# This output was generated with AUGUSTUS (version 3.4.0). # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de), # O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff. # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), # Using native and syntenically mapped cDNA alignments to improve de novo gene finding # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 # No extrinsic information on sequences given. # Sources of extrinsic information: M RM # Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ... # saccharomyces version. Using default transition matrix. # Looks like split/input_2/input_2.fa_chunk_0000007 is in fasta format. # We have hints for 0 sequences and for 0 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 57217, name = 3_related_000142F) ----- # # Predicted genes for sequence number 1 on both strands # (none) # # ----- prediction on sequence number 2 (length = 39491, name = 3_related_000163F) ----- # # Predicted genes for sequence number 2 on both strands # start gene g1 3_related_000163F AUGUSTUS gene 298 2165 0.61 - . g1 3_related_000163F AUGUSTUS transcript 298 2165 0.61 - . g1.t1 3_related_000163F AUGUSTUS stop_codon 298 300 . - 0 transcript_id "g1.t1"; gene_id "g1"; 3_related_000163F AUGUSTUS CDS 298 1250 0.78 - 2 transcript_id "g1.t1"; gene_id "g1"; 3_related_000163F AUGUSTUS CDS 2012 2165 0.75 - 0 transcript_id "g1.t1"; gene_id "g1"; 3_related_000163F AUGUSTUS start_codon 2163 2165 . - 0 transcript_id "g1.t1"; gene_id "g1"; # protein sequence = [MFGGILESWNYCGPNKDMKIQIKWYLTDCRSFLAVPNVYCIKLIGLCDSISXKPRTSKNSEKAGVLTPEEYRKAGVVF # GRSTFGTSARTSLLNPTNESSRPSSSQIPTEESHGSSVSRGTGSSISRGRLTSLPRNLKKSNLDPKRKRKEINLIDIEEDIIELIAPESISTSSTSIE # STRLIDTLHQTISQASNTIEPVKMTTNNYGMPALSADTIEPVKMTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIF # EHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1 ### # start gene g2 3_related_000163F AUGUSTUS gene 3280 4173 0.78 - . g2 3_related_000163F AUGUSTUS transcript 3280 4173 0.78 - . g2.t1 3_related_000163F AUGUSTUS stop_codon 3280 3282 . - 0 transcript_id "g2.t1"; gene_id "g2"; 3_related_000163F AUGUSTUS CDS 3280 4173 0.78 - 0 transcript_id "g2.t1"; gene_id "g2"; 3_related_000163F AUGUSTUS start_codon 4171 4173 . - 0 transcript_id "g2.t1"; gene_id "g2"; # protein sequence = [MSSTPVDLSDHTATTNCSALQHALDPRNQHHIHHIGDSWYDCDSQPCPHALSNSVQNPITKEDTTFLPIPHPRLPTPT # MSTPTLPAPSTSAEDLMTQLIRQVANLATAMEERSSSKSSMNNPKVFKGKDGSEAHCFMAQFQNWASEQPDLAKSQVKLIKSALGFFIESAGDWATPH # LLHFSAENPPFGGNWDMFLKEFGQWFEPMDPGMEACSEIKNLRQSKGQTVAEFAQKFKDIRDQTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAP # TLKEAIKRAILVDVYLHDPTMTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g2 ### # start gene g3 3_related_000163F AUGUSTUS gene 10611 10868 0.64 - . g3 3_related_000163F AUGUSTUS transcript 10611 10868 0.64 - . g3.t1 3_related_000163F AUGUSTUS stop_codon 10611 10613 . - 0 transcript_id "g3.t1"; gene_id "g3"; 3_related_000163F AUGUSTUS CDS 10611 10868 0.64 - 0 transcript_id "g3.t1"; gene_id "g3"; 3_related_000163F AUGUSTUS start_codon 10866 10868 . - 0 transcript_id "g3.t1"; gene_id "g3"; # protein sequence = [MTVSIQGIIIRAYSHCCDHKIHIDWDARKQDMELNFDNDDSPTLQALNKSQPQVYSDSAYNDSEYNDGVHTICSSISA # FLTICTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g3 ### # start gene g4 3_related_000163F AUGUSTUS gene 11869 12153 0.58 - . g4 3_related_000163F AUGUSTUS transcript 11869 12153 0.58 - . g4.t1 3_related_000163F AUGUSTUS stop_codon 11869 11871 . - 0 transcript_id "g4.t1"; gene_id "g4"; 3_related_000163F AUGUSTUS CDS 11869 12153 0.58 - 0 transcript_id "g4.t1"; gene_id "g4"; 3_related_000163F AUGUSTUS start_codon 12151 12153 . - 0 transcript_id "g4.t1"; gene_id "g4"; # protein sequence = [MVSKAAKSKAKHDLLKGDISKYIDSLQVIIPKLTDWYNITGYEYERHFGLESEADTQFHSLVQEYQELNKQLAEKIIQ # DGGILSDAVDISPLKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g4 ### # start gene g5 3_related_000163F AUGUSTUS gene 15864 16652 0.51 + . g5 3_related_000163F AUGUSTUS transcript 15864 16652 0.51 + . g5.t1 3_related_000163F AUGUSTUS start_codon 15864 15866 . + 0 transcript_id "g5.t1"; gene_id "g5"; 3_related_000163F AUGUSTUS CDS 15864 16652 0.51 + 0 transcript_id "g5.t1"; gene_id "g5"; 3_related_000163F AUGUSTUS stop_codon 16650 16652 . + 0 transcript_id "g5.t1"; gene_id "g5"; # protein sequence = [MDGFLDPNWCNWLLDSLFCAWLIDEIVDARRRTLKSERPQGYKIAVGMTKLDLGPPSKLAFLYRRSNPYPFGPPPDLL # ATMVTAVYIPNTRRLRSGYTASETLKKLPGTVTSHAKHSSSTSSSCSSSSSPSTSETSVSTSTAMRTRMNDDQRRAKLERDLDIVPGTVHPRTVTCRG # CEHTIRLDTKIKYGDSNWRTHKKKCVKLREEDRTISDILLSLNVEVRLQKISSSSQADPSEDLAELEYCAVQALRDVQRRMDHSTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g5 ### # start gene g6 3_related_000163F AUGUSTUS gene 24855 26374 0.69 - . g6 3_related_000163F AUGUSTUS transcript 24855 26374 0.69 - . g6.t1 3_related_000163F AUGUSTUS stop_codon 24855 24857 . - 0 transcript_id "g6.t1"; gene_id "g6"; 3_related_000163F AUGUSTUS CDS 24855 26167 0.98 - 2 transcript_id "g6.t1"; gene_id "g6"; 3_related_000163F AUGUSTUS CDS 26326 26374 0.7 - 0 transcript_id "g6.t1"; gene_id "g6"; 3_related_000163F AUGUSTUS start_codon 26372 26374 . - 0 transcript_id "g6.t1"; gene_id "g6"; # protein sequence = [MDLHNVVKEYMAVRIFHVASSDAEFNGKVLEGRERRRNERGSDSDYHTDESSSELSDESNDSEEPSCHCSLSSPQDRD # VNMQSTSLTRSHQISNQQVPMTPTAIPLTPSISLTPTPSIPDPSGSHFHATILLREIELMHRVTDFEHDAATVYAVCSGQEASIYKHCLNSRTNKKDA # SKRFPTLARMVTSRDGRIQAKEDDVCRQAKVQADKERARKKKDKERDDIIHCAAQEKEGTEFEGSLNSKNKTELEDIAFSLGLDIDATAIVLKIRIDV # HFNATPSLKQDPRYMGLFTRKWKCAPVLSENDDIRPSSSWRLLSAKPQSPSPSSYFLHHCSHSPPSHYHSPSPLLHSNFPHRQFGSTVNNLISSLSST # HPSNNAFPPSSFPHYNINMSPTPIIPRPRPIPSQPHSSTSTAPHTSSFPHMYIPSYHHPFTSHYDTHLSTYSQPETPSNNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g6 ### # start gene g7 3_related_000163F AUGUSTUS gene 27671 28057 0.58 + . g7 3_related_000163F AUGUSTUS transcript 27671 28057 0.58 + . g7.t1 3_related_000163F AUGUSTUS start_codon 27671 27673 . + 0 transcript_id "g7.t1"; gene_id "g7"; 3_related_000163F AUGUSTUS CDS 27671 28057 0.58 + 0 transcript_id "g7.t1"; gene_id "g7"; 3_related_000163F AUGUSTUS stop_codon 28055 28057 . + 0 transcript_id "g7.t1"; gene_id "g7"; # protein sequence = [MSATSTERPSSSNTESKKQKSALSRGNTTQAQKSNPAASSTVITVAAGQCLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPLQWNLGWDHHNGGLPPWVTPNLPVVPWEVSHTPLPGEREDLPLDRYRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g7 ### # start gene g8 3_related_000163F AUGUSTUS gene 29701 31971 0.49 + . g8 3_related_000163F AUGUSTUS transcript 29701 31971 0.49 + . g8.t1 3_related_000163F AUGUSTUS start_codon 29701 29703 . + 0 transcript_id "g8.t1"; gene_id "g8"; 3_related_000163F AUGUSTUS CDS 29701 31971 0.49 + 0 transcript_id "g8.t1"; gene_id "g8"; 3_related_000163F AUGUSTUS stop_codon 31969 31971 . + 0 transcript_id "g8.t1"; gene_id "g8"; # protein sequence = [MQSHAVGAESQRDPNQRRTLVVHEEAVPPQGAPLGTPFVTGAQTNRPGMVVDSAHSQESVAMIQQQARVIETLQEQLR # EVKKGFTAGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPSVDRRHIHEWGAR # VQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPPSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSDEGEQNQ # SSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDLRQGWHRKAAPRPPNEGRSTWESNKEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERM # FGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTG # FNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLHGEKVLQGWLSRFPGLELAPEAPYKSPLRREREPADVWTSNP # KPAATGRFQSRPNWKEGRQRASAAWGEGESYDSENREEDEDCCHCRDGGEWTEAVLRAGVTDTGRKWTPEERAEKWRRRRQELCMRCGRKEHWAKDCP # NPESLERPAEDQGSSERASKADSTRGRGTANQGGGRKDDSTRPLERIRAGIVVEEREGMDDLWNVHILDSPKGGEQELLDEVGNGQGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g8 ### # start gene g9 3_related_000163F AUGUSTUS gene 32184 33755 0.85 + . g9 3_related_000163F AUGUSTUS transcript 32184 33755 0.85 + . g9.t1 3_related_000163F AUGUSTUS start_codon 32184 32186 . + 0 transcript_id "g9.t1"; gene_id "g9"; 3_related_000163F AUGUSTUS CDS 32184 33755 0.85 + 0 transcript_id "g9.t1"; gene_id "g9"; 3_related_000163F AUGUSTUS stop_codon 33753 33755 . + 0 transcript_id "g9.t1"; gene_id "g9"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSTGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQRPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSRDTKRSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEGSPTEEILRASGSND # PERVQQPKDPENGNPGLEQGGVVKELDEEVSKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKE # YIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g9 ### # start gene g10 3_related_000163F AUGUSTUS gene 35455 36526 0.67 + . g10 3_related_000163F AUGUSTUS transcript 35455 36526 0.67 + . g10.t1 3_related_000163F AUGUSTUS start_codon 35455 35457 . + 0 transcript_id "g10.t1"; gene_id "g10"; 3_related_000163F AUGUSTUS CDS 35455 35483 0.71 + 0 transcript_id "g10.t1"; gene_id "g10"; 3_related_000163F AUGUSTUS CDS 35572 36526 0.7 + 1 transcript_id "g10.t1"; gene_id "g10"; 3_related_000163F AUGUSTUS stop_codon 36524 36526 . + 0 transcript_id "g10.t1"; gene_id "g10"; # protein sequence = [MPSDITSDRGRTNRTSKPICGGIPSIYCSYDQDDWDLLLPIAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQG # AEVNEYASNLKELHAYLQERIRVANEAYAKYANQRRQEAPDWKEGDHVWLNMENVRTRRPMKKLDHKWTGPYSILAKIGTHAYRLDLPGDLHKIHNVF # HVDRLKPHFHDKFKRQNSPPPPIFVKGESEHFVESILDSKPIKGKPEEVEYLVKWEGYDEGFNSWVGWRGMAGSLELLKQWHKRHTRKRQPKRSHWEL # LEKQAEDDEEEATEPTKGTGSGKENKEGRGEEPDQQFNDLRQDHTTRRALRLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g10 ### # # ----- prediction on sequence number 3 (length = 48765, name = 3_related_000155F) ----- # # Predicted genes for sequence number 3 on both strands # start gene g11 3_related_000155F AUGUSTUS gene 1923 2423 0.8 + . g11 3_related_000155F AUGUSTUS transcript 1923 2423 0.8 + . g11.t1 3_related_000155F AUGUSTUS start_codon 1923 1925 . + 0 transcript_id "g11.t1"; gene_id "g11"; 3_related_000155F AUGUSTUS CDS 1923 2423 0.8 + 0 transcript_id "g11.t1"; gene_id "g11"; 3_related_000155F AUGUSTUS stop_codon 2421 2423 . + 0 transcript_id "g11.t1"; gene_id "g11"; # protein sequence = [MLALSTALPHSDGIGRWDDVVPALPSIDQLTADWEQLMLRYIHHITDTPLSGTDAQGPISSVESATESLAEVLVERSL # GAPVVLGSTSSVGPHPQVPLFLPEQESSTSPSPTLPPLFGSVANLAIDLTGDDDELYEMEEASAGRFSVEREVIDLAAGQDVIKDESW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g11 ### # start gene g12 3_related_000155F AUGUSTUS gene 9755 10960 0.94 + . g12 3_related_000155F AUGUSTUS transcript 9755 10960 0.94 + . g12.t1 3_related_000155F AUGUSTUS start_codon 9755 9757 . + 0 transcript_id "g12.t1"; gene_id "g12"; 3_related_000155F AUGUSTUS CDS 9755 10960 0.94 + 0 transcript_id "g12.t1"; gene_id "g12"; 3_related_000155F AUGUSTUS stop_codon 10958 10960 . + 0 transcript_id "g12.t1"; gene_id "g12"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGTEARRFMAQFQNWASEQSDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSVENPPFGGNWDTFLKEFSQRFEPMDPGMEARSQIKNLRQSKGQRVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHNPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTSTSAPAPVAATPSPPNQDFSSQIGQIRELLD # RANAMSSSSSGFQQGFKEGTRFGCTKSTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g12 ### # start gene g13 3_related_000155F AUGUSTUS gene 11106 13259 0.74 + . g13 3_related_000155F AUGUSTUS transcript 11106 13259 0.74 + . g13.t1 3_related_000155F