 . + 0 transcript_id "g750.t1"; gene_id "g750"; # protein sequence = [MPEGSIGKEGPSAGTAILTMTGEISLAGHVLPVGGLKEKILAAHRAGIKTILAPAANRADIEENVPDSVKEGIKLIYV # EDVREVLKEVFGGAVVEGSGEDVISRWADSVQVKEKERFPESSGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g750 ### # start gene g751 5 AUGUSTUS gene 3862962 3864573 0.73 - . g751 5 AUGUSTUS transcript 3862962 3864573 0.73 - . g751.t1 5 AUGUSTUS stop_codon 3862962 3862964 . - 0 transcript_id "g751.t1"; gene_id "g751"; 5 AUGUSTUS CDS 3862962 3863784 0.92 - 1 transcript_id "g751.t1"; gene_id "g751"; 5 AUGUSTUS CDS 3864441 3864478 0.75 - 0 transcript_id "g751.t1"; gene_id "g751"; 5 AUGUSTUS CDS 3864571 3864573 0.77 - 0 transcript_id "g751.t1"; gene_id "g751"; 5 AUGUSTUS start_codon 3864571 3864573 . - 0 transcript_id "g751.t1"; gene_id "g751"; # protein sequence = [MHYLVEEREEAKLFYGGSYQTNNGAYAEFVRLYASVTFKLPDELSYEEGASLPIPHLTAVQVFYMRLNIPKPFSPPAA # EKEIILIWGGSTAVGHNAIQLARTSGLRVFVTASPAVHEELKTLGAEQTFDYKAVDVVKQIQDAAGERGIIYAIDTVGELSTTNSTIDALSLSRSGHL # VSTLPPDPSSVNRRKDVKVEFSLVYTLLGLDFTFASAFKYDAIPEDKALSLEYVSTYMPRVLEGWKAGQGSTSLKPQRLRKLEGGLEKIEEGLKIMRD # GKYGREKLVYTIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g751 ### # start gene g752 5 AUGUSTUS gene 3865304 3866213 0.63 + . g752 5 AUGUSTUS transcript 3865304 3866213 0.63 + . g752.t1 5 AUGUSTUS start_codon 3865304 3865306 . + 0 transcript_id "g752.t1"; gene_id "g752"; 5 AUGUSTUS CDS 3865304 3865321 0.64 + 0 transcript_id "g752.t1"; gene_id "g752"; 5 AUGUSTUS CDS 3865374 3866213 0.85 + 0 transcript_id "g752.t1"; gene_id "g752"; 5 AUGUSTUS stop_codon 3866211 3866213 . + 0 transcript_id "g752.t1"; gene_id "g752"; # protein sequence = [MSTIVPTRRALRNTRTATAKDAENANARPSRINTRAKPPSSSANNSGATYSIVNRATGATAASRAKISVNGDPKSDHP # VSKRKREALGEVTSLVANNKPGGKGKNKEIAQKFDGVVINKSKTVRQPLRTVASTRQSTTSTLVDNNEPLGEIAESQEIDDTAMIVDPPPRKVLPALT # IPKSLANLRDIPHTRTSARRSAHQAADDDLEAERVFKKARTSSDAPEDAVEEQWADQHELDALEEEVEADPNGPDWDDLDQDDGDDPVMVSEYVVEIF # EYFKKIEVCGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g752 ### # start gene g753 5 AUGUSTUS gene 3866278 3867237 0.3 + . g753 5 AUGUSTUS transcript 3866278 3867237 0.3 + . g753.t1 5 AUGUSTUS start_codon 3866278 3866280 . + 0 transcript_id "g753.t1"; gene_id "g753"; 5 AUGUSTUS CDS 3866278 3866790 0.3 + 0 transcript_id "g753.t1"; gene_id "g753"; 5 AUGUSTUS CDS 3866843 3866980 0.47 + 0 transcript_id "g753.t1"; gene_id "g753"; 5 AUGUSTUS CDS 3867049 3867237 0.46 + 0 transcript_id "g753.t1"; gene_id "g753"; 5 AUGUSTUS stop_codon 3867235 3867237 . + 0 transcript_id "g753.t1"; gene_id "g753"; # protein sequence = [MANQKDLGWTMRGILFDWLIELQERFRLLPETLFLCMNIVDRFLSARVVSLARLQLVGVTSMFIAAKVEEIVCPSAEE # FLAQTEASYSVADVFGAERYVLKTLNWNLNYANPVHFLRRVSKADDYNVKARTIAKYLLEIACLEWRLIAAPPSLLAAAAMWLARISLGSEIWTPNLA # HYSTYSESVLIPTANLMLNYILKPIKHESFYRKYARRKYMKVSVFMRRWAMNRWQEGIPVDLKAELPALKADCQAHRAQNGFVEDGEDDELLVAEQVL # GLRTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g753 ### # start gene g754 5 AUGUSTUS gene 3872492 3872668 0.9 + . g754 5 AUGUSTUS transcript 3872492 3872668 0.9 + . g754.t1 5 AUGUSTUS start_codon 3872492 3872494 . + 0 transcript_id "g754.t1"; gene_id "g754"; 5 AUGUSTUS CDS 3872492 3872668 0.9 + 0 transcript_id "g754.t1"; gene_id "g754"; 5 AUGUSTUS stop_codon 3872666 3872668 . + 0 transcript_id "g754.t1"; gene_id "g754"; # protein sequence = [MSDPAKFAIPVPSKDPASKKPDQTDKEEGTSKLEVKKDEEKDGDELVLYSPKFELEGY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g754 ### # start gene g755 5 AUGUSTUS gene 3873036 3873596 0.65 + . g755 5 AUGUSTUS transcript 3873036 3873596 0.65 + . g755.t1 5 AUGUSTUS start_codon 3873036 3873038 . + 0 transcript_id "g755.t1"; gene_id "g755"; 5 AUGUSTUS CDS 3873036 3873596 0.65 + 0 transcript_id "g755.t1"; gene_id "g755"; 5 AUGUSTUS stop_codon 3873594 3873596 . + 0 transcript_id "g755.t1"; gene_id "g755"; # protein sequence = [MTYSDTQPRGTLKYRLLSASLKPVNAPLVDPGTWGHEYVRHLAAELGEEFEHREEQEGGTSTESETSKVEVPGTIEDL # RSLAKECSLFLLSHNAEPDAVDLLQELEMIESIVTLVDENTFDRVCQYMTRCVSFLPPPDDIAFLQTVHKIYTQFQKFPEAITLAIRLGDRDMVRDDF # NAAGNPYVFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g755 ### # start gene g756 5 AUGUSTUS gene 3874255 3875140 0.42 + . g756 5 AUGUSTUS transcript 3874255 3875140 0.42 + . g756.t1 5 AUGUSTUS start_codon 3874255 3874257 . + 0 transcript_id "g756.t1"; gene_id "g756"; 5 AUGUSTUS CDS 3874255 3874528 0.42 + 0 transcript_id "g756.t1"; gene_id "g756"; 5 AUGUSTUS CDS 3874677 3875140 1 + 2 transcript_id "g756.t1"; gene_id "g756"; 5 AUGUSTUS stop_codon 3875138 3875140 . + 0 transcript_id "g756.t1"; gene_id "g756"; # protein sequence = [MSIFQAGCYLAIGISNASIRTETDAALALLAEHVENKSVPLRTGAIMGLGMAYAGSQREEVMATLLPLIVDEDVSMEI # CSLAALALGFVFVVSQLASADISQGQQNGSDATLETLKAIEKPISKTAQVIVEGCAFAGTTNVLRVQKMLHECDEHIVPPKEDEKKEGDKEKKEGDEK # KDGEEKKEEPSKQDDAFQTFAVIAIALISMGEEIGSQMSMRQFNHLVSSFKICSYNVQYFLTLSVDALW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g756 ### # start gene g757 5 AUGUSTUS gene 3877544 3878157 0.95 + . g757 5 AUGUSTUS transcript 3877544 3878157 0.95 + . g757.t1 5 AUGUSTUS start_codon 3877544 3877546 . + 0 transcript_id "g757.t1"; gene_id "g757"; 5 AUGUSTUS CDS 3877544 3877556 0.95 + 0 transcript_id "g757.t1"; gene_id "g757"; 5 AUGUSTUS CDS 3877652 3878157 1 + 2 transcript_id "g757.t1"; gene_id "g757"; 5 AUGUSTUS stop_codon 3878155 3878157 . + 0 transcript_id "g757.t1"; gene_id "g757"; # protein sequence = [MSTGSKRTDWVSQWYHPEAHTYDRCLPWTDLPDIGNSGIQPYPCPEEWEVRDRLVAGAIVSNTVNPVGLGIDETKCAS # EIWSRLIKWFKKQDEQRIYLAETALRHEVFDPTADNVELHEKKMQNLLKKVHNLGGTTMDAQFRRIIIFSMPPDWRQDIRTVPDTLSKDAFTYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g757 ### # start gene g758 5 AUGUSTUS gene 3886139 3886783 0.8 + . g758 5 AUGUSTUS transcript 3886139 3886783 0.8 + . g758.t1 5 AUGUSTUS start_codon 3886139 3886141 . + 0 transcript_id "g758.t1"; gene_id "g758"; 5 AUGUSTUS CDS 3886139 3886783 0.8 + 0 transcript_id "g758.t1"; gene_id "g758"; 5 AUGUSTUS stop_codon 3886781 3886783 . + 0 transcript_id "g758.t1"; gene_id "g758"; # protein sequence = [MRSIRPQLAVRIVSPFYSISFDLLNLIHLIHLDLATSLRQAMDLNDQMKQIGSLFDTARELFLRSILDLQNAGEDPVV # VLEALKAAKPNHRAINLNEWTLMATLFRWPSPFNLSGLDFDNRTPSEWIELLCSIHSGESTAHIDDKGHLVKSSPPPDSATEALEGLKEVERGSADEG # TSSQVGGSVPMELDLPTIESLAERTLSPEKGAESAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g758 ### # start gene g759 5 AUGUSTUS gene 3889094 3889444 0.87 + . g759 5 AUGUSTUS transcript 3889094 3889444 0.87 + . g759.t1 5 AUGUSTUS start_codon 3889094 3889096 . + 0 transcript_id "g759.t1"; gene_id "g759"; 5 AUGUSTUS CDS 3889094 3889444 0.87 + 0 transcript_id "g759.t1"; gene_id "g759"; 5 AUGUSTUS stop_codon 3889442 3889444 . + 0 transcript_id "g759.t1"; gene_id "g759"; # protein sequence = [MVLLVSARFIATLTVMFLLTVCRVSLKIKVIQFNSNPFQADEACSILKSRQDSGSDSSVSDASFTTAQSIPTTGSEDT # IVTPTEIAVPVLKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g759 ### # start gene g760 5 AUGUSTUS gene 3889698 3890390 0.97 - . g760 5 AUGUSTUS transcript 3889698 3890390 0.97 - . g760.t1 5 AUGUSTUS stop_codon 3889698 3889700 . - 0 transcript_id "g760.t1"; gene_id "g760"; 5 AUGUSTUS CDS 3889698 3890390 0.97 - 0 transcript_id "g760.t1"; gene_id "g760"; 5 AUGUSTUS start_codon 3890388 3890390 . - 0 transcript_id "g760.t1"; gene_id "g760"; # protein sequence = [MILWADRVTPRRSLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVQHRVDANK # VAELRRFERKYRHTIKDWNFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRQTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHEL # IDLTAEQLDLMVKDEDEYWMTPENDYIFDAIPHLRLSDINSDEELSEEEDQQLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g760 ### # start gene g761 5 AUGUSTUS gene 3890508 3891914 0.67 - . g761 5 AUGUSTUS transcript 3890508 3891914 0.67 - . g761.t1 5 AUGUSTUS stop_codon 3890508 3890510 . - 0 transcript_id "g761.t1"; gene_id "g761"; 5 AUGUSTUS CDS 3890508 3891400 0.97 - 2 transcript_id "g761.t1"; gene_id "g761"; 5 AUGUSTUS CDS 3891482 3891914 0.7 - 0 transcript_id "g761.t1"; gene_id "g761"; 5 AUGUSTUS start_codon 3891912 3891914 . - 0 transcript_id "g761.t1"; gene_id "g761"; # protein sequence = [MGLTDTSYKAVGWYIYQIDPSEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRCLTVETDASYI # KGMLDNPSCGPNATINCWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVNEDDPRSGYLYETAQEADDIELDVQEALDEERSYK # IHRNYMLESKNETCEVFSRNLFPTFDEEFVQNNPYSEAHRSSEGNRLDELIPLIGKYLSNPTDEVLGEMSKEERIKFIRLIKKFQVDDQGRLYHRNTD # QPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFVTNDFLQKRFWWPDIYKDVEWYVRSCQECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMLIPSNGC # KYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYVIKGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g761 ### # start gene g762 5 AUGUSTUS gene 3892489 3893019 0.98 + . g762 5 AUGUSTUS transcript 3892489 3893019 0.98 + . g762.t1 5 AUGUSTUS start_codon 3892489 3892491 . + 0 transcript_id "g762.t1"; gene_id "g762"; 5 AUGUSTUS CDS 3892489 3893019 0.98 + 0 transcript_id "g762.t1"; gene_id "g762"; 5 AUGUSTUS stop_codon 3893017 3893019 . + 0 transcript_id "g762.t1"; gene_id "g762"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSESISAISQPRRRNRGFSPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIESPILQAIARRTGKQPQCHAASESPRDPPPHFDLDAGDHNDQDPPVDPDNPGANNNHDNLDDDSGSLPRGEPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g762 ### # start gene g763 5 AUGUSTUS gene 3893768 3894709 0.97 + . g763 5 AUGUSTUS transcript 3893768 3894709 0.97 + . g763.t1 5 AUGUSTUS start_codon 3893768 3893770 . + 0 transcript_id "g763.t1"; gene_id "g763"; 5 AUGUSTUS CDS 3893768 3894709 0.97 + 0 transcript_id "g763.t1"; gene_id "g763"; 5 AUGUSTUS stop_codon 3894707 3894709 . + 0 transcript_id "g763.t1"; gene_id "g763"; # protein sequence = [MLELLSGFKGSIETLGTVLATLGHPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLS # YLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVNDTQGEAEDSLGNLKMKEPRTSGSTPWLLVPTGILLPWAYGRGLAECIKDEMARLP # EPATLADYRQEVRRIDNRYWKREETGKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSLAPFTPKPKPFSGGKPNNNGKPQNSSNSGQPGGQRP # AFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g763 ### # start gene g764 5 AUGUSTUS gene 3895132 3895863 0.92 + . g764 5 AUGUSTUS transcript 3895132 3895863 0.92 + . g764.t1 5 AUGUSTUS start_codon 3895132 3895134 . + 0 transcript_id "g764.t1"; gene_id "g764"; 5 AUGUSTUS CDS 3895132 3895863 0.92 + 0 transcript_id "g764.t1"; gene_id "g764"; 5 AUGUSTUS stop_codon 3895861 3895863 . + 0 transcript_id "g764.t1"; gene_id "g764"; # protein sequence = [MANIAVWFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNLLIDRASRNITFRNTSHFDSPQTSVPSAINPVVAKVTV # PLPELSPLVSPTILETPPGDSLRSRSCSCSRTLRAKPLSSKFPFEPIYSYPMVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYTEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGCHEAAEAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g764 ### # start gene g765 5 AUGUSTUS gene 3897436 3899532 0.89 - . g765 5 AUGUSTUS transcript 3897436 3899532 0.89 - . g765.t1 5 AUGUSTUS stop_codon 3897436 3897438 . - 0 transcript_id "g765.t1"; gene_id "g765"; 5 AUGUSTUS CDS 3897436 3899532 0.89 - 0 transcript_id "g765.t1"; gene_id "g765"; 5 AUGUSTUS start_codon 3899530 3899532 . - 0 transcript_id "g765.t1"; gene_id "g765"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELLE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIQIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYQRFIRNFAKIARPLNDLTKKDTSFTWT # DTQQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQQQTTTYALRYSVNATTIQLQDTPDYTGHSTWSVP # ISGGLRCALLWKNTLRDARFVPVRRSSDTHGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g765 ### # start gene g766 5 AUGUSTUS gene 3899832 3900749 0.45 - . g766 5 AUGUSTUS transcript 3899832 3900749 0.45 - . g766.t1 5 AUGUSTUS stop_codon 3899832 3899834 . - 0 transcript_id "g766.t1"; gene_id "g766"; 5 AUGUSTUS CDS 3899832 3900749 0.45 - 0 transcript_id "g766.t1"; gene_id "g766"; 5 AUGUSTUS start_codon 3900747 3900749 . - 0 transcript_id "g766.t1"; gene_id "g766"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAILVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g766 ### # start gene g767 5 AUGUSTUS gene 3902105 3902740 0.39 + . g767 5 AUGUSTUS transcript 3902105 3902740 0.39 + . g767.t1 5 AUGUSTUS start_codon 3902105 3902107 . + 0 transcript_id "g767.t1"; gene_id "g767"; 5 AUGUSTUS CDS 3902105 3902740 0.39 + 0 transcript_id "g767.t1"; gene_id "g767"; 5 AUGUSTUS stop_codon 3902738 3902740 . + 0 transcript_id "g767.t1"; gene_id "g767"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTQKGAPWIWDSSC # QEAFENLKTAFTSAPILADWEPNRPLIVETDTSDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVV # TDHKNLEYFSTTKVVTCRQVRWSEFLHQFNMVIRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g767 ### # start gene g768 5 AUGUSTUS gene 3902927 3904379 0.71 + . g768 5 AUGUSTUS transcript 3902927 3904379 0.71 + . g768.t1 5 AUGUSTUS start_codon 3902927 3902929 . + 0 transcript_id "g768.t1"; gene_id "g768"; 5 AUGUSTUS CDS 3902927 3903523 0.71 + 0 transcript_id "g768.t1"; gene_id "g768"; 5 AUGUSTUS CDS 3903633 3904379 0.98 + 0 transcript_id "g768.t1"; gene_id "g768"; 5 AUGUSTUS stop_codon 3904377 3904379 . + 0 transcript_id "g768.t1"; gene_id "g768"; # protein sequence = [MDIEALHQAIILALPANPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNR # TLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVIVDRSSKQAIFIPTHNTITSEQLA # ELFVIHVFSKHGVPNHVTSDRGSTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELH # AFLLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLHRIHPVFHVSQLEPVTPNPFPNRTQS # PPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g768 ### # start gene g769 5 AUGUSTUS gene 3907937 3908665 0.54 + . g769 5 AUGUSTUS transcript 3907937 3908665 0.54 + . g769.t1 5 AUGUSTUS start_codon 3907937 3907939 . + 0 transcript_id "g769.t1"; gene_id "g769"; 5 AUGUSTUS CDS 3907937 3908144 0.79 + 0 transcript_id "g769.t1"; gene_id "g769"; 5 AUGUSTUS CDS 3908247 3908665 0.65 + 2 transcript_id "g769.t1"; gene_id "g769"; 5 AUGUSTUS stop_codon 3908663 3908665 . + 0 transcript_id "g769.t1"; gene_id "g769"; # protein sequence = [MRLVPSRDLDPFASLRGQGVLVRNSSTVPPPVTSKTLSPPPSTKAPVVPPRALRRNREVEGLKADASAFHNELLNGFP # SVGSAARASSSSTKVPMGRKEPKSKTTIKAVEDSKASNSPPASMVYKRVRLPPRLRKIAPVTAKGKSRQVVVSEDDSASNEVESEDEEEDEDEEEDSA # PPPKRLKTTSSISGKIFILHFSSFYFINLIGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g769 ### # start gene g770 5 AUGUSTUS gene 3909266 3909916 0.39 + . g770 5 AUGUSTUS transcript 3909266 3909916 0.39 + . g770.t1 5 AUGUSTUS start_codon 3909266 3909268 . + 0 transcript_id "g770.t1"; gene_id "g770"; 5 AUGUSTUS CDS 3909266 3909314 0.39 + 0 transcript_id "g770.t1"; gene_id "g770"; 5 AUGUSTUS CDS 3909363 3909916 0.98 + 2 transcript_id "g770.t1"; gene_id "g770"; 5 AUGUSTUS stop_codon 3909914 3909916 . + 0 transcript_id "g770.t1"; gene_id "g770"; # protein sequence = [MDALNALHKASTSSTHNLANSLQRATDLNDQLKQLGSLFDTTRDLFLRSILDLQNAGEDPIIVLESLKTAEPNRRAIT # LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIHSGESTVRVDENGRLVESSPPPDSATEAFEGLNEVEKGSADEGTRSQVGGSVPMELDLP # MIESLAEQTLSPEKGAEPAQTLES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g770 ### # start gene g771 5 AUGUSTUS gene 3910965 3912417 0.1 + . g771 5 AUGUSTUS transcript 3910965 3912417 0.1 + . g771.t1 5 AUGUSTUS start_codon 3910965 3910967 . + 0 transcript_id "g771.t1"; gene_id "g771"; 5 AUGUSTUS CDS 3910965 3911132 0.98 + 0 transcript_id "g771.t1"; gene_id "g771"; 5 AUGUSTUS CDS 3911640 3911666 0.44 + 0 transcript_id "g771.t1"; gene_id "g771"; 5 AUGUSTUS CDS 3911773 3912417 0.33 + 0 transcript_id "g771.t1"; gene_id "g771"; 5 AUGUSTUS stop_codon 3912415 3912417 . + 0 transcript_id "g771.t1"; gene_id "g771"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRQSTEYLHDLLMNSASEDELNRRSTPYPTIGSN # KGSNKDEKSVVNEVSPRLSKVHCHTDSHVSSNCMSCLAEDKGESIQFKSVSNGFLFHDLVTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLN # FQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTENAVPVLKTVERATTPFTRGVTPMMEDK # GHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g771 ### # start gene g772 5 AUGUSTUS gene 3912669 3913360 0.32 - . g772 5 AUGUSTUS transcript 3912669 3913360 0.32 - . g772.t1 5 AUGUSTUS stop_codon 3912669 3912671 . - 0 transcript_id "g772.t1"; gene_id "g772"; 5 AUGUSTUS CDS 3912669 3912968 0.59 - 0 transcript_id "g772.t1"; gene_id "g772"; 5 AUGUSTUS CDS 3913052 3913360 0.41 - 0 transcript_id "g772.t1"; gene_id "g772"; 5 AUGUSTUS start_codon 3913358 3913360 . - 0 transcript_id "g772.t1"; gene_id "g772"; # protein sequence = [MILWADRVTLRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANK # VAELRRFERKYRHTIKDWDFKPGQLTTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDKDEYWMTPENDYIF # DAIPHLRLSDTDSDEELSKEEDQLLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g772 ### # start gene g773 5 AUGUSTUS gene 3913408 3914427 1 - . g773 5 AUGUSTUS transcript 3913408 3914427 1 - . g773.t1 5 AUGUSTUS stop_codon 3913408 3913410 . - 0 transcript_id "g773.t1"; gene_id "g773"; 5 AUGUSTUS CDS 3913408 3914427 1 - 0 transcript_id "g773.t1"; gene_id "g773"; 5 AUGUSTUS start_codon 3914425 3914427 . - 0 transcript_id "g773.t1"; gene_id "g773"; # protein sequence = [MGDKETEEPYQFDDFKDQIDPRSGYLYGTAQEADDIELDVQEALDEEHSYEIRRNHMLESKHATCEVFSRNLFPTFDE # EFVQNNPYPEVHRSSEGNRLDELIPLIGKYLSNPSDEFLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGH # KGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTL # GEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNLKLMERLKERIWTYARL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g773 ### # start gene g774 5 AUGUSTUS gene 3914518 3918458 0.95 - . g774 5 AUGUSTUS transcript 3914518 3918458 0.95 - . g774.t1 5 AUGUSTUS stop_codon 3914518 3914520 . - 0 transcript_id "g774.t1"; gene_id "g774"; 5 AUGUSTUS CDS 3914518 3916952 1 - 2 transcript_id "g774.t1"; gene_id "g774"; 5 AUGUSTUS CDS 3917027 3918458 0.95 - 0 transcript_id "g774.t1"; gene_id "g774"; 5 AUGUSTUS start_codon 3918456 3918458 . - 0 transcript_id "g774.t1"; gene_id "g774"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNDNTKRLVFDGVHIPTKPGLIPGKLVETTNGNQKTVRFEAPKSIDWPLKKPSVTIE # DVDESNDEDAIKLIPSSRPMNQINSEHRPYDHVQPRTYRPIQINTPTKVPKDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFNAKVDLSMEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDNPSKVQMIDTCIRIEDLWQDQADMFEVLTESHNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNNQINTSRYNEPKNVPPDNEKSTGENDSK # GNFHSSMNGYKQCEQETFSKKELSEAYVLASREHLKSQDDQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGELDNQLNNDQFNLNPIKSFFLQNGRIKP # KPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNKNTSETIRDDNWNKPKNSQRTRKRKVRYEILKRGTESFQRSQPSFEKVRYESRQRKK # GKAQDSKDKKENVQPDLLNEPPTNKLEERIKLNQQDKSPINLIDETNKQVVIEAIRVEEPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHG # DPLLELPELSKHPKPFVPTGRYTKERKEIIDKNHPEGFLWKQERDLMHEMMCKQEAGFAWGPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIF # EDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTF # QTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSR # TKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCP # ALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMMLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSC # GPNATINRWIEHVRNYHFTLIHVKGATHGPDGLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g774 ### # start gene g775 5 AUGUSTUS gene 3918488 3918838 0.86 - . g775 5 AUGUSTUS transcript 3918488 3918838 0.86 - . g775.t1 5 AUGUSTUS stop_codon 3918488 3918490 . - 0 transcript_id "g775.t1"; gene_id "g775"; 5 AUGUSTUS CDS 3918488 3918838 0.86 - 0 transcript_id "g775.t1"; gene_id "g775"; 5 AUGUSTUS start_codon 3918836 3918838 . - 0 transcript_id "g775.t1"; gene_id "g775"; # protein sequence = [MDLRNPERLNGGPRHGLDSYKLRDNARMPRDDPNIPRCKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g775 ### # start gene g776 5 AUGUSTUS gene 3919419 3921109 0.64 + . g776 5 AUGUSTUS transcript 3919419 3921109 0.64 + . g776.t1 5 AUGUSTUS start_codon 3919419 3919421 . + 0 transcript_id "g776.t1"; gene_id "g776"; 5 AUGUSTUS CDS 3919419 3920231 0.64 + 0 transcript_id "g776.t1"; gene_id "g776"; 5 AUGUSTUS CDS 3920300 3921109 0.99 + 0 transcript_id "g776.t1"; gene_id "g776"; 5 AUGUSTUS stop_codon 3921107 3921109 . + 0 transcript_id "g776.t1"; gene_id "g776"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFNLDTGDHEDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGEPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALWVS # QRMVVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARL # PEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQR # PAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g776 ### # start gene g777 5 AUGUSTUS gene 3921442 3923638 0.6 + . g777 5 AUGUSTUS transcript 3921442 3923638 0.6 + . g777.t1 5 AUGUSTUS start_codon 3921442 3921444 . + 0 transcript_id "g777.t1"; gene_id "g777"; 5 AUGUSTUS CDS 3921442 3922262 0.77 + 0 transcript_id "g777.t1"; gene_id "g777"; 5 AUGUSTUS CDS 3922376 3922789 0.78 + 1 transcript_id "g777.t1"; gene_id "g777"; 5 AUGUSTUS CDS 3922873 3923638 0.88 + 1 transcript_id "g777.t1"; gene_id "g777"; 5 AUGUSTUS stop_codon 3923636 3923638 . + 0 transcript_id "g777.t1"; gene_id "g777"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHPDSPQTSVPSAINPVAAKVAV # PLPEPSPSVSPTILETPPGDSLRPRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPSFL # AKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHQEHVKEVLRRLRHH # RLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLDDIVVPMTRLTRKGAPWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYA # IAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFR # PGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLKAQPYEPRLSWISKPYTKLSFSPFPPIRAPLLVWNLLKILPMNVGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g777 ### # start gene g778 5 AUGUSTUS gene 3923928 3924893 0.92 + . g778 5 AUGUSTUS transcript 3923928 3924893 0.92 + . g778.t1 5 AUGUSTUS start_codon 3923928 3923930 . + 0 transcript_id "g778.t1"; gene_id "g778"; 5 AUGUSTUS CDS 3923928 3924893 0.92 + 0 transcript_id "g778.t1"; gene_id "g778"; 5 AUGUSTUS stop_codon 3924891 3924893 . + 0 transcript_id "g778.t1"; gene_id "g778"; # protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKA # LSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDEL # HVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPF # PNRTQSPPPPIEVDGEEEYNVAEILGLQAGQKVQTLSSTLLHSVGRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g778 ### # start gene g779 5 AUGUSTUS gene 3951657 3952862 0.87 + . g779 5 AUGUSTUS transcript 3951657 3952862 0.87 + . g779.t1 5 AUGUSTUS start_codon 3951657 3951659 . + 0 transcript_id "g779.t1"; gene_id "g779"; 5 AUGUSTUS CDS 3951657 3952862 0.87 + 0 transcript_id "g779.t1"; gene_id "g779"; 5 AUGUSTUS stop_codon 3952860 3952862 . + 0 transcript_id "g779.t1"; gene_id "g779"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTSADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGFKEGTRFGCTESTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g779 ### # start gene g780 5 AUGUSTUS gene 3953652 3956588 0.92 + . g780 5 AUGUSTUS transcript 3953652 3956588 0.92 + . g780.t1 5 AUGUSTUS start_codon 3953652 3953654 . + 0 transcript_id "g780.t1"; gene_id "g780"; 5 AUGUSTUS CDS 3953652 3956588 0.92 + 0 transcript_id "g780.t1"; gene_id "g780"; 5 AUGUSTUS stop_codon 3956586 3956588 . + 0 transcript_id "g780.t1"; gene_id "g780"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFIQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAVYLDDILIFSNDLEEHRQMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISKGEVRMDPVKVAAVRDWPVPTNLRELRGF # LGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPVLALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ # PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDN # RQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPG # LHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEG # VADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSAL # GMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYR # ILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSR # APKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g780 ### # start gene g781 5 AUGUSTUS gene 3959339 3960156 0.6 - . g781 5 AUGUSTUS transcript 3959339 3960156 0.6 - . g781.t1 5 AUGUSTUS stop_codon 3959339 3959341 . - 0 transcript_id "g781.t1"; gene_id "g781"; 5 AUGUSTUS CDS 3959339 3959956 0.99 - 0 transcript_id "g781.t1"; gene_id "g781"; 5 AUGUSTUS CDS 3960013 3960156 0.61 - 0 transcript_id "g781.t1"; gene_id "g781"; 5 AUGUSTUS start_codon 3960154 3960156 . - 0 transcript_id "g781.t1"; gene_id "g781"; # protein sequence = [MPGSQASMSASDWYKCTTRSSSKRSSDGGSKSQFKWGHQHKNIKISADEIHLGFYCKAPLLHSSKFSKFLRVINLSDR # SVLKPKTLRHPGICTYWKSSTHESFSHTISESSSTGNSFLWSSTGSVASSSFTAPLSSHSSVPEVKATSGPSSLSLEPGTITSHFDILPHLIGSETKG # VLRSAPIVVRHAGTILEKQISESATHIVWSGDLIMEELDFEVDLVYIAVKLANWDWEIEGNVSEGGNVRPGSELVLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g781 ### # start gene g782 5 AUGUSTUS gene 3962979 3963365 0.76 + . g782 5 AUGUSTUS transcript 3962979 3963365 0.76 + . g782.t1 5 AUGUSTUS start_codon 3962979 3962981 . + 0 transcript_id "g782.t1"; gene_id "g782"; 5 AUGUSTUS CDS 3962979 3963365 0.76 + 0 transcript_id "g782.t1"; gene_id "g782"; 5 AUGUSTUS stop_codon 3963363 3963365 . + 0 transcript_id "g782.t1"; gene_id "g782"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPLDRYRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g782 ### # start gene g783 5 AUGUSTUS gene 3963698 3966412 0.54 + . g783 5 AUGUSTUS transcript 3963698 3966412 0.54 + . g783.t1 5 AUGUSTUS start_codon 3963698 3963700 . + 0 transcript_id "g783.t1"; gene_id "g783"; 5 AUGUSTUS CDS 3963698 3966412 0.54 + 0 transcript_id "g783.t1"; gene_id "g783"; 5 AUGUSTUS stop_codon 3966410 3966412 . + 0 transcript_id "g783.t1"; gene_id "g783"; # protein sequence = [MTLRLEDVIRIQECIPEDVAMVLREVLESMGIEILGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLW # LYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRILYRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKID # EESNEDANAIAAKNRRRRRYTMAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMRHMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNL # ERALEFRRRLVADNRGTSYMVQCEPESVGEFPPEQFDQKRQLHGSDGRFLAQKHSSPRSTKVPEFFNPGNTATRSPQLCSGTSPNVHALAQNATPPPR # VNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAP # FGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTAGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQ # AMEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQ # GGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEG # RNTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKR # EFGSKFGPIDEVDEARRRLAWMKQMPEESLPTSSFASTNTLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g783 ### # start gene g784 5 AUGUSTUS gene 3967490 3970405 0.64 + . g784 5 AUGUSTUS transcript 3967490 3970405 0.64 + . g784.t1 5 AUGUSTUS start_codon 3967490 3967492 . + 0 transcript_id "g784.t1"; gene_id "g784"; 5 AUGUSTUS CDS 3967490 3970405 0.64 + 0 transcript_id "g784.t1"; gene_id "g784"; 5 AUGUSTUS stop_codon 3970403 3970405 . + 0 transcript_id "g784.t1"; gene_id "g784"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNIRISAALASEIVQPGAEGGTEELGRGVNGEKIHAGTLQSPPEAPQRPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASDSSA # TEGVQQPNDPENGNPGLEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKE # YIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGS # FEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEASHVGHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEK # VKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILS # QLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLG # AKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDATIIEALKRIARNEEESFVWEDGLIRREVVYTSQTLGPYE # GRSYSRTTTIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g784 ### # start gene g785 5 AUGUSTUS gene 3971975 3974619 0.66 - . g785 5 AUGUSTUS transcript 3971975 3974619 0.66 - . g785.t1 5 AUGUSTUS stop_codon 3971975 3971977 . - 0 transcript_id "g785.t1"; gene_id "g785"; 5 AUGUSTUS CDS 3971975 3973174 0.81 - 0 transcript_id "g785.t1"; gene_id "g785"; 5 AUGUSTUS CDS 3973282 3974619 0.82 - 0 transcript_id "g785.t1"; gene_id "g785"; 5 AUGUSTUS start_codon 3974617 3974619 . - 0 transcript_id "g785.t1"; gene_id "g785"; # protein sequence = [MSPTPTRPSSRTPSPLLPPLTALGELPSPAPESDGEVEADELAFTIESPSRPQLQLFETVFNTGKSLSAYCQDDPLWP # ILAEVASPCTNCLKTPGKCKVLPSSPWCTNCSSKKTCSLGKILRYRYFARRCNQDLAYSRRFLELHGTPAHNSTWGIPLTVWREYDSALHARTSSTSI # LLELNMLDEQDAVDADQQELQQFLTLQRDEATVAAKRKRNRSPVPVAGPSSKKIRSDASKKRSRRKSPAVEVNVEPFRRVRLVVPPVRSVAPVPPVRL # VAPTSPPVPPPASPSLMGVLHRDLPMQGPSDLVRLADAAEVHPGLVQQAGSSSPARTPIKGTGQDLLSSTMPPILRPALVPRNPASHPYRAENQRLAA # RVRLLETQLADSQRENSSLTSALRDTSHALESRQREVEQLRSSSQEFLQRQEEYRRIIDQFNTLDRALSGPSDQRDWDDATGKLSTSSRRISELTTAL # LYQHGITDEGNALSTRQRARLEELQEEVHRTRGRAAFVERMIKEYPDEGYYEVVLPPLSQLEGDLVKVRADLRRVATLAHRLYRSDPATVLHHHNRYI # GAIIEAVVAFLRRALETEDPDVMEHNIWLALDYMQTARGVHGDLHIRSISSIQWFFNNAVDQDEGLYTLMLENSRFDSDRPFLTAAQHAGFTSPPPDS # MEPPLHRRMLSLSTALPHRGGAGRWDDLVPAIPSDDQLMQDWEQLMLQYMHHITDTPLPVPDPPVPMSSTGPVPESSVEANVEQSLEAPIVQVSSPSG # GSHPPVPLFLSEQESPTSPSPPPRSPVLPLLFGSVASLSIDLTGDDDELYETEESYASRVDVAMEGTELAVGQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g785 ### # start gene g786 5 AUGUSTUS gene 3976046 3976264 0.82 - . g786 5 AUGUSTUS transcript 3976046 3976264 0.82 - . g786.t1 5 AUGUSTUS stop_codon 3976046 3976048 . - 0 transcript_id "g786.t1"; gene_id "g786"; 5 AUGUSTUS CDS 3976046 3976264 0.82 - 0 transcript_id "g786.t1"; gene_id "g786"; 5 AUGUSTUS start_codon 3976262 3976264 . - 0 transcript_id "g786.t1"; gene_id "g786"; # protein sequence = [MIQPQEPITNKDNNSVHVPTASNKDDDNIQDLDNVPTPPDQGHDEGDTNNNFDGGTDIENESDDDEYMPVKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g786 ### # start gene g787 5 AUGUSTUS gene 3980082 3981071 0.84 + . g787 5 AUGUSTUS transcript 3980082 3981071 0.84 + . g787.t1 5 AUGUSTUS start_codon 3980082 3980084 . + 0 transcript_id "g787.t1"; gene_id "g787"; 5 AUGUSTUS CDS 3980082 3981071 0.84 + 0 transcript_id "g787.t1"; gene_id "g787"; 5 AUGUSTUS stop_codon 3981069 3981071 . + 0 transcript_id "g787.t1"; gene_id "g787"; # protein sequence = [MPSSRPHSSFPHEFFPPLPILTSLAEEVSPVPESEGEVEQDQLAFTIDSPSCPHFQLFENIFNTGKPLAGYCQDDPLW # SLLAAVASPCTNCVEAPHNCKVLPNSPHCTNCSAKKTCSLGKILQYRYFAQHCNQDLAYSRRFLELHGTPMHHATWGISLETWRQYDANLHQCTSSTT # VLLELNMANDQDADAVDQQELRTYLALQQEKAAIAAKCKRNCSPSPVAGPSHKKTTGSEVPKRRPCCKHLTVEASSEPAPCVRLVIPPGRSVVVPPTI # VPHASPSPMEVPSRDEPLQGPAGLVQLAAAAEAQSGVVQRFVSPLQATTPIKGTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g787 ### # start gene g788 5 AUGUSTUS gene 3982278 3982583 0.82 + . g788 5 AUGUSTUS transcript 3982278 3982583 0.82 + . g788.t1 5 AUGUSTUS start_codon 3982278 3982280 . + 0 transcript_id "g788.t1"; gene_id "g788"; 5 AUGUSTUS CDS 3982278 3982583 0.82 + 0 transcript_id "g788.t1"; gene_id "g788"; 5 AUGUSTUS stop_codon 3982581 3982583 . + 0 transcript_id "g788.t1"; gene_id "g788"; # protein sequence = [MSVPVPSDEPTSAVGEGVPSSPIPSRVPLFLPEQESPTSPSPPPPSPSLPPLFGSVANLAIDLTGGDDDLYEPEDSHC # TRGSEADGMEVAPLSDVLKEEPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g788 ### # start gene g789 5 AUGUSTUS gene 4003120 4005355 0.12 + . g789 5 AUGUSTUS transcript 4003120 4005355 0.12 + . g789.t1 5 AUGUSTUS start_codon 4003120 4003122 . + 0 transcript_id "g789.t1"; gene_id "g789"; 5 AUGUSTUS CDS 4003120 4004058 0.13 + 0 transcript_id "g789.t1"; gene_id "g789"; 5 AUGUSTUS CDS 4004978 4005355 0.7 + 0 transcript_id "g789.t1"; gene_id "g789"; 5 AUGUSTUS stop_codon 4005353 4005355 . + 0 transcript_id "g789.t1"; gene_id "g789"; # protein sequence = [MRETHSDIEEEQYEVEYPTLPPQLKQNPNQYYYHFQEQQLLPPSYNNHQTIYPPGLVHPAASRGPAYTPSMGQVLNVP # MYHDPQLSPQYPIHQITQLAPAHIPMPLSRTQALTSLEASLPASSNASSKVSTPVPVRAQISNAMANPKCCSICARRPPSLTRLAILTPCAHALCPAC # LTSALNIVGEKDMECAGCRAKVADFKLVSITADEGVAEKVEDNSSSPSKAQEPKQLTHDNLLYNCELNENQTFDISDLDETDFFSDENLRASTPPPKV # KGMGRVFESGTVSGVEQAATKYHDPVVLRIDNVPWVSHHKSQLAKFSNKEEPARPLSACGSDSDAHSSVRAPDHADPTDADVEDEDGENDPQGDASLS # EESHPSSDEVRTPSSTTAANSSSSSSPEIDSIASAQDHMRDDIAREFGVEAQLVEALIQRLSMTQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g789 ### # start gene g790 5 AUGUSTUS gene 4006468 4007110 0.35 + . g790 5 AUGUSTUS transcript 4006468 4007110 0.35 + . g790.t1 5 AUGUSTUS start_codon 4006468 4006470 . + 0 transcript_id "g790.t1"; gene_id "g790"; 5 AUGUSTUS CDS 4006468 4006692 0.49 + 0 transcript_id "g790.t1"; gene_id "g790"; 5 AUGUSTUS CDS 4006757 4007110 0.65 + 0 transcript_id "g790.t1"; gene_id "g790"; 5 AUGUSTUS stop_codon 4007108 4007110 . + 0 transcript_id "g790.t1"; gene_id "g790"; # protein sequence = [MATTTVPSRSSYRTTLPSSKAMVTFTSFGIYNFDAGSSEIIGTNDPPNREPTHARPKEPQSRQSTLTAAHIQDTQDSK # QHCSNPPAPASQLAKKILARPPSLNGPPGPRIPMKFVVLAPIATEADAEDTSDDSVSDAEVSTSTASLSSSTCRTSGDHNSEMDEPTLRPLTVPPWHM # KSRRPNVCASAATSLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g790 ### # start gene g791 5 AUGUSTUS gene 4007449 4008306 0.66 - . g791 5 AUGUSTUS transcript 4007449 4008306 0.66 - . g791.t1 5 AUGUSTUS stop_codon 4007449 4007451 . - 0 transcript_id "g791.t1"; gene_id "g791"; 5 AUGUSTUS CDS 4007449 4008306 0.66 - 0 transcript_id "g791.t1"; gene_id "g791"; 5 AUGUSTUS start_codon 4008304 4008306 . - 0 transcript_id "g791.t1"; gene_id "g791"; # protein sequence = [MTTPTPARIPPIHVPITPKHLPKNPSSASIYSPYPATTASAPVASSHLPGPFSIARNVVATNGFRGLWLGHTGTVLRE # TGGTAVWFAVKEWVARVLKDRRAKADPSVLPAENNPSTLLPWESAFSGAISGAVCVAALYPADTVKSAMQTEEELREMRTYQKRASSAAREWSTSSSS # LPPISSSPSSASSSPTFPSATVSSSGAAPKPSSIKPTSAIRQTISNSKALAGAARVSIESMSFLETFLKIYRTHGAKGLYSGCGMSMARAVPSSGIVF # VVYDGLTAWFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g791 ### # start gene g792 5 AUGUSTUS gene 4020156 4020650 0.44 + . g792 5 AUGUSTUS transcript 4020156 4020650 0.44 + . g792.t1 5 AUGUSTUS start_codon 4020156 4020158 . + 0 transcript_id "g792.t1"; gene_id "g792"; 5 AUGUSTUS CDS 4020156 4020650 0.44 + 0 transcript_id "g792.t1"; gene_id "g792"; 5 AUGUSTUS stop_codon 4020648 4020650 . + 0 transcript_id "g792.t1"; gene_id "g792"; # protein sequence = [MTSKFAAVAGAKLVPTSMTKRKRIQEETELPTSTRSTDQRIFQNDTHLSKPRKNGRKRGSPKSTRLGCETSTEASPDG # PTVEEVDPIFPGHSKSSHIVSSPLPIRKALLKWYATVCTDRGMPWRKPHDVNLDMKGRAQRAYEVSDLLDAIFTDMKKLVHFDRYG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g792 ### # start gene g793 5 AUGUSTUS gene 4032334 4032849 0.31 - . g793 5 AUGUSTUS transcript 4032334 4032849 0.31 - . g793.t1 5 AUGUSTUS stop_codon 4032334 4032336 . - 0 transcript_id "g793.t1"; gene_id "g793"; 5 AUGUSTUS CDS 4032334 4032849 0.31 - 0 transcript_id "g793.t1"; gene_id "g793"; 5 AUGUSTUS start_codon 4032847 4032849 . - 0 transcript_id "g793.t1"; gene_id "g793"; # protein sequence = [MVVSRSAMTVIKVYIPEIRCNRISRRMGTCLSSVIVTPNAFSNCVIILGKIDLDIWLRFESTSNKRLSYDMQHSENMD # NRVLLKEPTLLLRSRSSNAFVAFDVDAVATGSTPLTFAPPSLSSSTSFTRPSKKVYSTSMNALIIFDTNAAGIGFCLFPLLIRDEESTPPAIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g793 ### # start gene g794 5 AUGUSTUS gene 4033785 4034177 0.33 - . g794 5 AUGUSTUS transcript 4033785 4034177 0.33 - . g794.t1 5 AUGUSTUS stop_codon 4033785 4033787 . - 0 transcript_id "g794.t1"; gene_id "g794"; 5 AUGUSTUS CDS 4033785 4034177 0.33 - 0 transcript_id "g794.t1"; gene_id "g794"; 5 AUGUSTUS start_codon 4034175 4034177 . - 0 transcript_id "g794.t1"; gene_id "g794"; # protein sequence = [MPSIEVGTVGGGTVLAPQQAILEMLGFKGAHPTHPGQNAQALARLIAAAVMAGELSLMSALAAGHLVRAHLVHNRSQL # NTPAASTPVTPGGPLGTETGGVLGIKARELGMSALTPSASTGSLPPYSLEKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g794 ### # start gene g795 5 AUGUSTUS gene 4034260 4035072 0.61 - . g795 5 AUGUSTUS transcript 4034260 4035072 0.61 - . g795.t1 5 AUGUSTUS stop_codon 4034260 4034262 . - 0 transcript_id "g795.t1"; gene_id "g795"; 5 AUGUSTUS CDS 4034260 4035072 0.61 - 0 transcript_id "g795.t1"; gene_id "g795"; 5 AUGUSTUS start_codon 4035070 4035072 . - 0 transcript_id "g795.t1"; gene_id "g795"; # protein sequence = [MRHYDYSRVMGACCENVVGFIPLPLGIAGPLKIDGHLFPIPMATAEGTLVASTSRGCKALNAGGGVTTVLTQDAMTRG # PAIDFPSIVQAAKCRAWIDSEEGYSIVKEAFESTSRFAKLRSLKCAMAGRTLFVRFATATGDAMGMNMISKGTEKALEVMQQHFPDMITLALSGNYCT # DKKPAAINWIEGRGKSVVAEAVIPGKVVKSVLKTTVEALCNLNTKKNLIGSAMAGSIGGFNAHAANILTAIFLATGQDPAQNVESSNCMTLMEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g795 ### # start gene g796 5 AUGUSTUS gene 4035147 4037628 0.33 - . g796 5 AUGUSTUS transcript 4035147 4037628 0.33 - . g796.t1 5 AUGUSTUS stop_codon 4035147 4035149 . - 0 transcript_id "g796.t1"; gene_id "g796"; 5 AUGUSTUS CDS 4035147 4035977 1 - 0 transcript_id "g796.t1"; gene_id "g796"; 5 AUGUSTUS CDS 4036536 4036991 0.48 - 0 transcript_id "g796.t1"; gene_id "g796"; 5 AUGUSTUS CDS 4037055 4037413 0.86 - 2 transcript_id "g796.t1"; gene_id "g796"; 5 AUGUSTUS CDS 4037502 4037524 0.75 - 1 transcript_id "g796.t1"; gene_id "g796"; 5 AUGUSTUS CDS 4037621 4037628 0.72 - 0 transcript_id "g796.t1"; gene_id "g796"; 5 AUGUSTUS start_codon 4037626 4037628 . - 0 transcript_id "g796.t1"; gene_id "g796"; # protein sequence = [MGQFRSSVNGDLTESVLNFTKEIPTSISGFAYDNACFRPVSSEALELEAPCFTNELVKSRSIHQTLAFTPGVKEDFTV # AFDRLIKSSPFHGGVEFEVEAKQAEAIGDMKSSKWVAYAATALVVRFWDLAKKADSLDIVLILAGYVLMHATFLLLFYRSRRLGSNFWLPSAIFTSSV # FALLLSLPIAMWFRIPMDPVALTEALPFLVCTVGFDKPLRLARVVFSHPHLQSPVGGSSSNGQLKPAGEIVLESLSSVYTPIFRDYVLEIAVLVIGAY # SKVNGLSEHVLNSLAATEHIEAEVNEGTETNNHGLLVKVNPSIHVRVIPLDSAIHDSASSSSDSGTSRSTSEIVENFMSSWSRLVGDPVLSKWIVMVL # AVSISLNGYLLKGIAAGLGGKGSVAKLGGVRFGGDATAEPSSSYAHSEPVVVQQPVSPIALMPPPIIAPAPAPRRPATFTLDEVDRRLQARRLTQSSS # SQDASSSSSDNEENDVIVRSLEECIEIFEKGPRPVSVALSLLNDEEVILLAQNGKVAAYALEKVLGNTEYERAVRIRRALICKSIYSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g796 ### # start gene g797 5 AUGUSTUS gene 4055392 4056369 0.7 - . g797 5 AUGUSTUS transcript 4055392 4056369 0.7 - . g797.t1 5 AUGUSTUS stop_codon 4055392 4055394 . - 0 transcript_id "g797.t1"; gene_id "g797"; 5 AUGUSTUS CDS 4055392 4056369 0.7 - 0 transcript_id "g797.t1"; gene_id "g797"; 5 AUGUSTUS start_codon 4056367 4056369 . - 0 transcript_id "g797.t1"; gene_id "g797"; # protein sequence = [MQRKDIPPLTIASRGQQFSLFGGFASQSREIVLISDTQDIIQGMESPSSVTPSDTSTSGLSLNLRTHSTDSVLSLPSS # PPLENAFRPTFTSRKTSPPGYLTIINTPLSPVTPSSPYFSMPMTPPPSPLKSSSRPSSRESTKSLPVPTHTVTPPDFPRVLHRNSSPTVHTAVWPTTS # TFEEAPQFSRHNLGSDVVMPISAKGRQGKSIFSAKPTPVVHRPAIPTSSSSTNLLAPPPFRRHVHSRRRSNSTSAALDLKAQVDEPAIHSASQLTQQS # GSIPSNTPHASLGSLRAHTKSVLSKSKRFVHSRAQAISHVDSILGSTAPRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g797 ### # start gene g798 5 AUGUSTUS gene 4058099 4059247 0.8 + . g798 5 AUGUSTUS transcript 4058099 4059247 0.8 + . g798.t1 5 AUGUSTUS start_codon 4058099 4058101 . + 0 transcript_id "g798.t1"; gene_id "g798"; 5 AUGUSTUS CDS 4058099 4058736 0.85 + 0 transcript_id "g798.t1"; gene_id "g798"; 5 AUGUSTUS CDS 4058812 4059247 0.92 + 1 transcript_id "g798.t1"; gene_id "g798"; 5 AUGUSTUS stop_codon 4059245 4059247 . + 0 transcript_id "g798.t1"; gene_id "g798"; # protein sequence = [MVAQTRHTGQPSPKKLAFREKLITKGQSNDTLLKKLKTLHSELAEMDQELVDVNSMSSVRKELVSSSIMLHKDRGVKA # YAACCMADILRLYAPDAPYTQAELRDIFQFFFKQLSNNLKGPDVTYYTQYFHLLESLSTVKSVVLVCDLPNADELVLGIFRDMFAMIRRDLPKQIETF # MAEILVAIVDESSSLSGDVLEIIMAQFMDKSAVRNPFVCNQTADKLQRNVALYFTDIIVSNSEEEDFEQIRIAHDLIKRLHASCPNLLPSVIPQLEEE # LHADASTLRAIATQVLGEMFSDKSGGDLARNHPSTWNAWLGRKVDKSPAVRLRFVESSNGLYSAPPEMAEAIECKLLSLLSIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g798 ### # start gene g799 5 AUGUSTUS gene 4066298 4066633 0.35 + . g799 5 AUGUSTUS transcript 4066298 4066633 0.35 + . g799.t1 5 AUGUSTUS start_codon 4066298 4066300 . + 0 transcript_id "g799.t1"; gene_id "g799"; 5 AUGUSTUS CDS 4066298 4066633 0.35 + 0 transcript_id "g799.t1"; gene_id "g799"; 5 AUGUSTUS stop_codon 4066631 4066633 . + 0 transcript_id "g799.t1"; gene_id "g799"; # protein sequence = [MILPNTDRRAMDHFLPAINNTATDELQAHTGMFAAHSNDGYYKLGLEAAGLIREAVMLSRGVLQPETQIDPQLEKEEK # KAAEMEKEQVVEENKTEERESTAAQNTQSASAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g799 ### # start gene g800 5 AUGUSTUS gene 4071357 4072398 0.34 - . g800 5 AUGUSTUS transcript 4071357 4072398 0.34 - . g800.t1 5 AUGUSTUS stop_codon 4071357 4071359 . - 0 transcript_id "g800.t1"; gene_id "g800"; 5 AUGUSTUS CDS 4071357 4071847 0.98 - 2 transcript_id "g800.t1"; gene_id "g800"; 5 AUGUSTUS CDS 4071900 4072398 0.35 - 0 transcript_id "g800.t1"; gene_id "g800"; 5 AUGUSTUS start_codon 4072396 4072398 . - 0 transcript_id "g800.t1"; gene_id "g800"; # protein sequence = [MIRQKMDKLAETRIRSSTKQVPGVKVNKMLAEKIQRDEERERKREERKKRKVQKNIAEAGEGDAMNVDEEEEEDVISG # RKDAPTSVLTDPRFAKVFEDPEFEVDVSSREYALLNPSSVVQRKGFGERGKTAVEEEEEESDKMSSDGLGKSDSEDDSGNSSDSSDAGELNKFDPRVR # PGQKNVRAQEAYNRSKQQNRTSNVKLVPMRPQSGANGSQLGTGKEATFGQRRSHSSYPGGGKSASRANKVNIAEDGGMEMSWVPSANSQDARELSGQG # KTSKQQDRRKGVEKFGAGLEKGGEDPLELSENDRKGRVHRRQGIRSGSKNAFRRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g800 ### # start gene g801 5 AUGUSTUS gene 4076029 4076889 0.56 - . g801 5 AUGUSTUS transcript 4076029 4076889 0.56 - . g801.t1 5 AUGUSTUS stop_codon 4076029 4076031 . - 0 transcript_id "g801.t1"; gene_id "g801"; 5 AUGUSTUS CDS 4076029 4076624 1 - 2 transcript_id "g801.t1"; gene_id "g801"; 5 AUGUSTUS CDS 4076730 4076889 0.56 - 0 transcript_id "g801.t1"; gene_id "g801"; 5 AUGUSTUS start_codon 4076887 4076889 . - 0 transcript_id "g801.t1"; gene_id "g801"; # protein sequence = [MFQPHLDNGSIERWEDEEYGRVFRKIWEGKWEEYDAWDMDHRADAVMDLYGGPGLLSIDDNGPRRGTIQFLPDIKLST # AYILLRPYFNDQNKLDMNSTYFYGADPGQGQVVKDIWHPHLQLNKTIISCPKAEPGDYVFWHCDLVHKVEEEHNGTNDSSVVYIPVVPLCAYNIGNLI # DQRKAFLEGVPPPDMPPETESEGLEKEHEDRGTPDDVLTVEGRRLMGLETFVENEPGITSGQKAIREAANEALGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g801 ### # start gene g802 5 AUGUSTUS gene 4078286 4078855 0.56 - . g802 5 AUGUSTUS transcript 4078286 4078855 0.56 - . g802.t1 5 AUGUSTUS stop_codon 4078286 4078288 . - 0 transcript_id "g802.t1"; gene_id "g802"; 5 AUGUSTUS CDS 4078286 4078855 0.56 - 0 transcript_id "g802.t1"; gene_id "g802"; 5 AUGUSTUS start_codon 4078853 4078855 . - 0 transcript_id "g802.t1"; gene_id "g802"; # protein sequence = [METIRVTDYSSDADDTGESAVSDTESSFVEHHRLPNGLKSQSIIKGEGKGKRSVNSANTRSLFNPFVSDTSQSESDEY # SPSKNPRLHVSIPKADSGYDGPSFASSSSSPSPPPPIASPSPSFLSVDTAERYSTSFFDWEDRSIGGDELDGYVSSAHSSQWDLLDPPVLVSPTYSFA # EIPDSTSELSETN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g802 ### # start gene g803 5 AUGUSTUS gene 4080272 4082626 0.26 + . g803 5 AUGUSTUS transcript 4080272 4082626 0.26 + . g803.t1 5 AUGUSTUS start_codon 4080272 4080274 . + 0 transcript_id "g803.t1"; gene_id "g803"; 5 AUGUSTUS CDS 4080272 4080935 0.75 + 0 transcript_id "g803.t1"; gene_id "g803"; 5 AUGUSTUS CDS 4080994 4081484 0.27 + 2 transcript_id "g803.t1"; gene_id "g803"; 5 AUGUSTUS CDS 4081646 4082626 0.95 + 0 transcript_id "g803.t1"; gene_id "g803"; 5 AUGUSTUS stop_codon 4082624 4082626 . + 0 transcript_id "g803.t1"; gene_id "g803"; # protein sequence = [MSFSAPSPPASTSSGFSSKGSPQPDLELDPSDPLNLLLRNSQSTDSSMDDPSAGASPPDWSQLSELWSSSLDAGNLAG # EYIAKAFPDVMDYTIPLSSELDFTSQMAIDPHALHFDTQKLGLDSFPLLNDLTPSQNYPFTFQSETSTSPQGRRLSVISSSSSSGASLSPVIEPSPAP # LRLNAPQELSSSSLDAAAEELAQRVRQSAGILLAVPMNAHSQQNNHPDFSMFTGQQAMLNNGFIQQPASPQSLRSFASSTSSEASTPPPTTPPPTESV # YPNSFNASVSNVNPYANAGGTTGVMPRPKTSHTTIERRYRTNLNSRITSLKMAVPALRVLEDKEGCGVGGGGKKGKGKNATLGKNVVFGSKVKKEGED # GEDVVDVIDERGFQGLKALVNGLVGGPALLSEWEREWREKFGGEEKDEVEGEDIDDGGSDDEGSGDDDDADDEGVRKRKKAKITPAKKEPKEKRPPLP # SPQPLVLPDGSVVVPEKRKRGRPRKVMLPVVAAVAEPSVPLHQPGAQSSVVQQQQHPQHAQYLLAVFALFSFFNNPLSSSPSHPPPNHSHTGTILVHE # LPPSTSGYSGWSWHDVIQFFHLLVSILVFFSILAPWAPTLYKYVTRYASLKKLTLFNSSRPRSISLVDALSPDNRGTVREAAGLRHALGNRHGVFASV # KAIVGNTKQNIGFEQAGLEQRAWVRLGELSVLGGLLSFALYRASN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g803 ### # start gene g804 5 AUGUSTUS gene 4083296 4083735 0.39 - . g804 5 AUGUSTUS transcript 4083296 4083735 0.39 - . g804.t1 5 AUGUSTUS stop_codon 4083296 4083298 . - 0 transcript_id "g804.t1"; gene_id "g804"; 5 AUGUSTUS CDS 4083296 4083602 0.39 - 1 transcript_id "g804.t1"; gene_id "g804"; 5 AUGUSTUS CDS 4083662 4083735 0.39 - 0 transcript_id "g804.t1"; gene_id "g804"; 5 AUGUSTUS start_codon 4083733 4083735 . - 0 transcript_id "g804.t1"; gene_id "g804"; # protein sequence = [MGPGVPSQTALQQKRHFPFMNSGSNQNIIQDKLSLLIRSTFQLVHSLPTYPRVDLWHPPSQRLSRCHSQNQRQKNLGH # DEEHNVTSHPVELDWEEDSGGLTPLSYDRFEPIPGWKRKIFDGRGLRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g804 ### # start gene g805 5 AUGUSTUS gene 4084255 4085457 0.73 + . g805 5 AUGUSTUS transcript 4084255 4085457 0.73 + . g805.t1 5 AUGUSTUS start_codon 4084255 4084257 . + 0 transcript_id "g805.t1"; gene_id "g805"; 5 AUGUSTUS CDS 4084255 4085457 0.73 + 0 transcript_id "g805.t1"; gene_id "g805"; 5 AUGUSTUS stop_codon 4085455 4085457 . + 0 transcript_id "g805.t1"; gene_id "g805"; # protein sequence = [MYPIFSAFLLSLSSLSGTLAYQWPKSFLSSINPLIGSAGPEPNLSGGMIPSVAPPFGSTRWVAQNQESYVSATPFNYT # ESYMNNGTIHGFMGTRQPAIWMGESAWAAVVPGISSGSDGDILTGFEERAMPKIAGTEKFGVGLYSVELVIPESGGSTVEVLMSASSRVGHLQFTFKQ # GSESQFQPYIFLPTTRPSTIFHNPNTFETTYPNGTVQISPFTSEICGSNTEMQDFILAPNSIKDAASHFTGWYCATFDTSFNDTGYGITVGSGDSTMR # TERAESGSGEELGAYARFQFPSNGTESNSMTVNVRIATSLISADQARYHLNADSENKIGSFNIQDTQSNTENAWAEKVGRFHVETDGSSESEEKLAVF # MTGVFHAMQVSIIVPISYYNCLHIWILL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g805 ### # start gene g806 5 AUGUSTUS gene 4085899 4086649 0.15 + . g806 5 AUGUSTUS transcript 4085899 4086649 0.15 + . g806.t1 5 AUGUSTUS start_codon 4085899 4085901 . + 0 transcript_id "g806.t1"; gene_id "g806"; 5 AUGUSTUS CDS 4085899 4086093 0.41 + 0 transcript_id "g806.t1"; gene_id "g806"; 5 AUGUSTUS CDS 4086165 4086264 0.39 + 0 transcript_id "g806.t1"; gene_id "g806"; 5 AUGUSTUS CDS 4086348 4086649 0.82 + 2 transcript_id "g806.t1"; gene_id "g806"; 5 AUGUSTUS stop_codon 4086647 4086649 . + 0 transcript_id "g806.t1"; gene_id "g806"; # protein sequence = [MVGTHADSLLAEAVLKGFGAGSAEENGIQTTFTTDELTTMWKAAWKDASVPPVGDSNVVYSDREEDVDYEVRAGLSTF # FEQYSAGYGWVANDIHSESVIALLSTLIPVEIVQGNTPNLDGIAAGFYNSSSANTNYNVTSLLNDRSLANPWTVWNETASAPALATGGEDIKGFVQAR # QQNGDWAGINQISPYHFEQLEY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g806 ### # start gene g807 5 AUGUSTUS gene 4087142 4087681 0.51 + . g807 5 AUGUSTUS transcript 4087142 4087681 0.51 + . g807.t1 5 AUGUSTUS start_codon 4087142 4087144 . + 0 transcript_id "g807.t1"; gene_id "g807"; 5 AUGUSTUS CDS 4087142 4087152 0.94 + 0 transcript_id "g807.t1"; gene_id "g807"; 5 AUGUSTUS CDS 4087291 4087681 0.52 + 1 transcript_id "g807.t1"; gene_id "g807"; 5 AUGUSTUS stop_codon 4087679 4087681 . + 0 transcript_id "g807.t1"; gene_id "g807"; # protein sequence = [MSACPFFSSLNVSIPVPPFIPPSHPSITSNSFYNSTTNSYDLRILAPGAESKPYVKNLKVNGGVIGDKEEPLISHEEI # RFGGLIEFEMSDKAERWGGGRGAWAEITSDARRSSGVVFNDQSRSSIVSVEHVEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g807 ### # start gene g808 5 AUGUSTUS gene 4087791 4091166 0.26 + . g808 5 AUGUSTUS transcript 4087791 4091166 0.26 + . g808.t1 5 AUGUSTUS start_codon 4087791 4087793 . + 0 transcript_id "g808.t1"; gene_id "g808"; 5 AUGUSTUS CDS 4087791 4088434 0.37 + 0 transcript_id "g808.t1"; gene_id "g808"; 5 AUGUSTUS CDS 4088484 4088771 0.77 + 1 transcript_id "g808.t1"; gene_id "g808"; 5 AUGUSTUS CDS 4089522 4091166 0.99 + 1 transcript_id "g808.t1"; gene_id "g808"; 5 AUGUSTUS stop_codon 4091164 4091166 . + 0 transcript_id "g808.t1"; gene_id "g808"; # protein sequence = [MNKTSEFDPYADHSELRKVRSRLNAAQSAESITPISTRSRDVDTLKINATMSTNAGTSKLARPTPFTPKRPVGAGTSM # ERLTRATVTPAPHLLASTHKKYKAPISSDVRSRTHLRTNSSKPTTLAPVPGSRPSSPTKSDSGRPRTPGTPRRGTTPDPSMARTSEMDVTNVDPEEVL # VDYQNVEPADVSLGEMDEAWLKTMQADHGKEDKVMVSVRVKPDSKSAWKPSVSTNTIELDPAHARQPASFTFDAILTGSANKPIFTTVARSHVVAAME # GFNAVIFAYGQTASGKTYTLSGSEVEPGIIPRAMRQVDHIPFRDSKLTRLLQPSLSGNARISVICTINPDPSAVAESTSTLLFAKRVKGVKLHAQKKE # IIDTDALIERYRKEIDDLKRRLEEKENMLDDGKEEEKEKVTMKRRRMSAQEKADESQAMQDLQSRIQQLTKLILTSQTVTDEAAGGPPGESRPVSPIK # VDFDMSPYQVCSNFLYIQIQRSLTKPFSQLQQELLTARLQLSSQETQILSLEAALEAARAVESSVPSDAGDKDKTIQDQAKTIEEQAKKIRELENARF # TREPSPSRVDLDREQKDWSSRLDEEKKKREEKERWAEELVRQLEKEKWIRTKLEDERRALAAFVSKFDSLGMGSTFPTSNASSPISSPVGRRRSSFAA # GSVVGLGGIGAGRRRSSAFGFGGSSSLRQPLFPSSSESSGLSSLSSSTSTSTFVSSSSHSSLTSATSATSLSSVAASAPKPGLPMEEGDISIQITGVG # NFGDPNLSSSALSPLRLPEGHIYAGVPSLLEQMPEEAWVLGDVSFDDESISMAGTEEKVPSVAGGMKSHVKGSGTVRFSTSVDIMGGKENVGPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g808 ### # start gene g809 5 AUGUSTUS gene 4093302 4094122 0.68 - . g809 5 AUGUSTUS transcript 4093302 4094122 0.68 - . g809.t1 5 AUGUSTUS stop_codon 4093302 4093304 . - 0 transcript_id "g809.t1"; gene_id "g809"; 5 AUGUSTUS CDS 4093302 4093790 1 - 0 transcript_id "g809.t1"; gene_id "g809"; 5 AUGUSTUS CDS 4093856 4094122 0.68 - 0 transcript_id "g809.t1"; gene_id "g809"; 5 AUGUSTUS start_codon 4094120 4094122 . - 0 transcript_id "g809.t1"; gene_id "g809"; # protein sequence = [MVRLSSYAALLSGFASSMAAGIPTRRAMAVHDERELPVHFANAGTPSPDTLMNLKLALTASDMAGLEQTFWDVSTPGN # ALYGQHLSFEETKVFAAPTTDTVTAVTAWLNENGINNITTTGAFDDWLAFTVPISTANSLFEADFQNFTEIGGPTQLIRTLSYSLPVDLQQHINLLHP # STDFVRNIKGPIFRASVPGSSLNNTARALTAPSSCNSVVTPTCLQDLYGIPTTPATQASSKLAVSGFIDQWPQVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g809 ### # start gene g810 5 AUGUSTUS gene 4095216 4095917 0.38 - . g810 5 AUGUSTUS transcript 4095216 4095917 0.38 - . g810.t1 5 AUGUSTUS stop_codon 4095216 4095218 . - 0 transcript_id "g810.t1"; gene_id "g810"; 5 AUGUSTUS CDS 4095216 4095917 0.38 - 0 transcript_id "g810.t1"; gene_id "g810"; 5 AUGUSTUS start_codon 4095915 4095917 . - 0 transcript_id "g810.t1"; gene_id "g810"; # protein sequence = [MPPIGFENASNLPSSAFISPTSSLHQVFEQTLESSMQSTLIDYPSGFFFSLGIGPEDDTMFMHDPFKFDYAQDKIPLG # QDNLQMVNEDSAISTNSTTVHNSTAPDDSASLSLNRATSANFNIHNSTAPDDSASFSLPSERGMSRAIRIQSSLDILRTGRISPVEFLTELLDVTNPR # SAQFRGKLYSKTNKRVDDLLDKIVEDPMGEALIEDWFRRYGLRKVSLSRSYVLRGLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g810 ### # start gene g811 5 AUGUSTUS gene 4096814 4097230 0.78 + . g811 5 AUGUSTUS transcript 4096814 4097230 0.78 + . g811.t1 5 AUGUSTUS start_codon 4096814 4096816 . + 0 transcript_id "g811.t1"; gene_id "g811"; 5 AUGUSTUS CDS 4096814 4097230 0.78 + 0 transcript_id "g811.t1"; gene_id "g811"; 5 AUGUSTUS stop_codon 4097228 4097230 . + 0 transcript_id "g811.t1"; gene_id "g811"; # protein sequence = [MEELIHISADIVPRLFPVVEIQIPAGIRTPAQTARRSPRNKKATSYALGSKRRRNSDEEEEQREEKDTEQDNDEEVAP # TPLESKVSARSAVRPLAAKRTRVGPEGFPSSKDERPTGIPDRLLINLDSTSLVFGLLQID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g811 ### # start gene g812 5 AUGUSTUS gene 4098655 4098948 0.76 - . g812 5 AUGUSTUS transcript 4098655 4098948 0.76 - . g812.t1 5 AUGUSTUS stop_codon 4098655 4098657 . - 0 transcript_id "g812.t1"; gene_id "g812"; 5 AUGUSTUS CDS 4098655 4098948 0.76 - 0 transcript_id "g812.t1"; gene_id "g812"; 5 AUGUSTUS start_codon 4098946 4098948 . - 0 transcript_id "g812.t1"; gene_id "g812"; # protein sequence = [MTWDRAKEAVEGARRSVEGGVLGGVEKMQQVTGLKVGEVWKLGEEKQGKVVEAVKALEENVKEAEVHVLEAAKVVEKK # TEEAVSDAETKKEETKRLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g812 ### # start gene g813 5 AUGUSTUS gene 4102914 4104863 1 - . g813 5 AUGUSTUS transcript 4102914 4104863 1 - . g813.t1 5 AUGUSTUS stop_codon 4102914 4102916 . - 0 transcript_id "g813.t1"; gene_id "g813"; 5 AUGUSTUS CDS 4102914 4104863 1 - 0 transcript_id "g813.t1"; gene_id "g813"; 5 AUGUSTUS start_codon 4104861 4104863 . - 0 transcript_id "g813.t1"; gene_id "g813"; # protein sequence = [MESLGPARWSSIRPWIPPLSLSVREITSVSVTFVLSAATSDQNSETELSLADLGLSAEDMHEDEDVADDEDTSTSELD # AKKPLSMVSSALNGGLSVEVDRSSWRRVFIRIDDKADEAVIIVYGLLPGRQYEIVLELVQGGHTNSIRQQVTTEGVYFYAAIRSTVLQLPFPENETKD # ASHASDSDSTSKSTAASSSSDINVLNTSAQPSPPSDSNGSSPQPSSSPGYGFAPLTLEDRLNQLQHTLSVLNSEQASLTATIKSSRRDAQKADANLRS # EIDVLKRASDRYLSSEQRSKQKVLALQEVVKRTQIITKEMEATIKEVNAEIPGLKEEKQKREAEHRKVKEAANKVRREKDAQAEQERKRIESMKNELN # TLTKQLEKLEVKKEKLEGGVIKELEEQLENVEQEMEMLEREEEELSNGSFSQPMTSQSIGPTWTPGLSGRHPEDEVPKTPDPGTIGRPSPNSLSKSSL # IQRPQGLVHLPNPLSISNAHWTPISSPRHSQPHSPNHINQRTSSLPQPNPQGNPHHLHHVHHHSQQHQHHHSHANSHFPAARPSQPSPTIILMNPNRQ # SLKNTPGGSIGTPASSAVHAVDPSEAISNNLSPSPAMGSTASGVSTPSTTGSTLSSRAPPFEPGRSLIMRSTSQSRTRVGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g813 ### # start gene g814 5 AUGUSTUS gene 4107938 4108556 0.85 - . g814 5 AUGUSTUS transcript 4107938 4108556 0.85 - . g814.t1 5 AUGUSTUS stop_codon 4107938 4107940 . - 0 transcript_id "g814.t1"; gene_id "g814"; 5 AUGUSTUS CDS 4107938 4108323 0.9 - 2 transcript_id "g814.t1"; gene_id "g814"; 5 AUGUSTUS CDS 4108400 4108556 0.94 - 0 transcript_id "g814.t1"; gene_id "g814"; 5 AUGUSTUS start_codon 4108554 4108556 . - 0 transcript_id "g814.t1"; gene_id "g814"; # protein sequence = [MPVLRDLKDGAMPPYVIPRKGGDVSVFKSQAPEISFLIYYRPSSEEPITLTTEITERILARGLKLCPDLAPPEIRAER # EPTVDDLRPLILDVGVGFRPYRNGGVRVGVEWMDSSPLKDKGKKVPVVFNYGSGSNIRFAKLADVCILCISVCRHGGNGYQAAWGSAIMALEYLEGAL # KNQE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g814 ### # start gene g815 5 AUGUSTUS gene 4109875 4110600 0.99 - . g815 5 AUGUSTUS transcript 4109875 4110600 0.99 - . g815.t1 5 AUGUSTUS stop_codon 4109875 4109877 . - 0 transcript_id "g815.t1"; gene_id "g815"; 5 AUGUSTUS CDS 4109875 4110600 0.99 - 0 transcript_id "g815.t1"; gene_id "g815"; 5 AUGUSTUS start_codon 4110598 4110600 . - 0 transcript_id "g815.t1"; gene_id "g815"; # protein sequence = [MPHHHGEGPGGPDGPGGFGGGPGGPGGFEGHNGSDRGFGGGHHHGGFGGPGGFGGGPQGGFGGGPGGGGFPGDQNGGF # FGGPGGHHNHHGQGGFGHGNPGFGGFGGGSGGPGGQGGPGYGSGYGMPPHHSSHNSLLGKLVNKLEGGGNYQHHNGVSGLIPHVPNLFGNNHSHHQPP # PGYGGPGPNRDMAFGQGPPQQGRSGFMSPPPQFGGGGGFMPQGPSQGPGGPGGPGGPQTDGPPRW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g815 ### # start gene g816 5 AUGUSTUS gene 4112800 4114260 0.76 - . g816 5 AUGUSTUS transcript 4112800 4114260 0.76 - . g816.t1 5 AUGUSTUS stop_codon 4112800 4112802 . - 0 transcript_id "g816.t1"; gene_id "g816"; 5 AUGUSTUS CDS 4112800 4114260 0.76 - 0 transcript_id "g816.t1"; gene_id "g816"; 5 AUGUSTUS start_codon 4114258 4114260 . - 0 transcript_id "g816.t1"; gene_id "g816"; # protein sequence = [MVLPSKPVSSAKRRASKSPDATPLSKRAASSALEEGELDDSEDPVPPPASSNTNPTNPRPSISISAGPSSLPQKPTAK # PKVAFPFKTKKADSQNQASPVVNSAALLSGAASTTSSSAAKGVYVRPDEEKWRVSGGGGNDKRRNGDNNRGGSRWRDSPSRENGRGYNSRSNSRSRST # SRSPSRHRLPDRRSPRRSSRRRSLEYDRYADDRGRDDTRYYEERDRSRSRHYEPGYRRSDDRDWTRRDERRDHYRPQYDSYRPDYSRTKSRTPPPPPR # AEFSPPSTSSAFPIDRARTPPFPPPPFPPSPHSSNAPTLSTEPEPFPGNIPPQPKSPPPPAPPPDTRLNNTAIGLPERPAMYMPLHPHSNAQSQFHSN # LHAPRPNAPADFHSPPSLRHIAHTDMDSHQDRNWGSSVDPHRDPTKKSMPEPPPRIQLSLKRKSVSRRTREEEKKAFGRVFEGCGVKADYEATTKLGE # GTFGYVFPYTRDRPCA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g816 ### # start gene g817 5 AUGUSTUS gene 4117197 4119791 0.52 + . g817 5 AUGUSTUS transcript 4117197 4119791 0.52 + . g817.t1 5 AUGUSTUS start_codon 4117197 4117199 . + 0 transcript_id "g817.t1"; gene_id "g817"; 5 AUGUSTUS CDS 4117197 4117751 0.56 + 0 transcript_id "g817.t1"; gene_id "g817"; 5 AUGUSTUS CDS 4118424 4119791 0.99 + 0 transcript_id "g817.t1"; gene_id "g817"; 5 AUGUSTUS stop_codon 4119789 4119791 . + 0 transcript_id "g817.t1"; gene_id "g817"; # protein sequence = [MAQTTALHNKWARYHSQGAMSPECQELNALYSQAVDGAHVKIPERLRTPPEPPEDSKFILTELFKAAHTWIQAFLIRQ # GGADFAPVSVEEADDLIRHLFSASETTISEYKLVELARRIARKHGTDFRPYLSYINYGALHTHEKYELAVSLRMSPEEEAYMWNSLLRSDIVSSKDLA # DKKLSGPLRIFSVTTEEFIKRFSHIDTTYLPDTLPEADLSSLPEALRAVFTEPEDLVRRYLSMADITSQNLDQCAEFAWMHHADHQLFWIFDSILNRQ # PVDQYIVLKWLDTHPLLVFCILKKFLSDETDSLPEPWAKLGPTIVQHIIRAAHAVPVASLYALERLKAIVAAIEFHNYLELLELVTLAIRAPQQVTET # LLVLHECREVVRTESSAKEYVHKQALAVTIDRAQEAADVCPCDEDGKIKRQRSAPTVVPLLPAEEDDLHIIAHIRVDSPTTIRLHSHVRFRAASKPEK # GDMESSILDGLVTLSESGEIRVRLVHRPPPEFARMQWYLYDVGSVGKRFDMYMFVLSVVPILATFRAMMDAIRRIALEGSECCRFSRMITDASPTVVE # AAEELAGSSLEVEIVRETTVLSTETEVTEDDGLNESQREAVQKTRKAQVSLIWGPPGNKGTTLSSEYKTKQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g817 ### # start gene g818 5 AUGUSTUS gene 4121772 4122632 0.54 + . g818 5 AUGUSTUS transcript 4121772 4122632 0.54 + . g818.t1 5 AUGUSTUS start_codon 4121772 4121774 . + 0 transcript_id "g818.t1"; gene_id "g818"; 5 AUGUSTUS CDS 4121772 4122632 0.54 + 0 transcript_id "g818.t1"; gene_id "g818"; 5 AUGUSTUS stop_codon 4122630 4122632 . + 0 transcript_id "g818.t1"; gene_id "g818"; # protein sequence = [MFIFAALYCMSKFQDRRQALLLPQALSQNIPNRAALPQELSSAPSSMPIPTPASLFNSSSPSPPTSQRNPVPILIPSA # PYSTAWSAPSQIQPSSLPVQNSPSMPMSIHAHPLPPPSQQSLPTALHPMHIPESLSGQRSTVDVEPQPLSSSVQPIVPVQSLENGLPPPPPPCQPYTT # MQGSTGTNGYGQIASLQGHPRITVASGFPALTAIQRTNNNRLDHASHSLPRNARKEKKPRGKAIRPPSLARRDRGPNIEDCINIAVGGVEVITIDVLV # YLPLPPKAIINV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g818 ### # start gene g819 5 AUGUSTUS gene 4123459 4123942 0.19 + . g819 5 AUGUSTUS transcript 4123459 4123942 0.19 + . g819.t1 5 AUGUSTUS start_codon 4123459 4123461 . + 0 transcript_id "g819.t1"; gene_id "g819"; 5 AUGUSTUS CDS 4123459 4123539 0.35 + 0 transcript_id "g819.t1"; gene_id "g819"; 5 AUGUSTUS CDS 4123586 4123942 0.58 + 0 transcript_id "g819.t1"; gene_id "g819"; 5 AUGUSTUS stop_codon 4123940 4123942 . + 0 transcript_id "g819.t1"; gene_id "g819"; # protein sequence = [MSQGASMDHDPQHAIDGSTSSTSQPRLAFTSAAGIHSISSKLWEEDWISPSPLASIPEFFDHERTLAIFQIVAEVNRG # GSECAGFEVKGANDQEMALEFIKLMQASVRSQDWSKILSPYRHFMWYAILSIQQYFLITTASQSIIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g819 ### # start gene g820 5 AUGUSTUS gene 4129017 4130669 0.45 - . g820 5 AUGUSTUS transcript 4129017 4130669 0.45 - . g820.t1 5 AUGUSTUS stop_codon 4129017 4129019 . - 0 transcript_id "g820.t1"; gene_id "g820"; 5 AUGUSTUS CDS 4129017 4130669 0.45 - 0 transcript_id "g820.t1"; gene_id "g820"; 5 AUGUSTUS start_codon 4130667 4130669 . - 0 transcript_id "g820.t1"; gene_id "g820"; # protein sequence = [MKAAVDVWPSIALLLTDAKVHDASARLLHHTVMLSHYRLYTWVSESIERVLDYPSSNWWSRLMRAVAEVVELGVPGTF # QFDSLEFFPAIDPPKSYTWLFQKRQNDQRTANTLLASRIIFHWLGLPMESDDRHRVQSLFLKSIMDSCKTPSILLLDEVWNAYNAPSHLCSIGIKRAL # PSKSAMKKLERAFLEHPILGHERSSEIDELFTALHRAHCLFIGLSTTSSASSSGTLVPLPRSPSLLTALPASSFTQTSAPTSNIASNLPLQNPRVIFF # RNWLLEIAEIYVCSSPLSQDVLTAEQRRILNNSDSSCPFRELALSRRQVSGIQGPFARLSREAVFSALIFRGITFNTNALHETGHPGLFDTFEAWSQF # KSQHAHRGERFICNPHAYGPTKGRVLGNDQQFWTSSQVLYEKLMGSNISFIGIWKFITYGKDDRKRKLFPSFGDLSAYLLAVDFVYAGHIPWPTLEEV # ARAIAELSKGALHGLQKMGLLSVDRFGKEDVEKTFKALYSFLDEDEKFATVKKAVVFDSFMVEHALCKVSKDRVFENHSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g820 ### # start gene g821 5 AUGUSTUS gene 4135617 4136252 1 + . g821 5 AUGUSTUS transcript 4135617 4136252 1 + . g821.t1 5 AUGUSTUS start_codon 4135617 4135619 . + 0 transcript_id "g821.t1"; gene_id "g821"; 5 AUGUSTUS CDS 4135617 4136252 1 + 0 transcript_id "g821.t1"; gene_id "g821"; 5 AUGUSTUS stop_codon 4136250 4136252 . + 0 transcript_id "g821.t1"; gene_id "g821"; # protein sequence = [MTFSHSSLHSAAVYSSRYISDRYLPDKAIDLVDEAASALRLAQESKPDELESLDREIMTLQIELASLKNESDVFSVER # REKVEFDLKRKKDEAQHWTSIWQAERERLDKIKNLKERLEETEYQLEVVQRQGQYELASRLRFATIPELEAQLLREDSEGAEVEGEGPLSMLHDRVNP # NDIARVVAKATGIPVQNLLKGEKDKLVRVREQFTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g821 ### # start gene g822 5 AUGUSTUS gene 4141696 4142502 0.81 + . g822 5 AUGUSTUS transcript 4141696 4142502 0.81 + . g822.t1 5 AUGUSTUS start_codon 4141696 4141698 . + 0 transcript_id "g822.t1"; gene_id "g822"; 5 AUGUSTUS CDS 4141696 4141720 0.81 + 0 transcript_id "g822.t1"; gene_id "g822"; 5 AUGUSTUS CDS 4141796 4142502 0.91 + 2 transcript_id "g822.t1"; gene_id "g822"; 5 AUGUSTUS stop_codon 4142500 4142502 . + 0 transcript_id "g822.t1"; gene_id "g822"; # protein sequence = [MEVSHFHLFVKPLVPTLFISFNIPSPQFRFHHLRRVIPTIIPSSNTSISSPGAPIRRPPLPTTLPSFPGSGTSSPSVK # TPLASPNLATYRAAEELVNSDNGDYFAGPSTSALAPVSEQAVEADDEDDDAETLDGHEVNEGENSTSPLIPDHGEMDEEIRTYFQEEATDGSEEGKSD # TELELVIDLPEPEAGNAEQHEEPHVVDLQDGNEVAGAEVDEDEEDDEEEDEEGEDEIAEEFQVRPQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g822 ### # start gene g823 5 AUGUSTUS gene 4144194 4145152 0.18 + . g823 5 AUGUSTUS transcript 4144194 4145152 0.18 + . g823.t1 5 AUGUSTUS start_codon 4144194 4144196 . + 0 transcript_id "g823.t1"; gene_id "g823"; 5 AUGUSTUS CDS 4144194 4144400 0.27 + 0 transcript_id "g823.t1"; gene_id "g823"; 5 AUGUSTUS CDS 4144502 4144642 0.25 + 0 transcript_id "g823.t1"; gene_id "g823"; 5 AUGUSTUS CDS 4144733 4145152 0.86 + 0 transcript_id "g823.t1"; gene_id "g823"; 5 AUGUSTUS stop_codon 4145150 4145152 . + 0 transcript_id "g823.t1"; gene_id "g823"; # protein sequence = [MVVSDHIAEPSGVTATAHTPRRVHLAESQACSSPAPLRDLAFLSDKRRSNTRLSALERAKELFGTRSSPEEEELKIDA # AEEAAEMSSGDGSDPMSQDPGLVQITSSDSKAAAISKQQQRTREISHYTIEKLKRDSCHKTLSGAGISKGKPRLTPRRSLGTAVGDMVYIPHSLVTTL # GRLLKEAEKEVKEEQFRAVSPRISKSGSLMPEDNALVGIGLSERASYRTPLPAKYGLAIRPQSTLVHEIRDVEDDHQND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g823 ### # start gene g824 5 AUGUSTUS gene 4153041 4153352 0.48 + . g824 5 AUGUSTUS transcript 4153041 4153352 0.48 + . g824.t1 5 AUGUSTUS start_codon 4153041 4153043 . + 0 transcript_id "g824.t1"; gene_id "g824"; 5 AUGUSTUS CDS 4153041 4153352 0.48 + 0 transcript_id "g824.t1"; gene_id "g824"; 5 AUGUSTUS stop_codon 4153350 4153352 . + 0 transcript_id "g824.t1"; gene_id "g824"; # protein sequence = [MSDEELEIFGVDWEGLQDEVLLRALRQNYSPNEGSGSWLGSRGPPPDLNTVTVDPPSTLLNPEQLAFLDQLVQNHSRL # PHEPEVVRLWIDALAIARTMYPNNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g824 ### # start gene g825 5 AUGUSTUS gene 4154255 4155132 0.19 - . g825 5 AUGUSTUS transcript 4154255 4155132 0.19 - . g825.t1 5 AUGUSTUS stop_codon 4154255 4154257 . - 0 transcript_id "g825.t1"; gene_id "g825"; 5 AUGUSTUS CDS 4154255 4154760 0.77 - 2 transcript_id "g825.t1"; gene_id "g825"; 5 AUGUSTUS CDS 4154819 4154886 0.47 - 1 transcript_id "g825.t1"; gene_id "g825"; 5 AUGUSTUS CDS 4154933 4155132 0.32 - 0 transcript_id "g825.t1"; gene_id "g825"; 5 AUGUSTUS start_codon 4155130 4155132 . - 0 transcript_id "g825.t1"; gene_id "g825"; # protein sequence = [MVPGVPTPISPQKPVTQLPNKIPTPSASHKLQPSRSLKREFAATDISTVFTCDPKRPCSESHREDNSEYNKENQDSAS # NKKLHSIPCLLELVDQQKARIRQLGIQVQAQEAAAKHQQKQLSDEHARYLRVKLQKGKLEGQLEELGRVNEQAETEAASKLKEMNRQIEQRDEQAKKD # AIKLKQYEEMMSSMEVEMIHMKKKTTMVHELCRKAGTILQAPYTFANDISLKDIQDVIEYRPQSTKVNRDPFSPEEAWKES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g825 ### # start gene g826 5 AUGUSTUS gene 4157476 4158399 0.96 - . g826 5 AUGUSTUS transcript 4157476 4158399 0.96 - . g826.t1 5 AUGUSTUS stop_codon 4157476 4157478 . - 0 transcript_id "g826.t1"; gene_id "g826"; 5 AUGUSTUS CDS 4157476 4158399 0.96 - 0 transcript_id "g826.t1"; gene_id "g826"; 5 AUGUSTUS start_codon 4158397 4158399 . - 0 transcript_id "g826.t1"; gene_id "g826"; # protein sequence = [MSLLRCQVPGCIRIFGRSNDLTRHVNWSHKDFCIPPTSASSVPAPQHSDSPTPDPIDTRQSFSPSPPLFFKEDRKYHP # FLRGQSLQYLILILRTDNYYIGDICTEDGHSLPAGAPPPPPPEVENPWEPFSGEVQFRIADLLFREVEMSQTKIDELFDIWNLHELMAMEANGHTSHG # MGPYRNHDDMYNLIDSIVDGGAPWNCFQTVVDEGLSAEAPEWQRTSYQIWYRNPDTVIANILANPEFANDFDPAPYVHINSDGQRHWADFMSGNWAWR # HAVRQITILYSQPSSYFRLKFMKMTRMTAWMVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g826 ### # start gene g827 5 AUGUSTUS gene 4158525 4159073 0.36 + . g827 5 AUGUSTUS transcript 4158525 4159073 0.36 + . g827.t1 5 AUGUSTUS start_codon 4158525 4158527 . + 0 transcript_id "g827.t1"; gene_id "g827"; 5 AUGUSTUS CDS 4158525 4159073 0.36 + 0 transcript_id "g827.t1"; gene_id "g827"; 5 AUGUSTUS stop_codon 4159071 4159073 . + 0 transcript_id "g827.t1"; gene_id "g827"; # protein sequence = [MSTRISSRIRAKQKTTQPAIGSPPHHKSQAAKKKEKEEAKAAAQERRRVSNNLVAQQLDTQAKENLALLRPDLEEMSS # RSAIEFDTGHPELADSSESMKRDSLPPVVNSPTSATLVSSPVSKNTVESSLSPAPIQNEPNVVMSGTHTEEEEDERNIQSLEAELKRIKEKKKKVRFI # RSCTQY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g827 ### # start gene g828 5 AUGUSTUS gene 4159166 4160812 0.13 + . g828 5 AUGUSTUS transcript 4159166 4160812 0.13 + . g828.t1 5 AUGUSTUS start_codon 4159166 4159168 . + 0 transcript_id "g828.t1"; gene_id "g828"; 5 AUGUSTUS CDS 4159166 4159681 0.14 + 0 transcript_id "g828.t1"; gene_id "g828"; 5 AUGUSTUS CDS 4160393 4160812 1 + 0 transcript_id "g828.t1"; gene_id "g828"; 5 AUGUSTUS stop_codon 4160810 4160812 . + 0 transcript_id "g828.t1"; gene_id "g828"; # protein sequence = [MLGAKHTLESSTVAATSVLAVLSCKLQCYLQYIFRPAKRSKPNQVGGLKPKWKEILHQNKTPSRSASIVKSADEFEQM # DEGEFVGDETPDALQAQRAGKSYGKRQIQVYYYLYVWVHTHVCEKGLLDVKLEPVDVNMIVKEELETKMPAQPPKKRVTAKVSDIPYVNVSDRSVHWA # LSLRANGITNVRNEGSGEEDSDTNAATPTKAKKKAKASASIARKTENSFGEKLTREYNKYQAHTSKLSEAKWALIIDASKRYIVNVPNSGAGPALKDV # LAEAEANPCVDDEINSEYDESIRGERRKQDVIMLSDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g828 ### # start gene g829 5 AUGUSTUS gene 4166952 4168004 0.89 + . g829 5 AUGUSTUS transcript 4166952 4168004 0.89 + . g829.t1 5 AUGUSTUS start_codon 4166952 4166954 . + 0 transcript_id "g829.t1"; gene_id "g829"; 5 AUGUSTUS CDS 4166952 4168004 0.89 + 0 transcript_id "g829.t1"; gene_id "g829"; 5 AUGUSTUS stop_codon 4168002 4168004 . + 0 transcript_id "g829.t1"; gene_id "g829"; # protein sequence = [MSSDESTKLAVLPTDYPRISSQIVEAEERYQIEGASAQDILRALVAVVHRYTGDTHVVLGTPSSVLRIDLSPEDYLDS # IQVVETESLSTGDLNVSVSGNSIRTVYNTILFTPIRIQLLHLHLALIIQNRTTPIGRVSLRTEKEEGILPNPRAPLNWCEWPGPITSVFSSNAAKNPE # KAAIITQTRTYAYGSLLNAANSLSNHLLEHGVQRGDVVMIYAHRSADLVLAVLGTLGAGATFSVIDPAYPPERQIVYLSVARPRAVIILQGAQDLNPV # DEAVRGYWEKDLGGVKVCIEGVSLGEDGTVHADGSILNVNAADPGVVLGPDSIATLSFTSGSTGVPKGVRGRHYSM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g829 ### # start gene g830 5 AUGUSTUS gene 4169582 4171501 1 + . g830 5 AUGUSTUS transcript 4169582 4171501 1 + . g830.t1 5 AUGUSTUS start_codon 4169582 4169584 . + 0 transcript_id "g830.t1"; gene_id "g830"; 5 AUGUSTUS CDS 4169582 4171501 1 + 0 transcript_id "g830.t1"; gene_id "g830"; 5 AUGUSTUS stop_codon 4171499 4171501 . + 0 transcript_id "g830.t1"; gene_id "g830"; # protein sequence = [MPLNPNGKIDKPTLPFPDTAAAVASLSAVSASALAVANGPDNLHADITPTQKTILNLFASLLPGFTPDFTGEALPSIP # LNESFFDLGGHSILATRLVFEMRRAFPVLKDRISLGVVYSKHAGEIASVRGLASIVDVLRGEDLGLPIDTKAGPNAKEGNGILDTDGDEEGEEDNHYA # QDLDELISSHLAYSYPSYSTSSARSLHVFLTGATGFLGAFILQQLLETQSSSSSSFASHVTCLVRASSPSSAIARLRDSCASRGVWSDSWISSNRLTV # LPGDLALPHFGVTYSQWESLEHEVDVIMHNGALVHWVYPYERLKAPNVMGTLTALELAGTQGKPKSMVFVSSTSVLDTPSYVRIGSSVVSQNLGCGVL # ETDDLETARRGLKTGYGQSKWVAEKLLFEAGKRGLSGYIIRPGYVVGESKGGVTNTDDFVWRMVKGCVQLGSVPDMSNGVNMVPVDRVAMCCVSAVTA # SPIPSDDASSEKGGPGGNISVMHVTARPLPTFNDLFTALKIYGWAVEKTEYVQWRLQLEAHVMNKSRNTNGEVEEEDNALFPLLHFVLDDLPTSTKAP # MLDDRNTVAVVERGRISEYDPPNTIDEKLLGRYLAWLVRAGFLPPPQGGQGGQNLPELEGGVTTAAGRSGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g830 ### # start gene g831 5 AUGUSTUS gene 4180912 4182531 1 + . g831 5 AUGUSTUS transcript 4180912 4182531 1 + . g831.t1 5 AUGUSTUS start_codon 4180912 4180914 . + 0 transcript_id "g831.t1"; gene_id "g831"; 5 AUGUSTUS CDS 4180912 4182531 1 + 0 transcript_id "g831.t1"; gene_id "g831"; 5 AUGUSTUS stop_codon 4182529 4182531 . + 0 transcript_id "g831.t1"; gene_id "g831"; # protein sequence = [MKNASLPAGILPVHPVNIVLPLPLSLTPSPTKLGFPFGDPEHRTPLRRRRSSAFAAIKNWTLTVQPGSPAPNSPHKSI # SVSPGRRSSISIARDLISRRTSISHNRAQSNSSVAHLVELETPGINDYKQPQFDLTKLGYTSIFASRIHTPSTPSPFLLRDPYPSSSQKQKSVQKETP # KGLKRIKSLGMLKRNRRKSVSAAAVDVQELASRPRSHSRSKSALVSAHSKKSSTHPPLPPTLASELLLRQFTDGGSLETHAKRVMEEQAQLAAPAGFH # KGTALPVGTIYRDENGVIWHDEDERLEREALLSPRTPESPAREWITFNSPGNSPVLPGMALGVGTSEPEERRGSLASVTSSLSMSSNNIVTPADGSSY # LLHSFQPSYSGPPSPLSGFGSTRVPVSPTSTLSTITGMAAATGSMAQNKRTRRRPAPLRLNAPSASNAFDDSFIPSPRAMALASIVPPGRRRSSTGAM # GLSAPPACTEFTSTSSASKVEGDATMKENFKADDLDSASLTTMRSKKVLGMKKISKLNLKSMKSLFGGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g831 ### # start gene g832 5 AUGUSTUS gene 4183150 4184788 0.33 - . g832 5 AUGUSTUS transcript 4183150 4184788 0.33 - . g832.t1 5 AUGUSTUS stop_codon 4183150 4183152 . - 0 transcript_id "g832.t1"; gene_id "g832"; 5 AUGUSTUS CDS 4183150 4183487 1 - 2 transcript_id "g832.t1"; gene_id "g832"; 5 AUGUSTUS CDS 4183539 4183903 0.48 - 1 transcript_id "g832.t1"; gene_id "g832"; 5 AUGUSTUS CDS 4183958 4184259 0.96 - 0 transcript_id "g832.t1"; gene_id "g832"; 5 AUGUSTUS CDS 4184312 4184402 0.86 - 1 transcript_id "g832.t1"; gene_id "g832"; 5 AUGUSTUS CDS 4184495 4184701 0.71 - 1 transcript_id "g832.t1"; gene_id "g832"; 5 AUGUSTUS CDS 4184763 4184788 0.94 - 0 transcript_id "g832.t1"; gene_id "g832"; 5 AUGUSTUS start_codon 4184786 4184788 . - 0 transcript_id "g832.t1"; gene_id "g832"; # protein sequence = [MDWSSSRPSLSVMEANGSILTNKYSEGLPGARYYGGNEYIDELESLCRERALKAFNLDPAKWGVNVQPYSGSVSFSLI # FAALTALIQPQDRLMGLGLPDGGHLTHGYYTAKKKMTASSIYFQSFPYAISPESNLIDYAGLAAQAKIFKPRLIICGASAYPRDWDYAELKKTAEKEG # AWLLCDMAHTSGLIAAQELNSPFDYCDVVTTTTHKTLRGPRAGLIFFRKDLENAKDLEKRVNEAVFPACQGGPHNNTIAAVATALRQVADPSFKAYAK # QVVANARTLASTLLEHGYKLQTGGTDNHLVLWDLRPLGLTGSKVEKVCDLMGITINKNAVSGDASAQVPGGIRLGTSALTSRNMTEADIKVVADFLHR # TVQLSLLLQKEAGTKMLKDFVRVATTQQEGKQGFAQVKQLRDEVRAFASKWPLPGVDTANFKTPAGVEED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g832 ### # start gene g833 5 AUGUSTUS gene 4192226 4196200 0.81 + . g833 5 AUGUSTUS transcript 4192226 4196200 0.81 + . g833.t1 5 AUGUSTUS start_codon 4192226 4192228 . + 0 transcript_id "g833.t1"; gene_id "g833"; 5 AUGUSTUS CDS 4192226 4196200 0.81 + 0 transcript_id "g833.t1"; gene_id "g833"; 5 AUGUSTUS stop_codon 4196198 4196200 . + 0 transcript_id "g833.t1"; gene_id "g833"; # protein sequence = [MNGKDLARHGNGADAGFKAVERKISSPPKNNNDNASSSRYPYTPSIHTHPLNLNLNSSLNMTRISPIPEKGSSPDTAR # TSADDNSPTTPDLQTQTQWLIGERPTPSASHTSMNEMQTPGPANIKAKGTPKKGAGSKKPDTLTNASFPLPIEPPTSTINISGDVLAILKLSTSEKKN # RIIDVGKVVDANFRVLGGLHLELEKRLTDHSAHIGEDIAELATRLDNLEVADLTSIEGGPQDTSLPSQPVSAGVGILHDLKSRISALEEETDEEGGND # IRVAETEKMVKKLRGDISNMKDKADLDRQFAKTLATPKDVNDARTFATREVAMLRTKLSDEIKSVRALIPKDSVSKRVAPLESRIDILNSKVEDLEGK # LNRALAENELLRAQIHSKELNQGRSLASAPDGYQLSQSPSPHRHHSQAPGRYRSRSASPFSQRRHALPPPPPPPPPTSTSRNKRRHSASQDSRPNKKG # QQQNPAAEKVSLYLGPFPQHSVCTRWDMCADGSRRWCNLHIVHTYSTQRTVITKLLSARALTLTVLWPPGRRTLLNPTCVTTMASTLDRGFLNGAEVL # QHVTESSQTSNSSITDDDIYDKNVIRILSWNVHGDFSVKMLSPDFRNMLSQYDLILIQETHLCTEEEDALTKLDGFNFFVQSRTTAKQWEKQHGGVCA # FVRKGIAASKSKLSSPDILVLDLGSLWVINAYILPVLSRYIHFTDVAPEEQLFETIRICALVDSSKKTVVATDANGRTSSRTPKAAHLTRLSQDTEVN # ARGLRILQLCEEMNLAIVNGTELESPNRGSYTSHQHNGKAVVDYILVSDELCPMIQNLSVEVRPLSKKDQWSDHSKLSLVMSREIYTMTAQRSSQPKV # PLTIPIHDEWTDTLYQETLQSGKPPHLLLRDFYGPVYYDQNPISVYTDGSCLENGKDYARAGSGICFGLQSNQNISLRVPGPETPTNNRAEAYAVLML # LAKVNPKRAMNIFCDSTYVIRECCYWAGRHLSTGWKMPNGDLLKDICLLLKYRLAFTRFIWVKGHSGIPQNELADELAKIGCTKDIPRDYSPLVSSPW # ERDPGNRQAIDVQKVSTDLPEHAEPRTMIGRSITWAAEQGHRGRSKVAKIRDDNLAKLRNCKTNAQFWMLYKSWLDPKAKDFELSLNHLYTEFKTRLN # TPVVPSLQLNHQHLSYLKHLEAMLPEANLDPTEQKFFSLTIHEEEVADAKEHVLECNLNSAIGSDSISYKEIMDIPNENIASFLNFCVKNKTAPSKWL # YAIVIGILKPGKNASDPNGYRLIVLECCFAKLLAYIIDRRIRSYADLKHLIPDSQNGFRPTYRTTNNPLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g833 ### # start gene g834 5 AUGUSTUS gene 4196368 4197837 0.32 + . g834 5 AUGUSTUS transcript 4196368 4197837 0.32 + . g834.t1 5 AUGUSTUS start_codon 4196368 4196370 . + 0 transcript_id "g834.t1"; gene_id "g834"; 5 AUGUSTUS CDS 4196368 4197837 0.32 + 0 transcript_id "g834.t1"; gene_id "g834"; 5 AUGUSTUS stop_codon 4197835 4197837 . + 0 transcript_id "g834.t1"; gene_id "g834"; # protein sequence = [MAYVVRVCGSHSEPFGGDMGVITGSPVSPNLFNLVVADFKVTEHPTDVVLHDKHVNHMLQADDTGMASTTPSSIQSKL # RQFEQYASLTGFEVSVPKCMITVFGQEANADTVFMLHDKPLQKKKKLKYIGVHHQTGQGGIYKDNYQKLADKAKNAAGAVLHAKTFVGNDMPIKDMIT # MYWARVDPYLKSGSEFIMDVVVSHREQLEEVQHYFLRRALSIQKRSSLEVLFTETGVMPIRYRRIILFFKNMQYLISLPHHHLAWKAMREAYSLAQKG # HTSIILEACRVLESLPIPVTWNIPEFEDITAAHLNGLIEHIQDSMERTLQNALMTCPRTADTLKDRKEYDRKNKKMVFKALAFRHYLTVPTGKHRKAL # IHMVTGNHQLAVERLRWNERNRPRIIREHRICRICKCSVEDPAHVLFECKGSTELIKLRDSFMQKVISELPQYAKSYSNAWMLFRILLAETRITELFA # KLTYDVLEVVYNTEMFVPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g834 ### # start gene g835 5 AUGUSTUS gene 4209323 4210970 0.42 - . g835 5 AUGUSTUS transcript 4209323 4210970 0.42 - . g835.t1 5 AUGUSTUS stop_codon 4209323 4209325 . - 0 transcript_id "g835.t1"; gene_id "g835"; 5 AUGUSTUS CDS 4209323 4209830 1 - 1 transcript_id "g835.t1"; gene_id "g835"; 5 AUGUSTUS CDS 4209887 4210000 0.87 - 1 transcript_id "g835.t1"; gene_id "g835"; 5 AUGUSTUS CDS 4210129 4210970 0.45 - 0 transcript_id "g835.t1"; gene_id "g835"; 5 AUGUSTUS start_codon 4210968 4210970 . - 0 transcript_id "g835.t1"; gene_id "g835"; # protein sequence = [MTLYAASSDGTIAVFDFEQDELEGIAPHSVQEQYLSKFGFTPPPLPEGYSHVIASSHNATVSEVRSQSAAFDTATIGG # EVVNVLVAKRNNKKKRAGLTTMTSVPSAGAGPSSYSSKRASFLPDSDAKLGKPVSPLVRESSFPAPDEQPFDTHPDWHSHGDVNMALSDAFDSGSMRK # KDEVSRPMYKTLGGNRQREMVLVKEINDYVSVGGSLGLSLPVPATLTRITAELDGTHIFEGLNPEDGGEYSTRADIHCSEHFQVLPRCISSRASKHFG # WIICRHRRFSPRLMPTLNLGLPCSILDGSKNCLLVITQAGVLHLWNVSKGIAFFPPVSVAPLISSPNDTIVSALVRPNGTPIVNCSNGTVYSYDAALF # TWVKISDRWWSEGSDVWQGRQRSQSQVANRGIVAFVEGSLSGPPSEASAETPRPEWWNTALTLGHLETRLHAARLLDSPVEYKQYLTLYAKKIADEGF # RAKAEELIKDLSGPIYW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g835 ### # start gene g836 5 AUGUSTUS gene 4216210 4216623 0.78 + . g836 5 AUGUSTUS transcript 4216210 4216623 0.78 + . g836.t1 5 AUGUSTUS start_codon 4216210 4216212 . + 0 transcript_id "g836.t1"; gene_id "g836"; 5 AUGUSTUS CDS 4216210 4216623 0.78 + 0 transcript_id "g836.t1"; gene_id "g836"; 5 AUGUSTUS stop_codon 4216621 4216623 . + 0 transcript_id "g836.t1"; gene_id "g836"; # protein sequence = [MGSQLILPDFTLSPCVMLSTLGISVQFRSRSNALNLGVPPTECFIPLIKILQTISAKQLKEVNIWLRPNGHMTQEEYE # QLDWDGLASVIEQPLFKSLFKFRFFASPKHVEIVRRVIKKRIWEQHPLLAPVVRIRAWG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g836 ### # start gene g837 5 AUGUSTUS gene 4216750 4218293 0.52 - . g837 5 AUGUSTUS transcript 4216750 4218293 0.52 - . g837.t1 5 AUGUSTUS stop_codon 4216750 4216752 . - 0 transcript_id "g837.t1"; gene_id "g837"; 5 AUGUSTUS CDS 4216750 4217145 0.99 - 0 transcript_id "g837.t1"; gene_id "g837"; 5 AUGUSTUS CDS 4217201 4217244 0.66 - 2 transcript_id "g837.t1"; gene_id "g837"; 5 AUGUSTUS CDS 4217327 4218293 0.78 - 0 transcript_id "g837.t1"; gene_id "g837"; 5 AUGUSTUS start_codon 4218291 4218293 . - 0 transcript_id "g837.t1"; gene_id "g837"; # protein sequence = [MTRGRRPAGICGAALLLAARMNNFRRSVEEIVQVVKIADSTLKKRLDEFKNTPSGALTLADFRTVWLEDEMDPPAYTK # GKEKEEAERLAAEQGVLEIEPTSKNKRQKKDKEKKKKRKRKRKRGDGDDEEATDEDVDAEGDSDGEPIAPMPPNLRQPIDLALMNEGILVGVQNLEEP # PLFLPELTMDQTPDPIIDPALLSQPVPSSSLSNFPSSLDSHWPPQSSSSIDPTLMAPPMDPFEVAVSSALAEEVSAFLDNNQGSLLSNALDDAEQQRL # AQINSNVDDQLLGLDEDELNRFLLTDEEVKIKERVWVELNKDYLEALAAKGDQSSSKESKARKRRKTHNNKPRDTSTPHGATPAESVRNLIQKNPRYS # KRINYDALKDLFVDSNVHSSDPGPDFGPASVGEASMDFDDVGLYTLDDKDDKDDADLIVIEEDGILGVSSAHPREEHDGDGEAEVGGWEDVYEQEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g837 ### # start gene g838 5 AUGUSTUS gene 4220900 4221220 0.92 - . g838 5 AUGUSTUS transcript 4220900 4221220 0.92 - . g838.t1 5 AUGUSTUS stop_codon 4220900 4220902 . - 0 transcript_id "g838.t1"; gene_id "g838"; 5 AUGUSTUS CDS 4220900 4221220 0.92 - 0 transcript_id "g838.t1"; gene_id "g838"; 5 AUGUSTUS start_codon 4221218 4221220 . - 0 transcript_id "g838.t1"; gene_id "g838"; # protein sequence = [MTIALVVGASRGLGLELAKILHDRNFQVFATSRSPAAHIRKELGPDFPQDINIIPNIDLTQRNAGERIVSYLKGDLGL # GVGLGETRKLDLVIMNAGVFKADVSPYW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g838 ### # start gene g839 5 AUGUSTUS gene 4221844 4222728 0.62 - . g839 5 AUGUSTUS transcript 4221844 4222728 0.62 - . g839.t1 5 AUGUSTUS stop_codon 4221844 4221846 . - 0 transcript_id "g839.t1"; gene_id "g839"; 5 AUGUSTUS CDS 4221844 4222728 0.62 - 0 transcript_id "g839.t1"; gene_id "g839"; 5 AUGUSTUS start_codon 4222726 4222728 . - 0 transcript_id "g839.t1"; gene_id "g839"; # protein sequence = [MATSFQYPTTSLSKELTQLIPIEIYEYIISFLDHSPTSKSCSLTCRSWLQASWKRLFAGTILMVHRENIDDLLEIVER # DVHFVTIIRFVRGLYLEQGGSLRLPTWSDSEERDKYKEAFQFDKYLPLLVGFKSVRMLKLGWIRGDTGPPTALSLQNNFGVGVTALELNSVILSSPLQ # FFEILHALPQLTSLMLVGLKFNSGRPSEDAREAPGMTLVDTPKPPQLQELYCNVTEDIADFVFSWFAFHGPIPIETVAVGLFNGSTNSKVSRFLCESG # STIDTVKIWDAYSQDGAFRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g839 ### # start gene g840 5 AUGUSTUS gene 4224314 4224894 0.78 - . g840 5 AUGUSTUS transcript 4224314 4224894 0.78 - . g840.t1 5 AUGUSTUS stop_codon 4224314 4224316 . - 0 transcript_id "g840.t1"; gene_id "g840"; 5 AUGUSTUS CDS 4224314 4224657 0.93 - 2 transcript_id "g840.t1"; gene_id "g840"; 5 AUGUSTUS CDS 4224732 4224894 0.78 - 0 transcript_id "g840.t1"; gene_id "g840"; 5 AUGUSTUS start_codon 4224892 4224894 . - 0 transcript_id "g840.t1"; gene_id "g840"; # protein sequence = [MYQSLRKSSIISVSVGSLSETLNGENDPALGIMNYDIWGSWSPTVGPNAPLNDSCLPHLFVDMQQTEVFYKKISLGLA # AYGHSFDVSNSNALNSSKALQLYPAFNAGDQPHGDSQDAQAGTDECGNSTPVGGIFNFWGLVDGGFLTTAGTAASGIDYTFDNCSQTVRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g840 ### # start gene g841 5 AUGUSTUS gene 4228754 4229821 0.9 + . g841 5 AUGUSTUS transcript 4228754 4229821 0.9 + . g841.t1 5 AUGUSTUS start_codon 4228754 4228756 . + 0 transcript_id "g841.t1"; gene_id "g841"; 5 AUGUSTUS CDS 4228754 4229821 0.9 + 0 transcript_id "g841.t1"; gene_id "g841"; 5 AUGUSTUS stop_codon 4229819 4229821 . + 0 transcript_id "g841.t1"; gene_id "g841"; # protein sequence = [MHLSTISQLRAIDADQLIKFGRSVRVVDDGVFLRHDWKDFLSPEDAHKNHHHNLNLTVPKALSALRSHSHTPKPIGSA # SSSSTPGLRSSVFQPLLIGDCASDSMLWSTPISYWTSAAAVRRIKAVCQSLFKTNTLFHTYDISSYTPDEEIAEHILELVNDARIAWPTDCFAQNSRR # EGGGVWRYVFDQEGPWNCIPHHAADLMYLFDNVPLPESSTRSIAGSSMQDSFSEADMFPESFAFEDDDDDIKYSPIVRDDDAMSSDDDGWGIPSVASW # SYSRVRDTMQEQWISFAYGEAPFSEDKVFVFGPEGETGERSESIFEGRRRRTLWKKAFEPLGMQVVHKMGVELSRGPPLRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g841 ### # start gene g842 5 AUGUSTUS gene 4230134 4230562 1 - . g842 5 AUGUSTUS transcript 4230134 4230562 1 - . g842.t1 5 AUGUSTUS stop_codon 4230134 4230136 . - 0 transcript_id "g842.t1"; gene_id "g842"; 5 AUGUSTUS CDS 4230134 4230562 1 - 0 transcript_id "g842.t1"; gene_id "g842"; 5 AUGUSTUS start_codon 4230560 4230562 . - 0 transcript_id "g842.t1"; gene_id "g842"; # protein sequence = [MISLQIQHIKPENIPRPPYSTSPATGNASSAPPTNTASTSNKGKAPATTKSKSPIAPQPKQNGKQMGGRRLPVSPEPL # PPLASRVSPYSPALPTGVLIDTVKAGMNATENNTGTSGTLGAPSPFGASGGPQKGKRKVVRVRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g842 ### # start gene g843 5 AUGUSTUS gene 4230973 4231242 1 - . g843 5 AUGUSTUS transcript 4230973 4231242 1 - . g843.t1 5 AUGUSTUS stop_codon 4230973 4230975 . - 0 transcript_id "g843.t1"; gene_id "g843"; 5 AUGUSTUS CDS 4230973 4231242 1 - 0 transcript_id "g843.t1"; gene_id "g843"; 5 AUGUSTUS start_codon 4231240 4231242 . - 0 transcript_id "g843.t1"; gene_id "g843"; # protein sequence = [MSRKAVLVEDEFDDDTDLPLPARPLPHTGAKGPVLQEIASDIDSEDDFDLDTSQLAGPASPPSSQPKLRPEGASQLPK # NTITDITPYKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g843 ### # start gene g844 5 AUGUSTUS gene 4237859 4238494 0.73 + . g844 5 AUGUSTUS transcript 4237859 4238494 0.73 + . g844.t1 5 AUGUSTUS start_codon 4237859 4237861 . + 0 transcript_id "g844.t1"; gene_id "g844"; 5 AUGUSTUS CDS 4237859 4238494 0.73 + 0 transcript_id "g844.t1"; gene_id "g844"; 5 AUGUSTUS stop_codon 4238492 4238494 . + 0 transcript_id "g844.t1"; gene_id "g844"; # protein sequence = [MFLTKFRMGDTSFYGPGLTVDTTSKITVVTQFITSDNTTTGDLTAIRRIYVQNGQVIQNSMSNIAGVTPTNEITTDFC # DQQKTAFGDTNTFSEKGGLTGMGAAFSRGMVLVLSIWDDDAAEMLWLDSTYPVGKTGPGAARGTCATTSGQPDQVETQSPNAQVVFSNIKFGAIGSTF # SSTGTGTGTGTGTGTGTGTTTSSAPAATQTKYGQW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g844 ### # start gene g845 5 AUGUSTUS gene 4241295 4242905 0.82 - . g845 5 AUGUSTUS transcript 4241295 4242905 0.82 - . g845.t1 5 AUGUSTUS stop_codon 4241295 4241297 . - 0 transcript_id "g845.t1"; gene_id "g845"; 5 AUGUSTUS CDS 4241295 4242905 0.82 - 0 transcript_id "g845.t1"; gene_id "g845"; 5 AUGUSTUS start_codon 4242903 4242905 . - 0 transcript_id "g845.t1"; gene_id "g845"; # protein sequence = [MAQAQNAAFAAMTENSTCTSEYQDCLSIHSSRLTECILAGQDACVNGAFAQCTGSTFSLTPCSSGLSCFALPLLNSNG # TSISCDTEADVEARIQAAGVEGGIFGNSTTTTSTAGAVSTTSSASNANSTDTGDASDCGDDDEPDITSNSMTATSMDCGDETTTFPTASVTVVTAVAS # ASSPALGTGEVVTATAPILSSAGSVTTTVTSSSNATTSASNSDSTTTVIDIPAGTDGAFPTASVSAAIASIASALSASAASASAATASGSATASPSVA # QNLFTLNPSSVSVSSTIVPTSSSVPVRRAIRGRQILSTASADLTTSVSTSSFSDVAVATSSPSSTGINTDSVIGTAAIASISSGTIAASAIGSPGVAS # SSSASSIAAAITSSTTITSSSSSTTDTLATPGATVTVTTTMFLIVPGQTGTATAVLSIPTTASGSSAATTSASVLSDSAISAASSTASSSVPLVTGAA # SSSSSAVPSSLVASTDVSSATDSAITSFTVLSAPSATAASSSTSAGFQFTGSGFGRRSWTRATGAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g845 ### # start gene g846 5 AUGUSTUS gene 4243912 4245028 0.27 - . g846 5 AUGUSTUS transcript 4243912 4245028 0.27 - . g846.t1 5 AUGUSTUS stop_codon 4243912 4243914 . - 0 transcript_id "g846.t1"; gene_id "g846"; 5 AUGUSTUS CDS 4243912 4244217 0.75 - 0 transcript_id "g846.t1"; gene_id "g846"; 5 AUGUSTUS CDS 4244333 4245028 0.34 - 0 transcript_id "g846.t1"; gene_id "g846"; 5 AUGUSTUS start_codon 4245026 4245028 . - 0 transcript_id "g846.t1"; gene_id "g846"; # protein sequence = [MSVLQDRDLHKLGLILADLIVQTEFSIPDGAFEEEDPRTGKRQKATFDTGLPFKTFREALPQCARVFRQRAAPGDLDK # ADILDIKYLIMQANIRAAAEVGSKGLLRNPNMAYFQYAQSLLADPAVVLRSAKKGLKCKQTSPFIRFQLLQRAVENAGQLGLQTLEQASSAEDPKWEE # GVAFFMSAWTDSNTFLAEAPPDNRHMRNVLYWNILLAIIIRGPELNPNLEEIKVRLLRLAQAAIVKQYSAAVSEWEEVILRLNNSSEKQPEVLPDSEK # VQNDLNNFLNDLQLDDESPAKRVAAHPKVNLNSVLLYQCSWCKNPSAMLKKCSGCSQTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g846 ### # start gene g847 5 AUGUSTUS gene 4250220 4251070 0.75 + . g847 5 AUGUSTUS transcript 4250220 4251070 0.75 + . g847.t1 5 AUGUSTUS start_codon 4250220 4250222 . + 0 transcript_id "g847.t1"; gene_id "g847"; 5 AUGUSTUS CDS 4250220 4250238 0.77 + 0 transcript_id "g847.t1"; gene_id "g847"; 5 AUGUSTUS CDS 4250352 4251070 0.8 + 2 transcript_id "g847.t1"; gene_id "g847"; 5 AUGUSTUS stop_codon 4251068 4251070 . + 0 transcript_id "g847.t1"; gene_id "g847"; # protein sequence = [MLEFSAPGSLENVETAAVLFHPSGTTLVDEILKKFTAFTEVRLAKVEGDLEKKKSGTERLLAKITGLEGREESLQKEN # QSLKEEQRQERVRTEGREKSLLAKITGVEGREEYFRKEIQSLKEEQRQERVRTEGREKSLLAKITGVEGREESLQKENQSLKEEQRQERVRTEGREKS # LLAKITGVEGREEYLQKEIQSLKEEQRQQRVRTSSLEDEITRLSGDFDDWITIGVSHLAVLQLCLFILL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g847 ### # start gene g848 5 AUGUSTUS gene 4260035 4261133 0.7 - . g848 5 AUGUSTUS transcript 4260035 4261133 0.7 - . g848.t1 5 AUGUSTUS stop_codon 4260035 4260037 . - 0 transcript_id "g848.t1"; gene_id "g848"; 5 AUGUSTUS CDS 4260035 4260457 0.99 - 0 transcript_id "g848.t1"; gene_id "g848"; 5 AUGUSTUS CDS 4260506 4260790 0.99 - 0 transcript_id "g848.t1"; gene_id "g848"; 5 AUGUSTUS CDS 4260840 4261133 0.71 - 0 transcript_id "g848.t1"; gene_id "g848"; 5 AUGUSTUS start_codon 4261131 4261133 . - 0 transcript_id "g848.t1"; gene_id "g848"; # protein sequence = [MYSNLYKPGTIRSSETSVRLSSSRDPYRYKQEWDYGVHWREDDEFDNEDEDEEDELSEEIENGQAQARWEAEEDYTLG # HVWKPAINGEVPDDKSAIVYFHSSLSDSECPVQVQITLFKGPIASRAGAGNTPYVFQARGHVYLSPLEDDELDPEEDYAEDLKMDIDIDTWNEPKNAF # AKFLLDSVGISPPNFHQSQQDSSLSSTPSLTHDSSSPTRIADFLPSSPYTSSSSPLRHSKISTLAFPTSFTGYTPAPPPAQRKRVAYIQRRIERSKHK # KPPKPVNGSDEDYDSDSSEAPVAGHQAKKLTGPQVIGERYITREQVMAIIGADDNVAEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g848 ### # start gene g849 5 AUGUSTUS gene 4262254 4263495 0.99 + . g849 5 AUGUSTUS transcript 4262254 4263495 0.99 + . g849.t1 5 AUGUSTUS start_codon 4262254 4262256 . + 0 transcript_id "g849.t1"; gene_id "g849"; 5 AUGUSTUS CDS 4262254 4263495 0.99 + 0 transcript_id "g849.t1"; gene_id "g849"; 5 AUGUSTUS stop_codon 4263493 4263495 . + 0 transcript_id "g849.t1"; gene_id "g849"; # protein sequence = [MALHTLVNIGHHGGTNVHAEIARQAPILVQTLLDHPEEHQTVEHIIVILSHSVGAAVNGDSQAPEMPEIHRSLDMRII # LKTTIHHMRQLYASKTLIDHGNQLVFASAMHCSAAFRSEPDLDKFLVAGLKSKNWGLRGSCLGAMIRSYILSTVSDRPALGPAQLIQIFGSAWPPHLL # EVMNQYGLSRCQTTQQRGHAMALSDAITGAHSRDHYILGGKLADLTLLTEFSLPATPMFPLSEIIPRCVEALRARGTAADTDKADILEMKYLIRLQDW # DGIKSKAQQFLARNPDSAYTFYALTLRPGSEDGLRAAKKGLKCKENNTTPYLYFQLLRRAIELAADLGVCYFQEYDQHGRMMWEEAIAFLMSALEDSK # TFIEQAPPDNPYMMAILHWNIVLTITMEGPNADLKMVEVGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g849 ### # start gene g850 5 AUGUSTUS gene 4263626 4263907 0.46 + . g850 5 AUGUSTUS transcript 4263626 4263907 0.46 + . g850.t1 5 AUGUSTUS start_codon 4263626 4263628 . + 0 transcript_id "g850.t1"; gene_id "g850"; 5 AUGUSTUS CDS 4263626 4263907 0.46 + 0 transcript_id "g850.t1"; gene_id "g850"; 5 AUGUSTUS stop_codon 4263905 4263907 . + 0 transcript_id "g850.t1"; gene_id "g850"; # protein sequence = [MLVVDLYAEAEKDWAAGIKIMDERLDEQIPPPDFPKKAEDELTAWLNDMSLKKFTCSSATPKVNVKDLWYKQCSWCRN # PSAVLRKCSGCESAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g850 ### # start gene g851 5 AUGUSTUS gene 4264462 4267224 0.93 - . g851 5 AUGUSTUS transcript 4264462 4267224 0.93 - . g851.t1 5 AUGUSTUS stop_codon 4264462 4264464 . - 0 transcript_id "g851.t1"; gene_id "g851"; 5 AUGUSTUS CDS 4264462 4267224 0.93 - 0 transcript_id "g851.t1"; gene_id "g851"; 5 AUGUSTUS start_codon 4267222 4267224 . - 0 transcript_id "g851.t1"; gene_id "g851"; # protein sequence = [MPTNVHSVLDESDHDQEAESTQLTSLSDMLFGGQLTSILVCQKCKNVSQTYEDFNDLSLSIKAEDYAKEKRREKLKKF # ARKMGMVGGKSKRHTPTPSNEPRSQSPSNLAISISPPLPSETSPPSHTSLDAHIPSEPNTSGTRASSVPAFPNANGVVHHEPIFSPDESRRRSLDGLT # GNNTAATVTDDEDDAVIIDVSTDNESTERPLPHPPGLVPPTSDEKHLEFVDPPKLVRSDKSKDKDGWARIGRRISMSVGIGRKGKEHAKERTSRSRNR # RSIDLSTERARSPPNTTAETVRQPEIRLSRPSLSPERPQSTPPIFLKRAITSQDQVPLQKLKPRPQSLTPSSSESAIPTLNGVHNEIHRHHHRSKSPN # LPKPSKAEEDYLRAILADIHTTPVSGAKPFDFLAHWTHGDDPQGSVPSSTSSGSLPSSSPATAWLAKLAQLPLAGIEECLRMFTAVEVLDGENMVGCR # RCWKLANGWYEEREKKREGKRGRERIREEDEEDEYGNDDSEDENSTEEDSGDEDDEDDHERGSESEDTSPTTSGSIEEVPGSAANLRTTSSAPASPTL # THKPLSSFSSPHLGLYAHGNKSDAFSVISSPPDVAGNSNLQTSSSTTPQSLVDTNNQQTQSFRRPSDLISEGPRLPSIRTTTEEEGRCSPSLPTAKPD # DKSLFRRSEVFTDATPSTDSSELLHLVSSSTNSHIGTGISASTSTNYSSDVDGGESDTTSISTTASAAASGQSVESLADTSMTNPSTTPSAVLFETNG # NNGQQHHRPSSSKSRSSLTKKNPKKSKGPKPVIMRPAYKRYLIATPPPILVIHLKRFQQINKSAIISFSSGFKKLEDYVAFPEYFDLTPFLAPKKEDF # GLGKQRHMGASGVKRKSESHKERCMYRLYAVVVHIGNMVSFSRLTGVQCQYLTDFSFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g851 ### # start gene g852 5 AUGUSTUS gene 4271333 4271761 0.78 - . g852 5 AUGUSTUS transcript 4271333 4271761 0.78 - . g852.t1 5 AUGUSTUS stop_codon 4271333 4271335 . - 0 transcript_id "g852.t1"; gene_id "g852"; 5 AUGUSTUS CDS 4271333 4271761 0.78 - 0 transcript_id "g852.t1"; gene_id "g852"; 5 AUGUSTUS start_codon 4271759 4271761 . - 0 transcript_id "g852.t1"; gene_id "g852"; # protein sequence = [MPNTPCTGHEDRAWHIAWNPAKSLLASCSADKSVKLFTYSHDGEGTLNFTLAASIPTGHLKTVRSVAWSPSGRTLATA # SFDSNIGIWEQELDDNGNPGEWECASLLEGHETECKSVAYSSTGTLLASCSRDKTVWIWEGVCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g852 ### # start gene g853 5 AUGUSTUS gene 4278532 4279317 0.44 - . g853 5 AUGUSTUS transcript 4278532 4279317 0.44 - . g853.t1 5 AUGUSTUS stop_codon 4278532 4278534 . - 0 transcript_id "g853.t1"; gene_id "g853"; 5 AUGUSTUS CDS 4278532 4279317 0.44 - 0 transcript_id "g853.t1"; gene_id "g853"; 5 AUGUSTUS start_codon 4279315 4279317 . - 0 transcript_id "g853.t1"; gene_id "g853"; # protein sequence = [MLVGPSMWVSWGFQCFSNPVDNATPLQNHLLFCYASNLLYAKNHGRVHLTDALPPSILDLVKRLFLDTTGFADALSST # SSTGFLASTSEKAMASFVYHAALFIVSAMPRQRQKPIDGFDSHYLSDLRDLEEPSTQFLSTFLPSNPQHASIRHRDAAPSFKVSLGHRVVSSRSVVPT # EFLYSLPVEPPIIDAASHPYVTHAAPNEYLCTDFSPSEMGRYAFDNPALSGDLNENEEVVNTSLESSKASNVSPSFRCCVLPSSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g853 ### # start gene g854 5 AUGUSTUS gene 4279607 4280353 0.95 - . g854 5 AUGUSTUS transcript 4279607 4280353 0.95 - . g854.t1 5 AUGUSTUS stop_codon 4279607 4279609 . - 0 transcript_id "g854.t1"; gene_id "g854"; 5 AUGUSTUS CDS 4279607 4280353 0.95 - 0 transcript_id "g854.t1"; gene_id "g854"; 5 AUGUSTUS start_codon 4280351 4280353 . - 0 transcript_id "g854.t1"; gene_id "g854"; # protein sequence = [MYPLPGVDFESFDQAMDELNDCISDSKSLIRNLDSGSHEGCEILALARMLRDEENDEDEEVSDKENQVPTTDYSETDA # LYWPTSDLDIGSAGKGDVDAESRPLNISDNLITTSSDIEICATAGGHDNDDDEDDEDDHLFANSSDVEFCNPIGDNNADDDDNLFVNSSDIEICNSTG # DNNDDEDKVFAISSDIEICDTISDNNDDDDANDVDDYLWSETTYVNALVDNQDLKFCVEEDGYAADAEEPYH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g854 ### # start gene g855 5 AUGUSTUS gene 4287584 4288273 0.66 + . g855 5 AUGUSTUS transcript 4287584 4288273 0.66 + . g855.t1 5 AUGUSTUS start_codon 4287584 4287586 . + 0 transcript_id "g855.t1"; gene_id "g855"; 5 AUGUSTUS CDS 4287584 4288273 0.66 + 0 transcript_id "g855.t1"; gene_id "g855"; 5 AUGUSTUS stop_codon 4288271 4288273 . + 0 transcript_id "g855.t1"; gene_id "g855"; # protein sequence = [MPLTKDEKAWAVEKLSSFVDHQNRKVVADFWPPLRAAFFSRFPLVTEISTDVDAETREALGRQSDEKFKVGLLIDNLS # LGLIIYLFGQALRNFLNNHSLNNSSRKSRAQAREAVKIYIGGSHLTATKSKTSNRHHKKQEIYSRLYYNAECKTQVDLEITNLGESISRSERMKIRNK # YINAGWEAAQQDPVKMEAIEVLAKSEKEEVPPAAMPTVASGQLRQLKGMEHVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g855 ### # start gene g856 5 AUGUSTUS gene 4288409 4290877 0.22 + . g856 5 AUGUSTUS transcript 4288409 4290877 0.22 + . g856.t1 5 AUGUSTUS start_codon 4288409 4288411 . + 0 transcript_id "g856.t1"; gene_id "g856"; 5 AUGUSTUS CDS 4288409 4288454 0.23 + 0 transcript_id "g856.t1"; gene_id "g856"; 5 AUGUSTUS CDS 4288683 4290877 1 + 2 transcript_id "g856.t1"; gene_id "g856"; 5 AUGUSTUS stop_codon 4290875 4290877 . + 0 transcript_id "g856.t1"; gene_id "g856"; # protein sequence = [MFIAAGLDPDNNNSLPGTVDWLKESAQSAPETGPALVSPVSEDAAVPSTSTQPPPVTPSSVAPADSSTVVSPCPASVE # SDSPGLPAVPAFSASPSAADAVLAVSGLSTASPAPVVNAGAPTAALSEVNPSAGSSAVVSISAVTSSDVVNSALLPQPPPGPISLSNACTSSESIEAR # ATSPLPVSSQPTESFPSTFPQSLLPQPEPIETFDPKRSILSNMTDLEFQELSDAALRNAEGFSNEDWAHLWNNGAFNPETNCEHPANTGSPLPEVPTP # KEQFDCSHLSAFPDEQCGDFPFLPTFPEQPSNFSSSDMVTNSINNLPQVPKSSAVVDPLSVGSTTSQITLAAITSLNALPTSLPSTASTLVSLLDSTG # TTLSNSLSGSLPCTPSTLASVLDSNPVTGTISPDSRADSLPSTTSAPVSILDPMLATIDTTCVNRASTVLQMVASAEKGSPLPGMDNDLPPSSTKPVS # DPQAASMTEPSREIPTSDYMSNPAILSEPISDPIVSNLAGPALLAASLAQNPNALAQTHCDPWNPVNDFSTGPSASNILLEVSTKGKGSSKRHGILKK # RRTSKQGGTAIKPVMAKTVGILKADNTSKDKLASTVGTPKSDPPSKKITSVSTDNAPRSDPGWKQVVCLRKIKLVLRAPGVGAVHKPTHKAVISLQST # KENIPPHHSTISGPAPPAHSQSGAPEIIDDGSVRPQRVRKPLSPREPITIKDRNDRMATAKRPADDQTVRGSSSKKRKVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g856 ### # start gene g857 5 AUGUSTUS gene 4292876 4293736 0.29 - . g857 5 AUGUSTUS transcript 4292876 4293736 0.29 - . g857.t1 5 AUGUSTUS stop_codon 4292876 4292878 . - 0 transcript_id "g857.t1"; gene_id "g857"; 5 AUGUSTUS CDS 4292876 4293154 0.77 - 0 transcript_id "g857.t1"; gene_id "g857"; 5 AUGUSTUS CDS 4293254 4293736 0.34 - 0 transcript_id "g857.t1"; gene_id "g857"; 5 AUGUSTUS start_codon 4293734 4293736 . - 0 transcript_id "g857.t1"; gene_id "g857"; # protein sequence = [MPIHGLPPSERPIKPVHFDIEQVIRPNILALHPYRCARDDYKEGILLDANENALGHSIANKASQNNGDSYDSTLDMDL # HRYPDPSHDPIKERIAALRSLPSVDHVFLGVGSDEVIDLLMRVCVSPGKEKILITPPTYGMYSVCAQVNDVGVVKCPLELTGQVKKAIDVDASIKLVF # LCSPGNPTGTKISLESIKAILDYEKFKGIVVVDEAYIDFAGEGYSAVELVKDYANICVLQTLSKSFGLAAIRFVFRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g857 ### # start gene g858 5 AUGUSTUS gene 4298146 4300659 1 + . g858 5 AUGUSTUS transcript 4298146 4300659 1 + . g858.t1 5 AUGUSTUS start_codon 4298146 4298148 . + 0 transcript_id "g858.t1"; gene_id "g858"; 5 AUGUSTUS CDS 4298146 4300659 1 + 0 transcript_id "g858.t1"; gene_id "g858"; 5 AUGUSTUS stop_codon 4300657 4300659 . + 0 transcript_id "g858.t1"; gene_id "g858"; # protein sequence = [MESLSDTVISLSGNVPLWLSPEHINNCRIYLSKLSTRELINSTRRVKHNVAVDGVIEALLCFASRSFVVGTEGVCLYS # EVHNQCVLEFGMAVVSVLHANFQVDIGFSRSDEVLIDSRVLPVVMSIFQQLSEFELVKLRQCLKISERGSSLSPNFCCLSPYGLSEMRSNNLFKLLAR # CFQRDYKHFFNMDDVTLSDKYLYCYGSIFVGMDLRDIIFRLLNVMGYDEKILRSIVCVIPADYVPESRNNIYRKEKRRDIRIQNANEEYDLLHKPSNS # WPQPISVDVRMQCLRNFRQAVQYSPPLICACCGCADKLRTGSYKHQSEWCNLSILKVTDPFILANTSQSRFTYICKDLDGLLLDKRGIHSVDIDCSSF # EMYLCRECSNAMQRMAMPRLALNNYLYRGELVESIENISWVEEMACAIYHTTAHVARIYGSSSSGDPLQLHGNVCAHPLDICSIAKRLPWSPVDLNDL # ITVVFVGKAKLNEDDVKKLKPYFVRRNVIRLLLSDLCRRNRLYIGLYMLDNSMLELYPENDLLPGLQDRIVYDHDSSADELFGAESTGFDDHPAELLG # GSKQDSVLLERSGVYDSESQDVPARFMTASSIHNIAQSLPVPGADVVLRYDRDPINEYNNPDLFPGMFPTLFPLGIGGFEDCRRFPVVSLEAHVEYLL # DQSSREFRYHHFFSFVALNLIQRRKAHLHTTLWVSSNKFCDIAPMLLSVSPTVLLDLADKLKNEKDKSDFSDEELNAFQLLNNVNIIAGKIPGSQASK # TATRNQIRSYYGYFGLPHLFLTLNPSAVHSPVFQVMYGEDGVDLAQRYPYVVHPRSERACRVAKDPVAAADFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g858 ### # start gene g859 5 AUGUSTUS gene 4300856 4305325 0.98 + . g859 5 AUGUSTUS transcript 4300856 4305325 0.98 + . g859.t1 5 AUGUSTUS start_codon 4300856 4300858 . + 0 transcript_id "g859.t1"; gene_id "g859"; 5 AUGUSTUS CDS 4300856 4305325 0.98 + 0 transcript_id "g859.t1"; gene_id "g859"; 5 AUGUSTUS stop_codon 4305323 4305325 . + 0 transcript_id "g859.t1"; gene_id "g859"; # protein sequence = [MHEVEGYCSQFLAFFDGLIHYHLPKVDDILVEGYEPRVEMPPDVPGIGSDSLTYLNWQRLFEDEHKKIGECFQRHQCR # PVCHKGHSSTSNCRFGYPHEVVESSRFDVKENSIIFACRESDVNGHNPDLLVYTRHNHDVKCILSGKAAKAAMFYISDYITKMPLSTDILLSTLSKAV # SSITAEELDSDPIISSKKLLHRCLTHFGRKQQIHAQQCARYLRRLGDNMVSHETVVLPSGNLMLFVKQIYECTFDSNNLHSDKSEFDIQVLLGFKEGK # MFSYSQIVDYWYRDILLVDLCFYDFIRYVSLQMQSKSRTVNTSDTRLGVLSRYKLMVGHPLYDTHELIQHTNYKQGDVGKEFVPVMVGAVPPRKHHKD # YPLFVIAHFKPFSNLKTLVEDSIDVDFENLTLSSEHKRILCNWEEIHECVDQRDAERLRKRADFLAKSIQLPDNVHSALDDDDELSVFVAPGSLKKDD # RKLNFDNQELQLLKTDLTCAAWLKEPSVSIKESIMKSSDNMLNLPLLTDVSVQKWINEGKIMADRVASLRYSKHNVLDQHSQSVENNDLVDHNGFYNN # KGFGKVNDVDCEKFTPMQLKAKIARDFQLNDEQLIAFEIIASMIIFREILKIPEWIAKQALVMNLTGPGGTGKTHVICAVQKVMEYYGMDHTYQALAP # TGNAASLVNGKTIHSGLNISVREHKNGRSKRPLGELSENVAVFATVKKNNSLRKEWKDVCLLLIDEVSMVDSILLADIDGSLRYAKEKPDEFFGGINV # IFCGDPYQYPPVGTPLYIPIRSSGKQTDEELMRRLGRMAWKSINTVVELHQQKRMEGDVEYAAAVGRLRLRQCNNSDVNLFNSRAIKTQSNPHGVIFD # NESQYFASIIVSKNSIRRALNEYKAAAICKGICSPNLLTVVAHDEIQYKDSGELGSKSKKLFPSLYEQAQLLAMDTSSGKLRAGLPGVLNLYIGMPVI # LKHENLNTELGITNGARGFLRKLELLTDNNGFTYCKYALVEFPDSKVQLVGLPKGYFPIKSRSWRCSTYIFNKDKKKVLVSVVRMQLPFEPLFALTGQ # GAQGHTLAAILCMLHLGGYGAYVSASRPRSREGLFITRKVTIDDLNLPVVPYDLWFEARRFKIMAHNTKIVWGFEEGILKDVPDAEGEQRLNFSNVHY # EFTGYSGKKRKHADSDFDEKVHKAIKIAGHAMTSINKSIYADHIVPKGPSWDSNDWSCCFDTALVVLYNCYICMSNKSRNLWHSQSFSKQIFKHLGEF # YGSSVKQMYTSVWNVVRDLWQSEIFGVFGSGYLQHGHVLLPVSTLIQCHLCEWSGVYLELNGRCDLHGVSHRYIGSVKSYNLLAKQLEPVYSHEAVIS # STQSYIDVLHSVNFVDISSEAVCDLRCISSFIVQDVSAQVIAFELNGVDGIIPSKELNVPLYNTSICLKYRLNSVIYYGENHFTARVINTSGMWVYDG # QINEGIFENDLLFNGEIDPNIMELHGRKAHIYVYVLCDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g859 ### # start gene g860 5 AUGUSTUS gene 4307957 4308334 0.99 + . g860 5 AUGUSTUS transcript 4307957 4308334 0.99 + . g860.t1 5 AUGUSTUS start_codon 4307957 4307959 . + 0 transcript_id "g860.t1"; gene_id "g860"; 5 AUGUSTUS CDS 4307957 4308334 0.99 + 0 transcript_id "g860.t1"; gene_id "g860"; 5 AUGUSTUS stop_codon 4308332 4308334 . + 0 transcript_id "g860.t1"; gene_id "g860"; # protein sequence = [MGTTKEMAKRQKQEIAELRKQVANVEQRFFNAYAELDSANTCAMRQQDRLEELEDMVCQYRDRAYVAEGLIRQYPENE # DLYNVKLPSLLEVQRELDAPEALVCCLATFAYRLYTADPANLLHYHN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g860 ### # start gene g861 5 AUGUSTUS gene 4312476 4312790 0.59 + . g861 5 AUGUSTUS transcript 4312476 4312790 0.59 + . g861.t1 5 AUGUSTUS start_codon 4312476 4312478 . + 0 transcript_id "g861.t1"; gene_id "g861"; 5 AUGUSTUS CDS 4312476 4312790 0.59 + 0 transcript_id "g861.t1"; gene_id "g861"; 5 AUGUSTUS stop_codon 4312788 4312790 . + 0 transcript_id "g861.t1"; gene_id "g861"; # protein sequence = [MSSSRTTTIGSIPVIGRQPTPPVTPARPSTPDPSDEERELELQLERTQEKNRRRKEEKKKAEEEAKRKAEEERERQEA # AARVANARRIEEEAAEKRRKIVAAAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g861 ### # start gene g862 5 AUGUSTUS gene 4314467 4315615 0.54 - . g862 5 AUGUSTUS transcript 4314467 4315615 0.54 - . g862.t1 5 AUGUSTUS stop_codon 4314467 4314469 . - 0 transcript_id "g862.t1"; gene_id "g862"; 5 AUGUSTUS CDS 4314467 4315615 0.54 - 0 transcript_id "g862.t1"; gene_id "g862"; 5 AUGUSTUS start_codon 4315613 4315615 . - 0 transcript_id "g862.t1"; gene_id "g862"; # protein sequence = [MVIRFRPGKLGEKPDSITRRWDIYPKEGDIGYAQVNPHNFCPIFTNEQLTASLRATFLEGPALRASIIMDIEALHQAI # ILALPADPSSVAGLELAKDPSNKRWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVHHQYTWPKVRDFVRDYVTSCTICGR # NKPRRHWPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSFKQAIFIPTHDTITSEQLAELFVIHVFSKHGVSNHVTSDRGSKFVLAFF # RALGKALSMELHYTSGYHPEADGQTECINQTLEQYIRIYCSYQQNDWSPVLPIAEFAYNNAPNASTGITPFFANKGYYPNITIRPEVDMKSDLARDFV # VNLDELHAFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g862 ### # start gene g863 5 AUGUSTUS gene 4315966 4317021 0.45 - . g863 5 AUGUSTUS transcript 4315966 4317021 0.45 - . g863.t1 5 AUGUSTUS stop_codon 4315966 4315968 . - 0 transcript_id "g863.t1"; gene_id "g863"; 5 AUGUSTUS CDS 4315966 4317021 0.45 - 0 transcript_id "g863.t1"; gene_id "g863"; 5 AUGUSTUS start_codon 4317019 4317021 . - 0 transcript_id "g863.t1"; gene_id "g863"; # protein sequence = [MEPILLRAIHSEVAACAAGRSSNTPTVPPLHPSIPEEYAEFADVFDKIAADSLSEHRPYNLKIDLEEGASPPLSHIYP # LSEKELVALKDFVDKQLATGAITPSSSPHGAPVLFVLKKDGKLRLCADFRGLNHITKKDRYPLPLISDLLDAPKRAKIYTRLDLAHAYHLVRIAEGDE # WKTTFRTHYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLWRLRKHWLYANPEKCEFNMDTVEYLGYIL # SPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFEISKLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g863 ### # start gene g864 5 AUGUSTUS gene 4321340 4322838 0.6 - . g864 5 AUGUSTUS transcript 4321340 4322838 0.6 - . g864.t1 5 AUGUSTUS stop_codon 4321340 4321342 . - 0 transcript_id "g864.t1"; gene_id "g864"; 5 AUGUSTUS CDS 4321340 4322149 0.98 - 0 transcript_id "g864.t1"; gene_id "g864"; 5 AUGUSTUS CDS 4322218 4322838 0.6 - 0 transcript_id "g864.t1"; gene_id "g864"; 5 AUGUSTUS start_codon 4322836 4322838 . - 0 transcript_id "g864.t1"; gene_id "g864"; # protein sequence = [MSTLPEAMEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVLAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRD # PPPHFDLDAGDHDDQDPPVDPDDPGADNNQDDLDDDSGGLPRGEPGDPSGPGGPGGPRSPISPDIPNEQHAMLELLSGFKGSIETLGTVLAALGHPSD # SSESKSKVKEPEVFDGSDPQKLKTFFVNLTLWVSQEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIR # FNTLAASTNWDYAALKWAYRQGLAERIKDEMAHLPEPAMLADYRQEVLLIDNCYWKCEETKKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSS # APFTPKPKPFSGGKPNNNGKPQNSSNSGQSSGQRPTFNHLGADGKVLPSEKERRMKNNLYLFCGGKHQIADCNKQKARESKGRAAEVEETPEATVEVV # EEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g864 ### # start gene g865 5 AUGUSTUS gene 4327095 4327787 1 + . g865 5 AUGUSTUS transcript 4327095 4327787 1 + . g865.t1 5 AUGUSTUS start_codon 4327095 4327097 . + 0 transcript_id "g865.t1"; gene_id "g865"; 5 AUGUSTUS CDS 4327095 4327787 1 + 0 transcript_id "g865.t1"; gene_id "g865"; 5 AUGUSTUS stop_codon 4327785 4327787 . + 0 transcript_id "g865.t1"; gene_id "g865"; # protein sequence = [MIDSGATGLFLHQKFVNKHHIYVRLLPCPIELYNIDGTANLAGRITHSARLLARVDQNQSQILEFLVTNIGSEDVILG # LPWLCKVNPDINWRDGQIQIPAKPKVQHHVAIEEVPEPKELNVGGNTEQILESNRPESSDLPHPVPRTEPGLETTETGTSSRDELVFEESGSPLYCLT # GNCKQCRAWLRAGFIQEVTEELWCAAGYTYSQQLAKAANKDKAQKTFEEMVPEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g865 ### # start gene g866 5 AUGUSTUS gene 4328253 4329125 0.99 + . g866 5 AUGUSTUS transcript 4328253 4329125 0.99 + . g866.t1 5 AUGUSTUS start_codon 4328253 4328255 . + 0 transcript_id "g866.t1"; gene_id "g866"; 5 AUGUSTUS CDS 4328253 4329125 0.99 + 0 transcript_id "g866.t1"; gene_id "g866"; 5 AUGUSTUS stop_codon 4329123 4329125 . + 0 transcript_id "g866.t1"; gene_id "g866"; # protein sequence = [MYFGLTNSPATFQALLNSIFADLIAVGKVAVYLDDILIFSASLQEHWKIVHEVLEQLAKNGTYLRPEKCEFEQTSIEY # LGLMISEGEVHMDLVKVEAVKNWPAPTCLQDVRGFLGFANFIDGFAKKARALNDLTKKGVGWSWGTNEQVAFETLKEAFTTAPILVLWDPDKPTRIEV # DACGFATGGVLLQQQGDGLWHPVAFRSASMDPAERNYEIREMLAIIEALKDWRHFLEGLPNPFEIVTDHRNLEYWRTAQDLSRRQARWALWLSRFDFT # LTHRTGKTNAQADTLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g866 ### # start gene g867 5 AUGUSTUS gene 4329993 4330583 0.97 - . g867 5 AUGUSTUS transcript 4329993 4330583 0.97 - . g867.t1 5 AUGUSTUS stop_codon 4329993 4329995 . - 0 transcript_id "g867.t1"; gene_id "g867"; 5 AUGUSTUS CDS 4329993 4330583 0.97 - 0 transcript_id "g867.t1"; gene_id "g867"; 5 AUGUSTUS start_codon 4330581 4330583 . - 0 transcript_id "g867.t1"; gene_id "g867"; # protein sequence = [MSNPTPDPAPTTPVTTPHVHGKSLLREPSIFDGDKTQFKEWRCTLFAYIRNPRNRVTADNERIDIAISYMRGPKVSSW # VQNYTDNNFDDDKEEWAITWKGFKDALNASFLDKRLTGNAQDKLEYLCQGPNERVEDFFKEFEVIMRDAGYAKDAPYVIRLIKMNVKPKLKDQVYGTS # NERIEKFDELKQKIISINDM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g867 ### # start gene g868 5 AUGUSTUS gene 4331514 4333697 0.37 - . g868 5 AUGUSTUS transcript 4331514 4333697 0.37 - . g868.t1 5 AUGUSTUS stop_codon 4331514 4331516 . - 0 transcript_id "g868.t1"; gene_id "g868"; 5 AUGUSTUS CDS 4331514 4333697 0.37 - 0 transcript_id "g868.t1"; gene_id "g868"; 5 AUGUSTUS start_codon 4333695 4333697 . - 0 transcript_id "g868.t1"; gene_id "g868"; # protein sequence = [MPNTSAPFVVETDASNFAMGAVLLQQALDGELHPVAYYSKVMSLAERNYDIYDKELLSVIRALEEWRPYLEGSPHQIC # VLSDHRNLEYFMSARDLNQRQARWSIFLNWFDFIIEHRPGRLSNGPDGLSRRPDYEEGKEHDNKNQVLLDNKRVRQCCQVMLQPYQFMVKVGEIAEVE # DDSKILEQICTASPKDTKLKAVFNKEHADGLIQRRLKEWEVIDGVVYFRGLVSVPNDPDIKHQILELYHDSIPAGHPGEAATLAAVMRNYRWPRMAEY # VKQYVSGCETCQLNKPQQQRPFGKLQTTEIPKGPWQFITVDFIGRLPESNGYDFIMVVVDCFLKRAHFLSCNSTITAEGAADLFMEHIWCLHGTPQKV # LSDQGPQFISKFLAHIYERMGIKRSLSTAYHAQTDGQTEHVNQDLEVYLRIFINYYQDDWSRWLPFAEFAQSNRHYKAIGTTPFFAEYGYHPTFSIDP # VSSQRVPKADNHLDQIHQVQHNIQSMLEIAAKRMKRFYDDWKEDAPQYQPGDKVFLERTDLHSLRPSHKLDHKRYGPYTIQEKNSDSAYKIRIPSHWR # VHDVFHVSSMIPVNKETIIGHIQPPPPPVFLYEDGTEELEVEQILKMCVGSDGVKEYSLKWKDMDEYENEWLSEVDINTPELLAEFEAGEEAKRNENN # AGGNTKYSSFNLHSQTFFFPQKYLILSFAGGRHRRGRAWCHDMTTNNSAHTTYVPLVSLNC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g868 ### # start gene g869 5 AUGUSTUS gene 4334157 4335335 0.59 - . g869 5 AUGUSTUS transcript 4334157 4335335 0.59 - . g869.t1 5 AUGUSTUS stop_codon 4334157 4334159 . - 0 transcript_id "g869.t1"; gene_id "g869"; 5 AUGUSTUS CDS 4334157 4335335 0.59 - 0 transcript_id "g869.t1"; gene_id "g869"; 5 AUGUSTUS start_codon 4335333 4335335 . - 0 transcript_id "g869.t1"; gene_id "g869"; # protein sequence = [MVTHDTTMRMVVGDHREDVRFDIADIGDDNIILGISWLRKHQPQIDWARTTITFNSDWCRTRCHRCWKHKPIPTAKKV # VQTISGMGKPTNTTAEGQAIPTRAERNQNSKRSKTQKTMLQQHEKADAIRVAQAAIQDPLQWTEGEGMAGTSDGQVCRPVLTGTTRESACPREPERGD # QSWIFEHSYDIDLKTVYVKTGGSFSQQLAESARPTVSQSTEDMVPSEYHEFFDRFDKRESDRLPAHTPHDLAIELEDGTALPKSGKLYQMSPAKRKAL # KEFLHENLDKGYIRPSRTPLGAPVFFVKKKDGGLRLCVDFRALNTITKKDSYPIPLTADLIDCLKAANLFTTLDMCWGYHNVCIREGDEWKTSFRTRY # GQFEFLVMPFGLSNASAAFQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g869 ### # start gene g870 5 AUGUSTUS gene 4335677 4336273 0.39 - . g870 5 AUGUSTUS transcript 4335677 4336273 0.39 - . g870.t1 5 AUGUSTUS stop_codon 4335677 4335679 . - 0 transcript_id "g870.t1"; gene_id "g870"; 5 AUGUSTUS CDS 4335677 4336273 0.39 - 0 transcript_id "g870.t1"; gene_id "g870"; 5 AUGUSTUS start_codon 4336271 4336273 . - 0 transcript_id "g870.t1"; gene_id "g870"; # protein sequence = [MPRMPARTKTNGEYCSFGDIDPENTASSESHALRQNSSFLSQHISNFRSIFNRLSPADKQTKLVHDILKDSLRDDIQK # HLVGWRGTTAKELVDRLNKIEPDLKRLRQRKYIHSTQSTTNPSPIPTPIATYTPPPCHDPNTMDMDALRRLHEEKAKLRCKVCGGIGHLDAHCSTQCV # ARVETLVKEGLFPAEDAIPGFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g870 ### # start gene g871 5 AUGUSTUS gene 4341967 4342572 0.69 + . g871 5 AUGUSTUS transcript 4341967 4342572 0.69 + . g871.t1 5 AUGUSTUS start_codon 4341967 4341969 . + 0 transcript_id "g871.t1"; gene_id "g871"; 5 AUGUSTUS CDS 4341967 4342125 0.77 + 0 transcript_id "g871.t1"; gene_id "g871"; 5 AUGUSTUS CDS 4342183 4342572 0.7 + 0 transcript_id "g871.t1"; gene_id "g871"; 5 AUGUSTUS stop_codon 4342570 4342572 . + 0 transcript_id "g871.t1"; gene_id "g871"; # protein sequence = [MDCIPLPDLVALGRTCKQSRIDVTKYKERVFSIQHAYRNFFNVEEIAEFQKLQQLIGLLVSGSIALEFFNREAYDGDL # DAFCNIQHCEVAGDWLISHGYLYQCKVGQAVEFIDALSETPVISTTSDADTEEYRFSTVIAVWDFVRNSSKIQLIATCGAPLECIFSFHSSALVISFI # MTLYTY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g871 ### # start gene g872 5 AUGUSTUS gene 4345837 4346166 0.5 - . g872 5 AUGUSTUS transcript 4345837 4346166 0.5 - . g872.t1 5 AUGUSTUS stop_codon 4345837 4345839 . - 0 transcript_id "g872.t1"; gene_id "g872"; 5 AUGUSTUS CDS 4345837 4346166 0.5 - 0 transcript_id "g872.t1"; gene_id "g872"; 5 AUGUSTUS start_codon 4346164 4346166 . - 0 transcript_id "g872.t1"; gene_id "g872"; # protein sequence = [MHGAHYPAEQDAQAGNVEIETGDVVPSDVPERLKEKANTAYMDAVGIKLDEMVEEPAFIVELEIEDAAVKRNDTYEAG # ERKADARLYAGCWTKDIRVLLLLLIRVCRVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g872 ### # start gene g873 5 AUGUSTUS gene 4353139 4354200 0.85 + . g873 5 AUGUSTUS transcript 4353139 4354200 0.85 + . g873.t1 5 AUGUSTUS start_codon 4353139 4353141 . + 0 transcript_id "g873.t1"; gene_id "g873"; 5 AUGUSTUS CDS 4353139 4354200 0.85 + 0 transcript_id "g873.t1"; gene_id "g873"; 5 AUGUSTUS stop_codon 4354198 4354200 . + 0 transcript_id "g873.t1"; gene_id "g873"; # protein sequence = [MLLQPDLNEWLKAEEKEISGLFDLGVFEEVLTCPKGKFPIGLKMVYDLKLDGTKKARLGAQGFTQQPEDYGNVHTPVT # RMVSYRIVMAWTAQMDLELYCFDVKQAFPNAPLAKEIYVKQIPGRPIPTNPNAIYRLCQALYGLHQASAAWYSMLSKALEGIGFKQCECDDAVFIGHW # TMPPDTSITMLTTGDPLVMLMLVHIDDGLMSTNSADLYCWFITRINEQFKVIDLGPTSTFLGIRIYCDHPHHLLWLSQESYVKDILERYSLTKCITHN # LPLQYKFDGPDPNLTPYADVDPESLMKIYQGLIDCLLFLALCTQPDIAYTVMFLAQFNSKLLSRHLIAVKGTLQYLAKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g873 ### # start gene g874 5 AUGUSTUS gene 4354273 4354749 0.93 + . g874 5 AUGUSTUS transcript 4354273 4354749 0.93 + . g874.t1 5 AUGUSTUS start_codon 4354273 4354275 . + 0 transcript_id "g874.t1"; gene_id "g874"; 5 AUGUSTUS CDS 4354273 4354749 0.93 + 0 transcript_id "g874.t1"; gene_id "g874"; 5 AUGUSTUS stop_codon 4354747 4354749 . + 0 transcript_id "g874.t1"; gene_id "g874"; # protein sequence = [MALSDADWGSNSLDCKSISGFGIFLFGGLVAWSASKQKSIALSSTKAEYMGLTHILKELLWVRVFTALISLLIPVPFP # LISDNRSSIDIANSRSVSNRSKHIDICYHFICFHIEDDSITTVWCSSLNMITDIFTKSLPTDLHYKHSLSLGLVPLPAVT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g874 ### # start gene g875 5 AUGUSTUS gene 4358341 4358799 0.84 - . g875 5 AUGUSTUS transcript 4358341 4358799 0.84 - . g875.t1 5 AUGUSTUS stop_codon 4358341 4358343 . - 0 transcript_id "g875.t1"; gene_id "g875"; 5 AUGUSTUS CDS 4358341 4358799 0.84 - 0 transcript_id "g875.t1"; gene_id "g875"; 5 AUGUSTUS start_codon 4358797 4358799 . - 0 transcript_id "g875.t1"; gene_id "g875"; # protein sequence = [MCLRFAALERKFGEIDRARAIYAHASQFCDPRVNPQFWSEWNAFEYETGSEDTFREMLRIKRSVQAQFNTEASYIAAQ # TMAAQQGTRQADNNAMEEASDAMAVTEREAGSAPSFVTAKQTALHPQPQPDAASATATTAANADEIHISDEEDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g875 ### # start gene g876 5 AUGUSTUS gene 4360036 4361709 0.5 - . g876 5 AUGUSTUS transcript 4360036 4361709 0.5 - . g876.t1 5 AUGUSTUS stop_codon 4360036 4360038 . - 0 transcript_id "g876.t1"; gene_id "g876"; 5 AUGUSTUS CDS 4360036 4360698 0.55 - 0 transcript_id "g876.t1"; gene_id "g876"; 5 AUGUSTUS CDS 4361095 4361709 0.81 - 0 transcript_id "g876.t1"; gene_id "g876"; 5 AUGUSTUS start_codon 4361707 4361709 . - 0 transcript_id "g876.t1"; gene_id "g876"; # protein sequence = [MPSVASKIPSADELKALFPLTLPIPTPDTIPDLITPKDFYREENLLRNPQSFQAWWSAIHTAQESYATEIKLERSDLP # ESSVALLGPLATPLARISFQRLTYLYEAALVHFPNLFKMWKSYLIMRMSFVLGKQVVKKRAGSRKKFPEMKDALVDEREDLEQWEGGLNSIIGWEEWK # SLIATFERALMWVPNVSSFVFHVFTENSSFSDEVGLDVEETLQSNAVVAEADAKETESEKEAAPASVDGKLIRMAGPAVAVDADGKALPPYDEDIDFK # SLRKLNIEQIIYKDSFAVYKDQAGQLWTGLATYWIKRGEFDRAKETFEKGLDSVLTIQDFTQIFDAYAEFGELLISAMMESLADEEDEAEVAETEKEL # DLRMKEFEELMDRRPFLINGVLIRRNPNDVQEWEKLVALHGDDDEKVGIFVSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g876 ### # start gene g877 5 AUGUSTUS gene 4363334 4365192 0.32 + . g877 5 AUGUSTUS transcript 4363334 4365192 0.32 + . g877.t1 5 AUGUSTUS start_codon 4363334 4363336 . + 0 transcript_id "g877.t1"; gene_id "g877"; 5 AUGUSTUS CDS 4363334 4363432 0.46 + 0 transcript_id "g877.t1"; gene_id "g877"; 5 AUGUSTUS CDS 4363510 4363842 0.81 + 0 transcript_id "g877.t1"; gene_id "g877"; 5 AUGUSTUS CDS 4364686 4365192 0.58 + 0 transcript_id "g877.t1"; gene_id "g877"; 5 AUGUSTUS stop_codon 4365190 4365192 . + 0 transcript_id "g877.t1"; gene_id "g877"; # protein sequence = [MSVDLQFEGVCVAVESSYVVLKDVLDENSGRPVSSDLRSFISLDFNNRQTLYDQVEGLIAENTQLLTPLDMVMHFFND # LFFDCPLPDASTMSMQRVASLSDHGGLWLVDSAREVVSVAVVAQISPYADDLKCGEYLDMTVYNQEIEICRTDTHVQELFSWDITKGSNGKAVNKPNR # ICSNIIRKLRVLPEDEDDMRLLFHTEAVRRADDIDRLAEESRLAEEARELARREEVLHLEKTMEKAKSLADAKKKRLEELRVKTTKNSSTTPTKRSAV # ALASGNLRKSKRLELKKGLADVEVEEGEINEDMFIDLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g877 ### # start gene g878 5 AUGUSTUS gene 4367379 4368619 0.65 - . g878 5 AUGUSTUS transcript 4367379 4368619 0.65 - . g878.t1 5 AUGUSTUS stop_codon 4367379 4367381 . - 0 transcript_id "g878.t1"; gene_id "g878"; 5 AUGUSTUS CDS 4367379 4367510 0.92 - 0 transcript_id "g878.t1"; gene_id "g878"; 5 AUGUSTUS CDS 4367563 4367738 0.69 - 2 transcript_id "g878.t1"; gene_id "g878"; 5 AUGUSTUS CDS 4368346 4368450 0.83 - 2 transcript_id "g878.t1"; gene_id "g878"; 5 AUGUSTUS CDS 4368601 4368619 0.82 - 0 transcript_id "g878.t1"; gene_id "g878"; 5 AUGUSTUS start_codon 4368617 4368619 . - 0 transcript_id "g878.t1"; gene_id "g878"; # protein sequence = [MENDQAHRLITSKDHASDQIAIADVEANGRALPTTTTFALCAIQTNSMVEIKRTDPPQPLVNDDKEDSKYRLLYTKSK # IYVNPTAYARDNIPGFISLVKRDAPNPSYYLAWFPETLLNERGATEWDKFVKVEEKADLDDEDNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g878 ### # start gene g879 5 AUGUSTUS gene 4370253 4370891 0.66 - . g879 5 AUGUSTUS transcript 4370253 4370891 0.66 - . g879.t1 5 AUGUSTUS stop_codon 4370253 4370255 . - 0 transcript_id "g879.t1"; gene_id "g879"; 5 AUGUSTUS CDS 4370253 4370891 0.66 - 0 transcript_id "g879.t1"; gene_id "g879"; 5 AUGUSTUS start_codon 4370889 4370891 . - 0 transcript_id "g879.t1"; gene_id "g879"; # protein sequence = [MWIGAIPFELRILTLPERVLVSRYFAAAYIVKLYPKKQGSTSLPTDMLTSGLKGNVSSYFMNIQEIAGMVDNGLLPPR # PSILAATIAVTFIGPNKVPLKALAPMMTVRRKRVADALRWLIANNPLYSGIQLSERNLQQLPEDGVPEEIWGNVKWTDQVTLLEKEHAGYVPEDNDEE # LVDDDEENEFVYGNSGYYYNLEDTFINERLSGSGKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g879 ### # start gene g880 5 AUGUSTUS gene 4371871 4372371 0.65 + . g880 5 AUGUSTUS transcript 4371871 4372371 0.65 + . g880.t1 5 AUGUSTUS start_codon 4371871 4371873 . + 0 transcript_id "g880.t1"; gene_id "g880"; 5 AUGUSTUS CDS 4371871 4372371 0.65 + 0 transcript_id "g880.t1"; gene_id "g880"; 5 AUGUSTUS stop_codon 4372369 4372371 . + 0 transcript_id "g880.t1"; gene_id "g880"; # protein sequence = [MNDSELHEYYLQHHSSNSYLGRRDNALPAPASYFYNDSRHLYSHPIAPGREKPQPFVLHIVGRVSAQGNFMSLKKSIS # SLLNPNAATEKIQTKSLRHSALLGRARAGPFPQDWPHAMSKLKELMKILTKSETEPTRNLWVNEGGNVNDVHIKFGSPCFKVFQSISL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g880 ### # start gene g881 5 AUGUSTUS gene 4373790 4374041 0.56 + . g881 5 AUGUSTUS transcript 4373790 4374041 0.56 + . g881.t1 5 AUGUSTUS start_codon 4373790 4373792 . + 0 transcript_id "g881.t1"; gene_id "g881"; 5 AUGUSTUS CDS 4373790 4374041 0.56 + 0 transcript_id "g881.t1"; gene_id "g881"; 5 AUGUSTUS stop_codon 4374039 4374041 . + 0 transcript_id "g881.t1"; gene_id "g881"; # protein sequence = [MPQFNWEDVDANSSLIQSSNNNVVKLADNGTLSFIQVTTRANNVQGPSGNGGERFDGGGNTRAGPINTIGDTIFGQNK # EPSRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g881 ### # start gene g882 5 AUGUSTUS gene 4379584 4379934 0.69 - . g882 5 AUGUSTUS transcript 4379584 4379934 0.69 - . g882.t1 5 AUGUSTUS stop_codon 4379584 4379586 . - 0 transcript_id "g882.t1"; gene_id "g882"; 5 AUGUSTUS CDS 4379584 4379934 0.69 - 0 transcript_id "g882.t1"; gene_id "g882"; 5 AUGUSTUS start_codon 4379932 4379934 . - 0 transcript_id "g882.t1"; gene_id "g882"; # protein sequence = [MNDYSSQAYKKARRQYLKTTRNKDSNIDKAWTSFHAAEKHFKARFPPPDFVKVLDLATLDASRAPEVAAGIWAGKSGA # VETRAFVTKVGTKGYAMPSMPGKSLHTYKSAWILYTYP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g882 ### # start gene g883 5 AUGUSTUS gene 4381484 4382378 0.37 + . g883 5 AUGUSTUS transcript 4381484 4382378 0.37 + . g883.t1 5 AUGUSTUS start_codon 4381484 4381486 . + 0 transcript_id "g883.t1"; gene_id "g883"; 5 AUGUSTUS CDS 4381484 4381687 0.88 + 0 transcript_id "g883.t1"; gene_id "g883"; 5 AUGUSTUS CDS 4381745 4381909 0.37 + 0 transcript_id "g883.t1"; gene_id "g883"; 5 AUGUSTUS CDS 4382061 4382378 0.81 + 0 transcript_id "g883.t1"; gene_id "g883"; 5 AUGUSTUS stop_codon 4382376 4382378 . + 0 transcript_id "g883.t1"; gene_id "g883"; # protein sequence = [MFQLNEAELEVDSDKASYKQKLEVLQQQEELIEDEEEQKQKEEDARGAKRKAEEREAQTAQALLPDTELVPESVKAEG # DDARMTTEQLKELGEALSILSIRSSVLKERSDLRALMDENLHAEEMISQDAQGHIPVQDLQKALAVIKHRSDDKIGQAVIQKLDVDKDGFVELEHVLG # LVQEEGLGAVSEPFRTYRIPIDFVDDDAQTLIGQGREIKNSKPRKEDIVQED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g883 ### # start gene g884 5 AUGUSTUS gene 4386411 4387112 1 + . g884 5 AUGUSTUS transcript 4386411 4387112 1 + . g884.t1 5 AUGUSTUS start_codon 4386411 4386413 . + 0 transcript_id "g884.t1"; gene_id "g884"; 5 AUGUSTUS CDS 4386411 4387112 1 + 0 transcript_id "g884.t1"; gene_id "g884"; 5 AUGUSTUS stop_codon 4387110 4387112 . + 0 transcript_id "g884.t1"; gene_id "g884"; # protein sequence = [MSTAVLPALDKPPSVPPPPRQPYPQLAYNPFVPPAVPPPPSGPPGSFVLDERARMAAAIAAKLGAIRPPQPPESAPPP # VEEQSKRFATYNDFTLLFTDTTYYRRPDPHGFAARLMAEWVHKEGQGLGADGSGVVNALTVEQVKGGKGPGATRGRMTNRGKIINNNEDVKAREKARF # GEPNPIVLLTNMVGSEDVDDDNLRSEIGLFDLLLWITSCSHWNQGMNVLRTVLLRGC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g884 ### # start gene g885 5 AUGUSTUS gene 4399720 4399905 0.28 - . g885 5 AUGUSTUS transcript 4399720 4399905 0.28 - . g885.t1 5 AUGUSTUS stop_codon 4399720 4399722 . - 0 transcript_id "g885.t1"; gene_id "g885"; 5 AUGUSTUS CDS 4399720 4399905 0.28 - 0 transcript_id "g885.t1"; gene_id "g885"; 5 AUGUSTUS start_codon 4399903 4399905 . - 0 transcript_id "g885.t1"; gene_id "g885"; # protein sequence = [MYSVPSDILAELNELVRREAASADKDVSGWVYDSTDVYDEQKKEELSVVHDDIDYYAKSSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g885 ### # start gene g886 5 AUGUSTUS gene 4400538 4401011 0.9 - . g886 5 AUGUSTUS transcript 4400538 4401011 0.9 - . g886.t1 5 AUGUSTUS stop_codon 4400538 4400540 . - 0 transcript_id "g886.t1"; gene_id "g886"; 5 AUGUSTUS CDS 4400538 4401011 0.9 - 0 transcript_id "g886.t1"; gene_id "g886"; 5 AUGUSTUS start_codon 4401009 4401011 . - 0 transcript_id "g886.t1"; gene_id "g886"; # protein sequence = [MFRSAEQDCESNAEQDYESSAEQDYESNAEQDYESSVEQDHESIAKQESRPEQEYESSPEQVYRSTAEQVYRPADAQT # QDISAAHVYDLYESSEEQVYGISAGQVYDSYDSSEKQVHGISAGHTYGSYDSSTKQVYGTNKEQIYRSSAEQLYRSSPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g886 ### # start gene g887 5 AUGUSTUS gene 4412261 4416009 0.14 + . g887 5 AUGUSTUS transcript 4412261 4416009 0.14 + . g887.t1 5 AUGUSTUS start_codon 4412261 4412263 . + 0 transcript_id "g887.t1"; gene_id "g887"; 5 AUGUSTUS CDS 4412261 4412358 0.17 + 0 transcript_id "g887.t1"; gene_id "g887"; 5 AUGUSTUS CDS 4413225 4413381 0.42 + 1 transcript_id "g887.t1"; gene_id "g887"; 5 AUGUSTUS CDS 4413529 4416009 0.97 + 0 transcript_id "g887.t1"; gene_id "g887"; 5 AUGUSTUS stop_codon 4416007 4416009 . + 0 transcript_id "g887.t1"; gene_id "g887"; # protein sequence = [MKHNNIVLYSSNNDSEDVRPSKVSATTTKDTECSEVTKLPLNIKPKFYRTCERKSITLVITNLKAFCTLNIINLSVHP # SELVFDLPKLTTIAPKKSQVQLTQLDLEAAKTALRQKQEEQKQQRAQRSARRESYKELSSNISKLTEGSSSSQRIPSAEKKSSTPIRDKAVSELQSVT # KDRIQSNLELQQQRAASLLISPLAQHIPLPNSPELTLRQIEKLPASNSIPGSFDHQASEEEDHSINSEQEQSFVEFENFASTQLFPPEFSESEEGQEL # ELPESSSAVEQIKQEETDSESLFDLEYKEGSKTPPPFAFSFGQAISPGFLNFNPNSQQTSSPRNSLYKTTITMSGSSSTMPRPGSRDAPRLTAEGTDD # PMKVRRYFDDLENLFTDCNINNELHKKKWTVRYPEEQVAWEWKAMSEYSTATSTFTEFKKVVLSSYPGATDEERGTMRELNRLFKKYKNIGSDDLDEY # MALVRRFRAVKKELNPPQVAGAAVQPEPLVTNRELVEKFTRALDIGFRNAIFAALHIKGKTRTVPAGQKVRPDDMYDIDEVIAQGEAIARGTMPGTDP # MSSVATNASSSYAPPVHIKQEQFQQQINDLISEKIAVLMDTIKISQDQVRQENSKQINEFMRTYQQNNVPRGSVPQGYASHQMPAGFETNPVKSQNVE # MRDNNKAPYDWHGNLSKVVCYFCSEEGHVANDCHHRQDLLELGRIVLVNGRARLPGNYPIPRQPIGAVSEKDRIDYYYLEKEKRDKDNAKQVNLVQST # PNNIPGMINTATMSTYLSNQLSDKDLRIANLEKELQSLNNPASQMMYQMPGQMNQFMQQPFYMPQHNPMMQSQFSQVGWNPSSQMNSYIPSTSPTMHM # LNSMYQNQNSMTPNYPNMGMHTQPQQSMPTMAEIEAFVQTRRQKEESEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g887 ### # start gene g888 5 AUGUSTUS gene 4416219 4420243 0.51 + . g888 5 AUGUSTUS transcript 4416219 4420243 0.51 + . g888.t1 5 AUGUSTUS start_codon 4416219 4416221 . + 0 transcript_id "g888.t1"; gene_id "g888"; 5 AUGUSTUS CDS 4416219 4417164 0.62 + 0 transcript_id "g888.t1"; gene_id "g888"; 5 AUGUSTUS CDS 4417221 4420243 0.52 + 2 transcript_id "g888.t1"; gene_id "g888"; 5 AUGUSTUS stop_codon 4420241 4420243 . + 0 transcript_id "g888.t1"; gene_id "g888"; # protein sequence = [MKGIQAVDRGVHDRSIQQIDKSEIGPAYKFIAPVQRLGKVNDLVDKILDNDICVKASDLLSTSKPIREELKYRVTQQR # VNSGEQPKSTQVKAQFEELQLDSDTIDIDSLPSVTWEKKTERTNSGEQISAFVVGDVVLQYLETLAPKETAKQIVVAKDSQSLRSIYPLLNGREHVES # LLDSGSQIVSTSQEKAEKAGLIWDPDIVIYMQSANKGLEKSLGLARNVPFLIGDMTVLLQVHVIKEPAYDLLLGRPFDALLQTHIQNFADGRQIITLT # EPLTNRRITVPTFARGTAAILANSSKMEKATESTTANPVAQVFEVKKNGEVEIDSYCLPPKKKFTYDGLRNAYLVASVDATAHDKHAQHSLSSYLSSV # YSMDIKTPGTNISTAGTAEVVYTEDWKFSKLFDINRTKNPIRVTKTIENPETTPKTSENRIDYISKIKHEFYCINHTPLSSFISKLSQSEIGDLKPCR # TDIYFEPMAVLASRKYKPVAKKVRPIIGELPQKFRIIRDIKGDPLKDMPKLSTHPPEFKPTGRYTEARKAIIDKIHGDDFLWPEERKLMHHLMMEQEM # GFAWNDEERGKFREDFFPPVDMPVIPHTPWVEKNIPIPPGTYDEICKAVKVKIDAGVYEPSNSSYRSRWFGVLKKDGKSIRLVHSLEPLNKVTIQHSG # LPPATDELADQFAGYSCGAILDMYVGYDERMLATQSRDFTTFQTPYGALRLTTLPMGWTNSVPIFHDDVTYMLREEIPHVTRPYIDDVPIKGPPTRYE # TKDGSYEVIPENSGICRFVWEHMQNVNRVIQRVKYCGGTFSGHKAVVCASEFKVVGYRCTYEGRVVDPDLMGVIDRWGPCKNIGDVRSFLGTAGLCRM # FVKNYAKIAEPINNLRKDNVVFFWGPIEQKAMDELKKAIKESPALRKLDYNSDSNVILSVDSSFKGVGFYICQEDEKDKRKRHYARFGSITYNDREAR # FSQPKRELYGLYRALQACKYWLFGVRKLTIEVDAKYIKGMLQHPDEVPNAAINRWIEQILMFHFELKHIPGKKHGSDGLSRRDLQPGDKIYVNPEEKY # QDEPPAFTVTFENGIDTTIPFEAFKDRIDTRTGYTQEIAESVQDFVQLVEEASRNEAKLRAKFVQQYPANGAFLTTLPQIIKPQNFISEERYEEKHRS # NKGKEQDNRLLLVRKWLKNPKWKPDNMSENQYLNFKQFARQFFTKDDKLYQRNIEGKHRLVVGKEHRMSIMKAAHDGLGHRGVYATKSLLMEWFWWPE # LERDANWYVKTCHLCQQRLKDHIRTPPRLTATPSIFQVLHADTMHMPVSNGKKYFVHGRYKLDGGESP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g888 ### # start gene g889 5 AUGUSTUS gene 4420518 4421255 0.73 + . g889 5 AUGUSTUS transcript 4420518 4421255 0.73 + . g889.t1 5 AUGUSTUS start_codon 4420518 4420520 . + 0 transcript_id "g889.t1"; gene_id "g889"; 5 AUGUSTUS CDS 4420518 4421255 0.73 + 0 transcript_id "g889.t1"; gene_id "g889"; 5 AUGUSTUS stop_codon 4421253 4421255 . + 0 transcript_id "g889.t1"; gene_id "g889"; # protein sequence = [MWADRITVRKRLGCSPFFALTGAHPVLPFDIMQATWLMQIPGHVLSTTELIGLRARALALHTEQVKEIMSRIDQKKQK # DTLRYEHMHTNTIKNFDFKPGELVLVRNSQVENSLNAKMLPRWMGPCIVIRRTAGGSYVLAEMDGAVFQNKVSPFRVRPYNARHKVKLPQALPLLTGI # SMEALDAIANGPEPDNSEAIELESSRIEESLEIEYENDDSIIEPLIRGELNANSEVDYENELSDDEDDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g889 ### # start gene g890 5 AUGUSTUS gene 4421372 4422528 0.36 - . g890 5 AUGUSTUS transcript 4421372 4422528 0.36 - . g890.t1 5 AUGUSTUS stop_codon 4421372 4421374 . - 0 transcript_id "g890.t1"; gene_id "g890"; 5 AUGUSTUS CDS 4421372 4421622 1 - 2 transcript_id "g890.t1"; gene_id "g890"; 5 AUGUSTUS CDS 4421678 4421894 0.59 - 0 transcript_id "g890.t1"; gene_id "g890"; 5 AUGUSTUS CDS 4421958 4422092 0.71 - 0 transcript_id "g890.t1"; gene_id "g890"; 5 AUGUSTUS CDS 4422154 4422315 1 - 0 transcript_id "g890.t1"; gene_id "g890"; 5 AUGUSTUS CDS 4422376 4422528 0.97 - 0 transcript_id "g890.t1"; gene_id "g890"; 5 AUGUSTUS start_codon 4422526 4422528 . - 0 transcript_id "g890.t1"; gene_id "g890"; # protein sequence = [MPACHSAVRALTKRIHEVRAATQPAASVASAINTAGNSNAVTSVPPVMKTKTTRRSNRKGKAPKSVPMIVDTSSEDEE # EVQIIGGDIAMGDSTPPVNNTTSTDSVMSVDSVVPGTTLSVEPMAASTPSIPAPLPANIKFNKNKDKEPIVESNDASKAQVRYLFLGDVPGLDSNSRL # YFKAVHYAKKGFEETRKRQRSGAGSEYINIAPGTSLAFPNSSAQVAAAASSSSSPAATEIIHKAKDLVHNISLSPKSERGLIKQESDLRSELDVTINR # VHYLLQYFDLLKAQHVQVLKELHVAEGTSVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g890 ### # start gene g891 5 AUGUSTUS gene 4428459 4428845 0.93 - . g891 5 AUGUSTUS transcript 4428459 4428845 0.93 - . g891.t1 5 AUGUSTUS stop_codon 4428459 4428461 . - 0 transcript_id "g891.t1"; gene_id "g891"; 5 AUGUSTUS CDS 4428459 4428845 0.93 - 0 transcript_id "g891.t1"; gene_id "g891"; 5 AUGUSTUS start_codon 4428843 4428845 . - 0 transcript_id "g891.t1"; gene_id "g891"; # protein sequence = [MKKLGDKQFGPFKVLEKIGPSSYKFDIPHTWKRIHNVFNETHLSPYHEPQFPTQPRNTEPPPEVVGEEEEYEVEEVVV # ACKYWNGIQYKVKWKGYGPHEMMWESAANITNAKEAVQDFHKKYPNKLRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g891 ### # start gene g892 5 AUGUSTUS gene 4432011 4432394 0.78 - . g892 5 AUGUSTUS transcript 4432011 4432394 0.78 - . g892.t1 5 AUGUSTUS stop_codon 4432011 4432013 . - 0 transcript_id "g892.t1"; gene_id "g892"; 5 AUGUSTUS CDS 4432011 4432394 0.78 - 0 transcript_id "g892.t1"; gene_id "g892"; 5 AUGUSTUS start_codon 4432392 4432394 . - 0 transcript_id "g892.t1"; gene_id "g892"; # protein sequence = [MFPLWQARPHCEVLSRESNEAAVHQRHVEPDDTGGSGGYGQRIGFCTAPAVDKGLLGPISESVSDFLSLSYVDSQFSF # EFGSTGTSNKNNLSMMTTQTEEKPVRYEPNTSEWVAQRLQVDKLSMAIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g892 ### # start gene g893 5 AUGUSTUS gene 4432580 4433179 0.99 - . g893 5 AUGUSTUS transcript 4432580 4433179 0.99 - . g893.t1 5 AUGUSTUS stop_codon 4432580 4432582 . - 0 transcript_id "g893.t1"; gene_id "g893"; 5 AUGUSTUS CDS 4432580 4433179 0.99 - 0 transcript_id "g893.t1"; gene_id "g893"; 5 AUGUSTUS start_codon 4433177 4433179 . - 0 transcript_id "g893.t1"; gene_id "g893"; # protein sequence = [MSNPTPASTTTTSNIHGKSLLREPSIFDGNKAQFKQWRRTLFAHICDPRNRIVTDSERIDIVVSYMRGPKVSSWVQNY # TDDNFNDDEEEWKVTWKGFKDTLNASFVDKGLTENAQEKLEHLRQGPNERVEDFFKEFEVIMRDAGYAKDTSYVIRLIEMNVKPKLIDQVYGTSNERI # EKFNELKQKIISIDDMWWHREEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g893 ### # start gene g894 5 AUGUSTUS gene 4434441 4440455 0.17 - . g894 5 AUGUSTUS transcript 4434441 4440455 0.17 - . g894.t1 5 AUGUSTUS stop_codon 4434441 4434443 . - 0 transcript_id "g894.t1"; gene_id "g894"; 5 AUGUSTUS CDS 4434441 4437271 0.61 - 2 transcript_id "g894.t1"; gene_id "g894"; 5 AUGUSTUS CDS 4437353 4440455 0.28 - 0 transcript_id "g894.t1"; gene_id "g894"; 5 AUGUSTUS start_codon 4440453 4440455 . - 0 transcript_id "g894.t1"; gene_id "g894"; # protein sequence = [MAAPLTGTIASSPMIGNNKPENDNTVHVTNEIPHTSLSSQHLYKASEFALLTVLQKQQIFNVLIQSPSISCNELRKLA # TLHVDLTTWDSQHQQKNKMKLLSDFAQHFCSNHCLIRQVQAETVGITHIPSISQSEFLECAKALKLRNYNEASAYKHKYEHKHFSQKKMKISHTSTSA # ANDVHFTSPVVDSEIWPEILSLNEKQAILQESYDAGSNASIRMIECSFCGTLETGMNICSIPCTDLDISLLDTAVHEIRLKTQQATIEAFRHETINND # CYQLCIQCKREVRYKTSIDNSEGHGKSQRSFVRLPLRSYANGTWTGDLPNALKGLTFLEEQCIARARATKCMFKLELGPSGQYASRGNVCIFPQDPGP # LATCLPPPLSQLHDEICVILVGSPDTEITIETLTRTPLLVRRSRIINALQWLRLNNPLYYDLNLDAMLVNANQYPEHGIPIPLKSIIRTSSNSEGSSY # TAQANSEQFNENVSSAGMLSSTVVDADHIDSTYQMRKLNALQQLKTGNSPFIKFPSGSIPLSTYKNPKVYAYLWPTLFPYGVGMMENDDVHCNSSVGF # RHIDMRTHIAYLLQSRPNFRFQTHLSFIFVIGNILQRRQTSFNAKLAVKRSWFPRVEMLLGKLSNDTILEFSEKLKKNPFVHPETEGEKAAKQLMKYI # NYIGENIPGSMSEVQNMREELFSLVHTNGLPHVFLTLNPSDTNNPIAQVLAGRNIDLDQIFHDLKLHSENLERSTCIAQNPIAAAQFFDISVRNLLDI # LLGTKRQNKKGVFGEVAVYYGVVEAQGRGSLHIHLLIWLKHGLSPNEIKFKCESDPKWAQHLIDWYDDVFSQSIPNHTQEYIQTEGMYKRQPVMSRPM # NPQISGYWYSFNQDLRNVLENAGMVHEHTDTCFKHLPIKLRSLRNDDKDCRFQLPRDKVEKTHFDEDGYLVLKCNNGNVNGHNTIITVAERCNTDAKP # IGSGSVAMAMFQYFGNYTIKNTMDTAFVFSALCAAIKMLSDNLPMDIDGNLDTYEHSRQFLIKTANKLIGKRELTMLREIASEVFDTADLHNDEESDI # NCNGNSIEDPETLQQNLPPREEFDCDSFVLLTEKTLKTGKFSSKSYTHNSLFNDIFFRPDVLFDICAWDLMCEYSKEELPKSKKQIKTYLRFKLGHPQ # YTTHCLKKIDADNYQRVPVLKGYPIPRSDKIECQDKYMIAMLALFKPWSHNEQSPLKAPQEAWNTAFNTWKDTDLFKSHIRIINNMQLLYESKDAKLD # YSAQRQKRLAELSHKLASEEDDGESYLYDPEWENAMQVQVPATIDNDILQEVDNYNVVSQEVLDVMEATVQRGFYKGELDSSSKKQLQNSYSNCTRVA # TLLDKVAVEDSINSIMKEKEDLIKRRLEFIRKPDSQLHHRLPTSCIPSPFATELNKEIEYAQKLFMKFHPNSPAWDELKFHQKLAIALINKHKLNDQQ # ILAFLLLADTVGHQSLTDKPVEPLRMLVTGPGGTGKSRIFAAWSDFHEGINCKDEFRLTAPTGVVASQIGGCTIHSEAALRVARSTMKAETAGGQKIR # SQLEKRFAPLRTLVVDEIYFMSPENISILSEYCSIAKGITEHPFGKLNIITCGDPAQLPPPRAKPLFDRELVKCYESTHLNALNSKTQYEVKGIQAWH # QIDKVVVLSEIMRQKGDDMLIDILSRLRTGTCTQVDKDILDKYVLSNDACSNETKSLIDITQWITNPERACPLITYTNAARDAHNFESAKAFARATGQ # EFHVYHSTDTRGRGKNKKVIKGVAAEAAWRIPVKDAQDLGGKVPYIPGMPVFGTENIATELGLSNGSLGTLVSLTYEIHDDRYYAVSATVDFPGYKSN # DPIHPNRVLLKPITQSIKFHLPNSEKLYTATRKQLPLIPAFAFTSHNAQGRSMDVACIDFASCHSIQSAYVMLSRVHSLKGLCILRPFSINKIRNHIS # EELRSELKRTENLASRTAEAAKNNLSWYYSKFPTQLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g894 ### # start gene g895 5 AUGUSTUS gene 4447641 4448027 0.71 + . g895 5 AUGUSTUS transcript 4447641 4448027 0.71 + . g895.t1 5 AUGUSTUS start_codon 4447641 4447643 . + 0 transcript_id "g895.t1"; gene_id "g895"; 5 AUGUSTUS CDS 4447641 4448027 0.71 + 0 transcript_id "g895.t1"; gene_id "g895"; 5 AUGUSTUS stop_codon 4448025 4448027 . + 0 transcript_id "g895.t1"; gene_id "g895"; # protein sequence = [MRFDPERQYESTSSRTDAPAGATIPVSSLVPFSELPSSFDYSGFLSPMNPPSGPMTDELNTEANSLTPAHPFHNPGIT # RSSTSLSAANSQEDPCRVAVRDNSEDSAIFSPAPLPSRRLSALRLTFILN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g895 ### # start gene g896 5 AUGUSTUS gene 4457371 4458411 0.43 + . g896 5 AUGUSTUS transcript 4457371 4458411 0.43 + . g896.t1 5 AUGUSTUS start_codon 4457371 4457373 . + 0 transcript_id "g896.t1"; gene_id "g896"; 5 AUGUSTUS CDS 4457371 4457499 0.43 + 0 transcript_id "g896.t1"; gene_id "g896"; 5 AUGUSTUS CDS 4457896 4458411 0.88 + 0 transcript_id "g896.t1"; gene_id "g896"; 5 AUGUSTUS stop_codon 4458409 4458411 . + 0 transcript_id "g896.t1"; gene_id "g896"; # protein sequence = [MSGLTPKSPSTAATSPQQLADGDVSAQISQLNLGEPVDDNLRVSWLGKPHFLLEGVIHTVFEGDTQHEEWTKVKHVPH # SRVAAVLDGSWRGLIRWKRVGFGSYPAATPSASSSPNPSHIALPSASNRSYGAASKADLTGPNAEFNTLIDLSTLWVVPKQVRPLEKQLPTESRKLWE # GVTSRLLKKDFSEATKEKVVIEQKQRDEAAERKKKGVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g896 ### # start gene g897 5 AUGUSTUS gene 4460011 4460750 0.44 - . g897 5 AUGUSTUS transcript 4460011 4460750 0.44 - . g897.t1 5 AUGUSTUS stop_codon 4460011 4460013 . - 0 transcript_id "g897.t1"; gene_id "g897"; 5 AUGUSTUS CDS 4460011 4460654 0.74 - 2 transcript_id "g897.t1"; gene_id "g897"; 5 AUGUSTUS CDS 4460735 4460750 0.44 - 0 transcript_id "g897.t1"; gene_id "g897"; 5 AUGUSTUS start_codon 4460748 4460750 . - 0 transcript_id "g897.t1"; gene_id "g897"; # protein sequence = [MLAASMFPQDLTYGFYSLRKKHGDPTKPLDWAIVEATAITEEGYIVPGASVGASPEILQSAEKIIIEVNTRIPSLEGL # HDINHSWIPPHRQPYLITHPSDRIGLTAIPIDPDRVVAVIEGNKPDNTGENAPETAESRAIAKHLIEFLSGEVDAGRLPRSLLPLQSGIGNVANSIIG # GLAEGPFDNVQVWTEVLQGEISCPNKDVPFCLIMGLRYVPPVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g897 ### # start gene g898 5 AUGUSTUS gene 4463809 4464822 0.5 - . g898 5 AUGUSTUS transcript 4463809 4464822 0.5 - . g898.t1 5 AUGUSTUS stop_codon 4463809 4463811 . - 0 transcript_id "g898.t1"; gene_id "g898"; 5 AUGUSTUS CDS 4463809 4464822 0.5 - 0 transcript_id "g898.t1"; gene_id "g898"; 5 AUGUSTUS start_codon 4464820 4464822 . - 0 transcript_id "g898.t1"; gene_id "g898"; # protein sequence = [MLAFAHPGEEEHHHDRRAELNIREFKVAAKRGLSACSEKLQRRDFHNRAAERRAAKVDSYRRHNGLRARDTNTTADTS # HLSSANYTSGTPESTIFASNGTCILNPEGETGPYWVKGELIRSDLREEQPGVPITIEGQFVDVETCEPIVGLYWDIWNCNSTGVYSGLVAMGNGNSDD # ESNMNSTFLRGIQQTDDEGVVTFDTVFPGHYSGRATHIHMIAHLNATLLSNNTLSGGTVPHVGQVFWDQDLINDVEATYPYNTNTIAITENVDDRVFS # TETEDTTSDPVLEYVYLGSNLSDGLFAWVTIAVNTSATYDPNYSFVWTSDGSIAESGGELTVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g898 ### # start gene g899 5 AUGUSTUS gene 4472608 4473567 0.68 - . g899 5 AUGUSTUS transcript 4472608 4473567 0.68 - . g899.t1 5 AUGUSTUS stop_codon 4472608 4472610 . - 0 transcript_id "g899.t1"; gene_id "g899"; 5 AUGUSTUS CDS 4472608 4472933 0.69 - 2 transcript_id "g899.t1"; gene_id "g899"; 5 AUGUSTUS CDS 4473051 4473567 0.68 - 0 transcript_id "g899.t1"; gene_id "g899"; 5 AUGUSTUS start_codon 4473565 4473567 . - 0 transcript_id "g899.t1"; gene_id "g899"; # protein sequence = [MRTHPRECRIPDSVSYSQAALAEPLSVLLHASRRAGICPASSYPSLGSSTSFSTTSTTSTSSSAAGKKVLVFGVGAIG # LIACALAQELGAERVCAVDINNDRLAFAARERFTTSEGNSTYCLPLPPKITSMEPNPKEPENIRRAKENAANALAVFDEPDGFDVIFECTGAESLGMG # SPILSSFPISAAATREVDLIGSFRYADTYNEAVELLSGSNLLTLSCKGGHINGVQAVQNAGFSQKLSKLVTHRYPLSQAKEAFELLARGRDDHGGMVL # KVMIES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g899 ### # start gene g900 5 AUGUSTUS gene 4479332 4480138 0.59 - . g900 5 AUGUSTUS transcript 4479332 4480138 0.59 - . g900.t1 5 AUGUSTUS stop_codon 4479332 4479334 . - 0 transcript_id "g900.t1"; gene_id "g900"; 5 AUGUSTUS CDS 4479332 4479619 0.93 - 0 transcript_id "g900.t1"; gene_id "g900"; 5 AUGUSTUS CDS 4479758 4480138 0.6 - 0 transcript_id "g900.t1"; gene_id "g900"; 5 AUGUSTUS start_codon 4480136 4480138 . - 0 transcript_id "g900.t1"; gene_id "g900"; # protein sequence = [MALYSTIEASKEVLLSTFDKDLPVLPGIRELVDSVEFSTDSAEPLIPIALKAHESFAALKGLEGIIAVALCKKRFGED # TKVKALVNCNHAALFPAMSFLSTVDGIPKWGSEMKNKIMGMSVDDGIYRRGVSLLNGLSSLDATPTLKALGLPPYDEGKNEKKVAQRAIEVSTQRYTS # EDLDKMIRDIKQAGSPCLTRAEFLASSHVRIERERTQVSWLTSSIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g900 ### # start gene g901 5 AUGUSTUS gene 4490568 4492610 0.45 + . g901 5 AUGUSTUS transcript 4490568 4492610 0.45 + . g901.t1 5 AUGUSTUS start_codon 4490568 4490570 . + 0 transcript_id "g901.t1"; gene_id "g901"; 5 AUGUSTUS CDS 4490568 4492610 0.45 + 0 transcript_id "g901.t1"; gene_id "g901"; 5 AUGUSTUS stop_codon 4492608 4492610 . + 0 transcript_id "g901.t1"; gene_id "g901"; # protein sequence = [MDAEDSLRAEKMLEDGSFDNHLKTLRKLLKEARDLGATISDSQFRSILLNSFPETWDAVTLAVPGTTSADAVEHLESH # WIKRVRRARERESEATKAKALMTAAAVQASAARLQLPDNRPICTNPICGKRGHTIEKCWKKGGGAEGKGPTNWRFNRNNTPGTTPSPSAAGVQPQTTA # SHVKIITDPEPEDIYANRIDIPHMKPGASTLELVTLSSPDTPIPRQATPVVNIVCQEGERSTIDPDVSITCRVVAPSECIICLGNTSSQPRTLLDSAA # SEHCWVEKLNFLDYRDVKGQGGNSAIAEEAGRFRIQGVGSVQVTSSVNGVSMSLPLTGVKQTPDFSDNLISLSSLDSLGYRGEWGDGTLLVRAPLGEI # VMVGVQLGNTKLYQVDVQKVHASSAQFHEKPTDLQTWHRRFGHVGTPRILRMASQNLVDGIQITSKTMLGMCEPCLYGKATQRPFDKKVTHETEVLER # VHIDLWGPSRMQSRGGASYMMLCSDGKSSVRVPYFLSNKRAETTCDSFNKYRLMAENQTGKRIRIIQIDGGGELDNGVMREYCESRGILIEKIPPYSS # SANGMAERGNRTVIEGTRTLLDDSEFPRSFWAEAASTFIYVDNFVPTARFPDLVPMEAWTQRRQDVSHLRPLAVSAGPNSQRLVEMGSWHGSQSKVVC # WGIWEGGVKIMYTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g901 ### # start gene g902 5 AUGUSTUS gene 4495513 4499264 0.25 - . g902 5 AUGUSTUS transcript 4495513 4499264 0.25 - . g902.t1 5 AUGUSTUS stop_codon 4495513 4495515 . - 0 transcript_id "g902.t1"; gene_id "g902"; 5 AUGUSTUS CDS 4495513 4496717 0.59 - 2 transcript_id "g902.t1"; gene_id "g902"; 5 AUGUSTUS CDS 4496834 4499264 0.33 - 0 transcript_id "g902.t1"; gene_id "g902"; 5 AUGUSTUS start_codon 4499262 4499264 . - 0 transcript_id "g902.t1"; gene_id "g902"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHFDSPQTSVPSAINPVVAKVAV # PLPEPSPSVSPTILETPPGDSPRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSATPTVPPLHPSIPEEYAEFVDVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRWLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRLVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVS # AFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLAR # DFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQ # LEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYLKTWTLITQNHFIP # FPFSPRSAEVYFVRLEDKHDDSKLSVYLFLLIAYFLFNVLFTYISFTFTTTYTLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g902 ### # start gene g903 5 AUGUSTUS gene 4499597 4501288 1 - . g903 5 AUGUSTUS transcript 4499597 4501288 1 - . g903.t1 5 AUGUSTUS stop_codon 4499597 4499599 . - 0 transcript_id "g903.t1"; gene_id "g903"; 5 AUGUSTUS CDS 4499597 4501288 1 - 0 transcript_id "g903.t1"; gene_id "g903"; 5 AUGUSTUS start_codon 4501286 4501288 . - 0 transcript_id "g903.t1"; gene_id "g903"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTARIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g903 ### # start gene g904 5 AUGUSTUS gene 4502762 4504663 0.96 + . g904 5 AUGUSTUS transcript 4502762 4504663 0.96 + . g904.t1 5 AUGUSTUS start_codon 4502762 4502764 . + 0 transcript_id "g904.t1"; gene_id "g904"; 5 AUGUSTUS CDS 4502762 4504663 0.96 + 0 transcript_id "g904.t1"; gene_id "g904"; 5 AUGUSTUS stop_codon 4504661 4504663 . + 0 transcript_id "g904.t1"; gene_id "g904"; # protein sequence = [MISAELNYDIYDKELLAIMDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYGFVINYRPGR # LGAKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALRRIARKEEESLVWEDGLIKRGGRIYVPDVGT # LRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPATAGPEKYDAIL # VVVCRLTKQAIYIPCHTTDNAEDFANLFITHVFSKHGMPSDITSDRGSLFVSQFWRELCRAVGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYD # QDDWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQEQIGVANKAYAKYANQKRQEAPDWKEGDPVWLN # MENVRTRRPMKKLDHKWTGPYTILSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEGILDSKPKKGQPEEVEY # LVKWEGYNDEFNSWVGWEGMVGSIELLRSWHKHHPRKRQPSRLQWASLEQEAREDEEEDREGRRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g904 ### # start gene g905 5 AUGUSTUS gene 4504896 4507446 0.61 - . g905 5 AUGUSTUS transcript 4504896 4507446 0.61 - . g905.t1 5 AUGUSTUS stop_codon 4504896 4504898 . - 0 transcript_id "g905.t1"; gene_id "g905"; 5 AUGUSTUS CDS 4504896 4506068 1 - 0 transcript_id "g905.t1"; gene_id "g905"; 5 AUGUSTUS CDS 4506126 4506331 0.72 - 2 transcript_id "g905.t1"; gene_id "g905"; 5 AUGUSTUS CDS 4506966 4507446 0.62 - 0 transcript_id "g905.t1"; gene_id "g905"; 5 AUGUSTUS start_codon 4507444 4507446 . - 0 transcript_id "g905.t1"; gene_id "g905"; # protein sequence = [MLDEKDTAETDHQELQKFLTLQQGEAVIAANRKHDRSPSPVAGPSSKKVRLDGSKKRSRCRVPVEGAAQESPRCVRLV # VPPGRSMGASTSTPALPRALPSSMEVSVRDESVQGPSSLVQLAAAAEAQSGVAQRFVSPSPVTSPIKGTGSDSLPSNMPPTSQSQLADSQRENSSLTT # ALRDTSHALDARQREVEQLWSSSHEVLQHEVEYRSVLDQFHAMDRALSVFPGQTVVQHLQALEEELRVVKRDRDVAVEELSTASHKASESKTALLQQQ # GLVDKTNALATRQRRRLEEVQEEVHRTRDRAAFVEQMIKEYPDKGFYEVVLPPLSQLEEDLKRAQEDLRRVATYAHRLYRSDPATVLHHHSRYIGAII # EAVVAFLRRGLASDDPDVVAHNFQLALDYMQTARGIHGDLYMRSISSIQWFFNNAVDEDKGLHRLVLEHSRFDNDGPILTAAQHAGFAAPPEGSLEPP # LHRRMLALSTAFPHRDGSGRWDDIVPAIPSLDQSMVVWEQLMLEYLHHITDTPMSLPVPSDEPPAAVGEGVSSPPASSHVPLFLPEQASPTSPSPPPP # SPSLPPLFGSVADLAIDLTGGDDELYEPEESCRARVSEADGRDAVPKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g905 ### # start gene g906 5 AUGUSTUS gene 4512158 4512976 0.77 + . g906 5 AUGUSTUS transcript 4512158 4512976 0.77 + . g906.t1 5 AUGUSTUS start_codon 4512158 4512160 . + 0 transcript_id "g906.t1"; gene_id "g906"; 5 AUGUSTUS CDS 4512158 4512976 0.77 + 0 transcript_id "g906.t1"; gene_id "g906"; 5 AUGUSTUS stop_codon 4512974 4512976 . + 0 transcript_id "g906.t1"; gene_id "g906"; # protein sequence = [MATCGGYWDWSGCSQGMTVVSSIITPSPPLEIKSSTSVSKAPVAPPRLIRRNRELESLKADASTFCKCQLNPLISYFY # SFNLIAVSSPRPTHSRDSDNELLSRFRSAVSASRAASSTKVSVDRKESKPKTTIKVVEDSKASKPTSSAMVYKRVRLPPCSRKIAPTTAKGKSRQVVV # SDDDSASNEVESEDEEEDSAPPPKRLKTTSSISGKISSLLFLFYFFNLILLQLRCLVVRLNGCPSPNELQRSPQSPLLSIPFFRCLDSYLTFSKLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g906 ### # start gene g907 5 AUGUSTUS gene 4516720 4518551 0.83 - . g907 5 AUGUSTUS transcript 4516720 4518551 0.83 - . g907.t1 5 AUGUSTUS stop_codon 4516720 4516722 . - 0 transcript_id "g907.t1"; gene_id "g907"; 5 AUGUSTUS CDS 4516720 4517095 0.94 - 1 transcript_id "g907.t1"; gene_id "g907"; 5 AUGUSTUS CDS 4517248 4518551 0.84 - 0 transcript_id "g907.t1"; gene_id "g907"; 5 AUGUSTUS start_codon 4518549 4518551 . - 0 transcript_id "g907.t1"; gene_id "g907"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLQELRGF # LGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRLASMQ # PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPLDIITDHSNLEFWRTAQDLTRRQARWALYLFDPTEPLRGSYPESLRTGSTGIGGSQNSQRAQTTA # LGQWIAKWEEDNGWSTTEVEYTYQQTTTYALRYSVSAMTIQLQDTPDYTGHSTWSVPISGGLRCALLWKNTLRDARFVPVRRSSDTHGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g907 ### # start gene g908 5 AUGUSTUS gene 4519390 4520556 0.84 - . g908 5 AUGUSTUS transcript 4519390 4520556 0.84 - . g908.t1 5 AUGUSTUS stop_codon 4519390 4519392 . - 0 transcript_id "g908.t1"; gene_id "g908"; 5 AUGUSTUS CDS 4519390 4520556 0.84 - 0 transcript_id "g908.t1"; gene_id "g908"; 5 AUGUSTUS start_codon 4520554 4520556 . - 0 transcript_id "g908.t1"; gene_id "g908"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARHFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHNPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g908 ### # start gene g909 5 AUGUSTUS gene 4541439 4543020 0.21 - . g909 5 AUGUSTUS transcript 4541439 4543020 0.21 - . g909.t1 5 AUGUSTUS stop_codon 4541439 4541441 . - 0 transcript_id "g909.t1"; gene_id "g909"; 5 AUGUSTUS CDS 4541439 4542027 0.73 - 1 transcript_id "g909.t1"; gene_id "g909"; 5 AUGUSTUS CDS 4542453 4542667 0.46 - 0 transcript_id "g909.t1"; gene_id "g909"; 5 AUGUSTUS CDS 4542781 4543020 0.3 - 0 transcript_id "g909.t1"; gene_id "g909"; 5 AUGUSTUS start_codon 4543018 4543020 . - 0 transcript_id "g909.t1"; gene_id "g909"; # protein sequence = [MPLRTRAQFRANSEENTFFITARSFAPFSESISAIGQPCHCNRGFGPATVPTTSTLPEAMKEDQQFEYNTLYTGDGQP # VQPQRHANSPSPHDPPPHFDLDTGDHNDQDPPVDPNNLDNVDLDDDSGCLPHGEPGDPSGPGRPGGPRTPTSNVTNWDSAALKWAYGRGLAEHIKDEM # ACLPEPATLANYHQEVLRIDNRYWKREETKKCEAGKPFIARNPKKGSSDFKAGSTNQQNDSQPLGSLVPFMPKPKPFNGGKPNNSDKPQNSLNSGQSS # GQRPVFNHLGADGKVLPSEKERRMKNNLCLFCSGKHQIADCNKRKARESKGHAAELEETPDAMPIIVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g909 ### # start gene g910 5 AUGUSTUS gene 4544666 4548054 0.38 - . g910 5 AUGUSTUS transcript 4544666 4548054 0.38 - . g910.t1 5 AUGUSTUS stop_codon 4544666 4544668 . - 0 transcript_id "g910.t1"; gene_id "g910"; 5 AUGUSTUS CDS 4544666 4544831 0.79 - 1 transcript_id "g910.t1"; gene_id "g910"; 5 AUGUSTUS CDS 4544912 4548054 0.38 - 0 transcript_id "g910.t1"; gene_id "g910"; 5 AUGUSTUS start_codon 4548052 4548054 . - 0 transcript_id "g910.t1"; gene_id "g910"; # protein sequence = [MDALRRAIQPDNDLHVIWCSDFNRHHPMWDDPANHHLFTPVAMEEAEKLIHLTYTQELEMILPPTIPTYRVASTGIWT # RPDNVFLSEATVQALVSCDVTPEAMTNGADHIPISTVLSLSLLQAQPSPKRNFRTANWETFNEYFAEELEKIPPPYEITTQQLLNTAVQDITRTIQLA # IEKAIPLSQPYPASKRWWTSELSEMKKALNRLSAKSYKYRAIPDDDSHRELRELRTQYKALIFKEKEEHWKDFLDNVDTDSIFTAAKYATTPNIDQDT # TTVIPELKALDENGAVRRIASTNEEKAALLAETFFPSAPRNYSLDRNPCRDQLPNPPPITQQRIIDALQRLKSYKAPGPDGIPNIILKKCAGMLAPYL # CEIYNAIGYLKAYPKEWLNSTMVVIRKPARKSYSLPKSYRPIALINTLAKGYTSIIAEDITFLATQHNLLPDTQFGGRPCRMTTDGIHMVIDKIKNAW # RNKREASMLSLDIEGAFPNAVTQRLLYNLRKRRIPERLVQAVSLSLKGRVTRLKFGDFTSAPISLTNGIGQGDPLSMIAYLFYNADFFDIAFKSRRQG # LSVGFIDDKNILVEGKSLTGNVEMLESFMNKPGGGFSWATKHNSSFELSKLVLTHFPRPKTKQEAPPPALVLQGTAVTEKTEVRMLGITLDSKLKWNE # QAAQAAAKASSIASAFWKLSRPSAGVSLKMMRKLYLTVVIPKMTYGLDVWYTPPHRPEGAKNRRGSLKALRNFTRIQQMVTITTAGAMRSSPTDLLDI # HTNLLPMDLMLEKICHRAILRIYTLPDENPVVKIAQAAFRQRRVEKMAPPLRLLPRIFGLPSPATVETITSPQRTAQWTSPIETRILKKDDASRSLEE # ESATYKIFSDGSGYGGMTGAAAVLYKNGQLLTDAVLRYQLGPITEHTTYDAEGVGILLGLQLIDRYVNEPNHLSSLICLDGRSAIEALESRLPKSGQN # IIEATLRTAKRMAKANNTEKISTIAWIPGHCGIEGNERADREAKKAAEGNTSAKVDLPAYLRNGNLPATASAIWQHFHKSLKTRWAHRGDATKANKHP # IPTANRTCAPKLAPPQDRKGRQPKLPTLRHRREDNHRNGKTLHY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g910 ### # start gene g911 5 AUGUSTUS gene 4548468 4550129 1 - . g911 5 AUGUSTUS transcript 4548468 4550129 1 - . g911.t1 5 AUGUSTUS stop_codon 4548468 4548470 . - 0 transcript_id "g911.t1"; gene_id "g911"; 5 AUGUSTUS CDS 4548468 4550129 1 - 0 transcript_id "g911.t1"; gene_id "g911"; 5 AUGUSTUS start_codon 4550127 4550129 . - 0 transcript_id "g911.t1"; gene_id "g911"; # protein sequence = [MSRQSTLSSAGTLRRGTPNKTRPEPVNEVLEPTETDNTPTVTATKEQIAREYLTSKAAIIGTNALLTKEDVYDAMLRA # TRLPKKEIDVTLKTVEHGITLLRDIDEKRSQRELLGEIKGTVESSFAKLDIEKQLQHQLTQVRNEFNERLDSIAANINGTEEKIDSIAKKSQPITPEI # SYADITQTNGKRTMAPTQAMTRQRMRAHVEVKRRQILILNAGNDAGKEIISKNPGEMLEYLNNMLIKMGALNKGTFVSATKLKNTDNLLTEVSSPELA # DWIHRVEQMIQFTTLSSQALTIADKEYEIILHFVPTTFGADDAFELRRLEDINDLPTCSITRAKWAKAVQRRKEGQRVASLLLYLNNANAANRLLLSG # AVISNKRVEAEKTVREEKRCYKCQRFGHIAGQCTEEVENICGKCGEHHSTANCSSEKRYCINCKTDEHASLDRECPIFRQKCESLNKRSPTNLLPFFP # SDEEWTWAEEPDNAPRMGPPPKITFRQDRHRQRQTQLTGWQQSNQLNVNTLPLGGPLRWGSQDPTGSQNEIADISDENQGSLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g911 ### # start gene g912 5 AUGUSTUS gene 4555357 4556022 0.48 + . g912 5 AUGUSTUS transcript 4555357 4556022 0.48 + . g912.t1 5 AUGUSTUS start_codon 4555357 4555359 . + 0 transcript_id "g912.t1"; gene_id "g912"; 5 AUGUSTUS CDS 4555357 4556022 0.48 + 0 transcript_id "g912.t1"; gene_id "g912"; 5 AUGUSTUS stop_codon 4556020 4556022 . + 0 transcript_id "g912.t1"; gene_id "g912"; # protein sequence = [MLMPWRLDPEAQPSAVVPEDERPTHKLGFLGLFGEKVDSIEWARSEIRVCNELLEAGRAKIPGYNAQTSRLSFHPDFD # DDGDDDFGGQGGIIGTVGKVGNVVKRKNKKTEREPQEARAEEQSVDAAAAIDDPYPVSNSAFITFRKQISAHLAGQSLIHHEPYRMSSRYIEVAPSDV # IWSNLSLNPFEIKIRIAISWAITIALIVFWALPGLHSFSPLSIFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g912 ### # start gene g913 5 AUGUSTUS gene 4557218 4557655 0.74 + . g913 5 AUGUSTUS transcript 4557218 4557655 0.74 + . g913.t1 5 AUGUSTUS start_codon 4557218 4557220 . + 0 transcript_id "g913.t1"; gene_id "g913"; 5 AUGUSTUS CDS 4557218 4557655 0.74 + 0 transcript_id "g913.t1"; gene_id "g913"; 5 AUGUSTUS stop_codon 4557653 4557655 . + 0 transcript_id "g913.t1"; gene_id "g913"; # protein sequence = [MSEKMYHEEDVTPAVQDESSASAKDQGYPMDRVESKGVRGASVDDDRLKLQASDNDRQSNGEDSTKPTPDRVAPRAEE # SYGFSHPAASRPQRTVWIPKDRLGLAQEEEIACRDKGIDISTKDAEMNEKGKVNLTGDCQPPDLVVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g913 ### # start gene g914 5 AUGUSTUS gene 4558670 4559242 0.53 - . g914 5 AUGUSTUS transcript 4558670 4559242 0.53 - . g914.t1 5 AUGUSTUS stop_codon 4558670 4558672 . - 0 transcript_id "g914.t1"; gene_id "g914"; 5 AUGUSTUS CDS 4558670 4559242 0.53 - 0 transcript_id "g914.t1"; gene_id "g914"; 5 AUGUSTUS start_codon 4559240 4559242 . - 0 transcript_id "g914.t1"; gene_id "g914"; # protein sequence = [MYYVGFSTATIVASLILFQGFNTTDTTNTVSLLCGFVVIFLGVHILNLSRRSNDDAHLSTDAGVLDRPLNFTGRLSLD # GWHGIVEGGRPEGGSHRMTHGRQSSLYRSQTSTLFNAFEGEEDTSRHEHVGLHQLREEDESDDDDANELTRLRSVPERQVDPRRSASRSHSNSPQPPN # HRSLADVRPSPRQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g914 ### # start gene g915 5 AUGUSTUS gene 4581021 4581809 0.93 - . g915 5 AUGUSTUS transcript 4581021 4581809 0.93 - . g915.t1 5 AUGUSTUS stop_codon 4581021 4581023 . - 0 transcript_id "g915.t1"; gene_id "g915"; 5 AUGUSTUS CDS 4581021 4581809 0.93 - 0 transcript_id "g915.t1"; gene_id "g915"; 5 AUGUSTUS start_codon 4581807 4581809 . - 0 transcript_id "g915.t1"; gene_id "g915"; # protein sequence = [MVLYFSKPPVLTRLFAFLLLTSYTSWPAGALNPSCAPGGNFDLSPWELQLPIGSTGSPETISSASLQGCSGWENFDYF # FTESGDGALVMKVPGSPASAGCVTTPNSLHCRTELREVDPSTGAAASWSPNAATNRLIVELVVTVADNSARGTVIGQIHIDDSISSKPVCELYYNSNG # DISIGVEQTRSGGDEVFTSLGNIPIGTVFTYELEYYTGLLKVAINGNFQTLDTYELDAPNSYFKVGNYNQGSSASDVHVFSIYLEH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g915 ### # start gene g916 5 AUGUSTUS gene 4583649 4584573 0.5 - . g916 5 AUGUSTUS transcript 4583649 4584573 0.5 - . g916.t1 5 AUGUSTUS stop_codon 4583649 4583651 . - 0 transcript_id "g916.t1"; gene_id "g916"; 5 AUGUSTUS CDS 4583649 4584176 0.88 - 0 transcript_id "g916.t1"; gene_id "g916"; 5 AUGUSTUS CDS 4584238 4584573 0.6 - 0 transcript_id "g916.t1"; gene_id "g916"; 5 AUGUSTUS start_codon 4584571 4584573 . - 0 transcript_id "g916.t1"; gene_id "g916"; # protein sequence = [MASAQNPSSLKTPMAMVCVNFYKTTFKVLSLTPQEHTATMDRFSGSGRTDSTIDDSPFGSTLNTPADEDVREPFEAIG # QRLKELQAHRAVNNLEKQYKQMDNLGTCELLAPEQDSADIDVDSERHDLVSISPSQDYPQEEIIQSRVQDEHNPITGSLSMVNISRVAAEENFDESFI # NRSDISMISDKLLSSFPTVPFSSPEIPNDNAMASSPVPFSNELSRSLYNIQTQSVRSSPEMTVSSPSIQNSNSPANSLMFFSPDLDQGFSAHSRASVS # PLDSRIVSLTSRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g916 ### # start gene g917 5 AUGUSTUS gene 4586083 4588695 0.2 + . g917 5 AUGUSTUS transcript 4586083 4588695 0.2 + . g917.t1 5 AUGUSTUS start_codon 4586083 4586085 . + 0 transcript_id "g917.t1"; gene_id "g917"; 5 AUGUSTUS CDS 4586083 4586715 0.6 + 0 transcript_id "g917.t1"; gene_id "g917"; 5 AUGUSTUS CDS 4586888 4587452 0.51 + 0 transcript_id "g917.t1"; gene_id "g917"; 5 AUGUSTUS CDS 4587724 4588005 0.66 + 2 transcript_id "g917.t1"; gene_id "g917"; 5 AUGUSTUS CDS 4588160 4588695 0.98 + 2 transcript_id "g917.t1"; gene_id "g917"; 5 AUGUSTUS stop_codon 4588693 4588695 . + 0 transcript_id "g917.t1"; gene_id "g917"; # protein sequence = [MDDEVLDWDDGEDQAPAVSGPIDDADGVSLGSDSGDENENAAPFVEEGSAPSRITSPLTKEANTASRPASPNSLTSLQ # RKDSYSSSRTTKPMHAVLVDSPKNQHRSQRSKSKPLSSAQMMLHGLPPKPVTSAVSFLPSSQSSLTEATAMVARETAKGKSGGGSNKNTVAKPVYKDE # IDSLPPNWEIRHPRSGGKQVYYYNNRTHESTWIHPSTVQSSRGPPSDSAYLSQDSPSLEDRYYRPADRRNDSPGDLNERSDRHAPPGPATSRRRSPSR # DPSPFAIRRPRSISPERGRVSGRRGRPVQPTSAKESHIANRDRDTIQNVSSDRRWSPPSPQDFEGSKSRPRQRQRMQEHPNEAQSNDSRSQDEQPTYR # TSAPNRWGAREDSVQDLHEPTNHNTIHRHRSPPPIRERQPNDRNSSTSTTRKRPTRFGTPPGVALGSDHEDWVPDEFRVEHSMDHTLLREKIADNGIA # HDSVRPNSPVQQPEPVSELQQLPPQEQVQAPPPLAARSQPPPTLDRDLPPHQRLSKPGPPTNDDSIASSARYRHQSPPARYQERNIVSDSTGFTKPTD # DSSSLTPRVDSAASADNITRQGSTVYLDRGQGEDDPASQPPKAPRAMGRDDAAPTAPRLSSARERSPRGSDRDARELGPSHNSDRGWKEDSAGQVRLP # ECSVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g917 ### # start gene g918 5 AUGUSTUS gene 4589203 4590279 0.81 + . g918 5 AUGUSTUS transcript 4589203 4590279 0.81 + . g918.t1 5 AUGUSTUS start_codon 4589203 4589205 . + 0 transcript_id "g918.t1"; gene_id "g918"; 5 AUGUSTUS CDS 4589203 4590279 0.81 + 0 transcript_id "g918.t1"; gene_id "g918"; 5 AUGUSTUS stop_codon 4590277 4590279 . + 0 transcript_id "g918.t1"; gene_id "g918"; # protein sequence = [MPPSHRSNSLQRHPEEASPPPISREVTTSPRWEQDSDRGGHLTHDRSLEPSNPLTEYPSRNAPANHERNRRDQGQPEP # HRSANGYHPPSPLSSTVLPYSLPPKPVLPFVPDHDRTHRLRAPPQRDWRPVSTENRPRRGPSPQRHWEPPKRPESPVDSRRQRRDLSPQHWSPPRQLV # SPVEFRGSRRAPSPQRDRTPPKRTGSPEARGPRRRPADVQFPPPHRNEARYSSEYSPKPPDNRRRAPDIREPADMDVDDVPPRQHNDQGKRDQTDNHH # ERPPVGRRGGSLLDRLSISVGDQVPPLRDRVQIPAKRDREELMRDGGSFNGDIDMDDGVVGKKPRRRSGKPRRGRGGRGAGAHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g918 ### # start gene g919 5 AUGUSTUS gene 4596672 4597220 0.39 + . g919 5 AUGUSTUS transcript 4596672 4597220 0.39 + . g919.t1 5 AUGUSTUS start_codon 4596672 4596674 . + 0 transcript_id "g919.t1"; gene_id "g919"; 5 AUGUSTUS CDS 4596672 4597220 0.39 + 0 transcript_id "g919.t1"; gene_id "g919"; 5 AUGUSTUS stop_codon 4597218 4597220 . + 0 transcript_id "g919.t1"; gene_id "g919"; # protein sequence = [MHQLLANDNTTRLLVCAPNNSAADLLTQKLSTLGPSVVLRLNSLSRKLSELPKSLHRFAIINDNEVFAMPTAQDIRKY # RVVVSTCITAGVPASLGIERGYYSHIFVDEAGQAMEPTVMVPLKELADDKTNVVLAGDNKQLGPIVHSGLASVLGLKTSYLARIMDREIYDLDGKSSV # GGRGVT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g919 ### # start gene g920 5 AUGUSTUS gene 4598963 4600705 0.97 - . g920 5 AUGUSTUS transcript 4598963 4600705 0.97 - . g920.t1 5 AUGUSTUS stop_codon 4598963 4598965 . - 0 transcript_id "g920.t1"; gene_id "g920"; 5 AUGUSTUS CDS 4598963 4600705 0.97 - 0 transcript_id "g920.t1"; gene_id "g920"; 5 AUGUSTUS start_codon 4600703 4600705 . - 0 transcript_id "g920.t1"; gene_id "g920"; # protein sequence = [MSFHIDNIPTGRIPASVLKKPTVVGLYGVSGCGKSFLLKELKEELGEQEFDYHEGAAVISRLVPEGLSAFQKMEYREK # TVWRERAIDQIQEDCTISGRVALVAGHFMFWDEHDKTPQLGWTEHDQTTFTHILYLHVPPDVIAQRRINDSNRARSSISDEHLRKWQQAECDQLRLVC # LEHKILFSIVPPSRHKIAKLLRNFQRNTEEYNLSCARDRLDEVVREVAGPGKLKTTLVMDGDRTLIAEDTGALFWHLFNKTVKDATENTGGGKDPLKE # LFSGPFGYSYAAFVQAALLYEEVDEKQFDDFCEEVASAVTVHPEFVSLLVQAAECKVGAVVITCGLGLIWEKILKKTGLSETVKVIGGGRIRDHLIIT # GEVKAALVARLRTAHGMYVCAFGDSVLDLPMLKGASQAIVVVGEERHRSHRMDDALLKAIDDEGLQACQVLLPKTASARLDVVKLPLVSITEGRFLDS # LVSRLPCRIHILHATNKNPAKLLMSGMRDARVAGPALREVHRRVGWYLTTEFVSELIGLEEYPIPHVQGPQTQANGHRLRDENRILIVALMRGGEPMA # LGVSEALPLAPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g920 ### # start gene g921 5 AUGUSTUS gene 4602594 4604233 0.45 - . g921 5 AUGUSTUS transcript 4602594 4604233 0.45 - . g921.t1 5 AUGUSTUS stop_codon 4602594 4602596 . - 0 transcript_id "g921.t1"; gene_id "g921"; 5 AUGUSTUS CDS 4602594 4603112 0.87 - 0 transcript_id "g921.t1"; gene_id "g921"; 5 AUGUSTUS CDS 4603511 4604233 0.48 - 0 transcript_id "g921.t1"; gene_id "g921"; 5 AUGUSTUS start_codon 4604231 4604233 . - 0 transcript_id "g921.t1"; gene_id "g921"; # protein sequence = [MDNTRVSGISGFVRHWVLLFVDKTFPQWTWRSKWKGLGAVAHPKGMHLNLEALEGLALESAAMEAGVPLSELLPPGFV # RRWAERHPSTSGEEDTCSTRVSSASSALPPPPTSVPQENSNFGPPPSRLETWMTRLQNAQKNYTQEKDDIPLTHARLGRMVAMLGGFALAVNRPGTLK # CSVPRSSAKPMKAANYPSNASPSINETRSLSQQYDAYRIVMEREEVKAFYARLIVVWTLFLVFWLSTKIFDRAVARYKTREKAKALAKSQRKSNALSS # AAALSPLPPPSISTHISKMPSEEVNADSSPRPQPHAKSDTQLHNKGGGFANTVRHVDKKLEELPRSILAHARLFSEHLQYFVGPGSVGANGGQEIPPS # LKKLMDDIAGASKFGERIQTEILQDAEARQTLFTLSIESES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g921 ### # start gene g922 5 AUGUSTUS gene 4604969 4605643 0.95 - . g922 5 AUGUSTUS transcript 4604969 4605643 0.95 - . g922.t1 5 AUGUSTUS stop_codon 4604969 4604971 . - 0 transcript_id "g922.t1"; gene_id "g922"; 5 AUGUSTUS CDS 4604969 4605643 0.95 - 0 transcript_id "g922.t1"; gene_id "g922"; 5 AUGUSTUS start_codon 4605641 4605643 . - 0 transcript_id "g922.t1"; gene_id "g922"; # protein sequence = [MSSNNQVSTVSEKYTLSRDVEKGPGNNGDYQNEVIGQGSSQDEPVLDDDEVEFEEDDEHEPISAISAVTDYSLQHRGS # LSGLSLFSTASIDLRYRSRSGPPQWWIKLKAFLYPPDPQKDPSGSSFIPNYRYTPIFSAVIIPFSILLEIPGLTGNWYIKTIDNQTVEKRSNPVLLDV # ALGISMGCALVANVALIVRFLEKNVKLMTIVCVVFLTLHGESNLFILT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g922 ### # start gene g923 5 AUGUSTUS gene 4611172 4613403 0.43 - . g923 5 AUGUSTUS transcript 4611172 4613403 0.43 - . g923.t1 5 AUGUSTUS stop_codon 4611172 4611174 . - 0 transcript_id "g923.t1"; gene_id "g923"; 5 AUGUSTUS CDS 4611172 4613403 0.43 - 0 transcript_id "g923.t1"; gene_id "g923"; 5 AUGUSTUS start_codon 4613401 4613403 . - 0 transcript_id "g923.t1"; gene_id "g923"; # protein sequence = [MTGTHLPINQHAVHHIHARIMSNVVIGPGGQATLVAPTQPESSNAIVSSMTDINVASATQQAVFTSPSTATSDISLTS # IISSSSATPATPTTSGLMEVSTTVVVTSEVVETSTKSSSNPTTSNASSDSESATPTTSVDLSTTSLSTIPPTTSVDSTTASLASASTSDASTNLLSTV # SSSSSTTASPSSLAAATTSLATNTSATKESTLYIGIVLGTIIVIACFAALIAWWFRLRTHNRRRKKSVAVPWANRPESSLSSFTDSDLLEKGEPPDPH # RHTWEPRGDRDAGEPKRTKSYLEDIGSPVKRQSLPILSLPSPPPAIYPFRDHPLPQYPTSCSSLFPSVSLSSVEPLQESVAYPLPSSSGSRFTMNIHP # NPSSVHMQFLTDPEFGTPRESKIKPRYLSLNQGLEVPWNTEAPALALATYPLPVPSENVPSSPASLSEKHPQTQEITPFADVPASVSSSQAGTWSSTF # KANLVFAFNAVAKAAGGIRSDEEYDKLSPLPSRNASRNCKNIIRRDKSTSAPVPETVWVEYLGGELVGKAPVLITSTTSEASQADEGIGTVHVRTSFS # RDGLLPFPGTVDSALTTLGPAFGTGMGLESYRGNDNAFSSLPSTQRSMTPSRQISNTSYTSTAALVVKKKSRSTGTTRSSANAHSRISGSQRRPRYAY # SGEMTAVSRRGSLASSRAPELPALPSFSHSRSRSMASSLSRISTTRSMKSTRSILTNREERARKALIERQRKGNAMC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g923 ### # start gene g924 5 AUGUSTUS gene 4618724 4619776 0.55 - . g924 5 AUGUSTUS transcript 4618724 4619776 0.55 - . g924.t1 5 AUGUSTUS stop_codon 4618724 4618726 . - 0 transcript_id "g924.t1"; gene_id "g924"; 5 AUGUSTUS CDS 4618724 4619776 0.55 - 0 transcript_id "g924.t1"; gene_id "g924"; 5 AUGUSTUS start_codon 4619774 4619776 . - 0 transcript_id "g924.t1"; gene_id "g924"; # protein sequence = [MFTDGRYFLQASQQMDRNWELMKQGLPGVPTWQDYLTNNLPASSRIGIDPTLIAENDSKSLSGSRKQAESKGSQTLVP # LTTNLVDLIWGSDRPPRPKNAVVPLDEKYSGESVTSKLNRLASAVSSNTPAPLAFVLTALDDIAWLFNLRGSDIAYNPVFFSYAVVHFEPSEADGSKN # PTAVLFLQRDAVEHDADLKYALGSQVEIRPYEDIWEYLKDLGNQVRSTFADKGQEKLVLIPDKASLAIVQAVGVVRVFDLLVLSTYQHICRSFLKDIS # NIVPSPITVLKAIKNSTELEGFRQSHIRDGIALARYFSWLEEKLGEEGNELTEWEGAEQLEKFRRCGCSCLVACTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g924 ### # start gene g925 5 AUGUSTUS gene 4620666 4621347 0.6 + . g925 5 AUGUSTUS transcript 4620666 4621347 0.6 + . g925.t1 5 AUGUSTUS start_codon 4620666 4620668 . + 0 transcript_id "g925.t1"; gene_id "g925"; 5 AUGUSTUS CDS 4620666 4620716 0.6 + 0 transcript_id "g925.t1"; gene_id "g925"; 5 AUGUSTUS CDS 4620803 4620951 0.98 + 0 transcript_id "g925.t1"; gene_id "g925"; 5 AUGUSTUS CDS 4621005 4621347 0.98 + 1 transcript_id "g925.t1"; gene_id "g925"; 5 AUGUSTUS stop_codon 4621345 4621347 . + 0 transcript_id "g925.t1"; gene_id "g925"; # protein sequence = [MNYSATFRELGPPDLCHLGSYHYISGVDASSSASLAAYINSLTYAIEDNSAWFSKGSSWKVKNGCYCCFNAFSRVDIR # VDVKIPGGVNAYAIDLRGERHEATQELWQETYVSALLRSILYSDDPNYWLDAYRKLDPITSPDSEIRFLQAAEALFMKGSLLSSFNARHLIIETNFRL # ASWF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g925 ### # start gene g926 5 AUGUSTUS gene 4622135 4622962 0.84 + . g926 5 AUGUSTUS transcript 4622135 4622962 0.84 + . g926.t1 5 AUGUSTUS start_codon 4622135 4622137 . + 0 transcript_id "g926.t1"; gene_id "g926"; 5 AUGUSTUS CDS 4622135 4622962 0.84 + 0 transcript_id "g926.t1"; gene_id "g926"; 5 AUGUSTUS stop_codon 4622960 4622962 . + 0 transcript_id "g926.t1"; gene_id "g926"; # protein sequence = [MEEEYRMQKAHGDISAVANGAGKAIHEDGTVRDSMISSDSATLGDQGIDDDNASTRGMVSPHSPRKSGSLDVSPGAFA # NGSTVSIASSITKVGLGLDPNGGASLTATIPTIRISTESDRDFDEDGNATDASPKGKDVNGDAPKATTNGFDNSRDVSEFGLEKPAQAAAGTEEGGLG # DDKDKESLHESPLPSTQTQSGSESFSFSNKRLCERWLDNLFMVLYEDLRVWTIFRAEVAHFKTQHVAYRKTGLEWEILGDLGMRLHHKEEAKEVSFNR # L] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g926 ### # start gene g927 5 AUGUSTUS gene 4626647 4627275 0.09 + . g927 5 AUGUSTUS transcript 4626647 4627275 0.09 + . g927.t1 5 AUGUSTUS start_codon 4626647 4626649 . + 0 transcript_id "g927.t1"; gene_id "g927"; 5 AUGUSTUS CDS 4626647 4626712 0.12 + 0 transcript_id "g927.t1"; gene_id "g927"; 5 AUGUSTUS CDS 4626781 4627275 0.54 + 0 transcript_id "g927.t1"; gene_id "g927"; 5 AUGUSTUS stop_codon 4627273 4627275 . + 0 transcript_id "g927.t1"; gene_id "g927"; # protein sequence = [MRFNNSFIVLGLAAVVSAVPVNDPTAQTNSGVGVNAVDASASGSPSLNARDIGVGLRAADLERREYTVTVTFKQEGGV # NPTEETEKEAQEMVKATLKNAARKLKMGQGSELEVKFTNYWPNSFLGKVEFTFQDPVCGSGGTGTCEGEATAGGKGTIKNGPKKRKDQKVLWTRAVSH # VSCYFQSKRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g927 ### # start gene g928 5 AUGUSTUS gene 4632463 4632918 0.61 - . g928 5 AUGUSTUS transcript 4632463 4632918 0.61 - . g928.t1 5 AUGUSTUS stop_codon 4632463 4632465 . - 0 transcript_id "g928.t1"; gene_id "g928"; 5 AUGUSTUS CDS 4632463 4632918 0.61 - 0 transcript_id "g928.t1"; gene_id "g928"; 5 AUGUSTUS start_codon 4632916 4632918 . - 0 transcript_id "g928.t1"; gene_id "g928"; # protein sequence = [MIAKACPEYSLSKPSTLVAISGAGNVSQFTALKVIELGATVVSMSDSKGSLIATTDSGFSKDVIESIGQLKLKGGFLD # SFKQFTDEGKYTYHPGTYSTVYVYAQNSDFLRDFQANAPGLFFPKSILLFPVQLRMKSPPPKQRLWLNPVSEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g928 ### # start gene g929 5 AUGUSTUS gene 4639833 4640243 0.97 - . g929 5 AUGUSTUS transcript 4639833 4640243 0.97 - . g929.t1 5 AUGUSTUS stop_codon 4639833 4639835 . - 0 transcript_id "g929.t1"; gene_id "g929"; 5 AUGUSTUS CDS 4639833 4640243 0.97 - 0 transcript_id "g929.t1"; gene_id "g929"; 5 AUGUSTUS start_codon 4640241 4640243 . - 0 transcript_id "g929.t1"; gene_id "g929"; # protein sequence = [MNSDSPLSNSAVPSLDQDTTKYTQELISSSNSAVPSLDQDTTKYTQELISSCLEGLPTFEESRYNTSTSDGPAVKYIQ # PPNPGWKFGEKVESSDLGRKWMEGSKLEDDWEHFDADKEDNRYVALLSTQSSSNLERS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g929 ### # start gene g930 5 AUGUSTUS gene 4642761 4644195 0.86 + . g930 5 AUGUSTUS transcript 4642761 4644195 0.86 + . g930.t1 5 AUGUSTUS start_codon 4642761 4642763 . + 0 transcript_id "g930.t1"; gene_id "g930"; 5 AUGUSTUS CDS 4642761 4643193 0.92 + 0 transcript_id "g930.t1"; gene_id "g930"; 5 AUGUSTUS CDS 4643372 4644195 0.89 + 2 transcript_id "g930.t1"; gene_id "g930"; 5 AUGUSTUS stop_codon 4644193 4644195 . + 0 transcript_id "g930.t1"; gene_id "g930"; # protein sequence = [MPKSSKKTEQSSSYRSADSGPTTHKTKLDGPPKNSKKKKDGGGTNKKQKLSKKELKELEKQQRQKSYIAPTKPQPIKP # DPLDSTGLVYVLPGELVIVLKNLGKKAVKTREKALDDLESGWVNSDKTKESSGQEQILIDMLPVWVKADGSESADVIGVWALASQDIDPAVASSASES # WRKFVGASLSKAQILTYAQRAIVDPGALYAYLNPSPLRTPASAPMPHDKLTGNQKTQIHSKGAKGKTTPVKGKSTSSTPKTSAGNPDVKQLQGFDDPP # LDSLETDTDRDARLRVSGLGALAWVLSASYLAETLDVLSDARLWSSLAGYDFGSFGFEQPPVRKAAWRLVGTVSGALGNFKPSVTAATQSSPSTDEKI # LKLLRILSFSVFHNAWTEQDAGVQGVMWQPLLRFLKGTFCVFPVSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g930 ### # start gene g931 5 AUGUSTUS gene 4644289 4647858 0.83 + . g931 5 AUGUSTUS transcript 4644289 4647858 0.83 + . g931.t1 5 AUGUSTUS start_codon 4644289 4644291 . + 0 transcript_id "g931.t1"; gene_id "g931"; 5 AUGUSTUS CDS 4644289 4647858 0.83 + 0 transcript_id "g931.t1"; gene_id "g931"; 5 AUGUSTUS stop_codon 4647856 4647858 . + 0 transcript_id "g931.t1"; gene_id "g931"; # protein sequence = [MGYNYTAEINLRMRDVDAGSDAGSDSDSESASSDGEDEDVRKGMEVPPFAASRAFKTFLSFLACGCNGSPIQAYPAVM # VVLSTIPSSILLASYSSPAMPFTDLFSSFWAAVEPEHHPSSSSSGITVTSTITTPNRIFSGSGADKASKAFVEAVLDCLTFLVRRIVFQSQNATSETT # ADILGLSTLIRTQVKRVWVEVVGTGGATTTVDANGDPPVRKLVLRISPDVLGTSLARMLRGLRGIPGGPFYDDAWETVTQLIQDSAIEVSSTSTSIAA # KDLSSFTSGVLKALQPSSVDSTDSTHSDAQQLLVTVFNIALDGCERSVTGINGSIAKGIGGLHLLTKLISTFGSESGIAAASDDVITRIDTFVVQNAY # KLLSLERKEGFELLTTYLLCRDANSAARSTESSQAALTWLALLEQVVEYFHSQSGSQKAEFPVVLSYLLTLLDSLRSKRGGKVAVAKLRPIMNELDDM # ILEFAQDTVASGFSTLSSKLNLVRDVLLLTHHTKIAETISHPLLVPASLVKLVGMLVARFESGLRSLLGVGSEGRDQRGNQEEEKVSDSLDRMDRLLV # LMEVILQLPPVNVVDSEQSKPGPSSSSYTASLPALPSTSVIPGIFLLAYALPRSSLSPQSVLATTEDETISHSRDNLCAKAQRIWESSIKLSNDVYGG # ARKDQPYHERIYSSVTQSLRTLLSKTNPACLYWCTAEDVVEVFEVLRNSMSLKTISLHSVTLEKNPINALLPSQDSFDVLLDRMSGAPISRSMSVVDE # LAGAASVFDPSSSDATSDMNDVRIYARYALALLYILSNDLGLAKGLFTASPGSWWVLRHLLVLGVYAGGTVSVPNAPNALYRNPLYHLAVLESDRAHR # CREIIGKVHRIVAYIFTSAEFAEGATGEEGREWRKDVCRMLSAPNETSLSTIPSLSAFLFSIAHFSAKTDSYRDCCVLREVLSRLFQTGLGSGGRSEI # SEEEADLWLNYARRLSETEKGKSARAPLTGVTIMSTLVANLPSSLSSSTLAASFSFPRLERYRNELASSLLGVSPSRATSDGLRILLRLVLGTAPDVE # SEAEFLPVQRAVNVIKACQKWIEEGGDNDDASGEEGEQIAETGDGMEELESAMTLTFYHLAPILQNVAGGHWQFIFDVVENNIEVCRIEALLIRLSCS # NSTCRTAISILPSHPPPLTHHSNSSPLLEQFAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g931 ### # start gene g932 5 AUGUSTUS gene 4648193 4648528 0.7 + . g932 5 AUGUSTUS transcript 4648193 4648528 0.7 + . g932.t1 5 AUGUSTUS start_codon 4648193 4648195 . + 0 transcript_id "g932.t1"; gene_id "g932"; 5 AUGUSTUS CDS 4648193 4648528 0.7 + 0 transcript_id "g932.t1"; gene_id "g932"; 5 AUGUSTUS stop_codon 4648526 4648528 . + 0 transcript_id "g932.t1"; gene_id "g932"; # protein sequence = [MCHLLSSSTYSSVPYPPTNSHLSSSLPSFASSIHHDQLAYQILHKAAKKRTEHFVLEAGVDTEGKVKAQLPEELLVLL # QQSVDLDIDVEKADIDGDREHVSPTYIHTTLFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g932 ### # start gene g933 5 AUGUSTUS gene 4660011 4660526 0.58 - . g933 5 AUGUSTUS transcript 4660011 4660526 0.58 - . g933.t1 5 AUGUSTUS stop_codon 4660011 4660013 . - 0 transcript_id "g933.t1"; gene_id "g933"; 5 AUGUSTUS CDS 4660011 4660526 0.58 - 0 transcript_id "g933.t1"; gene_id "g933"; 5 AUGUSTUS start_codon 4660524 4660526 . - 0 transcript_id "g933.t1"; gene_id "g933"; # protein sequence = [MFKSTPKSFPVPFVQGDIFDTKFLESTKPFTVESPPTKPVPALNTLTSLNPLRGHLSACFCGAFFHLFGEDGQKQIAE # ALTGLLSPEPGSMIFGVHGSRAVKGFWHPTGSERYMFCHSPESWKDLWEGLFGKGNVEVKAQLRKEIGGDDLFGTYPGNKDPYHVMEWSVSRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g933 ### # start gene g934 5 AUGUSTUS gene 4672971 4673414 0.62 + . g934 5 AUGUSTUS transcript 4672971 4673414 0.62 + . g934.t1 5 AUGUSTUS start_codon 4672971 4672973 . + 0 transcript_id "g934.t1"; gene_id "g934"; 5 AUGUSTUS CDS 4672971 4673414 0.62 + 0 transcript_id "g934.t1"; gene_id "g934"; 5 AUGUSTUS stop_codon 4673412 4673414 . + 0 transcript_id "g934.t1"; gene_id "g934"; # protein sequence = [MDTIEYLGYILSPDRLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFYHCFMYNYSDIVVPMTWLTQKGAPWIWDNNC # QEAFENLKIAFTSVPILAHWEPNHPIIMETKASNYAIAAILSIQTVDSEIHPLAFLSRTFHAAELNYNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g934 ### # start gene g935 5 AUGUSTUS gene 4674195 4674623 0.69 + . g935 5 AUGUSTUS transcript 4674195 4674623 0.69 + . g935.t1 5 AUGUSTUS start_codon 4674195 4674197 . + 0 transcript_id "g935.t1"; gene_id "g935"; 5 AUGUSTUS CDS 4674195 4674623 0.69 + 0 transcript_id "g935.t1"; gene_id "g935"; 5 AUGUSTUS stop_codon 4674621 4674623 . + 0 transcript_id "g935.t1"; gene_id "g935"; # protein sequence = [MDFIEQLPMSNGYTAILVIMDQSSKQAIFIPTFNTITSEQLAELFVIHVFSKHGVPNHVTSNHGSEFVLAFFRALGKV # FSMELHYTSGYHPEANGQTERVNQTLEQYIRIYYSYQQDDWSHLLPIAKFAYNNAVTKRQRRSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g935 ### # start gene g936 5 AUGUSTUS gene 4675416 4675661 0.48 + . g936 5 AUGUSTUS transcript 4675416 4675661 0.48 + . g936.t1 5 AUGUSTUS start_codon 4675416 4675418 . + 0 transcript_id "g936.t1"; gene_id "g936"; 5 AUGUSTUS CDS 4675416 4675661 0.48 + 0 transcript_id "g936.t1"; gene_id "g936"; 5 AUGUSTUS stop_codon 4675659 4675661 . + 0 transcript_id "g936.t1"; gene_id "g936"; # protein sequence = [MPNPFPNRTQSPPPPIEVDGEEEYNVAEILNSKLDRRYKCCPLRYYIWWAGYEGTDDEFSWVAADELVPTFHTQYPQK # PGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g936 ### # start gene g937 5 AUGUSTUS gene 4677879 4678346 0.58 + . g937 5 AUGUSTUS transcript 4677879 4678346 0.58 + . g937.t1 5 AUGUSTUS start_codon 4677879 4677881 . + 0 transcript_id "g937.t1"; gene_id "g937"; 5 AUGUSTUS CDS 4677879 4678346 0.58 + 0 transcript_id "g937.t1"; gene_id "g937"; 5 AUGUSTUS stop_codon 4678344 4678346 . + 0 transcript_id "g937.t1"; gene_id "g937"; # protein sequence = [MSASRTTTTTVTSATTAGPSRSRTTNPPPADTVDNDEEELEEDDDEAIRQAEEKVRRMKARKAAAAAKKKAEEEAARK # AAEEAQRQKEAAARELEERRRVMAAAATARSQRGSSPGETSASNRRPVVEIRQRKDKAKAKTKAQVSTAKLWLPLIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g937 ### # start gene g938 5 AUGUSTUS gene 4679301 4682864 0.99 - . g938 5 AUGUSTUS transcript 4679301 4682864 0.99 - . g938.t1 5 AUGUSTUS stop_codon 4679301 4679303 . - 0 transcript_id "g938.t1"; gene_id "g938"; 5 AUGUSTUS CDS 4679301 4682864 0.99 - 0 transcript_id "g938.t1"; gene_id "g938"; 5 AUGUSTUS start_codon 4682862 4682864 . - 0 transcript_id "g938.t1"; gene_id "g938"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKVVLGYSFLSRYNPLIDWVSRNITFRNTSHPDSPQTSVPSAINPVVAKVAV # PLPESSPSVSPTILETPPGDSPRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSATPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVSNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGFTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g938 ### # start gene g939 5 AUGUSTUS gene 4683197 4684888 0.99 - . g939 5 AUGUSTUS transcript 4683197 4684888 0.99 - . g939.t1 5 AUGUSTUS stop_codon 4683197 4683199 . - 0 transcript_id "g939.t1"; gene_id "g939"; 5 AUGUSTUS CDS 4683197 4684888 0.99 - 0 transcript_id "g939.t1"; gene_id "g939"; 5 AUGUSTUS start_codon 4684886 4684888 . - 0 transcript_id "g939.t1"; gene_id "g939"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPDGPGGPGGPGGPGGPGGPRSPNSPDIPNEQRAMLDLLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNTNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g939 ### # start gene g940 5 AUGUSTUS gene 4685828 4686295 0.53 + . g940 5 AUGUSTUS transcript 4685828 4686295 0.53 + . g940.t1 5 AUGUSTUS start_codon 4685828 4685830 . + 0 transcript_id "g940.t1"; gene_id "g940"; 5 AUGUSTUS CDS 4685828 4686295 0.53 + 0 transcript_id "g940.t1"; gene_id "g940"; 5 AUGUSTUS stop_codon 4686293 4686295 . + 0 transcript_id "g940.t1"; gene_id "g940"; # protein sequence = [MSASRTTTTTVTSATTAGPSRSRTTNPPPADTVDNDEEELEEDDDEAIRQAEEKVRRMKARKAAAAAKKKAEEEAARK # AAEEAQRQKEAAARELEERRRVMAAAATARSQRGSSPGETSASNRRPVVEIRQRKDKAKAKTKAQVSTAKLWLPLIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g940 ### # start gene g941 5 AUGUSTUS gene 4687250 4690813 0.98 - . g941 5 AUGUSTUS transcript 4687250 4690813 0.98 - . g941.t1 5 AUGUSTUS stop_codon 4687250 4687252 . - 0 transcript_id "g941.t1"; gene_id "g941"; 5 AUGUSTUS CDS 4687250 4690813 0.98 - 0 transcript_id "g941.t1"; gene_id "g941"; 5 AUGUSTUS start_codon 4690811 4690813 . - 0 transcript_id "g941.t1"; gene_id "g941"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKVVLGYSFLSRYNPLIDWVSRNITFRNTSHPDSPQTSVPSAINPVVAKVAV # PLPESSPSVSPTILETPPGDSPRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSATPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVSNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGFTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTEGVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g941 ### # start gene g942 5 AUGUSTUS gene 4691146 4692837 0.99 - . g942 5 AUGUSTUS transcript 4691146 4692837 0.99 - . g942.t1 5 AUGUSTUS stop_codon 4691146 4691148 . - 0 transcript_id "g942.t1"; gene_id "g942"; 5 AUGUSTUS CDS 4691146 4692837 0.99 - 0 transcript_id "g942.t1"; gene_id "g942"; 5 AUGUSTUS start_codon 4692835 4692837 . - 0 transcript_id "g942.t1"; gene_id "g942"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPDGPGGPGGPGGPGGPGGPRSPNSPDIPNEQRAMLDLLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNTNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g942 ### # start gene g943 5 AUGUSTUS gene 4697564 4698109 0.99 + . g943 5 AUGUSTUS transcript 4697564 4698109 0.99 + . g943.t1 5 AUGUSTUS start_codon 4697564 4697566 . + 0 transcript_id "g943.t1"; gene_id "g943"; 5 AUGUSTUS CDS 4697564 4698109 0.99 + 0 transcript_id "g943.t1"; gene_id "g943"; 5 AUGUSTUS stop_codon 4698107 4698109 . + 0 transcript_id "g943.t1"; gene_id "g943"; # protein sequence = [MSTPVPPAPNTSAEDLMTQLIRQVANLATAMEECSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPAMEAHSEIKNLRQSKGQTVAEFAQKFKDIRDRTEMSDIDLRERFFTA # LLPEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g943 ### # start gene g944 5 AUGUSTUS gene 4700028 4701719 0.64 + . g944 5 AUGUSTUS transcript 4700028 4701719 0.64 + . g944.t1 5 AUGUSTUS start_codon 4700028 4700030 . + 0 transcript_id "g944.t1"; gene_id "g944"; 5 AUGUSTUS CDS 4700028 4701719 0.64 + 0 transcript_id "g944.t1"; gene_id "g944"; 5 AUGUSTUS stop_codon 4701717 4701719 . + 0 transcript_id "g944.t1"; gene_id "g944"; # protein sequence = [MFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRVVREVLTRLEKHDLYLQPKKCEFEQQQIEY # LGLIISEGEVRMDPVKVAAVRDWPVPTNLRELQGFLGFANFYRCFIRNFAKIARPLNDLTKKYISFTWTDTQQKAFDTLREAFISAPILALWTPDRPT # RIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIIMDHSNLEFWRTAQDLTHRQARWALYL # SRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFVKIAASILRNPLEDRIRKALEQEAQVLEGLKTVKEHGLQRLANGIAEWEEDN # GLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHRTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQQHPRAVTQPLDVPSSLWEEVGVDLIT # QLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVANIYYREIFRLHGLPLHFKSDRGSQFAAKLMRSLLTRLGIKSDLTSGYHPQSNGQTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g944 ### # start gene g945 5 AUGUSTUS gene 4739385 4740053 0.7 + . g945 5 AUGUSTUS transcript 4739385 4740053 0.7 + . g945.t1 5 AUGUSTUS start_codon 4739385 4739387 . + 0 transcript_id "g945.t1"; gene_id "g945"; 5 AUGUSTUS CDS 4739385 4740053 0.7 + 0 transcript_id "g945.t1"; gene_id "g945"; 5 AUGUSTUS stop_codon 4740051 4740053 . + 0 transcript_id "g945.t1"; gene_id "g945"; # protein sequence = [MDSNMYSYTHHYSTADLQDLAVASGSYDSRTAAYIQSSRMPFSGTSRSSYIPESQQDPQSSYIDPESLSTSHHTFVNP # SNVSRLQQQVPPSTSPTSSTGRGAIGMRHGSPNSPLSADIPLPQAARPRRSPASRHLALPDDIDDESDDDPLPPNASERERTEWKKRRNTRAARRSRK # RKMIYTERLEVQVEKLRTEKEIWRTRALTLRQLLKSHNLPCPDFED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g945 ### # start gene g946 5 AUGUSTUS gene 4740848 4742848 0.15 + . g946 5 AUGUSTUS transcript 4740848 4742848 0.15 + . g946.t1 5 AUGUSTUS start_codon 4740848 4740850 . + 0 transcript_id "g946.t1"; gene_id "g946"; 5 AUGUSTUS CDS 4740848 4741351 0.15 + 0 transcript_id "g946.t1"; gene_id "g946"; 5 AUGUSTUS CDS 4741406 4742848 0.41 + 0 transcript_id "g946.t1"; gene_id "g946"; 5 AUGUSTUS stop_codon 4742846 4742848 . + 0 transcript_id "g946.t1"; gene_id "g946"; # protein sequence = [MTSVQTEVLSHLPQISYPYDPKTPHVRDLLVRAKTGTGKTLAFLIPAIEAREKAIKQSGTQALLDAGLMSDDALVRRV # RKRYSRETVGVLILSPTRELATQIANEATKLLHHHKGMEVRLFTGGMNKRTQMRDWMKGSRDVVVATTGRLRDLMESEPEVLRSIQTAKTFILDEADT # MLDMGFRDDIHAIQNELPRSPTRQTLLFSATVSPLIRQVASNVLAKDYKFIDCVKSDDSPVHAHVPQYHTVLPNASAQIPHILRLIAHDQLTNPKSKI # VLFLPTTKMTQLFSTVISQLSRDLLPVATTVHEIHSKRPMESRILASERFRTEKSPASILVTSDVSARGVDYPGVTRVIQVGIPSSTTQYIHRIGRTG # RTGGVVGRGDLVLLPWEIGFITWQLTEVPIKPVTAGEIKLQVEELAKKADSEPNSHKGIRTPFTPRLSDFDSAPDEIMSRFEEEAVRELFVSMLGYYL # TKSDELRVEKGVILEGCRDWSVQVGGLQAAPFVSYAFLAKLGLGGPRNPKPPRPILPNQQHWQLRGNSVRNKERMGIERPRSGRPKDSGRNWSRDAGE # GANNWSRDVNENGSGRKRSWSNNSDRSRGDWSRDADVDRGSNGWSRGDNQDGGKLSDPNREHKSREYKARNFSRQGGSSW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g946 ### # start gene g947 5 AUGUSTUS gene 4744257 4746243 0.95 + . g947 5 AUGUSTUS transcript 4744257 4746243 0.95 + . g947.t1 5 AUGUSTUS start_codon 4744257 4744259 . + 0 transcript_id "g947.t1"; gene_id "g947"; 5 AUGUSTUS CDS 4744257 4745373 0.99 + 0 transcript_id "g947.t1"; gene_id "g947"; 5 AUGUSTUS CDS 4745525 4746243 0.96 + 2 transcript_id "g947.t1"; gene_id "g947"; 5 AUGUSTUS stop_codon 4746241 4746243 . + 0 transcript_id "g947.t1"; gene_id "g947"; # protein sequence = [MLVDPVANPSNSSISAPTNISDLEEYLNTELFGPSTSVAAMSPGPSGSSRASSPSSHSDSLSQILSTPPQPVENSFPA # VDPYSFLGGLSGADGNHNFGFGFGGGSGTPSFFNFLDEEMKVDPSTNSIPFETGSPFDFMSALGIGGVSGLTIDPSTSFSPGSGSVAMAIDPQLVDSP # STHVQSDFGDDEDKEQKTEHAVVPIIGDEKKTRSQSKALSPKTSEDAADVTKEAQEKLTVTITPVKVGGHGKARKGTVQSGGVTKRVVIPTTAPATVP # IPLPVLAAPSSLSSTSSYSPSTSAASLLSRNKENVSAASPSSSTTSHLKEVDDRDKDDDDDLPADWRPPPEVFAKMSSKEKRQLRNKISARNFRVRRK # ALRQEVAALKRALLDGRGATSPMSPSSSSSSLIRSASPALIIRGADVNLNSAAVTTGLTIDDLNLPPPAPLPERSAAEELALRAAASGAAPSASTSNA # TTNILTPNIKKDLPTSPRLNNAAGFWGGVSQAGFGFGGMGGGFTPVHTVLMPDLNTNMNVDGTNISIGQWVRDVLAANAANLRDGSSSPEASPKLLQE # NMNPVMNVAGAHQEDNMSPSAGIHNGFEGFVDTNPFTMKSLDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g947 ### # start gene g948 5 AUGUSTUS gene 4746323 4747120 0.65 + . g948 5 AUGUSTUS transcript 4746323 4747120 0.65 + . g948.t1 5 AUGUSTUS start_codon 4746323 4746325 . + 0 transcript_id "g948.t1"; gene_id "g948"; 5 AUGUSTUS CDS 4746323 4747120 0.65 + 0 transcript_id "g948.t1"; gene_id "g948"; 5 AUGUSTUS stop_codon 4747118 4747120 . + 0 transcript_id "g948.t1"; gene_id "g948"; # protein sequence = [MAASSSHQASHPNQSPPQQPSQPNIYSSTYAQQRKALERELSYSSPFTLPSHQPGAKSPHSHHHHHNLTTSLKPAYFV # NSNKPNLPSPPPPKMGSTLSALLAGKHSTPNAFGGSFPAIPAHSSLPSSSNLSRPALSKQQQQQQMQQAQNVMYAALASTASQTLVRRLGNAFWDAFS # GSSSGPSASGSGAHSHMKPWDADKVRKVLEGKAVIKVVDVDEPVQRVTKREPSTPMLPSSSLASSDCDKSCSMTALLEDSMRTLSLGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g948 ### # start gene g949 5 AUGUSTUS gene 4747756 4748651 0.21 - . g949 5 AUGUSTUS transcript 4747756 4748651 0.21 - . g949.t1 5 AUGUSTUS stop_codon 4747756 4747758 . - 0 transcript_id "g949.t1"; gene_id "g949"; 5 AUGUSTUS CDS 4747756 4748077 0.75 - 1 transcript_id "g949.t1"; gene_id "g949"; 5 AUGUSTUS CDS 4748420 4748429 0.21 - 2 transcript_id "g949.t1"; gene_id "g949"; 5 AUGUSTUS CDS 4748486 4748651 0.34 - 0 transcript_id "g949.t1"; gene_id "g949"; 5 AUGUSTUS start_codon 4748649 4748651 . - 0 transcript_id "g949.t1"; gene_id "g949"; # protein sequence = [MKFYRGEHLPIHPKFSANSNALCNGNSSGPAALDAPNLKYTEDDDRAIDDFHKQFIQTSLQSVIYTQLSIAPANVGAN # TYSSALTVGEKAAVIIAEDLGFPLDGVGILETSEQSMSGFAEPVSAPSTKTQILDDFAGLQGIEGLTINSMVNDEYPNSKSSMITVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g949 ### # start gene g950 5 AUGUSTUS gene 4759685 4760554 0.98 + . g950 5 AUGUSTUS transcript 4759685 4760554 0.98 + . g950.t1 5 AUGUSTUS start_codon 4759685 4759687 . + 0 transcript_id "g950.t1"; gene_id "g950"; 5 AUGUSTUS CDS 4759685 4760554 0.98 + 0 transcript_id "g950.t1"; gene_id "g950"; 5 AUGUSTUS stop_codon 4760552 4760554 . + 0 transcript_id "g950.t1"; gene_id "g950"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVANLATAMEEHSSSKSSMSKPEVFKGKDGAEAHRFMAQFQNWASEQPDLTKSQVK # LIKSALGFFTKSAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFTQKFKDIGDRTEMSDIDLREGFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKQAISVDVYLHDPTMTGRNSGYPSTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g950 ### # start gene g951 5 AUGUSTUS gene 4763247 4766810 1 - . g951 5 AUGUSTUS transcript 4763247 4766810 1 - . g951.t1 5 AUGUSTUS stop_codon 4763247 4763249 . - 0 transcript_id "g951.t1"; gene_id "g951"; 5 AUGUSTUS CDS 4763247 4766810 1 - 0 transcript_id "g951.t1"; gene_id "g951"; 5 AUGUSTUS start_codon 4766808 4766810 . - 0 transcript_id "g951.t1"; gene_id "g951"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINPVVAKVAV # PLPEPSPSVSPTILETPPGDSLRPRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNCITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYSRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPMKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g951 ### # start gene g952 5 AUGUSTUS gene 4767143 4768834 1 - . g952 5 AUGUSTUS transcript 4767143 4768834 1 - . g952.t1 5 AUGUSTUS stop_codon 4767143 4767145 . - 0 transcript_id "g952.t1"; gene_id "g952"; 5 AUGUSTUS CDS 4767143 4768834 1 - 0 transcript_id "g952.t1"; gene_id "g952"; 5 AUGUSTUS start_codon 4768832 4768834 . - 0 transcript_id "g952.t1"; gene_id "g952"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRATSESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSSNSGQSGGHRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESRGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g952 ### # start gene g953 5 AUGUSTUS gene 4770727 4772007 0.86 + . g953 5 AUGUSTUS transcript 4770727 4772007 0.86 + . g953.t1 5 AUGUSTUS start_codon 4770727 4770729 . + 0 transcript_id "g953.t1"; gene_id "g953"; 5 AUGUSTUS CDS 4770727 4772007 0.86 + 0 transcript_id "g953.t1"; gene_id "g953"; 5 AUGUSTUS stop_codon 4772005 4772007 . + 0 transcript_id "g953.t1"; gene_id "g953"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLIPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFMKFDVHWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAVYLDDILIFSNNLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPIKVAAVRDWPVPTNLWELQGF # LGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTQQKAFDTLREAFISAPILALWTPDRPTQIEVDASGFATGGALMQKQDNGQWHLVAFRSASMQ # PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIIMDHSNLEFWRTAQDLTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g953 ### # start gene g954 5 AUGUSTUS gene 4773022 4773663 0.76 + . g954 5 AUGUSTUS transcript 4773022 4773663 0.76 + . g954.t1 5 AUGUSTUS start_codon 4773022 4773024 . + 0 transcript_id "g954.t1"; gene_id "g954"; 5 AUGUSTUS CDS 4773022 4773663 0.76 + 0 transcript_id "g954.t1"; gene_id "g954"; 5 AUGUSTUS stop_codon 4773661 4773663 . + 0 transcript_id "g954.t1"; gene_id "g954"; # protein sequence = [MSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREVRQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAED # INLQLSSKKLGDRQLGPYHILEKIGPLDYCLDLPLSLDRLHPIFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVK # WKGYDAGHNSWEPANELASFLCERERKESNGHSNQPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g954 ### # start gene g955 5 AUGUSTUS gene 4775750 4776295 0.99 - . g955 5 AUGUSTUS transcript 4775750 4776295 0.99 - . g955.t1 5 AUGUSTUS stop_codon 4775750 4775752 . - 0 transcript_id "g955.t1"; gene_id "g955"; 5 AUGUSTUS CDS 4775750 4776295 0.99 - 0 transcript_id "g955.t1"; gene_id "g955"; 5 AUGUSTUS start_codon 4776293 4776295 . - 0 transcript_id "g955.t1"; gene_id "g955"; # protein sequence = [MSDIDLKKPFYSALLPGIQQNLITVNIGQGVAQTLKEAITQAVSVDVYLHDPILTGQNLRPTRFHATPADPMLWILMP # PTPVMGTLGRHSWPACEDNALFGSRSCQAELPTLRNHLPLLWTLKTSGSNLPGQVHGTWTRLKPTPATSAPGLKLGAFFSLAKLGNRWKPKKANLSKF # PSLPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g955 ### # start gene g956 5 AUGUSTUS gene 4778440 4779717 0.17 - . g956 5 AUGUSTUS transcript 4778440 4779717 0.17 - . g956.t1 5 AUGUSTUS stop_codon 4778440 4778442 . - 0 transcript_id "g956.t1"; gene_id "g956"; 5 AUGUSTUS CDS 4778440 4779717 0.17 - 0 transcript_id "g956.t1"; gene_id "g956"; 5 AUGUSTUS start_codon 4779715 4779717 . - 0 transcript_id "g956.t1"; gene_id "g956"; # protein sequence = [MVQGKLYPAILGVWEGACLRYLINGIPPSSSSSLDPILSYAVRLCIDYFITDSFGQVIAMVVWSFLGVLVVESVEVES # IDERRSKRPKGTGSSFTRIQEQVVDQSTTEEDTLPLSVSPAQNLQESSPLPLSLPLSSSSSIQREEYEVKYPEDDVNDDLQTPLPQSRVLIPEDDDDN # DDELQTPLALLPISSLPELSIPADQSILLRPIRSTSTSPVPIPAPALPYITTSSPHPTSPSSPSLHLSTLHPLSHSLSPSSSSQQSTILLSPTSLYTH # ADALRQQAWKEHHYLKTQLENDLALARSQGNTTEAFMLLGEIKDTLARIDKLHGRAKRRFYLARNNNNNNDSNNALIPTTTTSNPSSIDVHGLLVPEA # IDKTEEAFRGVLRTGNRFLRVIVGKGNHSKNGMPKLRPAIIHAFTQLRVFPFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g956 ### # start gene g957 5 AUGUSTUS gene 4783364 4783819 0.51 - . g957 5 AUGUSTUS transcript 4783364 4783819 0.51 - . g957.t1 5 AUGUSTUS stop_codon 4783364 4783366 . - 0 transcript_id "g957.t1"; gene_id "g957"; 5 AUGUSTUS CDS 4783364 4783819 0.51 - 0 transcript_id "g957.t1"; gene_id "g957"; 5 AUGUSTUS start_codon 4783817 4783819 . - 0 transcript_id "g957.t1"; gene_id "g957"; # protein sequence = [MSSISIPMDLSLDMDMDGMGFGREPAVGGGMGMGRNIDKDEFNDAKTAETLPALKKRRLDKEKEKGKEREKVVVIPDS # PASLTDGQGGKGGGGETDDERSGKSQRLKKVKKSKAVKSKFGSEQDRSSKTGAASEREGHGKDKDLKERSGSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g957 ### # start gene g958 5 AUGUSTUS gene 4784443 4786136 0.39 - . g958 5 AUGUSTUS transcript 4784443 4786136 0.39 - . g958.t1 5 AUGUSTUS stop_codon 4784443 4784445 . - 0 transcript_id "g958.t1"; gene_id "g958"; 5 AUGUSTUS CDS 4784443 4785984 0.62 - 0 transcript_id "g958.t1"; gene_id "g958"; 5 AUGUSTUS CDS 4786128 4786136 0.39 - 0 transcript_id "g958.t1"; gene_id "g958"; 5 AUGUSTUS start_codon 4786134 4786136 . - 0 transcript_id "g958.t1"; gene_id "g958"; # protein sequence = [MYDFSGEKDCRTPHDFSGASATKLDDIGEGDGDDDEEEEEPSSSKSKETNSKASTSRGVPIPAPSPPLHFHGRPRSPG # PDKDTSTKDQTSRGRSSHHPNSRKRSHSHLAGRESRSRSHSPSFSGHVQPSLLQQQRAAHTLSGGYTSISNPHTNSNPNFDLFGIASIGARAGASSSS # PSSPPPSHMEFGGRNSLAFNALGGLSNMRDIRDLGFNGHSLRDLHGISDLRELRGLGMGNLNFDSIRDSRTFNGVNDFNGFNAFGGGGGSIDLTTLRG # MNRVDAINALRSLGVDLGVEGNRDMRDPRDSRNFDPRSPDLDNPNMNPNMNPSLNPAISTRMMYQQMMLHQQHQQQLIQRRERLAALQAAHAHGEPLS # PHIHHPSHPTHSHNSIHRHSRSSLPRDPRDLPISSDAFSSRDHDRHDMRRRSSSSTAVGLAGRPITEGLEKDKEKEKAKDDKDKDKNKSKDSDIGDLV # AFLDAVENPPSGSRAQDTPGLLRRSSSQSGSTLEWPTTTAREGSGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g958 ### # start gene g959 5 AUGUSTUS gene 4788822 4789037 0.42 - . g959 5 AUGUSTUS transcript 4788822 4789037 0.42 - . g959.t1 5 AUGUSTUS stop_codon 4788822 4788824 . - 0 transcript_id "g959.t1"; gene_id "g959"; 5 AUGUSTUS CDS 4788822 4789037 0.42 - 0 transcript_id "g959.t1"; gene_id "g959"; 5 AUGUSTUS start_codon 4789035 4789037 . - 0 transcript_id "g959.t1"; gene_id "g959"; # protein sequence = [MKEVRRIIIPWLLSSQQTACAELYTSVNNVFLPYMSRSLPAATRSTDDSNGGTGETDQHVQILENNAEEAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g959 ### # start gene g960 5 AUGUSTUS gene 4798451 4799383 1 + . g960 5 AUGUSTUS transcript 4798451 4799383 1 + . g960.t1 5 AUGUSTUS start_codon 4798451 4798453 . + 0 transcript_id "g960.t1"; gene_id "g960"; 5 AUGUSTUS CDS 4798451 4799383 1 + 0 transcript_id "g960.t1"; gene_id "g960"; 5 AUGUSTUS stop_codon 4799381 4799383 . + 0 transcript_id "g960.t1"; gene_id "g960"; # protein sequence = [MASKGLVRQEGFHPDTSSSGSDLSWRPSSALSGIGSSPHDLGGGGGGDFDQELATLISSERSTASTSSSSGSTTNDYV # QRTHNIFDMGVRPPSSSSLHTAHNNSHNQHAPSNSQRADSPPHPTSIPAHFNSTLPALNSSMRYEPLPDLPTSSMTPVPPTGDSPGLGGWTRHTPSPR # PTGTNNNNTNPNNNNGNASVGHPYAVSRSRSRSRPPSAYPGHPGPSASPSILPSSLGSSGIGPQRTTRARRGNSVSSMSSMTSSTSPPPLLQQSAQAI # VIPRTGHHHTQSGNGNGGGDGWYGPGSQGSLGSSTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g960 ### # start gene g961 5 AUGUSTUS gene 4799615 4801460 0.12 + . g961 5 AUGUSTUS transcript 4799615 4801460 0.12 + . g961.t1 5 AUGUSTUS start_codon 4799615 4799617 . + 0 transcript_id "g961.t1"; gene_id "g961"; 5 AUGUSTUS CDS 4799615 4800608 0.24 + 0 transcript_id "g961.t1"; gene_id "g961"; 5 AUGUSTUS CDS 4800691 4801460 0.21 + 2 transcript_id "g961.t1"; gene_id "g961"; 5 AUGUSTUS stop_codon 4801458 4801460 . + 0 transcript_id "g961.t1"; gene_id "g961"; # protein sequence = [MGSMNNMNSPSMNISSPLNQYIGSGSLDGIGGSPMGLNGFNPGLSTGGINGMSISGGIGNINNGINSINNGMPNSTSS # FNANGHWPSSPGAGDQQHFGSPFGNSSSPHLHTGPHPHQHQGQHPHQHHQGHHEQHGHGHAQMHFGGTHTPTPASFNSSLDRIDRLDRFDKLERFDRL # DRLDGWGFPESRSHSGHSSSNGGTGGGMTPLSSSLPTTSTILPPPPPSSSSGRGHGHSASISGATSTSSTTTSSSNRRSTKAEKAERAAALDSNTNNN # KHLTPAEKQALVANEKRRRRRESHNAVERRRRDNINEKIGELATLIPDVMFGGEGGGGTSNSGASPPPGTDSSNNINPLSPISPTSPTSPTSPSGLPG # LTNLSGHSYGFNLDMMGLPVPDEYFHNNPGAAAGGPGSGSGSGVALKTEPMDSDTVVGDEEALTAKGGDGRGSSGGKDGKDKDGGKDGDEAGGVVKAN # KGMILRKSVEYIRSVFGQTVQFLLLDVFFRINSESSISFNHLNCSNSKYLQVSPTTSHGARCSEQGTREGIEDVSRRTCESQPQLLVVQYSECYEHSQ # PHEHDRSGFGREHGRNGVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g961 ### # start gene g962 5 AUGUSTUS gene 4801825 4802943 0.23 + . g962 5 AUGUSTUS transcript 4801825 4802943 0.23 + . g962.t1 5 AUGUSTUS start_codon 4801825 4801827 . + 0 transcript_id "g962.t1"; gene_id "g962"; 5 AUGUSTUS CDS 4801825 4802943 0.23 + 0 transcript_id "g962.t1"; gene_id "g962"; 5 AUGUSTUS stop_codon 4802941 4802943 . + 0 transcript_id "g962.t1"; gene_id "g962"; # protein sequence = [MGNSFSGMGPINMNMNDLNNMSGLSGMGSLNSMGSMNSIGMGLSMGSPLSDVDEDEDEHKEVKEEKGFKGFKEHTERR # DSRKTKLNTSNSKDSVHPGDADASTTISGVSSLSKEKDTNNNGVSSLPSPGASESSSTSSNPAPHSISGTTLPMGKSTRTTRLRANSVKNNISSSASA # VNASASHSNPNLSSPSSTSTSMPKDILSGENNRGRTRRARRGSDVTGGKVGGKAEVLGNVSTSPVARRRRAAVAATHKSKLKPDSEDPDVDMDTASVV # DSAVVDDDDYEDDDPEAVDDADDGGDDDRDEDYRDEDHSPNSVTSRPGSGSPRNAGGNDDDDSPSAMAMEMDDEPIGRRNGRNGRRNRVALGGGGMEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g962 ### # start gene g963 5 AUGUSTUS gene 4808518 4810388 0.6 + . g963 5 AUGUSTUS transcript 4808518 4810388 0.6 + . g963.t1 5 AUGUSTUS start_codon 4808518 4808520 . + 0 transcript_id "g963.t1"; gene_id "g963"; 5 AUGUSTUS CDS 4808518 4808795 0.91 + 0 transcript_id "g963.t1"; gene_id "g963"; 5 AUGUSTUS CDS 4808888 4808904 0.64 + 1 transcript_id "g963.t1"; gene_id "g963"; 5 AUGUSTUS CDS 4809379 4810388 0.91 + 2 transcript_id "g963.t1"; gene_id "g963"; 5 AUGUSTUS stop_codon 4810386 4810388 . + 0 transcript_id "g963.t1"; gene_id "g963"; # protein sequence = [MVIILICTFLTVPSPSLPRTARSTPQVIGSPDMSQSAGHFAEVEAAASDADCSDGVYDTNANDCETDLVVVGKQVRDQ # SPIEWSPTPPRGQALTISKVHDPEFANLVLSPSSSQHPSSPIRPHPLPTSSASADVGAGLQMDDDSFDLCYPPEDPEVSTPVETSSRGLSVDEYDDLD # IDLPADFRSIRALRTPSPDLPSNPLDGWSPTPRAQSTLGSLARRGLFPNSSTNPHILPSKLRRDTSPLKVLSGSSPSPPRSLLSSPSHSYSGTSTANT # SPSKASAQGFPKSRGKDRVQFHPFKQSTHNHHVPSSLIVGTSPVKSPSKSSAAGKRLRNDLIRHALCDGQPSPSTTSTREIRNALIREALGESDLTND # VSSSGTAVVQEHDPQEVPPFVDNNLGDTGVLNSAWIDRRFAVSFRSVTNLPLVSVNLYVIFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g963 ### # start gene g964 5 AUGUSTUS gene 4813798 4820553 0.23 + . g964 5 AUGUSTUS transcript 4813798 4820553 0.23 + . g964.t1 5 AUGUSTUS start_codon 4813798 4813800 . + 0 transcript_id "g964.t1"; gene_id "g964"; 5 AUGUSTUS CDS 4813798 4815427 0.24 + 0 transcript_id "g964.t1"; gene_id "g964"; 5 AUGUSTUS CDS 4815548 4820553 0.96 + 2 transcript_id "g964.t1"; gene_id "g964"; 5 AUGUSTUS stop_codon 4820551 4820553 . + 0 transcript_id "g964.t1"; gene_id "g964"; # protein sequence = [MVHCLFSVKLIILCFFVTFKVEYCILKIVYLRPLSKQRHFGGGRPPHNKSESGIVSTLITEAFTFKCPIPKTSTVPPN # TVDNITFNFPPPPITRSHMALVIDKWCKSSSPVNFEEAGCAVCGQLTLCTDLSALKNMKNYLHVLEAQSVTRAFRSSPDESISEIEGPVLDKSAGDNI # CNNCCSSLRAGNVPKLALCRGLWLGVIPDELKGLTFYEKMLIARVRHTKCFVRVQKGSTNYSKLVSNVIAFENPIPKIYDTLPPPKEEIEEVLAVMFS # GSTKPTQDDYARALLLVRRNVVAKALQILILNHFDYNDVVFSSANLESYAEDAPIVSVEYFQKGSNRNAEGISVHDDLNDDGTEEGDCVFTVHGIVGP # SIKNMTRDQMIGIAAMHLDNEGKFMRTSHAENPESLWNNPQLYPKMFPWLFPFGLGGIGASDIKAFSESSHLKFLLLYHDKRFQLDSNFPLIAFSHQQ # IKANSSQSYLLAESKKFTEISDRFLSVDRSILQNIATRMANGEHVKPANESEIQCFKLLGDLTHAGARTQGSINTKEKFDVPLRTSSECRLLISNNPV # AGARFFHLLVNLFLKHIVDIESSDGGLFGPTSGYYCTVEQQGRLALHLHGLIFNRKTLSPQEIRDKILDPASSFQSQLVSFLESVRIGEFLTGSHTCV # KEAVALQTESNPNYVSPERTLPTPPPPYCDCEIADCHKCSTFIQWFEQFKLTVDDLLLKSNVHDCFRGISPDGSVLNQDKFETSCLNNVHKKCKARFP # RECFQQTLVDPENGHINLKKLEEWLNDISPGLTYLVRGNTDVSSILSGTAIKSAVIYIADYITKTGLKTHVVFDSIKTIFDKSTEIIDGSFSTKEKSR # RLISRIVNLLSTKLELGSPIISLYLLNNPDHYTSHHFIPFYWRTYVSTARSVFEENDATSEPKVILTKRWGKIIGLSSSLDYTHRPVQHAHYNLYDWI # CCFYKTAKNKSKGVIEHDPELISSRSSKGNKQLLFLPGHPLVDTHAIATRQDSSMTVPNFVGSLPRPDKDDREYYCCTMLTLFKPWRSGEDLKNKNQS # WHEAFEAYVFSDQSLLYMKNMNIRFECLDARDDFHAQLKSGKLDVTKLPSSIPVQLHEDLVNKLDGSQLDVNSSVIEDTDYSYDQYTQDKKGSFFLKR # ESAMKAMKDILFNSGWVTPLTSNIQPKPIPICSPIPLPKEKPQHWDLILKGMRDHVLAARDKSRGLPPADNDTNKNNEPGKYRPNIVEICDKYYFDKL # GLEYGSIKELTLNIVKCHNLNNEQERAFRIIAQHSACLVSEPLQMYIGGMGGTGKSQVIKALLQFFAERNSSFAIVTSAPTGNAAALLGGSTYHFLLG # LNNKVEEVGRGTMAQVCARLEHIQYMILDEVSMLSCLDLYRISVQLCEAKNKHDIAFGGMNMIFAGDFAQLPPVGGESVSLYSYRKPTDANKYNGQCA # AMGKSLWHNVTHVVILRKNMRNTGSSKMDISFRLALDNMQYKSCTKEDILFLNTLVSSKLPDRPFVGKSPWRDAAIIVGENKYKDEINRLGCLRFAAD # TKQKLTNFYSDDLVSGNADQGAPAKSKNKKRSISSISKDLQQHLWELPTCAHEYHAPPVLSLCIGLPIIIRHNIATELSITKGQRGTVYAWHESTGAF # GQCTLDVLFVLLDDPPTPIQVPDLPPNVVPLTRRKTKGIVTLKNDVKISVTRFQVDVLPGFSMTAYASQGQGLIPNATDLNTLSDHHAMYTALSRSRS # AASTVILQGFDSRAITGGASGPLRKEYRELEILDEITHLKYEGTLDPSVVGVTRNLLIESFLVWKGTSYVPSQIHSAVSWSAKDPYIQQSEQPLSWSR # VQKKAVKKLMKQNKKSNTSENTTTSPAPLVPPDISRFEVKSKKRNLSDVYGSTDIPLPSAVRQRTTNQHIVPLSNELRRSSAARQASQKRAQKNRITS # GNQRQLAILPTGLTWSNNSCAFDSVLLILLYIWMELNITGDEYSNLPQLIKGFSEYKQGKHTLETVHDDLRILLNSRRPREFNLTGFCSSTAILEEML # KMKSPFMTTKLQCEQGHLSRRRPHNVKVSLLEEPRLVLPSSTNEWISVNGPASSSIMCNVCNLPLRKLFHIKCAPNILAFACDGRPQLKIDYSVHLQC # NNEDVHYVLKGVIYYIPMREHFISRIVASDNMVYVYDGMFNNGVPILESSDYSVLDWAQCQSGSASAVIYSRTDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g964 ### # start gene g965 5 AUGUSTUS gene 4828081 4828679 0.69 + . g965 5 AUGUSTUS transcript 4828081 4828679 0.69 + . g965.t1 5 AUGUSTUS start_codon 4828081 4828083 . + 0 transcript_id "g965.t1"; gene_id "g965"; 5 AUGUSTUS CDS 4828081 4828188 0.79 + 0 transcript_id "g965.t1"; gene_id "g965"; 5 AUGUSTUS CDS 4828326 4828679 0.71 + 0 transcript_id "g965.t1"; gene_id "g965"; 5 AUGUSTUS stop_codon 4828677 4828679 . + 0 transcript_id "g965.t1"; gene_id "g965"; # protein sequence = [MTEGIDPILLPSSYSSPSTSPSSIPINPFGTGPLYSTPDEDKGDSKENFGKGNNGEKGIIFESSVNGYPNGFVIIVNV # YDVPSGAQHGFGSTQTFDKVVQVEVGSRPPAKEGTENDCTRCYSVFEARTIINWLRVLVDEKEEESCQKKWWRDW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g965 ### # start gene g966 5 AUGUSTUS gene 4830815 4831207 0.93 + . g966 5 AUGUSTUS transcript 4830815 4831207 0.93 + . g966.t1 5 AUGUSTUS start_codon 4830815 4830817 . + 0 transcript_id "g966.t1"; gene_id "g966"; 5 AUGUSTUS CDS 4830815 4831207 0.93 + 0 transcript_id "g966.t1"; gene_id "g966"; 5 AUGUSTUS stop_codon 4831205 4831207 . + 0 transcript_id "g966.t1"; gene_id "g966"; # protein sequence = [MKKASKRHDHTVTVILTADGLCRAIHIIIKCSTIHEYTRSLPAAAGSTDDSDGRAGKTDVHVHILENNAEEAKKNRDR # AARGRLNAVTALDRSSRAAHCGDEPISSRRKCGFHLEVMYKNMAADILKELS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g966 ### # start gene g967 5 AUGUSTUS gene 4833792 4835046 0.37 - . g967 5 AUGUSTUS transcript 4833792 4835046 0.37 - . g967.t1 5 AUGUSTUS stop_codon 4833792 4833794 . - 0 transcript_id "g967.t1"; gene_id "g967"; 5 AUGUSTUS CDS 4833792 4834667 0.67 - 0 transcript_id "g967.t1"; gene_id "g967"; 5 AUGUSTUS CDS 4834757 4834896 0.39 - 2 transcript_id "g967.t1"; gene_id "g967"; 5 AUGUSTUS CDS 4835022 4835046 0.77 - 0 transcript_id "g967.t1"; gene_id "g967"; 5 AUGUSTUS start_codon 4835044 4835046 . - 0 transcript_id "g967.t1"; gene_id "g967"; # protein sequence = [MTSKPCRELRDISHPVTEDHRISTDIEKALLKIDEVASNQEGIAAEEALILRGCVRLNASIAFKASDQDTLDTARLVE # TGAKKLAQLYTKLVAEGSSGTTPAPGVEIVKAPFPSQLRTTLQPIVAFLRTLPVPSTHPSHPAAAAILTTLKDAQRGYADMRGTWGKKCLEAHGKRVV # DRADTVEPIATGRELGAWVQSVLSVAREEYDLLIEMSTLVSPSQLASHFGNLLNPLVLLMSTTITALVAFSKRSLQKYGFLILSAYEALLELQPMWEE # ISALKVSPESRNDNRKETNEYKDVLHVVRMVCIRMFPEALADIKLSTAGRTGDTSTALLDAAVEVRFSSISY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g967 ### # start gene g968 5 AUGUSTUS gene 4839452 4839748 0.57 + . g968 5 AUGUSTUS transcript 4839452 4839748 0.57 + . g968.t1 5 AUGUSTUS start_codon 4839452 4839454 . + 0 transcript_id "g968.t1"; gene_id "g968"; 5 AUGUSTUS CDS 4839452 4839748 0.57 + 0 transcript_id "g968.t1"; gene_id "g968"; 5 AUGUSTUS stop_codon 4839746 4839748 . + 0 transcript_id "g968.t1"; gene_id "g968"; # protein sequence = [MRKHKSLPTAARSADDSNRAASKTDEDVQILEDNAKEPKNRSSAGATGRLGAIAALDRASTATAGRLIARSRRGDRKG # SESGGDKSEFELHAEYREST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g968 ### # start gene g969 5 AUGUSTUS gene 4841045 4842565 0.2 - . g969 5 AUGUSTUS transcript 4841045 4842565 0.2 - . g969.t1 5 AUGUSTUS stop_codon 4841045 4841047 . - 0 transcript_id "g969.t1"; gene_id "g969"; 5 AUGUSTUS CDS 4841045 4842026 0.77 - 1 transcript_id "g969.t1"; gene_id "g969"; 5 AUGUSTUS CDS 4842147 4842565 0.2 - 0 transcript_id "g969.t1"; gene_id "g969"; 5 AUGUSTUS start_codon 4842563 4842565 . - 0 transcript_id "g969.t1"; gene_id "g969"; # protein sequence = [MKRPETRVYVRWVIGEILRDPSLFKEYTKGKGIIATRERFRQWLEAEKGKKGIRSDGGRLDEEDLGSETEQKGQMKPE # FGKTVIVPIAIPGCGELDVIRHAVLSDERWLQVKPLLQSLSPIFSVLDIHKVMMCTLRNPRPNNHLRQHRTQLRELTQKMIPPVRLLALNWSLASYPQ # STVHRICGDRVLVRGDNHQTLRADASKFRAHEDVIWMFITQTEELAPAEVDAIIDMDLEEDFVSAVNRAVDGICKELDLPRPTPENIAKGIEKATGYR # PATKKADEESKQKPKEKEPRYFGIVPEIHLEQVLTKVLGENPTTYTMWMHLKKNQRITQRPHITVIHKKSLPGEIELWERCMDLHSSKNPPMFEFKLK # NVIWNDRVMAVVVSDLKVLPGSDLEQKGAEFIGKLSEKIRTRLHITVGTKNHNIPPVEAKALVEEWRQGNTGGVRTIEFSEDVLVQGRIKGLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g969 ### # start gene g970 5 AUGUSTUS gene 4850795 4851976 0.65 - . g970 5 AUGUSTUS transcript 4850795 4851976 0.65 - . g970.t1 5 AUGUSTUS stop_codon 4850795 4850797 . - 0 transcript_id "g970.t1"; gene_id "g970"; 5 AUGUSTUS CDS 4850795 4851976 0.65 - 0 transcript_id "g970.t1"; gene_id "g970"; 5 AUGUSTUS start_codon 4851974 4851976 . - 0 transcript_id "g970.t1"; gene_id "g970"; # protein sequence = [MAGPSNLNYNEFTSMHSENSMTSPFSNYSPPPSWTYAPAAFPNNSTAGPLNAGHDNLTFTHGNNNIGSPFSSSLHSTY # SPILYNNFPTSHPTVGTQSTIFNPSSMNYYPQQAGSSLPLPSLPYALVPGPGIVQGHGPSSSRTRRLSRSSTLISVEGSVFHSNNPLVQNNTMTNKVD # SGSGNTGGDYGNQASASSTSPTVDALSRSASGNQDTTFTGSSMAQRNSRTGTSSSNSRKAPYTKARAPKRPKGTHEPDFVEARKLRTDRVCKWRYTSG # FECQHDFGQDNKKSVSAHAIAHRDDSIQEEQSSGKAPSKGKFICRWTGCDLEGNGMAADAFARHFVHHHSPIRILCLRCGQALARADCEKRHRAGCCE # NNVIKKPEMRDQVWLEYELVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g970 ### # start gene g971 5 AUGUSTUS gene 4853206 4854117 0.67 - . g971 5 AUGUSTUS transcript 4853206 4854117 0.67 - . g971.t1 5 AUGUSTUS stop_codon 4853206 4853208 . - 0 transcript_id "g971.t1"; gene_id "g971"; 5 AUGUSTUS CDS 4853206 4853826 0.67 - 0 transcript_id "g971.t1"; gene_id "g971"; 5 AUGUSTUS CDS 4853881 4854018 0.67 - 0 transcript_id "g971.t1"; gene_id "g971"; 5 AUGUSTUS CDS 4854097 4854117 1 - 0 transcript_id "g971.t1"; gene_id "g971"; 5 AUGUSTUS start_codon 4854115 4854117 . - 0 transcript_id "g971.t1"; gene_id "g971"; # protein sequence = [MALAEPLICPFAHRVELALAETGLKSNKDFVRYEIDLKNKPEWYQPKINPASKVPAIAYGGPKTTGDQPSPSSTKIAE # SLVLIEFVADLFPNSSLLPKDPVLRAKTRFFIDTFANKFGPALFTFQSGKAPNGAEGIFSAIEQLQDLMAPEGLAIGDGTEFTLADAAVIPFFGRMEV # SLKNDFGAFPEGEGKSTWEALQTDKRFARWKKYWDTAKARESFKTTFDEVTKNFFSSHDPQLTTDLLLQDYLTKSYSTRWTRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g971 ### # start gene g972 5 AUGUSTUS gene 4859089 4860018 0.72 + . g972 5 AUGUSTUS transcript 4859089 4860018 0.72 + . g972.t1 5 AUGUSTUS start_codon 4859089 4859091 . + 0 transcript_id "g972.t1"; gene_id "g972"; 5 AUGUSTUS CDS 4859089 4860018 0.72 + 0 transcript_id "g972.t1"; gene_id "g972"; 5 AUGUSTUS stop_codon 4860016 4860018 . + 0 transcript_id "g972.t1"; gene_id "g972"; # protein sequence = [MNPTSKSKDSDSIRAADTPSRSSLNGGNETLIPSGAADSTTPGKHRGGRKMGPQPTSEEEDHSKGKEPALANSSPFND # TSQIMEGSNATTSQTKHHHHHHHHRTSNATANKHDDDGDDTSTLEPPRRHRGSTVTPNVKPDLKRVNSSMSSGSDYAVTLSSEDGNTRQSTKDTRPER # LRSPGHHRTGSSASKHNSFDTGVVRTGSSASRGPGGPNRGRPRTGSMNNSMDRSSTREREREKEREREREREREKEREREKAENRASALYAATQNTQN # MQTTQSAAFNANTFATNFGNAAAPVPGMTKPPGTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g972 ### # start gene g973 5 AUGUSTUS gene 4860353 4860966 0.24 + . g973 5 AUGUSTUS transcript 4860353 4860966 0.24 + . g973.t1 5 AUGUSTUS start_codon 4860353 4860355 . + 0 transcript_id "g973.t1"; gene_id "g973"; 5 AUGUSTUS CDS 4860353 4860421 0.38 + 0 transcript_id "g973.t1"; gene_id "g973"; 5 AUGUSTUS CDS 4860520 4860966 0.51 + 0 transcript_id "g973.t1"; gene_id "g973"; 5 AUGUSTUS stop_codon 4860964 4860966 . + 0 transcript_id "g973.t1"; gene_id "g973"; # protein sequence = [MHRRHFDFENDQLGSDDPAVMLSDNDFDQVYHNAEQSTKPPPLHTHNHKNHENHSSDFNSYDEYIAWERQDAEHIAKI # RRDIASTREQLEMQEAALAALEKEHREKKERHHASLNRDNFSNAVGNSKKKDRAGFIDYENDQFLWDASLKDNMKKVFGINDFRLCQRGCVAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g973 ### # start gene g974 5 AUGUSTUS gene 4862677 4863940 0.37 + . g974 5 AUGUSTUS transcript 4862677 4863940 0.37 + . g974.t1 5 AUGUSTUS start_codon 4862677 4862679 . + 0 transcript_id "g974.t1"; gene_id "g974"; 5 AUGUSTUS CDS 4862677 4862834 0.42 + 0 transcript_id "g974.t1"; gene_id "g974"; 5 AUGUSTUS CDS 4862873 4863248 0.7 + 1 transcript_id "g974.t1"; gene_id "g974"; 5 AUGUSTUS CDS 4863311 4863940 0.65 + 0 transcript_id "g974.t1"; gene_id "g974"; 5 AUGUSTUS stop_codon 4863938 4863940 . + 0 transcript_id "g974.t1"; gene_id "g974"; # protein sequence = [MGAQNVGAVVPGLDYVTILNDVPFQVYAILSFAQNLKQCRKIQFAKQVFRPVVYFSHTSNVSITSWSTSSVSAHTPCG # HCDNCTRDADSFEDKDVTFEAWQLLKIVQEVTRGGGNVTLAKTAELARSSGKAAYTGTGDGGAGGGRSGKRGRKGGGGRKENVVMDLDAVCGGKVQLK # REDIETLLIELLLNRYLKEQYYSTAYATVVYIQLGERAPMLTRFPTKEGLATLSMKLSFSFRVMKRNAKGRPKLTTSSSKKGKAAASAAGSTSILNDE # HGDPDVPGFDIDDHNDEDVEEDAKLFKSKMTPSQRNFRTSTSLQNRARPQATSNPADAINISDDEDDDASKGSNDEESDDENKNAGGWMNVTTRTRPP # RKRRKTEEVIELSSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g974 ### # start gene g975 5 AUGUSTUS gene 4864165 4867072 0.26 - . g975 5 AUGUSTUS transcript 4864165 4867072 0.26 - . g975.t1 5 AUGUSTUS stop_codon 4864165 4864167 . - 0 transcript_id "g975.t1"; gene_id "g975"; 5 AUGUSTUS CDS 4864165 4864376 0.94 - 2 transcript_id "g975.t1"; gene_id "g975"; 5 AUGUSTUS CDS 4864510 4867072 0.26 - 0 transcript_id "g975.t1"; gene_id "g975"; 5 AUGUSTUS start_codon 4867070 4867072 . - 0 transcript_id "g975.t1"; gene_id "g975"; # protein sequence = [MQGPSKGFSGVRVFKGPTLSSFNLNPFSTVSAHFDSFDVGYRPSQPDLPQRHGGHPPRNQQQPARNWQAHNNMYTPSN # APPPPPSHTYQQNPMAHFGVRTASQSSGSRSQEPPRHRDVQPQPQPTPLNHNYFIHPGKSTDMYIYEASDAFSEYSPSTFSPTLSTDSTTTLQSPSPL # PLGQSGLSWDHVRSATPSVRPNTPAPPSGHSRAQSPQSYPSNSYPSNSGNGSISFPSGLPGIRQAQTALRGFFGSNGQVGQPGERQSGESTQTQGATN # GRIHARTLSESSSTANALPNSETEFDDLARMNTALNAGYSYYYPETPALVRPRSGSTSIPNSSSQRSPRDSLMFYSDVQRVEQSPETDLNFPYSQTAA # TVNIRATSDQVPSSTLEMSGAAVENSEASNTLNHGTSSLVPALERSISSSSQSSELSILRTPSPTSYPPSQLPSWLQSQPQTFPYPPVQSKPVEQAST # TVPPAYTTYLSASPEPQTSPSSLVQVQSSAPLLSSSRSQSQSSSTSSSASDTLNGSHSEVYSSFNRDRVVAHPATGEGIASNSTSAVTNTSPNQSYPM # PHAALTETRSSNNTTLAPLADPLNISQSGRTRSPTTGRHGDSRNVMAPATDNGEARRGGPSDNNDSFVRTRKSSTTTRSPNSSSPRIHGQPTTDSQRA # NAPPRFSLPASTTPAPPQQVQTRVRKDSMSLGMKSSSSSRLMSRSNPSATPSYPNSNIETVSREANSGRFASSPTVETSSSISPANPLSTSAMPSSFP # EPRRSHSDGDNPSLTAATRRSAVPFQTEFVPAVSSSASAIGSHNNRDFSRDTLLQPAFENNHRPEPARTHSSELPSRPASVNPRPAAETLLLIGYSDQ # LWTNGGAFRSPPGGEEYPLDLDGYPDFGEGWMNEEGTRIDMAHRLIPKAPLRSALKIKARAN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g975 ### # start gene g976 5 AUGUSTUS gene 4878428 4880360 0.4 + . g976 5 AUGUSTUS transcript 4878428 4880360 0.4 + . g976.t1 5 AUGUSTUS start_codon 4878428 4878430 . + 0 transcript_id "g976.t1"; gene_id "g976"; 5 AUGUSTUS CDS 4878428 4879738 0.43 + 0 transcript_id "g976.t1"; gene_id "g976"; 5 AUGUSTUS CDS 4879797 4880360 0.43 + 0 transcript_id "g976.t1"; gene_id "g976"; 5 AUGUSTUS stop_codon 4880358 4880360 . + 0 transcript_id "g976.t1"; gene_id "g976"; # protein sequence = [MSPTPTRPSSRTPSPLLPPLTALGEVPSPAPESDGEVEADELAFTIESPSRPQLQLFETVFNTGKSLSAYCQDDPLWP # ILAEVASPCTNCLKTPGKCKVLPSSPRCTNCSSKKTCSLGKILRYRYFARRCNQDLAYSRRFLELHGTPAHKSTWGIPLTAWREYDSALHARTSSTSI # LLELNMLDEQDAVDADQQELQQFLTLQWDEAAVAAKRKRNHSPMPVAGPSSKKIRSDASKKRSRRKSPAVEVNVEPFRRVQLVVPPVRSVAPTSLPVP # PPASPSLMGVLHRDLPMQGPSDLVRLADAAEVHPGLVQQAGSSSPARTPIKGTGQDLLSSTMPPILRPALVPRNPASHPYRAENQCLAARVRLLETQL # ADSQRENSSLTSALRDTSHALESRQREVEQLRSSSQEFLQRQEEYRRIIDQFNALDRALSGPSDQSSRAFPKSGGRTCITQKDRDDATGKLSTSSRRI # SELTAALLYQHGITDEGNALSTRQRAHLEELQEEVHRTRGRAAFVERMIKEYPNEGYYEVVLPPLSQLEGDLVKVRADLRRVATLAHRLYRSDPATVL # HHHNRYIGAIIEAVVAFLRRALETEDPDVMEHNIQAGLGLYANGAWCSWGPPHTVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g976 ### # start gene g977 5 AUGUSTUS gene 4881555 4882814 0.79 - . g977 5 AUGUSTUS transcript 4881555 4882814 0.79 - . g977.t1 5 AUGUSTUS stop_codon 4881555 4881557 . - 0 transcript_id "g977.t1"; gene_id "g977"; 5 AUGUSTUS CDS 4881555 4882814 0.79 - 0 transcript_id "g977.t1"; gene_id "g977"; 5 AUGUSTUS start_codon 4882812 4882814 . - 0 transcript_id "g977.t1"; gene_id "g977"; # protein sequence = [MNEDLLVNRVREAPKDTTIIEALKRIARNEEESFVWEDGLIKRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTK # KLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPATAGPEKYDAILVVVCRLTKQAIYVPCHTTDKAEDF # ANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNNTPNTTTG # VSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKAYAKYANQKRQEAPDWKEGDQVWLNMENVRTRPPMKKLDHKWTGPYTIL # SKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHTNSNARPPRLPQSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g977 ### # start gene g978 5 AUGUSTUS gene 4886785 4887815 0.22 - . g978 5 AUGUSTUS transcript 4886785 4887815 0.22 - . g978.t1 5 AUGUSTUS stop_codon 4886785 4886787 . - 0 transcript_id "g978.t1"; gene_id "g978"; 5 AUGUSTUS CDS 4886785 4887669 0.89 - 0 transcript_id "g978.t1"; gene_id "g978"; 5 AUGUSTUS CDS 4887795 4887815 0.25 - 0 transcript_id "g978.t1"; gene_id "g978"; 5 AUGUSTUS start_codon 4887813 4887815 . - 0 transcript_id "g978.t1"; gene_id "g978"; # protein sequence = [MIQQQARGNERIYEGGPSPVVPQPRSWQATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAE # LGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNG # GRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRL # PSMLGKRTSALPQLVISLVQHSPTSTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g978 ### # start gene g979 5 AUGUSTUS gene 4889439 4890023 1 - . g979 5 AUGUSTUS transcript 4889439 4890023 1 - . g979.t1 5 AUGUSTUS stop_codon 4889439 4889441 . - 0 transcript_id "g979.t1"; gene_id "g979"; 5 AUGUSTUS CDS 4889439 4890023 1 - 0 transcript_id "g979.t1"; gene_id "g979"; 5 AUGUSTUS start_codon 4890021 4890023 . - 0 transcript_id "g979.t1"; gene_id "g979"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSGGYQPSSTVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g979 ### # command line: # augustus --species=saccharomyces split/input_2/input_2.fa_chunk_0000009