AUGUSTUS start_codon 11106 11108 . + 0 transcript_id "g13.t1"; gene_id "g13"; 3_related_000155F AUGUSTUS CDS 11106 13259 0.74 + 0 transcript_id "g13.t1"; gene_id "g13"; 3_related_000155F AUGUSTUS stop_codon 13257 13259 . + 0 transcript_id "g13.t1"; gene_id "g13"; # protein sequence = [MVDCGATALFLNQDFATRNHVRCAPLHKPIDVFNIDGTPNRAGRITHFARLALTVDNQEQWMDFLITNLGGEEVILGL # PWLRKVNPEIDWEKGRLSVKPPRVAIEEVPDEEISYSHLAAANTESPIPELPNLEPPAESSHIEVPLEATLEDSKSAVVEEPPIHRIRANYKTRRAWV # KAGILEEQTEEVWCAAGFTYSQQLAEEANQAKPVKTVEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLIPGALATMRTKIYPMSLNEQEELDRF # LEENLQKGYIVPSKSPIWSPVFFVKKKDGKLRFVQDYRKLNKYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNVRIKEGHEWKGAFATTRGLF # EPKVMFFGLTNSPATFQALMNAIFADLITAGKVAVYLDNILIFSSDLQEHRRVVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVK # VAAVRDWPAPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTRKDTPFAWMDTQQQAFDTLRKAFISAPILALWTPDRPTRIEVDASGFATGGALM # QKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTCRQACWALYLSRFDFHMIHRPGRINT # QADALFRMEAHQVLDSEDNRQQTVLKPNHFTKIAASILRNPLEDRIRKTSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g13 ### # start gene g14 3_related_000155F AUGUSTUS gene 17478 17870 0.99 + . g14 3_related_000155F AUGUSTUS transcript 17478 17870 0.99 + . g14.t1 3_related_000155F AUGUSTUS start_codon 17478 17480 . + 0 transcript_id "g14.t1"; gene_id "g14"; 3_related_000155F AUGUSTUS CDS 17478 17870 0.99 + 0 transcript_id "g14.t1"; gene_id "g14"; 3_related_000155F AUGUSTUS stop_codon 17868 17870 . + 0 transcript_id "g14.t1"; gene_id "g14"; # protein sequence = [MRDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIDLDVQEALDEERSYEMHRNHMLESKDATCEVFSRNLFPTFDE # EFVQNNPYPEAHRSSEGNRLDELIPLIGDYLSNPTDEFLGKMSKEERLNLLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g14 ### # start gene g15 3_related_000155F AUGUSTUS gene 18116 18595 0.42 + . g15 3_related_000155F AUGUSTUS transcript 18116 18595 0.42 + . g15.t1 3_related_000155F AUGUSTUS start_codon 18116 18118 . + 0 transcript_id "g15.t1"; gene_id "g15"; 3_related_000155F AUGUSTUS CDS 18116 18595 0.42 + 0 transcript_id "g15.t1"; gene_id "g15"; 3_related_000155F AUGUSTUS stop_codon 18593 18595 . + 0 transcript_id "g15.t1"; gene_id "g15"; # protein sequence = [MKLLKAPPILMHTPSLFQKVHVDTMIMSILSNGCKYIIHGRNSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE # VVTDNAGQMKNMLAWLEEKYRIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWSDRVTVKIMYTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g15 ### # start gene g16 3_related_000155F AUGUSTUS gene 20323 21408 0.98 - . g16 3_related_000155F AUGUSTUS transcript 20323 21408 0.98 - . g16.t1 3_related_000155F AUGUSTUS stop_codon 20323 20325 . - 0 transcript_id "g16.t1"; gene_id "g16"; 3_related_000155F AUGUSTUS CDS 20323 21408 0.98 - 0 transcript_id "g16.t1"; gene_id "g16"; 3_related_000155F AUGUSTUS start_codon 21406 21408 . - 0 transcript_id "g16.t1"; gene_id "g16"; # protein sequence = [MVSQFAAQLETPKVDIVLVSAAVFNRACKDAGMEPILLRAIHSEVAAHADDRSSTAPTVPPLPHSIPAEYAEFADIFH # EIAADALPEHRPYDLKIDLEEGASPPLGHIYPLSEKELVALKDFIDKQLATGAITPSSSPHSAPVLFVLKKDGKLRLCVDFHGLNRITKKDRYPLPLI # SDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQCFVNDIFSDMLDVCVIVYLDDILIYSNTPEEHREHVK # EVLRRLWKHWLYANPDKCEFNMGTVEYLGYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVLMTRLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g16 ### # start gene g17 3_related_000155F AUGUSTUS gene 22217 23754 0.94 - . g17 3_related_000155F AUGUSTUS transcript 22217 23754 0.94 - . g17.t1 3_related_000155F AUGUSTUS stop_codon 22217 22219 . - 0 transcript_id "g17.t1"; gene_id "g17"; 3_related_000155F AUGUSTUS CDS 22217 23379 0.96 - 2 transcript_id "g17.t1"; gene_id "g17"; 3_related_000155F AUGUSTUS CDS 23463 23754 0.98 - 0 transcript_id "g17.t1"; gene_id "g17"; 3_related_000155F AUGUSTUS start_codon 23752 23754 . - 0 transcript_id "g17.t1"; gene_id "g17"; # protein sequence = [MPPKARAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNCGFGPTTVPTTSTLPEAMEEEQQLEYSTLYTGDGQP # VQVLTPHRGQPPVVTPARAESPHDPPPHFNLDAGDHNNQDPPVNPNDPGADNDNDNLDDDSGGLPRGEPGGPRSPISPDIPNEQRAMLELLLGFKGSI # ETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNNRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLESLLAWTSSFKAL # VKELQDNFGVYDAQGEAEDSLGNLKMKETENIQKYNIRFNTLAASTNWDSAALKWAYGRSLAERIKDKMARLPEPATLADYRQEVLRIDNRYWKHKET # RKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLC # LFCGGKHQIADCNK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g17 ### # start gene g18 3_related_000155F AUGUSTUS gene 25289 26067 0.39 - . g18 3_related_000155F AUGUSTUS transcript 25289 26067 0.39 - . g18.t1 3_related_000155F AUGUSTUS stop_codon 25289 25291 . - 0 transcript_id "g18.t1"; gene_id "g18"; 3_related_000155F AUGUSTUS CDS 25289 25590 0.83 - 2 transcript_id "g18.t1"; gene_id "g18"; 3_related_000155F AUGUSTUS CDS 25799 25923 0.8 - 1 transcript_id "g18.t1"; gene_id "g18"; 3_related_000155F AUGUSTUS CDS 26039 26067 0.5 - 0 transcript_id "g18.t1"; gene_id "g18"; 3_related_000155F AUGUSTUS start_codon 26065 26067 . - 0 transcript_id "g18.t1"; gene_id "g18"; # protein sequence = [MNSASKDELVTPYPTTGSNKGSNKDEKSAVNNVSPRLSKIHCHADSHASSNSEFEFNANLVKTYATRARIAKVIADEA # CSILKSRQDSGSDSSASDASFTTAQSIPTTGSEDTIVTPTEIAVPVIKTVKRATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g18 ### # start gene g19 3_related_000155F AUGUSTUS gene 27775 29037 0.18 - . g19 3_related_000155F AUGUSTUS transcript 27775 29037 0.18 - . g19.t1 3_related_000155F AUGUSTUS stop_codon 27775 27777 . - 0 transcript_id "g19.t1"; gene_id "g19"; 3_related_000155F AUGUSTUS CDS 27775 28316 0.91 - 2 transcript_id "g19.t1"; gene_id "g19"; 3_related_000155F AUGUSTUS CDS 28461 28575 0.58 - 0 transcript_id "g19.t1"; gene_id "g19"; 3_related_000155F AUGUSTUS CDS 28718 28762 0.28 - 0 transcript_id "g19.t1"; gene_id "g19"; 3_related_000155F AUGUSTUS CDS 28870 29037 0.42 - 0 transcript_id "g19.t1"; gene_id "g19"; 3_related_000155F AUGUSTUS start_codon 29035 29037 . - 0 transcript_id "g19.t1"; gene_id "g19"; # protein sequence = [MEVLDVEESETEEEVLPPPSKCLKSSKTTPVPSKTLNFRPALLIDDQGRLKLLGDSHTFAMPKPYIQCEPQPSIPAQA # CVSALSQGEFNPNSSCFPGLKCESCSSRSLKYLTNSLRRTQLDRLGTVFDQARQSFLQSFLDLQQAGQDPIVVLKALKAAEPQRESLSIQDWTLLATL # FQWSSPFNLNGLKFDNQTLTEWIDLLCSIHSGASSVTITLDGHLVDASQPPESAVKVLEDPDTQGSPPIDTIKKDSRFEDATSLPEGSPIQAELDFPP # IESLTGPTPSPEKGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g19 ### # start gene g20 3_related_000155F AUGUSTUS gene 37381 38813 0.06 + . g20 3_related_000155F AUGUSTUS transcript 37381 38813 0.06 + . g20.t1 3_related_000155F AUGUSTUS start_codon 37381 37383 . + 0 transcript_id "g20.t1"; gene_id "g20"; 3_related_000155F AUGUSTUS CDS 37381 37548 0.86 + 0 transcript_id "g20.t1"; gene_id "g20"; 3_related_000155F AUGUSTUS CDS 37588 37754 0.12 + 0 transcript_id "g20.t1"; gene_id "g20"; 3_related_000155F AUGUSTUS CDS 37794 37833 0.09 + 1 transcript_id "g20.t1"; gene_id "g20"; 3_related_000155F AUGUSTUS CDS 38169 38813 0.54 + 0 transcript_id "g20.t1"; gene_id "g20"; 3_related_000155F AUGUSTUS stop_codon 38811 38813 . + 0 transcript_id "g20.t1"; gene_id "g20"; # protein sequence = [MPIHHKKDLDIARVAEPHLSALQQLLASYKGKKTNNPNKATISVLRRSTEYLHDLLEKPVTLRNHVRQVTNLIAHQSI # IDTLCLGHKLFPDIVSDSHFEQHLSSWLLPMMLVLFRTLSSGIASSINRRSTPYPTTGSNKGSNKDEKSAVNKVSPRLSKVPCHTDSHVSSNCMSCLA # EDKGESIQFKSVSNGFLFHDLVTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAASLNFQAAEFEFNANLVKTYATCAHIAKVIADKACSILKSRQ # DSGSDSSASDASFATAQSIPTTSSEDTVVTPIEITVPVLKTVEQATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g20 ### # start gene g21 3_related_000155F AUGUSTUS gene 39074 41037 0.06 - . g21 3_related_000155F AUGUSTUS transcript 39074 41037 0.06 - . g21.t1 3_related_000155F AUGUSTUS stop_codon 39074 39076 . - 0 transcript_id "g21.t1"; gene_id "g21"; 3_related_000155F AUGUSTUS CDS 39074 40355 0.54 - 1 transcript_id "g21.t1"; gene_id "g21"; 3_related_000155F AUGUSTUS CDS 40608 40944 0.9 - 2 transcript_id "g21.t1"; gene_id "g21"; 3_related_000155F AUGUSTUS CDS 41019 41037 0.2 - 0 transcript_id "g21.t1"; gene_id "g21"; 3_related_000155F AUGUSTUS start_codon 41035 41037 . - 0 transcript_id "g21.t1"; gene_id "g21"; # protein sequence = [MLDNPSCATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQ # EADDIELDVQEALDEERSYEIRRNHMLESKNATCEVFNRNFGGKRKRMHMLNSTHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQM # KLLKAPPTLMPTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYG # IKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVELTWLVNPPNRILTRDELIG # YRAQALSKHNSFIEKVRRRVDANKVAELRRFEQKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIVEMDGTVLKEKV # GAFRVLPHFTRNESIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g21 ### # start gene g22 3_related_000155F AUGUSTUS gene 41649 42235 0.62 - . g22 3_related_000155F AUGUSTUS transcript 41649 42235 0.62 - . g22.t1 3_related_000155F AUGUSTUS stop_codon 41649 41651 . - 0 transcript_id "g22.t1"; gene_id "g22"; 3_related_000155F AUGUSTUS CDS 41649 42148 0.71 - 2 transcript_id "g22.t1"; gene_id "g22"; 3_related_000155F AUGUSTUS CDS 42229 42235 0.62 - 0 transcript_id "g22.t1"; gene_id "g22"; 3_related_000155F AUGUSTUS start_codon 42233 42235 . - 0 transcript_id "g22.t1"; gene_id "g22"; # protein sequence = [MNRIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELD # QLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTDMNYQKEVTKPFQRILELDDLFGNTSKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g22 ### # start gene g23 3_related_000155F AUGUSTUS gene 42393 43250 0.97 - . g23 3_related_000155F AUGUSTUS transcript 42393 43250 0.97 - . g23.t1 3_related_000155F AUGUSTUS stop_codon 42393 42395 . - 0 transcript_id "g23.t1"; gene_id "g23"; 3_related_000155F AUGUSTUS CDS 42393 43250 0.97 - 0 transcript_id "g23.t1"; gene_id "g23"; 3_related_000155F AUGUSTUS start_codon 43248 43250 . - 0 transcript_id "g23.t1"; gene_id "g23"; # protein sequence = [MIKLKEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQ # KFSLGENCDKSESTETTQNQCNNENTSETVRDDNWNKPKNSQRTRKRMVRYEVLKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQPDLV # NEPPTNKLEEHIKLNQQDRPPINLIDETNKQVVNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVP # TGRYTKRGKRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g23 ### # start gene g24 3_related_000155F AUGUSTUS gene 43659 43979 0.99 - . g24 3_related_000155F AUGUSTUS transcript 43659 43979 0.99 - . g24.t1 3_related_000155F AUGUSTUS stop_codon 43659 43661 . - 0 transcript_id "g24.t1"; gene_id "g24"; 3_related_000155F AUGUSTUS CDS 43659 43979 0.99 - 0 transcript_id "g24.t1"; gene_id "g24"; 3_related_000155F AUGUSTUS start_codon 43977 43979 . - 0 transcript_id "g24.t1"; gene_id "g24"; # protein sequence = [MKTISDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGL # ARNIPFKFGEVTVYLQLHVQKKHHFKCY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g24 ### # start gene g25 3_related_000155F AUGUSTUS gene 44172 44524 0.49 - . g25 3_related_000155F AUGUSTUS transcript 44172 44524 0.49 - . g25.t1 3_related_000155F AUGUSTUS stop_codon 44172 44174 . - 0 transcript_id "g25.t1"; gene_id "g25"; 3_related_000155F AUGUSTUS CDS 44172 44453 0.84 - 0 transcript_id "g25.t1"; gene_id "g25"; 3_related_000155F AUGUSTUS CDS 44498 44524 0.49 - 0 transcript_id "g25.t1"; gene_id "g25"; 3_related_000155F AUGUSTUS start_codon 44522 44524 . - 0 transcript_id "g25.t1"; gene_id "g25"; # protein sequence = [MIMFNLGRITNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTK # TNNYVSTLSEDGETEILDEPLGYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g25 ### # start gene g26 3_related_000155F AUGUSTUS gene 45358 45822 0.63 - . g26 3_related_000155F AUGUSTUS transcript 45358 45822 0.63 - . g26.t1 3_related_000155F AUGUSTUS stop_codon 45358 45360 . - 0 transcript_id "g26.t1"; gene_id "g26"; 3_related_000155F AUGUSTUS CDS 45358 45822 0.63 - 0 transcript_id "g26.t1"; gene_id "g26"; 3_related_000155F AUGUSTUS start_codon 45820 45822 . - 0 transcript_id "g26.t1"; gene_id "g26"; # protein sequence = [MSDRRKEDPFKIDEVMNAAEKYMIGSSLITTIKHFPLLLRAHQLITLIHLVGDILFTVCCRCSKTDRNYLQALKPKVE # DEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKVITVALQRRSRHYDAVNSSNGTDGLKKMLKE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g26 ### # # ----- prediction on sequence number 4 (length = 63347, name = 3_related_000134F) ----- # # Predicted genes for sequence number 4 on both strands # start gene g27 3_related_000134F AUGUSTUS gene 715 957 0.45 - . g27 3_related_000134F AUGUSTUS transcript 715 957 0.45 - . g27.t1 3_related_000134F AUGUSTUS stop_codon 715 717 . - 0 transcript_id "g27.t1"; gene_id "g27"; 3_related_000134F AUGUSTUS CDS 715 957 0.45 - 0 transcript_id "g27.t1"; gene_id "g27"; 3_related_000134F AUGUSTUS start_codon 955 957 . - 0 transcript_id "g27.t1"; gene_id "g27"; # protein sequence = [MMCREDGSEDADYDHEIHAPEKGTGCDDAHDNYVQENGNGNKRIDDGNDGMVNGVLYDQASNTSGNSASASSARRRSS # LT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g27 ### # start gene g28 3_related_000134F AUGUSTUS gene 1892 2665 0.8 - . g28 3_related_000134F AUGUSTUS transcript 1892 2665 0.8 - . g28.t1 3_related_000134F AUGUSTUS stop_codon 1892 1894 . - 0 transcript_id "g28.t1"; gene_id "g28"; 3_related_000134F AUGUSTUS CDS 1892 2665 0.8 - 0 transcript_id "g28.t1"; gene_id "g28"; 3_related_000134F AUGUSTUS start_codon 2663 2665 . - 0 transcript_id "g28.t1"; gene_id "g28"; # protein sequence = [MFLLLLEQQNDEEDEEDLQHSLLILSALVCGVLDNENECARRRNPSRLYLTRPQLMPYPRFESPWIRLWEGQNDRAFI # TTMGFDVQTFRFILEGRGHFAELWNNTPIPRVDVSKFGAPRIGGRSLDAAGALGLVLHYIGSAILESQLQQIFAIVPSVLSRYLEFSLGILLTVLQKM # EEAKITLPSSVEKYEELSSLITDRHSLLEGAFASIDGLSLPVQVSDDPEIENATYNGWKTDHRITNVLMFSPKGVLLTASC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g28 ### # start gene g29 3_related_000134F AUGUSTUS gene 6713 7651 1 + . g29 3_related_000134F AUGUSTUS transcript 6713 7651 1 + . g29.t1 3_related_000134F AUGUSTUS start_codon 6713 6715 . + 0 transcript_id "g29.t1"; gene_id "g29"; 3_related_000134F AUGUSTUS CDS 6713 7651 1 + 0 transcript_id "g29.t1"; gene_id "g29"; 3_related_000134F AUGUSTUS stop_codon 7649 7651 . + 0 transcript_id "g29.t1"; gene_id "g29"; # protein sequence = [MSATSTEQHSSSKIESKKQKSALSRGNTTQAQKSNQAASSTVIMVAAGQRLMSIPEQSFGDETASNVRTPEGRQPAVQ # EPPPVEPGMGPPQWRYTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPVLQLDMESASNAGGRVSGQVAAIERIQGENTDPLTIRQQEKLPERRVSPAV # CEQSRTSSRRLPTPPVQSLNPPPPRRGGSLSGLLKSPAMNTPTWEHTHALHHIRTNFPVQPLSEMTLCLEDVIRIQECIPEDVAMVLREVLESMGIEI # LGDGFEFSDLRVQFLTVGTQLEIDLPEKAQRWLMTPAN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g29 ### # start gene g30 3_related_000134F AUGUSTUS gene 8312 9244 0.34 + . g30 3_related_000134F AUGUSTUS transcript 8312 9244 0.34 + . g30.t1 3_related_000134F AUGUSTUS start_codon 8312 8314 . + 0 transcript_id "g30.t1"; gene_id "g30"; 3_related_000134F AUGUSTUS CDS 8312 9244 0.34 + 0 transcript_id "g30.t1"; gene_id "g30"; 3_related_000134F AUGUSTUS stop_codon 9242 9244 . + 0 transcript_id "g30.t1"; gene_id "g30"; # protein sequence = [MVQCEPENAGEFPLEQFDLKGQLHGSDGRFRGQKHLSSRNNEVPEFLNPGNTAMRSPQLRSGTSPTVHALGQNSTPPP # RVNLQTKPVKPVSTQRYQFGEVRMDGAQHSSRIYGQDLTARLVPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGAESQRDPNQRRTLVVHEEAVPPQGA # PLGTPFVTGAQTDQPGMVVDSAHSQESVVMIQQQARVIETLQEQLREVKKGFAAGEVPTGGPLSKTGNTVGLFGQAPRVMREYTRGGPSPVVPQPRSW # QAMEPISFNRNTPAGAKDGNPQVEQAGQIPATPSVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g30 ### # start gene g31 3_related_000134F AUGUSTUS gene 9608 12396 0.61 - . g31 3_related_000134F AUGUSTUS transcript 9608 12396 0.61 - . g31.t1 3_related_000134F AUGUSTUS stop_codon 9608 9610 . - 0 transcript_id "g31.t1"; gene_id "g31"; 3_related_000134F AUGUSTUS CDS 9608 11710 0.89 - 0 transcript_id "g31.t1"; gene_id "g31"; 3_related_000134F AUGUSTUS CDS 11797 12396 0.61 - 0 transcript_id "g31.t1"; gene_id "g31"; 3_related_000134F AUGUSTUS start_codon 12394 12396 . - 0 transcript_id "g31.t1"; gene_id "g31"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATTLFLNQDFATRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDVILGLPWLRKVNLEIDWEKGQLSVKPPQVAIEEVPDEEISYSHLAAANTESPIPELPN # LEPPAESPHIEAPLEATLEESESATEEVWCAAGFTYSQQLAEEANRAKPVKTFEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLIPGAPATMRT # KIYPMSLNEQEELDHFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNHYPLPLVADIISRLQGARYFTKFDVRWGYNNVRIK # EGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSSDLQEHRRVVREVLTRLEKHNLYLQPEKCEFEQQQIEY # LGLIISEGEVRMDPVKVAAVRDWPAPTNLRELRGFLGFANFYWRFIRNFARMARPLNDLTWKDTPFAWMDTQQQAFDTLRKAFISAPILALWTPDRPT # RIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDQEMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLPRCQARWALYL # SQFDFHMIHRPGRINTQADALSRMAAHQVLDSEDNRQQTVLKPNHFTKIAASILRNPLEDRIRKASQREAQVLEGLKTVKEHGLQRLANGIAEWEEDN # GLVYYQGRVYVPAHNDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLHSFVEKYVEGCETCARKKIQRHPRAVTQPLVPLGLWEEVGVDLITQ # LPNSQGYDAVLVCTDLYGKQIHALPCTSSITAEGVADI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g31 ### # start gene g32 3_related_000134F AUGUSTUS gene 15388 15975 0.99 + . g32 3_related_000134F AUGUSTUS transcript 15388 15975 0.99 + . g32.t1 3_related_000134F AUGUSTUS start_codon 15388 15390 . + 0 transcript_id "g32.t1"; gene_id "g32"; 3_related_000134F AUGUSTUS CDS 15388 15975 0.99 + 0 transcript_id "g32.t1"; gene_id "g32"; 3_related_000134F AUGUSTUS stop_codon 15973 15975 . + 0 transcript_id "g32.t1"; gene_id "g32"; # protein sequence = [MTEGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMLEESFTNFFIRFNEYAPLTGFNDEALITYLKKGVAP # WLPLQVVTGREEPRSYDEWTRVFMKLDGAVRVQAESLRNLHGKKPLQGWLSRFPGLELAPEAPYKSPLRREQDPADVWTSNPKPAVTGRFQNRSNWKE # GQQRASTAWGEGESYDSKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g32 ### # start gene g33 3_related_000134F AUGUSTUS gene 17824 18447 0.62 + . g33 3_related_000134F AUGUSTUS transcript 17824 18447 0.62 + . g33.t1 3_related_000134F AUGUSTUS start_codon 17824 17826 . + 0 transcript_id "g33.t1"; gene_id "g33"; 3_related_000134F AUGUSTUS CDS 17824 18447 0.62 + 0 transcript_id "g33.t1"; gene_id "g33"; 3_related_000134F AUGUSTUS stop_codon 18445 18447 . + 0 transcript_id "g33.t1"; gene_id "g33"; # protein sequence = [MPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEVSHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYL # GVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLEFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTSQCSSAFELLKSAFSEASILGHYNPDLPVV # LECDACDLAIAGILSQLDPETGEIHPIAFHA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g33 ### # start gene g34 3_related_000134F AUGUSTUS gene 18817 20046 0.68 + . g34 3_related_000134F AUGUSTUS transcript 18817 20046 0.68 + . g34.t1 3_related_000134F AUGUSTUS start_codon 18817 18819 . + 0 transcript_id "g34.t1"; gene_id "g34"; 3_related_000134F AUGUSTUS CDS 18817 20046 0.68 + 0 transcript_id "g34.t1"; gene_id "g34"; 3_related_000134F AUGUSTUS stop_codon 20044 20046 . + 0 transcript_id "g34.t1"; gene_id "g34"; # protein sequence = [MNKDLLVNRVREAPKDTTMIEALKRIARNEEESLVWEDGMIKRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTK # KLVNQLFFWKGLSKDVNYYVQSCHLCLRAKASHSKPYGNLRPLPIGQQPWSSISLDHITQLPVTAGPEKYDTILVVVCRLTKQAIYIPCHTTDNAEDF # ANLFITHIFSKHGMPSDITSDQGSLFVSQFWRELCRVLGIESRLSMVYHPQTDGQTEQVNQSVEAYLRIYCFYDQDDWDLLLPIAEFVYNNTPNTSTS # VSPFFANKGYHPRLSITLEQVQGAEVNEYASNLKELHTYLQERIRAANEVYAKYANQKRQDALDWKEGDHVWLNMENVRTRRPMKKLDHKWTGPYSIL # SKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHNKFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g34 ### # start gene g35 3_related_000134F AUGUSTUS gene 20595 21602 1 - . g35 3_related_000134F AUGUSTUS transcript 20595 21602 1 - . g35.t1 3_related_000134F AUGUSTUS stop_codon 20595 20597 . - 0 transcript_id "g35.t1"; gene_id "g35"; 3_related_000134F AUGUSTUS CDS 20595 21602 1 - 0 transcript_id "g35.t1"; gene_id "g35"; 3_related_000134F AUGUSTUS start_codon 21600 21602 . - 0 transcript_id "g35.t1"; gene_id "g35"; # protein sequence = [MIKEYPNEGYYEVILPPLSQLEGDLNKAHEDLRRVATFAHRLYRSDPATVLHHHYCYLGAIIEAVVAFLRHGLDSDDL # DVAVHNFQLALDYMQVARGVHGDMYMRSLSSIQWFFNNAVDEDEGLYHMVLAHSRFDNDGPFLTAAQHAGFAPPPDNSLEPPLHRRMLVLSTALPHSD # GTGRWNDIVPALPSIDQLTADWEQLMLQYIHHITDTPLSGPDPPVPMSSMGPVPEPSGEVNVEQSLEAPVIQVSSPSAGSHPPVPLFMPEQESLTSPS # PPPHSPDLPPLFGSVASLSIDLTGDDDDLYETEEAHAGRVTVAREVTESAVGHGVVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g35 ### # start gene g36 3_related_000134F AUGUSTUS gene 21662 22654 0.95 - . g36 3_related_000134F AUGUSTUS transcript 21662 22654 0.95 - . g36.t1 3_related_000134F AUGUSTUS stop_codon 21662 21664 . - 0 transcript_id "g36.t1"; gene_id "g36"; 3_related_000134F AUGUSTUS CDS 21662 22654 0.95 - 0 transcript_id "g36.t1"; gene_id "g36"; 3_related_000134F AUGUSTUS start_codon 22652 22654 . - 0 transcript_id "g36.t1"; gene_id "g36"; # protein sequence = [MLDDQDAADVDQQELRDFLALQQGEAAIAAKHKRDLSPLPVAGPSSKKVRSSASKKRPRRRSPMQETAQESPRRIRLV # VPPGCSMPTSTSTLLPPRASPSLMEVPDADLPVQGHSSLVRLVAVAEAQSGLVPRPVVPPSIKGTGPDLFSSNMPPVPRPTLVPRALATHPYRAENQR # LAARVRLLESQLSDSQWENSSLTSALRDTSHALESRQREVEQLRSSSHEVHEQQVEYRRVLDQFRALDEALPGPPGRVSIPSPSNSFLLVQLSLQSLL # ERFQKLQEDLQDAIRERKVAVEKLSTSTCRNLHLTTSLLYQQGIVDESNALVVNVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g36 ### # start gene g37 3_related_000134F AUGUSTUS gene 23511 24577 0.62 + . g37 3_related_000134F AUGUSTUS transcript 23511 24577 0.62 + . g37.t1 3_related_000134F AUGUSTUS start_codon 23511 23513 . + 0 transcript_id "g37.t1"; gene_id "g37"; 3_related_000134F AUGUSTUS CDS 23511 23526 0.62 + 0 transcript_id "g37.t1"; gene_id "g37"; 3_related_000134F AUGUSTUS CDS 23622 24577 0.98 + 2 transcript_id "g37.t1"; gene_id "g37"; 3_related_000134F AUGUSTUS stop_codon 24575 24577 . + 0 transcript_id "g37.t1"; gene_id "g37"; # protein sequence = [MLKKKTPPARVGRISTPTTSTPAPPLASAEPLAPAVTETTADPDIEIQSIPEEDMSSAQDVRDAITELTKNQAKLQDV # VSELVSGLSTTKSVGKPQNYNGKRGEDARRFLAAFELWANSIPALSTDRKKKITSAITYLEGDAAIWATPISETINRSSITGSGVPFPYDTWEEFVTA # FKTRFETTDASADAKQLLKRLYQNRTTVGTYSSTFQQYADRTGYSDKDLRDRFYDHLADRVKDGLVFTTRPTGSLQELIEAAIDVDNRQITRAWEQGK # KLVDDGILTNFRPTTVATPFTAPTRDPNAMDIDATTTRSPDAFRRFMIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g37 ### # start gene g38 3_related_000134F AUGUSTUS gene 25051 28731 0.99 + . g38 3_related_000134F AUGUSTUS transcript 25051 28731 0.99 + . g38.t1 3_related_000134F AUGUSTUS start_codon 25051 25053 . + 0 transcript_id "g38.t1"; gene_id "g38"; 3_related_000134F AUGUSTUS CDS 25051 28731 0.99 + 0 transcript_id "g38.t1"; gene_id "g38"; 3_related_000134F AUGUSTUS stop_codon 28729 28731 . + 0 transcript_id "g38.t1"; gene_id "g38"; # protein sequence = [MIDSGATGLFLHQKFVNKHHIYVRSLPRPIELYNIDGTANLAGRITHSARLLARVDQNQPQILEFLVTNIGSEDVILG # LPWLRKVNPDINWRDGQIQIPAKPKIQHHVAIEEIPEPKEPNVGGNTEQILEPNRAESNGLPHTVPKTELGPETAETGTSSEDELVFEESGSPLYRLT # GNRKRRRAWLRAGFIQEVTEELWCAAGYTYSQQLAEAANKDKPQKTFEEMVPEPYRRHAKVFSEKESEQLPEHKPWDHAIDLKPDAPETLRTKIYPMS # VNEQKELDRFLEDNLRKGYIRPSKSPLSSPVFFVKKKDGKLRFIQDYRRLNEYTVKNRYPLPLVADIINCLRQAKYFTKFDVRWGYNNVRIKEGHEWK # AAFSTNRGLFEPLVMFFGLTNSPATFQALMNSIFADLIAAGKVAVYLDDILIFSASLQEHRKIVHEVLERLAKNDLYLRPEKCEFEQTSIEYLGLIIS # EGEVRMDPVKVEAVKNWPAPTCLRDVRGFLGFANFYRRFIDGFAKKARALNDLTKKGVGWSWGTNEQVAFEALKEAFTTAPILVLWDPDKPTRIEVDA # SGFATGGALLQQQGDGLWHPVAFRSASMDPAERNYEIYDQEMLAIIEALKDWRHFLEGLPNPFEIVTDHRNLEYWRTAQDLSRRQARWALWLSRFDFT # LTHRAGKANAQADALSRVSQLEVMDADDNQQQIVLRPEHFLRAATAILFQNPLEGRIRKASERESEVLEGLRKLKTHGPHKLVNGLAEWEEKEGIVYY # KGRVYVPPDPQLRRDVVAQCHDALTAGHPGKHRTLELVSRQFWWPTVRSFVDKYVEGCDNCQRRRVRPQPQSSLEPLSVPGGPWQDIGVDLIGELPMT # QDGHNAAITFTDHYSKMIHCFPTTTELTAEGVADFYYKEIFRLHGLPRRFISDRGPQFAADIMKALLKRLGIESALTMSYHPETNGQTERANQEIGRY # IRMYVSRHQDDWDHLLPTAEFVINSRVHFAHDKAPFEVLYGYTPEFSIPIGSWKEYPSITDRLDALCHAREDAEAALRMSKQRITDTIAEHPNQPSFE # VGQPVWLSVNNLKIRRKSEKLGSRRLGPFEVIEKTGAHTYRLALPTWMKIHDNINVKRLAPWKGNEVNGILPAPPEPEVIDGEEFYDVDRILDSRIHG # RWKKLQYLVRWKGYDEGHDTWENEENVVGSSDEAINEFYAAHPNAPRKISATIFHSLPWQPMVNFTEVNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g38 ### # start gene g39 3_related_000134F AUGUSTUS gene 31296 32183 0.85 + . g39 3_related_000134F AUGUSTUS transcript 31296 32183 0.85 + . g39.t1 3_related_000134F AUGUSTUS start_codon 31296 31298 . + 0 transcript_id "g39.t1"; gene_id "g39"; 3_related_000134F AUGUSTUS CDS 31296 32183 0.85 + 0 transcript_id "g39.t1"; gene_id "g39"; 3_related_000134F AUGUSTUS stop_codon 32181 32183 . + 0 transcript_id "g39.t1"; gene_id "g39"; # protein sequence = [MKKNRYPLPLIGTLVDQLRKAKIFTKIDLRVGYNNVRVAQGHEWKTAFQTRYGSFEYLVMPFGLMNAPSAFQFFMNER # FHDMVDICRVIYLDDILIYLDNKASHVEHVRKVLERLRVNHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVMDWPKPRMVKELQVFLGFAN # FYRRFIDNYLGITKVFMKLLQKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLLVILECDASDLAIAGIISQLYPETGEIHPIAFHARSMISANK # LASFLCERERKESNGHSNQPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g39 ### # start gene g40 3_related_000134F AUGUSTUS gene 47039 47923 0.71 + . g40 3_related_000134F AUGUSTUS transcript 47039 47923 0.71 + . g40.t1 3_related_000134F AUGUSTUS start_codon 47039 47041 . + 0 transcript_id "g40.t1"; gene_id "g40"; 3_related_000134F AUGUSTUS CDS 47039 47923 0.71 + 0 transcript_id "g40.t1"; gene_id "g40"; 3_related_000134F AUGUSTUS stop_codon 47921 47923 . + 0 transcript_id "g40.t1"; gene_id "g40"; # protein sequence = [MVRRLATFAHRLYSADPANLLHHHNMYVGGLIEAIITLLSRSLLHPPERIRTVVELALEYLSQGRLTHGELHLRSTSS # LLYYYSNAADGVDGLYQDMLTHSRFSSDTAFLTAAQHAGYVEARPDSLEPPLHCRLFSFDHPIPLPQSPLSDHIPAVPMMDSVMSMWEDMISNYMREV # LGYPASPDRVSSPVNVPGSNDPLPTASPLVASDPHPVLDASEPVSQDAPLFLPGSLSPTSPCPPSPIPSSSRVPHVPREIVNLTMDDAEDLYESQEEF # LARTGGAVTVNQENTESEVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g40 ### # start gene g41 3_related_000134F AUGUSTUS gene 48460 49416 0.82 + . g41 3_related_000134F AUGUSTUS transcript 48460 49416 0.82 + . g41.t1 3_related_000134F AUGUSTUS start_codon 48460 48462 . + 0 transcript_id "g41.t1"; gene_id "g41"; 3_related_000134F AUGUSTUS CDS 48460 49416 0.82 + 0 transcript_id "g41.t1"; gene_id "g41"; 3_related_000134F AUGUSTUS stop_codon 49414 49416 . + 0 transcript_id "g41.t1"; gene_id "g41"; # protein sequence = [MEDRRVLDQFPALDEALPGVLGQVSTLVFPRFPPLFNPSFQSLSERFRKVQEDLQIATRERRVAVEKLIASTRKNSRL # TTTLLHQQGLVDESNALATRQRRLVEELQEEVHRVHGRAVFVEQMLKEYPDEGYYEVVLPPLSQLEGDLNKAHEDLRRVATFAHHLYRCDPATVLHHH # HRYLGAIIEAVVAFLRRGLDSDDLDVIVHNFRLALDYVQAARGVHGDMYMRSISSIQWFFNNAVDEDEGLYHMILEHSRFDSDSLFLTAAHHAGFVPP # PDDSVEPPLHRRMLALSTALVHSEGVGRWEDIVPVRPGSKWVLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g41 ### # start gene g42 3_related_000134F AUGUSTUS gene 50638 53245 0.63 + . g42 3_related_000134F AUGUSTUS transcript 50638 53245 0.63 + . g42.t1 3_related_000134F AUGUSTUS start_codon 50638 50640 . + 0 transcript_id "g42.t1"; gene_id "g42"; 3_related_000134F AUGUSTUS CDS 50638 51950 0.63 + 0 transcript_id "g42.t1"; gene_id "g42"; 3_related_000134F AUGUSTUS CDS 52114 53245 0.69 + 1 transcript_id "g42.t1"; gene_id "g42"; 3_related_000134F AUGUSTUS stop_codon 53243 53245 . + 0 transcript_id "g42.t1"; gene_id "g42"; # protein sequence = [MSAPLRRSSSRTRSPQLPILTTIGEVPSPDLESDGEAEQDQLAFTIEFPSRPQLQLFETVFNTGKPLSGYCQDDPLWP # LLAEVASPCSNCSKSPAKCKVLPNSPRCTNCSVKKTCSLGKILRYRYFARRCNQDLAYSRRFLELHGTPAHQSTWGIPMVTWRQYDAALHERTSSTST # LLELNMLDDQDAADVDQQELRDFLALQQEEAAVAAKRKRDLSPLPVAGPSSKKVRSNASKKCPRRRSPVQETAEESPRRVRLVVPPVRSLPVTTSTPL # PPRAFPSSMEVPDADLSVQGHSNLVRLAAVAGAQSGLVQQPAVSSSIKGTGQDLLSSNMPPVPRPTLVPRALATHPYRAENQRLAARVRLLESQLSDS # QRENSSLTSALRDTSHALESRQREVEQLRSSSREVREQQVEYRRVLDQFRALDEALPGPPDRVRILLLYQQGVVDESNALATRQRRLVEELQEEVHRA # RGRAAFVEQMIKEYPDEGYYEVVLPPLSQLEGDLHKAREDLRRVATFAHRLYRSEPATVLHHHYRYLGAIIEAVVAFLRRGLDSDDLDTVVHNFQLGL # DYMQAARGVHGDMYMRSLSSIQWFFNNAVDEDEGLYRMVLEHSRFDNDGPFLTAAQHAGFAPPPDSSLEPPLHRRMFALSTALPHSDGAGRWDDIVPA # LPSIDQLTADWEQLMLQYIHHITDTPLPVPDPPVPMSSMGPVPESSGEANVEQSLEAPIVQVSSPSAGSHPPVPLFLSEQESPTSPSPPPCSPVPPLL # FGSVASLSIDLTGDDDELYETEESYAGRIAVAREGTELAVGQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g42 ### # start gene g43 3_related_000134F AUGUSTUS gene 53485 57723 0.83 - . g43 3_related_000134F AUGUSTUS transcript 53485 57723 0.83 - . g43.t1 3_related_000134F AUGUSTUS stop_codon 53485 53487 . - 0 transcript_id "g43.t1"; gene_id "g43"; 3_related_000134F AUGUSTUS CDS 53485 57723 0.83 - 0 transcript_id "g43.t1"; gene_id "g43"; 3_related_000134F AUGUSTUS start_codon 57721 57723 . - 0 transcript_id "g43.t1"; gene_id "g43"; # protein sequence = [MRHPENLVDLTDSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRTHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNSEEIHAGTLQSPPEAPQRPPEAPQPPPEASQQPPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAIERVTPKPTKDSEEAYQKWKSRGTERSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASDSSA # TEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKE # YIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGS # FEYLVMPFGLTNAPSVFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEESHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEK # VKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILS # QLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLG # AKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALKRIARNEEESFVWEDELIKRGGRIYVPDVGTLR # REVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPATAGPEKYDAILVV # VCRLTKQAIYVPCHTTDKAEDFANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQD # DWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQEAEVNEYASNLKELHAYLQERIEVANKVYAKYANQKRQEAPDWKEGDQVWLNME # NVRTRRPMKKLDHKWTGPYTVLSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGKTEHFVEDILDSKPKKGRPEEVEYLV # KWEGYNDEFNSWVGWEGMVGSIELLRSWHKHHPRKRQPSRLQWASLEREAREDEEEGSGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g43 ### # start gene g44 3_related_000134F AUGUSTUS gene 58932 60335 0.42 - . g44 3_related_000134F AUGUSTUS transcript 58932 60335 0.42 - . g44.t1 3_related_000134F AUGUSTUS stop_codon 58932 58934 . - 0 transcript_id "g44.t1"; gene_id "g44"; 3_related_000134F AUGUSTUS CDS 58932 60335 0.42 - 0 transcript_id "g44.t1"; gene_id "g44"; 3_related_000134F AUGUSTUS start_codon 60333 60335 . - 0 transcript_id "g44.t1"; gene_id "g44"; # protein sequence = [MDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAPFG # TPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTEGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQAT # EPISFNRNTPTGARGGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGEGKGGFNPPTRVPPPHFSSQSRDRERPPSQGG # QGQREQGGRSGGGAPPPPPPPPPPSGGLGDSNLEGSDEGEQNQSSRNGGRREEDRGELPTGAPEVPPTRYDPDQPWYYDPRQGWHCKAAPRPPNEGRS # TWESNEEKNRITIESKLDVGKTESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g44 ### # # ----- prediction on sequence number 5 (length = 68261, name = 3_related_000136F) ----- # # Predicted genes for sequence number 5 on both strands # start gene g45 3_related_000136F AUGUSTUS gene 2535 3366 0.56 - . g45 3_related_000136F AUGUSTUS transcript 2535 3366 0.56 - . g45.t1 3_related_000136F AUGUSTUS stop_codon 2535 2537 . - 0 transcript_id "g45.t1"; gene_id "g45"; 3_related_000136F AUGUSTUS CDS 2535 2806 0.89 - 2 transcript_id "g45.t1"; gene_id "g45"; 3_related_000136F AUGUSTUS CDS 2901 3366 0.57 - 0 transcript_id "g45.t1"; gene_id "g45"; 3_related_000136F AUGUSTUS start_codon 3364 3366 . - 0 transcript_id "g45.t1"; gene_id "g45"; # protein sequence = [MQGLRTGAGARHGLVKEMDPDAVNRGDGRSLAADDSVRVSKLFVLFVFIWSPRATKKASYRPCTDMFEQADSRMPLSY # AREHTNPGEPQVYEVLFFSIGRVSVQSSHLFNYIRSQHTVVNEGFQDEMDDDDADSWTGNPNRRLWKSACSRAALNVSPAPQTSLILKSACRTWEDHL # WAQISIMCEEKQTMEMSRLGGSFWEGGMSAVEKGARSVSRETMEEEEEEWEEEVRSALNGLKSVHVEEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g45 ### # start gene g46 3_related_000136F AUGUSTUS gene 5335 7549 0.21 + . g46 3_related_000136F AUGUSTUS transcript 5335 7549 0.21 + . g46.t1 3_related_000136F AUGUSTUS start_codon 5335 5337 . + 0 transcript_id "g46.t1"; gene_id "g46"; 3_related_000136F AUGUSTUS CDS 5335 5919 0.85 + 0 transcript_id "g46.t1"; gene_id "g46"; 3_related_000136F AUGUSTUS CDS 6019 6052 0.81 + 0 transcript_id "g46.t1"; gene_id "g46"; 3_related_000136F AUGUSTUS CDS 6202 6354 0.23 + 2 transcript_id "g46.t1"; gene_id "g46"; 3_related_000136F AUGUSTUS CDS 6752 6783 0.43 + 2 transcript_id "g46.t1"; gene_id "g46"; 3_related_000136F AUGUSTUS CDS 6878 7549 0.72 + 0 transcript_id "g46.t1"; gene_id "g46"; 3_related_000136F AUGUSTUS stop_codon 7547 7549 . + 0 transcript_id "g46.t1"; gene_id "g46"; # protein sequence = [MKSRVFVLERLSDANIEEIIKRAVIRLSPPSLQTSEIVKSEPSPDDSFDFSSSPCPPTPVSSQIPQPSSPPSSTSIPN # GMIPKSPNPTPLFPAYPHFTAAVLASITSLSSGDARAALSLLDMVLSAPKTTAEEKLIENLRRSVSASYDRSGDSRYDMISALHKSVRGSDVDAAMYW # LARMLSAGEDPLYIARRMVGTGYGSTTSLSEAYNRAEAAAKSDLTLPVPLIARNAATSLMKDLGYAEGYKYNPDYVHPVHNANGGGEEGVFNPFQNHT # AENPSWLAVKPLHNVVIPLDSDPVVIDGQVVMRTPTTSSKHWLVKISALEIPVEYEAVMDTVPKLHLRPPVLPDEVKDDFYPLPPDKGYDFIFHVGVA # GRGPLRMEKLGHKLGYYMKDAAGKLAPIVKGPPSEFGRRGIEDTDVSVGEQPLQVGERLGLGFEMENAGDSYSARPSRGFGVGYEKFSDGQSFPDNLI # PSSSTSLHRNLHGHRCFKASL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g46 ### # start gene g47 3_related_000136F AUGUSTUS gene 9494 9904 0.99 + . g47 3_related_000136F AUGUSTUS transcript 9494 9904 0.99 + . g47.t1 3_related_000136F AUGUSTUS start_codon 9494 9496 . + 0 transcript_id "g47.t1"; gene_id "g47"; 3_related_000136F AUGUSTUS CDS 9494 9904 0.99 + 0 transcript_id "g47.t1"; gene_id "g47"; 3_related_000136F AUGUSTUS stop_codon 9902 9904 . + 0 transcript_id "g47.t1"; gene_id "g47"; # protein sequence = [MSRFFRQAGDSDSDSDESEELMSSGDEAPQAKPTTGAKTAMSRFLRKTGPGADSDSSSDSDSDSDEDSDSDSDVPKPK # KGLPLRSDSEDSETEEEEDRQGIRIMSAQEKRLAEMEGTGKAMENALKINDWVSISNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g47 ### # start gene g48 3_related_000136F AUGUSTUS gene 10658 11074 0.86 + . g48 3_related_000136F AUGUSTUS transcript 10658 11074 0.86 + . g48.t1 3_related_000136F AUGUSTUS start_codon 10658 10660 . + 0 transcript_id "g48.t1"; gene_id "g48"; 3_related_000136F AUGUSTUS CDS 10658 11074 0.86 + 0 transcript_id "g48.t1"; gene_id "g48"; 3_related_000136F AUGUSTUS stop_codon 11072 11074 . + 0 transcript_id "g48.t1"; gene_id "g48"; # protein sequence = [MPTELWISAQNEVDQLVAIVASNPAFIVQEITEDYDDLLERSPATEKSGIVRIRGSIISFIDRLDDEFTRSLQNIDPH # GTEYVDRLKDEKTLYSTICRAQAFYEQTKQDDPLSRVIMRRLEHIYSKVEIVFLETLAFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g48 ### # start gene g49 3_related_000136F AUGUSTUS gene 11311 11877 0.62 + . g49 3_related_000136F AUGUSTUS transcript 11311 11877 0.62 + . g49.t1 3_related_000136F AUGUSTUS start_codon 11311 11313 . + 0 transcript_id "g49.t1"; gene_id "g49"; 3_related_000136F AUGUSTUS CDS 11311 11877 0.62 + 0 transcript_id "g49.t1"; gene_id "g49"; 3_related_000136F AUGUSTUS stop_codon 11875 11877 . + 0 transcript_id "g49.t1"; gene_id "g49"; # protein sequence = [MSHLQESIHSADVATQILYNRTVVQLGLCAFRSGLIKEAQATLQDIFTTQRVKELLAQGVHQQRYQVLTPEQEKAEKQ # RQLPFHMHINTELLEAAFLVSSMLVEIPLLASIDSEELKRKAISKPFRRLLDFADRQVFTGPPESTRDHIMQASKALQDGEWEKCRDLVQSIKIWSLM # PEAASVKEMLAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g49 ### # start gene g50 3_related_000136F AUGUSTUS gene 16329 18486 0.23 - . g50 3_related_000136F AUGUSTUS transcript 16329 18486 0.23 - . g50.t1 3_related_000136F AUGUSTUS stop_codon 16329 16331 . - 0 transcript_id "g50.t1"; gene_id "g50"; 3_related_000136F AUGUSTUS CDS 16329 18072 0.31 - 1 transcript_id "g50.t1"; gene_id "g50"; 3_related_000136F AUGUSTUS CDS 18194 18486 0.23 - 0 transcript_id "g50.t1"; gene_id "g50"; 3_related_000136F AUGUSTUS start_codon 18484 18486 . - 0 transcript_id "g50.t1"; gene_id "g50"; # protein sequence = [MQIPISEGARDDDNAVEDTDVGYDMVLVNSCSFSALLMLIKRCMKEAFPSVSTSLIAARIVSEIHLLETDYDNAIQIV # ESGLRTLAKFEQDNGKILSKALQLVDEILLVSPENIAAIMGKGYILEASHEWEKAAEKFAKVFELLSTEHDEGLRAQEEYAWCISRNGDVQGGIDSLQ # NVLHILNGLEGRDHDRARCHWRLGKCLWNLDSKHCIVLCLVWYLLSSGEKIIEGFQNFIAALKCDPNYAPAFTCLGIYYSEHLSPSDPARASKCFQKA # FELDSREADAAHRLAKGFADEQEWDLVEVVARRTIEGEGGLDGGLQKIEENVAGKYLPTNAWAWKALGVVSLVRRLFISYHASNIAEQMNRSYVPAIN # ALQVALRAEPEDSFTWLRLGEAYLKSGRHSAALKALQRSQELHDENDWLCSYFVAEVYRQTGQYEDAINQLEMVLSSKPTEFSVLTALAQTHLDFGRA # KSSDGFVARAERALVESIRISLKAIAKSTGFRTVIWKTVADALYFLSTKDAFCDLDVVHSVLVDVKSVLGSPSNRIADIIAYRSQDDLHLDSNGILEV # AIAAYDHRIELGSPESVAVGSAWFDYSISLRSLAQRIPDGDRKTKVTDQLSKALIEAIRIAPTNDTYWVALGDFHFSQQPKTAQHAYIKAIEIDSKVR # TQCCYNLAFIVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g50 ### # start gene g51 3_related_000136F AUGUSTUS gene 20810 22242 0.44 - . g51 3_related_000136F AUGUSTUS transcript 20810 22242 0.44 - . g51.t1 3_related_000136F AUGUSTUS stop_codon 20810 20812 . - 0 transcript_id "g51.t1"; gene_id "g51"; 3_related_000136F AUGUSTUS CDS 20810 21620 0.65 - 1 transcript_id "g51.t1"; gene_id "g51"; 3_related_000136F AUGUSTUS CDS 21673 22055 0.65 - 0 transcript_id "g51.t1"; gene_id "g51"; 3_related_000136F AUGUSTUS CDS 22108 22242 0.5 - 0 transcript_id "g51.t1"; gene_id "g51"; 3_related_000136F AUGUSTUS start_codon 22240 22242 . - 0 transcript_id "g51.t1"; gene_id "g51"; # protein sequence = [MLIHDSQSLPKPHEYIDISKKTENLVTASTSYACTSSVEDIARSRIAQLASQHNVSEYSCLKYGPNGYPGKYVPLSVQ # APQTFQELRARQTQWSNAKAWWFSDKATEATSIVLGPSGASGVTSDSLSDGLAQQLSAAIDEQLPQPVNEGKLSRSSSNGAHSHTIKTSSSHPINISA # IIPVEILALLSSHVMFTSNGPFTESPRDFPSLDTQPTVFEVPSPFTLDRFILSFTGHPQTQFSQSHQSSIPPPSTSTEIHPDAHLRTRSHVTEALHAA # LNSGIKSGSITPIEDTGATFHSNGSSVSLSISLKSVPTSQGVSRTMSDTEQTNLEFGTNVDIPSEATSETGPPTNEELQAEAQLPSVDSIPTLPYSTD # TPSFILGNMFMSSCPGKKGMDSFTENKSRLFILFVSVRLKGPVKGRSGVCRDLYADLQRMKDLAVGCVVW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g51 ### # start gene g52 3_related_000136F AUGUSTUS gene 26088 26444 0.47 - . g52 3_related_000136F AUGUSTUS transcript 26088 26444 0.47 - . g52.t1 3_related_000136F AUGUSTUS stop_codon 26088 26090 . - 0 transcript_id "g52.t1"; gene_id "g52"; 3_related_000136F AUGUSTUS CDS 26088 26444 0.47 - 0 transcript_id "g52.t1"; gene_id "g52"; 3_related_000136F AUGUSTUS start_codon 26442 26444 . - 0 transcript_id "g52.t1"; gene_id "g52"; # protein sequence = [MQQRSKKCLSVLLVGRSVVFNLPILESRSQPTSAMVNNLDTVAAVTNMLAFETVSLAPTDNYGFKAISAGAILNSRSK # THPYCDADQDVASNSSEKNLMPLWDNRLFAIEFESLTLWM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g52 ### # start gene g53 3_related_000136F AUGUSTUS gene 27627 28681 0.59 - . g53 3_related_000136F AUGUSTUS transcript 27627 28681 0.59 - . g53.t1 3_related_000136F AUGUSTUS stop_codon 27627 27629 . - 0 transcript_id "g53.t1"; gene_id "g53"; 3_related_000136F AUGUSTUS CDS 27627 28157 0.98 - 0 transcript_id "g53.t1"; gene_id "g53"; 3_related_000136F AUGUSTUS CDS 28673 28681 0.61 - 0 transcript_id "g53.t1"; gene_id "g53"; 3_related_000136F AUGUSTUS start_codon 28679 28681 . - 0 transcript_id "g53.t1"; gene_id "g53"; # protein sequence = [MELRREERRRREFERAHPAGYVPGEDDLLSARDVRSQYDGSDAYSITSSEDDHWGMQIGGYNENSTQYPPPPAGLMPK # DRVMESAKTVDASELEAMLESGFDERDRPPTAPAYTPRFQLSDNGSATQLATGNNGYAPLTRSTSPTNTPTSPSFGASRAGSGGARQHYGPLGPLDPA # TRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g53 ### # start gene g54 3_related_000136F AUGUSTUS gene 29498 31162 0.98 - . g54 3_related_000136F AUGUSTUS transcript 29498 31162 0.98 - . g54.t1 3_related_000136F AUGUSTUS stop_codon 29498 29500 . - 0 transcript_id "g54.t1"; gene_id "g54"; 3_related_000136F AUGUSTUS CDS 29498 31162 0.98 - 0 transcript_id "g54.t1"; gene_id "g54"; 3_related_000136F AUGUSTUS start_codon 31160 31162 . - 0 transcript_id "g54.t1"; gene_id "g54"; # protein sequence = [MALRFQSNVDFTDVPIPTTTRPNVPSSGVTIRRAKTLTRPERSVAPVPLINSHPAIVSDSSYNGSQVWRITSRVLTCW # APDFLLSSLGGLKDKNVRQAWREKMTLCLIILVMCGLIGFATVGTQRVLCPQNASSQTQFLRLNSTPGTLGVLGHVYNVSSAKSSTVNLLGLSEASSG # QDITQYFNRDASDFGECSGLSFRVALDAPCSTTNPCTLGNINSSSTFTSLGMQDTGAIVGYSWEQVTTLQNYFVIDGAVLNLTTYMNLHPTSVPTDNV # DAALRTLLQGSTSVRGRDGTRLFYSRSDLESAVPCLKQRYYAGNIDKVTPGCFASQLILYAGLIVILGLVLIRFLMACIFSWFLSGRLAGAPDSDTLN # RNAISPAVMPEGANVSIDNKNGTAPWAAPGGGAKKLNKKDYNKSDRSFGSSTTLTNSTSDSSVAPVMSLASIGAELFAICLVTCYSEGEDSLRTTLDS # ISRTTYSDSRKLLFVVADGMITGAGEKKSTPDICVGLLEADPRFGNPIPMMYEAVGSGDKGINRAMVYAGHYSEFQSPSGKCAY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g54 ### # start gene g55 3_related_000136F AUGUSTUS gene 31783 33063 0.53 - . g55 3_related_000136F AUGUSTUS transcript 31783 33063 0.53 - . g55.t1 3_related_000136F AUGUSTUS stop_codon 31783 31785 . - 0 transcript_id "g55.t1"; gene_id "g55"; 3_related_000136F AUGUSTUS CDS 31783 33063 0.53 - 0 transcript_id "g55.t1"; gene_id "g55"; 3_related_000136F AUGUSTUS start_codon 33061 33063 . - 0 transcript_id "g55.t1"; gene_id "g55"; # protein sequence = [MHYSRVSTPPSLAYSPASAVLLNELLKGSISFVIALSRTREMADISWRRMSLWEIMRSLPYPGSTPFWTLCGEIFSPD # CWKLSIPAILYVVQNSLQFVAISNLPVASFQVTYQMKILTTAAFSVALLRRKLSTTKWLSLFFLAIGVGIVQIQTSSVSAPKNQSVGSAHDSAPLHIH # VMSPLKGFGAVTAACFTSGLAGVYFEMVLKNSKADLWVRNVQLSLFSLIPALLPILYSSTPPSVGFFEGLFRNFGIWAWATVAIQVFGGLVTAIVIKY # SDNILKGFATSLSIVLSFLASVMLFDFRITPSFVIGASTVLCATWMYNQPPGKDPLVSIALTGQSENNMPFTPVDAKEPIIGEFPRKKSSTFGSPRGI # ATALGLSAPENREPSNMLDTQRYNHAPYGSPFPSRPPSRAPSRTPTPQPPPASS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g55 ### # start gene g56 3_related_000136F AUGUSTUS gene 35330 35827 0.71 - . g56 3_related_000136F AUGUSTUS transcript 35330 35827 0.71 - . g56.t1 3_related_000136F AUGUSTUS stop_codon 35330 35332 . - 0 transcript_id "g56.t1"; gene_id "g56"; 3_related_000136F AUGUSTUS CDS 35330 35827 0.71 - 0 transcript_id "g56.t1"; gene_id "g56"; 3_related_000136F AUGUSTUS start_codon 35825 35827 . - 0 transcript_id "g56.t1"; gene_id "g56"; # protein sequence = [MVRARDIVFDHHLNCPTVERIERKYREQRAEQRKAAEERQAVEDGKVKSLMSKPPTRVSTPTPVPGTPLPGAFHEMPQ # NTDIPIEHNPVPPSLGDKGLNSMGRPNTMLNPFHKFSRKLGFRGTEDSLDSSPGPSVPRNPIQGATPLGNISKLVGCMFRSTLMLFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g56 ### # start gene g57 3_related_000136F AUGUSTUS gene 35996 36699 0.84 - . g57 3_related_000136F AUGUSTUS transcript 35996 36699 0.84 - . g57.t1 3_related_000136F AUGUSTUS stop_codon 35996 35998 . - 0 transcript_id "g57.t1"; gene_id "g57"; 3_related_000136F AUGUSTUS CDS 35996 36339 0.87 - 2 transcript_id "g57.t1"; gene_id "g57"; 3_related_000136F AUGUSTUS CDS 36417 36699 0.84 - 0 transcript_id "g57.t1"; gene_id "g57"; 3_related_000136F AUGUSTUS start_codon 36697 36699 . - 0 transcript_id "g57.t1"; gene_id "g57"; # protein sequence = [MLCSFLDEIRNIAVNSRLLSNGTLARLKKAPVLLALQRRVSVEETSKKVVDGDEDWETQYDLKRPDQIVIADDSNSLQ # LFGDKLFVAPQEDILEGSKRLSALVQENYEVTNEINNSPQAAKLQAHILERLPLFLHEHTHARTKTSFTWLSSSNNFIVRSFGKISVVKSLKFGSVNL # SKRQAASVVGPKSSRGPLQIWLANDVETDMYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g57 ### # start gene g58 3_related_000136F AUGUSTUS gene 38012 39133 0.8 - . g58 3_related_000136F AUGUSTUS transcript 38012 39133 0.8 - . g58.t1 3_related_000136F AUGUSTUS stop_codon 38012 38014 . - 0 transcript_id "g58.t1"; gene_id "g58"; 3_related_000136F AUGUSTUS CDS 38012 39133 0.8 - 0 transcript_id "g58.t1"; gene_id "g58"; 3_related_000136F AUGUSTUS start_codon 39131 39133 . - 0 transcript_id "g58.t1"; gene_id "g58"; # protein sequence = [MYLVWNKELLSIGGTVSRAVYELEMDNIKHISDSAGPAKSLELQTWLMDRAVHVLKFFTFHQSTPSADVSSLMEQAFF # ACSTGFRIISTNGIQDVADIRLPDAQFSSFLKDLPVLPEQLLTAARPMVTALQNRKLVKAITFSDVLKELRNRPLTEDESVACLTWWISLNKDGESAA # RLQSIQKQLLDAAVFTTGATGSKEERIIPLNTIQTILNPRNMAGNIPPDAPFPPTMLPPSFSKSFKPDQLTFAFHWTELTLVEWLRFITTSGPSPEYD # LSVSDHWSERVLGILARAWPSLSSHMKDEIVQVLKSSACIPTSHGSKIPEETYFANADIFHDLPVVKLPSGSAVKGNLERVLIALGVRKHVELQIIFT # R] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g58 ### # start gene g59 3_related_000136F AUGUSTUS gene 39608 40003 0.8 - . g59 3_related_000136F AUGUSTUS transcript 39608 40003 0.8 - . g59.t1 3_related_000136F AUGUSTUS stop_codon 39608 39610 . - 0 transcript_id "g59.t1"; gene_id "g59"; 3_related_000136F AUGUSTUS CDS 39608 40003 0.8 - 0 transcript_id "g59.t1"; gene_id "g59"; 3_related_000136F AUGUSTUS start_codon 40001 40003 . - 0 transcript_id "g59.t1"; gene_id "g59"; # protein sequence = [MRWVYTSGSEKAPAPSAIKPVKPPAPGGFFASLFSGLTSTSTTPHPPVTTVETPKPIDPLKTDTTSVSLTVFSADADI # KVDQKLAAELHRSTKKSVPKKIKYELIYVSQAKLNYTHFHRVEVPTCAIDRDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g59 ### # start gene g60 3_related_000136F AUGUSTUS gene 41530 42354 0.64 - . g60 3_related_000136F AUGUSTUS transcript 41530 42354 0.64 - . g60.t1 3_related_000136F AUGUSTUS stop_codon 41530 41532 . - 0 transcript_id "g60.t1"; gene_id "g60"; 3_related_000136F AUGUSTUS CDS 41530 42354 0.64 - 0 transcript_id "g60.t1"; gene_id "g60"; 3_related_000136F AUGUSTUS start_codon 42352 42354 . - 0 transcript_id "g60.t1"; gene_id "g60"; # protein sequence = [MSPASSEIRGPVHLLSMSSTATPPTASTSSSPKSSFATAKSLFTPSKRSMGPPLPLYHPFGKLAMSLPPLDPTAFGLP # VPINIDDESTRSSSHSKRSGVKLRDAAVETDPVPPVASVGTVAAIAAREVKEKASPRKKRAGGGGKRKRNSGDDGDATYPAKRTRQPRGVAPSAVDDE # PESLDASANGGLPMDVVSSTPGTPADVIDKPERRTTRSRGAITRRDSTASETPSASASSVKPGKDALSDTHDVTGDEREKRRSTSKEEGEVSEESKST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g60 ### # start gene g61 3_related_000136F AUGUSTUS gene 49447 50479 0.76 + . g61 3_related_000136F AUGUSTUS transcript 49447 50479 0.76 + . g61.t1 3_related_000136F AUGUSTUS start_codon 49447 49449 . + 0 transcript_id "g61.t1"; gene_id "g61"; 3_related_000136F AUGUSTUS CDS 49447 49716 0.76 + 0 transcript_id "g61.t1"; gene_id "g61"; 3_related_000136F AUGUSTUS CDS 49769 50479 0.94 + 0 transcript_id "g61.t1"; gene_id "g61"; 3_related_000136F AUGUSTUS stop_codon 50477 50479 . + 0 transcript_id "g61.t1"; gene_id "g61"; # protein sequence = [MSSNQPSQVGIELSSLGFSSYIDGQLIAPVSSSGAVTLNPESTSNLALVGRLIPQTSSEGLAAVSQVFNNFIHGLDSE # LMVNGASAGPSDVSWLNEAISALQVETSLPNLGVLNIIQSIDLNELDLQFSEDTAYAPATSSNSTTAAFTIPFDFPIDIVALQQDINVAAEGQVFAQL # FIPKGPSQTDVNARIISLAFGDVPFTVVDGADSVFNEFLAATTVGTSVTMGLSGFASADASTAVGTLSLTNISFSVDTTIAGLQGLDTEPVTINHLDV # FHGFPDYLLIKVSSPLTNPSNLTIGKVTCFSHSLNFHALLGAGDVSFGLEFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g61 ### # start gene g62 3_related_000136F AUGUSTUS gene 50862 51365 0.9 + . g62 3_related_000136F AUGUSTUS transcript 50862 51365 0.9 + . g62.t1 3_related_000136F AUGUSTUS start_codon 50862 50864 . + 0 transcript_id "g62.t1"; gene_id "g62"; 3_related_000136F AUGUSTUS CDS 50862 51365 0.9 + 0 transcript_id "g62.t1"; gene_id "g62"; 3_related_000136F AUGUSTUS stop_codon 51363 51365 . + 0 transcript_id "g62.t1"; gene_id "g62"; # protein sequence = [MSKISLSPVTIPALNQSLISSASLTFPTDIVSTGIAEATFSLANPFTASINLLTVDASATYQNITLGTISVGETSNPI # HADGHSNITSPSLPFNFNLNPVSIVELLQAGAQANGVNLGPLIDIFEFIIDNPNFNPPVRKHIESQLFTASHISTSGKLYCRYQFPDLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g62 ### # start gene g63 3_related_000136F AUGUSTUS gene 52499 53488 0.34 + . g63 3_related_000136F AUGUSTUS transcript 52499 53488 0.34 + . g63.t1 3_related_000136F AUGUSTUS start_codon 52499 52501 . + 0 transcript_id "g63.t1"; gene_id "g63"; 3_related_000136F AUGUSTUS CDS 52499 52856 0.66 + 0 transcript_id "g63.t1"; gene_id "g63"; 3_related_000136F AUGUSTUS CDS 53003 53157 0.45 + 2 transcript_id "g63.t1"; gene_id "g63"; 3_related_000136F AUGUSTUS CDS 53219 53488 0.96 + 0 transcript_id "g63.t1"; gene_id "g63"; 3_related_000136F AUGUSTUS stop_codon 53486 53488 . + 0 transcript_id "g63.t1"; gene_id "g63"; # protein sequence = [MVIKSSDNFLSFAELGLDLGTVTFDSFYDNVLVGRELLSRLLVVWALISLSALVGEDLVLSADATTTTHLSGRIIPQS # GSDLNTIGQLFSDYLAGDNLTLVAKGVSVQPPGSSSTVSWLTVTLNDDSEAYDPSTGSNFTSASYKNPFGFSLQVVQSATDIILSSNGVNIAELKLPT # SDTVGGVSTGNVANLPIAWENEPLKSLNDDAFNALFAAVTLSNSISLGLDGSANVTAKTTIGDVPISRIPFNVTSSLSGKIISE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g63 ### # start gene g64 3_related_000136F AUGUSTUS gene 53741 54944 0.35 + . g64 3_related_000136F AUGUSTUS transcript 53741 54944 0.35 + . g64.t1 3_related_000136F AUGUSTUS start_codon 53741 53743 . + 0 transcript_id "g64.t1"; gene_id "g64"; 3_related_000136F AUGUSTUS CDS 53741 53743 0.64 + 0 transcript_id "g64.t1"; gene_id "g64"; 3_related_000136F AUGUSTUS CDS 53818 53901 0.69 + 0 transcript_id "g64.t1"; gene_id "g64"; 3_related_000136F AUGUSTUS CDS 54288 54944 0.66 + 0 transcript_id "g64.t1"; gene_id "g64"; 3_related_000136F AUGUSTUS stop_codon 54942 54944 . + 0 transcript_id "g64.t1"; gene_id "g64"; # protein sequence = [MNLNLVPGTNSVPSEFHYEPANSNDSVAQIFNPTDAELQVLAIQSTGSIDGTVYAQFSTTFDSYLIPAGQTVNSGEIN # NVLLTQGAIASLGIIGENLDVAAANTIQVGVGGYTLPWLKINQLDVPTTYTLDIAGLTLGQLKSQAEQNASSISSSAVGSKPTSASTSQNGSTSVSAT # VSLSSLASSTITSSTTGDGTTAEAISSASSAGKEDSSTATSATANTPLMPASSASSDAAPTSATLVATLLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g64 ### # start gene g65 3_related_000136F AUGUSTUS gene 64384 65040 1 - . g65 3_related_000136F AUGUSTUS transcript 64384 65040 1 - . g65.t1 3_related_000136F AUGUSTUS stop_codon 64384 64386 . - 0 transcript_id "g65.t1"; gene_id "g65"; 3_related_000136F AUGUSTUS CDS 64384 65040 1 - 0 transcript_id "g65.t1"; gene_id "g65"; 3_related_000136F AUGUSTUS start_codon 65038 65040 . - 0 transcript_id "g65.t1"; gene_id "g65"; # protein sequence = [MSNLTPAPTTTTSNIHGKSLLREPSIFDGDKAQFKEWRCTLFAYIHDPRNRIVTDSERINIAVSYMQGPKVSSWVQNY # TDDNFNDDEEEWKVTWKGFKDTLNASFLDKGLTGNAQEKLEHLRQGPNERAENFFKEFEVIMRDAGYAKDAPYIIRLIEMNAKPKLIDQAYGTSNERI # EKFDELKQKIISIDDMWWHREEMQQNWSSRYQWNAGQGPSSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g65 ### # # ----- prediction on sequence number 6 (length = 30726, name = 3_related_000171F) ----- # # Predicted genes for sequence number 6 on both strands # start gene g66 3_related_000171F AUGUSTUS gene 339 1304 0.49 - . g66 3_related_000171F AUGUSTUS transcript 339 1304 0.49 - . g66.t1 3_related_000171F AUGUSTUS stop_codon 339 341 . - 0 transcript_id "g66.t1"; gene_id "g66"; 3_related_000171F AUGUSTUS CDS 339 998 0.92 - 0 transcript_id "g66.t1"; gene_id "g66"; 3_related_000171F AUGUSTUS CDS 1119 1304 0.51 - 0 transcript_id "g66.t1"; gene_id "g66"; 3_related_000171F AUGUSTUS start_codon 1302 1304 . - 0 transcript_id "g66.t1"; gene_id "g66"; # protein sequence = [MKARKAAAAAKRKAEEEAARKAAEEARRQKEAEARELEERRRRMAEAATARSRRGSSPGGSSPVGGDPDDGGDGDDDD # EDGGDGDDDDEDGGDRDDDDEDDDDRAPCERCRSKKISCQMQAGKRSSVICKPCHDAKVRCSYSGRPSTVKREGGNPYGERLAVLESQVAQLLADNRQ # LRDGQVKANTYHRHMNRKLDWLVTEASRRRRTPPELPEAGPSGLPKKRRRLADSDEEEEQRRVVQEVGEEEDGEGEEEMEEREEEERDEPAPRKARTE # KGKEREE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g66 ### # start gene g67 3_related_000171F AUGUSTUS gene 4356 5180 0.53 - . g67 3_related_000171F AUGUSTUS transcript 4356 5180 0.53 - . g67.t1 3_related_000171F AUGUSTUS stop_codon 4356 4358 . - 0 transcript_id "g67.t1"; gene_id "g67"; 3_related_000171F AUGUSTUS CDS 4356 5180 0.53 - 0 transcript_id "g67.t1"; gene_id "g67"; 3_related_000171F AUGUSTUS start_codon 5178 5180 . - 0 transcript_id "g67.t1"; gene_id "g67"; # protein sequence = [MSATLSNNTSYSMSAYINAFVGANTLTGSFTSSLKFISKLRSSFVTDNNLHIVCLSPPKTFTFKLVTSSISIVSSFTS # LVNKPMLVNVTDFSFGSRRCTFRKWIGPTYFSTDCEKGRISVSPFVNANSDPSRCNSVMPSNFAKRANSVCRSYLLTNVFGLQTTVACQHEAFVHDSQ # PTPSSSPSSCHVMHSVWRAWHARIIVPTFGGPSQVVSSKRRCWIPLLSKTISFTVFTINTRSTDSVRSFAMFAIAVKRSPRIAVSMMDTSFTLDIHLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g67 ### # start gene g68 3_related_000171F AUGUSTUS gene 7978 11058 0.92 - . g68 3_related_000171F AUGUSTUS transcript 7978 11058 0.92 - . g68.t1 3_related_000171F AUGUSTUS stop_codon 7978 7980 . - 0 transcript_id "g68.t1"; gene_id "g68"; 3_related_000171F AUGUSTUS CDS 7978 11058 0.92 - 0 transcript_id "g68.t1"; gene_id "g68"; 3_related_000171F AUGUSTUS start_codon 11056 11058 . - 0 transcript_id "g68.t1"; gene_id "g68"; # protein sequence = [MEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYP # LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDE # WKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDNILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYIL # SPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETD # ASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNM # VIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLELAKDPS # NERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRP # WDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEA # DGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRY # KEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDG # EEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g68 ### # start gene g69 3_related_000171F AUGUSTUS gene 12648 14164 0.27 + . g69 3_related_000171F AUGUSTUS transcript 12648 14164 0.27 + . g69.t1 3_related_000171F AUGUSTUS start_codon 12648 12650 . + 0 transcript_id "g69.t1"; gene_id "g69"; 3_related_000171F AUGUSTUS CDS 12648 12833 0.47 + 0 transcript_id "g69.t1"; gene_id "g69"; 3_related_000171F AUGUSTUS CDS 13094 14164 0.28 + 0 transcript_id "g69.t1"; gene_id "g69"; 3_related_000171F AUGUSTUS stop_codon 14162 14164 . + 0 transcript_id "g69.t1"; gene_id "g69"; # protein sequence = [MSSSSSNAVTGAPDPALPPVSSPPHPDPAERVVDAAIDELASTLEEPPLGQLALFKSVFGVGRTRFALPSEQWRDIAT # KVEASTNSTVALMELNALDEQDQRELDCLELGEFRRQQPQLPRPLTTSSLPSPIPSAVATKKRKRSVRQEEGGPSSHKRAVGAAPGSEVSPKVHDRKR # KRSAGESRDAEVPDYRRVVLVLRPPLVDTPGSAPLSGGRAEEDVPSSPPLGKTGSTGVPPSLSQDRSSGLPVRRRANSPGSSNQFIPPVLSERRPVLT # IQTPPPSQVSSLPFYSRNLCLIPVPQRSPDVLHPFPRARATAALRAENETLRAEVADLRKLLETSRAETSTLTSLLRDTTTSLDDRNKDLEASRRALQ # DVAADRLEYSRVLAQFRAIEAELPEAPLEVGVVPLLPSYFLLTGNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g69 ### # start gene g70 3_related_000171F AUGUSTUS gene 14654 15391 0.27 + . g70 3_related_000171F AUGUSTUS transcript 14654 15391 0.27 + . g70.t1 3_related_000171F AUGUSTUS start_codon 14654 14656 . + 0 transcript_id "g70.t1"; gene_id "g70"; 3_related_000171F AUGUSTUS CDS 14654 15391 0.27 + 0 transcript_id "g70.t1"; gene_id "g70"; 3_related_000171F AUGUSTUS stop_codon 15389 15391 . + 0 transcript_id "g70.t1"; gene_id "g70"; # protein sequence = [MRTVVELALEYLSQGRLTHGELHLRSTSSLLYYYSNAADRVDGLYQDMFTHSRFSTDAAFLTAAQHAGYVEARPDSLE # PPLHRQLFSFDHPIPLPQSPISDHIPAVPMMDSVMLMWEDMIRTYVREVLGYPASPDRASSPVDVPGSNDPLPTASPLVAPDAPPALDASESVSQDAP # LFLPESLSPTSPRPPSPIPSSSRVPHVPREIVDLTMDDAEDLYESQEEFLARTGGAVTVKQEDTESEVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g70 ### # start gene g71 3_related_000171F AUGUSTUS gene 15947 17305 0.94 + . g71 3_related_000171F AUGUSTUS transcript 15947 17305 0.94 + . g71.t1 3_related_000171F AUGUSTUS start_codon 15947 15949 . + 0 transcript_id "g71.t1"; gene_id "g71"; 3_related_000171F AUGUSTUS CDS 15947 17305 0.94 + 0 transcript_id "g71.t1"; gene_id "g71"; 3_related_000171F AUGUSTUS stop_codon 17303 17305 . + 0 transcript_id "g71.t1"; gene_id "g71"; # protein sequence = [MEDRRVLDQFPALDEALSGALDQVSTLVFPRFPPLFSPSLQSLSERFRKVQEDLQNATRERRVAVEKLITSTRKNSRL # TTTLLHQQGLVDESNALATRQRRLVEELQEEVHRVRGRAVFVEQMLKEYPDEGYYEVVLPPLSQLEGDLNQAREDLRRVATFAHRLYRCDPATVLHHH # HRYFGAIIEAVVAFLRRGLDSDDLDVIVHNFRLALDYVQAARGVHGDMYMRSISSIQWFFNNAVDEDEGLYRMILEHSRFDSDSPFLTAAHHAGFVPP # PDDSVEPPLHRRMLALSTALPHSEGVGRWEDIVPALPSIDQLTADWEQMMLQYIHHITDTPLPGTDSQGPMSSVEPATESLPEVLVQQSPEAPAALES # TSSVGLHPLVPLFLPEQESLTSPSPTLPPLFGSVANLVIDLTGDDDELYETEEVSAGRFSMAREVIDSAPGQDVVKDESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g71 ### # start gene g72 3_related_000171F AUGUSTUS gene 17521 19755 0.46 - . g72 3_related_000171F AUGUSTUS transcript 17521 19755 0.46 - . g72.t1 3_related_000171F AUGUSTUS stop_codon 17521 17523 . - 0 transcript_id "g72.t1"; gene_id "g72"; 3_related_000171F AUGUSTUS CDS 17521 19755 0.46 - 0 transcript_id "g72.t1"; gene_id "g72"; 3_related_000171F AUGUSTUS start_codon 19753 19755 . - 0 transcript_id "g72.t1"; gene_id "g72"; # protein sequence = [MDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFMKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPV # VLECNASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAEL # LSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATILMNEDLLLNRVREAPKDTSTIEVLKRIARNEEESLVWEDGL # IKRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTRKLVSQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQ # LPVTAGPEKYDAILVVVCRLTKQAIYVPCHTTDKAEDFANLFITHVFSKHGMPSDIVSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVN # QSVEAYLRIYCSYDQDDWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIRVANEVYAQYANQKRQ # EAPDWKEGDHVWLNMENVRTRRPMKKLDHKWTGPYSILAKIGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEDIL # DSKPKKGRPEEVEYLVKWEGYSEEFNSWVGWEGMAGSLELLRSWHEKHPRKRQPSQRHWARLLKDAQEDEEDEREDRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g72 ### # # ----- prediction on sequence number 7 (length = 81176, name = 3_related_000130F) ----- # # Predicted genes for sequence number 7 on both strands # start gene g73 3_related_000130F AUGUSTUS gene 1245 1677 0.66 + . g73 3_related_000130F AUGUSTUS transcript 1245 1677 0.66 + . g73.t1 3_related_000130F AUGUSTUS start_codon 1245 1247 . + 0 transcript_id "g73.t1"; gene_id "g73"; 3_related_000130F AUGUSTUS CDS 1245 1413 0.67 + 0 transcript_id "g73.t1"; gene_id "g73"; 3_related_000130F AUGUSTUS CDS 1472 1677 0.99 + 2 transcript_id "g73.t1"; gene_id "g73"; 3_related_000130F AUGUSTUS stop_codon 1675 1677 . + 0 transcript_id "g73.t1"; gene_id "g73"; # protein sequence = [MRDRDTQRSRGFGFVTFSTSQEAEAAIAALHEQELDGRLIKVNIAKVRGGGGGGGGGYGGGYSGGGGGGGYGGYQGGG # GGYQGGGGYNGSGGGGYSGGSGGYQGGGYSGGGGGYSGGGGGYQSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g73 ### # start gene g74 3_related_000130F AUGUSTUS gene 2458 3766 0.79 + . g74 3_related_000130F AUGUSTUS transcript 2458 3766 0.79 + . g74.t1 3_related_000130F AUGUSTUS start_codon 2458 2460 . + 0 transcript_id "g74.t1"; gene_id "g74"; 3_related_000130F AUGUSTUS CDS 2458 3048 0.8 + 0 transcript_id "g74.t1"; gene_id "g74"; 3_related_000130F AUGUSTUS CDS 3101 3766 0.99 + 0 transcript_id "g74.t1"; gene_id "g74"; 3_related_000130F AUGUSTUS stop_codon 3764 3766 . + 0 transcript_id "g74.t1"; gene_id "g74"; # protein sequence = [MNRALKLKYPKATQSVLSKQISDLWASAIPEVRAEYERRAEAAKVAHHLKYPNYKFNPRKKEEIAREKQAKLQAKEER # AKRNSARSAQRAPVDHSQLPQIPSLYPTLADFGPNGPSPPVSAAGSPQDLSSREASPAWLPPSSLTLPSPSFAAPSPFEPQEVFSPSTAPDTSLAGPS # NWGSPSAPFHAPEASEASQYNALLQFDFASSHPPVDSSFQQQPMIDAYSQGSAPNMGVALMGTGDSSIFHVDPFDNGIIDGQQNLDLNIGVGDLNGLF # GTTPWDFNQTIDQGQFSGNIDFEALFSSLDDPSFSQQNSSYLTGNEIQSQNSLYENNNPGPSSSSYSSSFASTALESAGMTIQPSALASSSSLTFEQG # SANTGSYAPPSGAVYAGNRRVGGNWAQYGLPSDEHSQPYALPAAAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g74 ### # start gene g75 3_related_000130F AUGUSTUS gene 5593 6834 0.87 + . g75 3_related_000130F AUGUSTUS transcript 5593 6834 0.87 + . g75.t1 3_related_000130F AUGUSTUS start_codon 5593 5595 . + 0 transcript_id "g75.t1"; gene_id "g75"; 3_related_000130F AUGUSTUS CDS 5593 6834 0.87 + 0 transcript_id "g75.t1"; gene_id "g75"; 3_related_000130F AUGUSTUS stop_codon 6832 6834 . + 0 transcript_id "g75.t1"; gene_id "g75"; # protein sequence = [MISGRFAFSALSEYLTLQKVKQVEYTFPEGFDNNAKDLVQKLLVSFTAFVPTNQNHSCQVREPTDRLGAGEPSSSLGM # SALRSHPFFESTIWATLWTEPAPPIVAGLVQREYPLDQGQDKNWQDVGATWDALVMDDDVSPVGDDIDWADDAEGSSLLLRQRQCDTSMSPVDISLVS # QVIPGDLDEEHRGLSGSADSTAAMPITIHSSVARTESPPSGSPESSSDGDGSVERVAAGLQTMKPFRFTSDYNEIAVERERGRSQAPTPIQGNTSSTI # ELYACNHLFPAILFIISCRPLALNPEPNEVVIYRSIVEDHSARRRANRLLKPIPGAQIKPKARELILTNYRLICVKAKTPPSYAPVKLELFLKAAYDR # EKEKKKDGKEIKGILESADLKGGRDFIVISVSPSLFNTAMF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g75 ### # start gene g76 3_related_000130F AUGUSTUS gene 7245 7568 0.57 - . g76 3_related_000130F AUGUSTUS transcript 7245 7568 0.57 - . g76.t1 3_related_000130F AUGUSTUS stop_codon 7245 7247 . - 0 transcript_id "g76.t1"; gene_id "g76"; 3_related_000130F AUGUSTUS CDS 7245 7568 0.57 - 0 transcript_id "g76.t1"; gene_id "g76"; 3_related_000130F AUGUSTUS start_codon 7566 7568 . - 0 transcript_id "g76.t1"; gene_id "g76"; # protein sequence = [MEREQILAHNFELGVHPEAVEAELRESISTALTPSQALRLKHQHLHSISTLANQFGGKIVDVSENSVIVELTAKTNRV # EAFLGLLRPFGILEAARTGKYLIFVCDPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g76 ### # start gene g77 3_related_000130F AUGUSTUS gene 11526 11878 0.64 - . g77 3_related_000130F AUGUSTUS transcript 11526 11878 0.64 - . g77.t1 3_related_000130F AUGUSTUS stop_codon 11526 11528 . - 0 transcript_id "g77.t1"; gene_id "g77"; 3_related_000130F AUGUSTUS CDS 11526 11803 1 - 2 transcript_id "g77.t1"; gene_id "g77"; 3_related_000130F AUGUSTUS CDS 11851 11878 0.64 - 0 transcript_id "g77.t1"; gene_id "g77"; 3_related_000130F AUGUSTUS start_codon 11876 11878 . - 0 transcript_id "g77.t1"; gene_id "g77"; # protein sequence = [MSMSQMTQSDYSLFASSAFDANEYANATLSGDPYLPSSDSKTSSTGKQASKLSAPEASAKDDISLAISKLSLGIEDVS # KQIKSLVRMMSLETGFVPSTHAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g77 ### # start gene g78 3_related_000130F AUGUSTUS gene 12932 13198 0.97 + . g78 3_related_000130F AUGUSTUS transcript 12932 13198 0.97 + . g78.t1 3_related_000130F AUGUSTUS start_codon 12932 12934 . + 0 transcript_id "g78.t1"; gene_id "g78"; 3_related_000130F AUGUSTUS CDS 12932 13198 0.97 + 0 transcript_id "g78.t1"; gene_id "g78"; 3_related_000130F AUGUSTUS stop_codon 13196 13198 . + 0 transcript_id "g78.t1"; gene_id "g78"; # protein sequence = [MLNQWIDDHGSSGSKDAVRKLPHKLSGRSSRTDGVDFDEDEDDEPQLSLLRDAPSRGHRSFKKPKLWPDNSQNTNLQG # DLEEEDGQSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g78 ### # start gene g79 3_related_000130F AUGUSTUS gene 14673 15917 0.41 + . g79 3_related_000130F AUGUSTUS transcript 14673 15917 0.41 + . g79.t1 3_related_000130F AUGUSTUS start_codon 14673 14675 . + 0 transcript_id "g79.t1"; gene_id "g79"; 3_related_000130F AUGUSTUS CDS 14673 15917 0.41 + 0 transcript_id "g79.t1"; gene_id "g79"; 3_related_000130F AUGUSTUS stop_codon 15915 15917 . + 0 transcript_id "g79.t1"; gene_id "g79"; # protein sequence = [MLLDHFPSSKQVFYSLQFLDQIHRHLYRTQKLRSTQTREFVADMRERMLQWQEEACPEVMLDLRAPLEVSPPPHIMQL # KSVLPLVTAFILLISYSLLVRLMWILLYRPFFQSSAGLDQSPSVLEAIPTCERAAIEINHIFTMYDRYYPLSRASYIVIFAGFLQATVDLALADREKS # VSGPTLSRLALAGRVLSGGSANIPGMHSSVRSLQTHLHATLSRWTRKGSEQLNARATSTTSSCLASSRGPSKDSRNISCSPSLSNQRSSATPPDALSD # GSTIASFSMSPISNIPSTHELEDSSVNSLPSHYSMLPHQHTSLSISPRHYSPSEVTPYPNVDILPKESLRPDFQMDSVYQDAPNSYIPQTPDQEVVDY # MIGSQLSHYESGCNAWFWPGDGGESAYNVNGSMLQNSHIASV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g79 ### # start gene g80 3_related_000130F AUGUSTUS gene 17098 18556 0.23 - . g80 3_related_000130F AUGUSTUS transcript 17098 18556 0.23 - . g80.t1 3_related_000130F AUGUSTUS stop_codon 17098 17100 . - 0 transcript_id "g80.t1"; gene_id "g80"; 3_related_000130F AUGUSTUS CDS 17098 17302 0.85 - 1 transcript_id "g80.t1"; gene_id "g80"; 3_related_000130F AUGUSTUS CDS 17400 17697 0.44 - 2 transcript_id "g80.t1"; gene_id "g80"; 3_related_000130F AUGUSTUS CDS 17823 18116 0.55 - 2 transcript_id "g80.t1"; gene_id "g80"; 3_related_000130F AUGUSTUS CDS 18172 18350 0.82 - 1 transcript_id "g80.t1"; gene_id "g80"; 3_related_000130F AUGUSTUS CDS 18423 18556 0.82 - 0 transcript_id "g80.t1"; gene_id "g80"; 3_related_000130F AUGUSTUS start_codon 18554 18556 . - 0 transcript_id "g80.t1"; gene_id "g80"; # protein sequence = [MGNVLSAYKTENCVLRVGDLGDIEGLVLSRAETNEPLARRFLSVPPNGTPRDCTRFGSICPQPNYTKLGNHAFSKYDE # DCLTLNIWTPSGTSPEQGWPVMLWFHGGWLQVGDPSVDPNMDPTELISATGGGLQCVFIAAAYRLSVFGFLASNELAEEAATLGEYAFGNYGLWDQRA # ALLWTHEHVHHFGGNAQELTLSGRSADFPLFFRYSNAIPADPKTVEEVQPQFDELLTAFAIPLSLSGSEKLECLRSKPALELVDKIMAFDNHTFRPIR # DGHFFPMDLFARYLNGDFAAEFKRRGMSQTNPPNDLDTLYKEVGNYYSPAVTRMMVDAYVNRKIKADGAHPDPDINIDPWKKVYGDIGKSTLFVT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g80 ### # start gene g81 3_related_000130F AUGUSTUS gene 34070 34432 0.29 + . g81 3_related_000130F AUGUSTUS transcript 34070 34432 0.29 + . g81.t1 3_related_000130F AUGUSTUS start_codon 34070 34072 . + 0 transcript_id "g81.t1"; gene_id "g81"; 3_related_000130F AUGUSTUS CDS 34070 34432 0.29 + 0 transcript_id "g81.t1"; gene_id "g81"; 3_related_000130F AUGUSTUS stop_codon 34430 34432 . + 0 transcript_id "g81.t1"; gene_id "g81"; # protein sequence = [MNERSASQDDSFRNLNAKLANPLAHIPREQLMEDARLFAETHGLKDLVLEFQKGALVAQDPSQFENLPQLDEADKAVF # RRELTHKWDQPRMLYYLVILCSMAAAVQGVCESSSKSTCTRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g81 ### # start gene g82 3_related_000130F AUGUSTUS gene 36905 37942 0.46 + . g82 3_related_000130F AUGUSTUS transcript 36905 37942 0.46 + . g82.t1 3_related_000130F AUGUSTUS start_codon 36905 36907 . + 0 transcript_id "g82.t1"; gene_id "g82"; 3_related_000130F AUGUSTUS CDS 36905 37339 0.46 + 0 transcript_id "g82.t1"; gene_id "g82"; 3_related_000130F AUGUSTUS CDS 37394 37942 0.81 + 0 transcript_id "g82.t1"; gene_id "g82"; 3_related_000130F AUGUSTUS stop_codon 37940 37942 . + 0 transcript_id "g82.t1"; gene_id "g82"; # protein sequence = [MYAIGPIYALDWCKSTSPKEQMRPRSSFRLGIGSFLENFSNRIAIVGLQDEHILVEDDYTDYPDFVTLCDAHHGYPVT # SLQWQPVSAISYQWSQKSPSTELLATTGDALRLWEYSGDAQPAMSNFVGRTASSSGHSLTLKTALSGQSKVQNNSNGAPLTNFSWNEKAPSLIVTSSI # DTTCTVWNIDTSAAVTQLIAHDREVYDVAWLPGSTDIFVSVGADGSLRAFDLRSLEHSTILYETPAPKNVPPPSVSPSTSARPPTSPLLRIAFNPSDS # NYMSTFHMDGSEIQILDMRSPGQPVLELKGHHSQINAVGWGSGDQPLLATAGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g82 ### # start gene g83 3_related_000130F AUGUSTUS gene 41892 43025 0.98 + . g83 3_related_000130F AUGUSTUS transcript 41892 43025 0.98 + . g83.t1 3_related_000130F AUGUSTUS start_codon 41892 41894 . + 0 transcript_id "g83.t1"; gene_id "g83"; 3_related_000130F AUGUSTUS CDS 41892 43025 0.98 + 0 transcript_id "g83.t1"; gene_id "g83"; 3_related_000130F AUGUSTUS stop_codon 43023 43025 . + 0 transcript_id "g83.t1"; gene_id "g83"; # protein sequence = [MTERLEIDPAKIPAPNFASGAYTFMRNALITDANTPEITTDEHAAQRLKVQWEIHIEGPKAQYEVQLQEAETLREQRR # QEAADAERLAAVEKQEKEKELAKEADKKRMPIYSFQKGVGVESIPLQVHPYAKKMMTARKYVPLWYFLPDAATEAKERSKDSLVGSHTLRASPNAIPD # SRLSWPQVMRAKSAFLNTLRLGAWPDDHISMFAAFYINMDMHSELQEQDGDQVMAHYHAEMRLAWYDAMERKESFDLSVISNRVLAESRREIVKQRQE # KSLKGKQTFSSIKKHRLTIDTCPFIASLYDLNTSPQFQTTTPTDTNATLATCATLTLPELPTLHECYSLLPMLTNNLAMLITDANAADSSTTTTDANS # QTPTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g83 ### # start gene g84 3_related_000130F AUGUSTUS gene 46653 48344 1 + . g84 3_related_000130F AUGUSTUS transcript 46653 48344 1 + . g84.t1 3_related_000130F AUGUSTUS start_codon 46653 46655 . + 0 transcript_id "g84.t1"; gene_id "g84"; 3_related_000130F AUGUSTUS CDS 46653 48344 1 + 0 transcript_id "g84.t1"; gene_id "g84"; 3_related_000130F AUGUSTUS stop_codon 48342 48344 . + 0 transcript_id "g84.t1"; gene_id "g84"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTCIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDNSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g84 ### # start gene g85 3_related_000130F AUGUSTUS gene 48677 51028 0.95 + . g85 3_related_000130F AUGUSTUS transcript 48677 51028 0.95 + . g85.t1 3_related_000130F AUGUSTUS start_codon 48677 48679 . + 0 transcript_id "g85.t1"; gene_id "g85"; 3_related_000130F AUGUSTUS CDS 48677 51028 0.95 + 0 transcript_id "g85.t1"; gene_id "g85"; 3_related_000130F AUGUSTUS stop_codon 51026 51028 . + 0 transcript_id "g85.t1"; gene_id "g85"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWVSRNITFRNTSHPDSPQTSVPSAINPVVAKVAV # PLPELSPSVSPTILETPPGDSLRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLHLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFRAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g85 ### # start gene g86 3_related_000130F AUGUSTUS gene 51173 52240 1 + . g86 3_related_000130F AUGUSTUS transcript 51173 52240 1 + . g86.t1 3_related_000130F AUGUSTUS start_codon 51173 51175 . + 0 transcript_id "g86.t1"; gene_id "g86"; 3_related_000130F AUGUSTUS CDS 51173 52240 1 + 0 transcript_id "g86.t1"; gene_id "g86"; 3_related_000130F AUGUSTUS stop_codon 52238 52240 . + 0 transcript_id "g86.t1"; gene_id "g86"; # protein sequence = [MDFIEQLPLSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDHGSEFVSAFFRALGKA # LSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDEL # HVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPF # PNCTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g86 ### # start gene g87 3_related_000130F AUGUSTUS gene 54067 55536 1 - . g87 3_related_000130F AUGUSTUS transcript 54067 55536 1 - . g87.t1 3_related_000130F AUGUSTUS stop_codon 54067 54069 . - 0 transcript_id "g87.t1"; gene_id "g87"; 3_related_000130F AUGUSTUS CDS 54067 55536 1 - 0 transcript_id "g87.t1"; gene_id "g87"; 3_related_000130F AUGUSTUS start_codon 55534 55536 . - 0 transcript_id "g87.t1"; gene_id "g87"; # protein sequence = [MDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNR # TLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPLSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLA # ELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGI # TPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVV # SRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADEL # HADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g87 ### # start gene g88 3_related_000130F AUGUSTUS gene 55635 57629 0.99 - . g88 3_related_000130F AUGUSTUS transcript 55635 57629 0.99 - . g88.t1 3_related_000130F AUGUSTUS stop_codon 55635 55637 . - 0 transcript_id "g88.t1"; gene_id "g88"; 3_related_000130F AUGUSTUS CDS 55635 57629 0.99 - 0 transcript_id "g88.t1"; gene_id "g88"; 3_related_000130F AUGUSTUS start_codon 57627 57629 . - 0 transcript_id "g88.t1"; gene_id "g88"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHPDSPQTSVPSAINPVVAKVAV # PLPELSPSVSPTILETPPGDSPRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGISATPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g88 ### # start gene g89 3_related_000130F AUGUSTUS gene 57962 59653 0.99 - . g89 3_related_000130F AUGUSTUS transcript 57962 59653 0.99 - . g89.t1 3_related_000130F AUGUSTUS stop_codon 57962 57964 . - 0 transcript_id "g89.t1"; gene_id "g89"; 3_related_000130F AUGUSTUS CDS 57962 59653 0.99 - 0 transcript_id "g89.t1"; gene_id "g89"; 3_related_000130F AUGUSTUS start_codon 59651 59653 . - 0 transcript_id "g89.t1"; gene_id "g89"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTARIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNNDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPNSPDIPNEQRAMLDLLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGVYDAQGEAEDALGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLAAYRLEVLRIDNRYWKREETKKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSANSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g89 ### # start gene g90 3_related_000130F AUGUSTUS gene 62060 62953 0.32 + . g90 3_related_000130F AUGUSTUS transcript 62060 62953 0.32 + . g90.t1 3_related_000130F AUGUSTUS start_codon 62060 62062 . + 0 transcript_id "g90.t1"; gene_id "g90"; 3_related_000130F AUGUSTUS CDS 62060 62953 0.32 + 0 transcript_id "g90.t1"; gene_id "g90"; 3_related_000130F AUGUSTUS stop_codon 62951 62953 . + 0 transcript_id "g90.t1"; gene_id "g90"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTENNSKWLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g90 ### # start gene g91 3_related_000130F AUGUSTUS gene 63037 63585 0.43 + . g91 3_related_000130F AUGUSTUS transcript 63037 63585 0.43 + . g91.t1 3_related_000130F AUGUSTUS start_codon 63037 63039 . + 0 transcript_id "g91.t1"; gene_id "g91"; 3_related_000130F AUGUSTUS CDS 63037 63585 0.43 + 0 transcript_id "g91.t1"; gene_id "g91"; 3_related_000130F AUGUSTUS stop_codon 63583 63585 . + 0 transcript_id "g91.t1"; gene_id "g91"; # protein sequence = [MTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMP # EGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQD # SSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g91 ### # start gene g92 3_related_000130F AUGUSTUS gene 63615 67759 0.92 + . g92 3_related_000130F AUGUSTUS transcript 63615 67759 0.92 + . g92.t1 3_related_000130F AUGUSTUS start_codon 63615 63617 . + 0 transcript_id "g92.t1"; gene_id "g92"; 3_related_000130F AUGUSTUS CDS 63615 65046 0.94 + 0 transcript_id "g92.t1"; gene_id "g92"; 3_related_000130F AUGUSTUS CDS 65121 67759 0.98 + 2 transcript_id "g92.t1"; gene_id "g92"; 3_related_000130F AUGUSTUS stop_codon 67757 67759 . + 0 transcript_id "g92.t1"; gene_id "g92"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVDEPDDEDTIKLIPSSRPTNQINNEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGAIVQKDIVESFLRDLSID # DERRSIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNGQFNLNPIKSFFLQNGRIKP # KPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKK # GKAQDSKDKKENVQADILNEPPTNKLEERIKLNQQDRSPINLIDETNKQVDSEAIGVEKPIKLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHG # DPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEVGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIF # EDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTF # QTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSG # TKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCP # ALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSC # GPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGNQLILLWEMGKRKSRINLMTSKIKLTLEVVTYTKQLKKL # MILN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g92 ### # start gene g93 3_related_000130F AUGUSTUS gene 67813 69380 0.92 + . g93 3_related_000130F AUGUSTUS transcript 67813 69380 0.92 + . g93.t1 3_related_000130F AUGUSTUS start_codon 67813 67815 . + 0 transcript_id "g93.t1"; gene_id "g93"; 3_related_000130F AUGUSTUS CDS 67813 68178 0.92 + 0 transcript_id "g93.t1"; gene_id "g93"; 3_related_000130F AUGUSTUS CDS 68280 69380 1 + 0 transcript_id "g93.t1"; gene_id "g93"; 3_related_000130F AUGUSTUS stop_codon 69378 69380 . + 0 transcript_id "g93.t1"; gene_id "g93"; # protein sequence = [MLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKK # FQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGTDEAVESTSYFDAYTFIVSEGTCRYNDNVIPSNGCKYIIHGRDSLSSWSEARAV # KHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRV # TPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWNFRPGQLVQV # RNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLRVEDEDEYWMAPENDYIF # DAIPHLRLSDTDSDEELS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g93 ### # start gene g94 3_related_000130F AUGUSTUS gene 69685 70432 0.2 - . g94 3_related_000130F AUGUSTUS transcript 69685 70432 0.2 - . g94.t1 3_related_000130F AUGUSTUS stop_codon 69685 69687 . - 0 transcript_id "g94.t1"; gene_id "g94"; 3_related_000130F AUGUSTUS CDS 69685 70082 0.74 - 2 transcript_id "g94.t1"; gene_id "g94"; 3_related_000130F AUGUSTUS CDS 70164 70299 0.89 - 0 transcript_id "g94.t1"; gene_id "g94"; 3_related_000130F AUGUSTUS CDS 70406 70432 0.26 - 0 transcript_id "g94.t1"; gene_id "g94"; 3_related_000130F AUGUSTUS start_codon 70430 70432 . - 0 transcript_id "g94.t1"; gene_id "g94"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAANDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSVSDASFATAQSIPPLVLRTPSSLLQRWLFQSLRPSNEL # LLHSLVVLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g94 ### # start gene g95 3_related_000130F AUGUSTUS gene 72203 73815 0.27 - . g95 3_related_000130F AUGUSTUS transcript 72203 73815 0.27 - . g95.t1 3_related_000130F AUGUSTUS stop_codon 72203 72205 . - 0 transcript_id "g95.t1"; gene_id "g95"; 3_related_000130F AUGUSTUS CDS 72203 72730 0.61 - 0 transcript_id "g95.t1"; gene_id "g95"; 3_related_000130F AUGUSTUS CDS 72854 72891 0.49 - 2 transcript_id "g95.t1"; gene_id "g95"; 3_related_000130F AUGUSTUS CDS 73270 73734 0.36 - 2 transcript_id "g95.t1"; gene_id "g95"; 3_related_000130F AUGUSTUS CDS 73794 73815 0.38 - 0 transcript_id "g95.t1"; gene_id "g95"; 3_related_000130F AUGUSTUS start_codon 73813 73815 . - 0 transcript_id "g95.t1"; gene_id "g95"; # protein sequence = [MADASSILDRRSVTKTPLKEDLSDTPKGSSSKKKVEKPLPKPKATARSKTTVKVVEESRVSPESEESATPSYQIKRVR # LPPRLRQAAKGKARQMEVLEESDTEEEVVPPPSKRLKSSKSAPAPPKASNFRPALLIDEQGRLKLPGDSAEGFTPFKQIEHARVNVDLAMDALNALHK # LRTQLDRLGALFDQARQSFLRSFLDLQQAGQDPIVVLEALKAAEPQRESISVEDWTLLATLFQWSSPFNLNGLKFDNRTPAEWIDLLRSIHSGATSAT # VTVDGHLVDTSQPPEADVEVSEALDPQGSLPNTVVEKVSGVEDLASLSEGSPIQTELDLPQIESLTESTLAPEKGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g95 ### # start gene g96 3_related_000130F AUGUSTUS gene 77137 78294 0.37 - . g96 3_related_000130F AUGUSTUS transcript 77137 78294 0.37 - . g96.t1 3_related_000130F AUGUSTUS stop_codon 77137 77139 . - 0 transcript_id "g96.t1"; gene_id "g96"; 3_related_000130F AUGUSTUS CDS 77137 77796 1 - 0 transcript_id "g96.t1"; gene_id "g96"; 3_related_000130F AUGUSTUS CDS 77896 78294 0.37 - 0 transcript_id "g96.t1"; gene_id "g96"; 3_related_000130F AUGUSTUS start_codon 78292 78294 . - 0 transcript_id "g96.t1"; gene_id "g96"; # protein sequence = [MSTSQTVTATTRPKTSTAGPSRSRPTPPPPIDLTTHADPDEEEDDILEEDDDEAIRRAEERVRKMKARKAAAAAKRKA # EEEAARKAAEEARRQKEAEARELEERRRRMAEAATARSRRGSSPGGSSVSPRRPVPVGGDPDDGGDGDDDDEDGGDGDDDDEDGGDRDDDDEDDDDRA # PCERCRSKKISCQMQAGKRSSVICKPCHDAKVRCSYSGRPSTVKREGGNPYGERLAVLESQVAQLLADNRQLRDGQVKANTYHRHMNRKLDWLVTEAS # RRRRTPPELPEAGPSGLPKKRRRLADSDEEEEQRRVVQEVGEEEDGEGEEEMEEREEEERDEPAPRKARTEKGKEREE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g96 ### # # ----- prediction on sequence number 8 (length = 98668, name = 3_related_000015F_2) ----- # # Predicted genes for sequence number 8 on both strands # start gene g97 3_related_000015F_2 AUGUSTUS gene 8270 9796 0.53 + . g97 3_related_000015F_2 AUGUSTUS transcript 8270 9796 0.53 + . g97.t1 3_related_000015F_2 AUGUSTUS start_codon 8270 8272 . + 0 transcript_id "g97.t1"; gene_id "g97"; 3_related_000015F_2 AUGUSTUS CDS 8270 9796 0.53 + 0 transcript_id "g97.t1"; gene_id "g97"; 3_related_000015F_2 AUGUSTUS stop_codon 9794 9796 . + 0 transcript_id "g97.t1"; gene_id "g97"; # protein sequence = [MTTNNYGMPVLSAEAKAEIDKASAKLPRKYKTAPLFNITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAANVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNG # TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFADMEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g97 ### # start gene g98 3_related_000015F_2 AUGUSTUS gene 9826 10671 0.66 + . g98 3_related_000015F_2 AUGUSTUS transcript 9826 10671 0.66 + . g98.t1 3_related_000015F_2 AUGUSTUS start_codon 9826 9828 . + 0 transcript_id "g98.t1"; gene_id "g98"; 3_related_000015F_2 AUGUSTUS CDS 9826 10671 0.66 + 0 transcript_id "g98.t1"; gene_id "g98"; 3_related_000015F_2 AUGUSTUS stop_codon 10669 10671 . + 0 transcript_id "g98.t1"; gene_id "g98"; # protein sequence = [MRTLRSNAAAPEESEKAKRNQFNDKTKRLVFDGVYIPKKPGLIPGKLVETTNGNQKTVRFEAPKSINRPLKKPSVTIE # DVDESDDEDTIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFYETFPLM # MNEGTLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g98 ### # start gene g99 3_related_000015F_2 AUGUSTUS gene 10884 15607 0.66 + . g99 3_related_000015F_2 AUGUSTUS transcript 10884 15607 0.66 + . g99.t1 3_related_000015F_2 AUGUSTUS start_codon 10884 10886 . + 0 transcript_id "g99.t1"; gene_id "g99"; 3_related_000015F_2 AUGUSTUS CDS 10884 11256 0.67 + 0 transcript_id "g99.t1"; gene_id "g99"; 3_related_000015F_2 AUGUSTUS CDS 11331 15607 0.98 + 2 transcript_id "g99.t1"; gene_id "g99"; 3_related_000015F_2 AUGUSTUS stop_codon 15605 15607 . + 0 transcript_id "g99.t1"; gene_id "g99"; # protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV # GTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQNDQAEEIIDCYLNQKTIGDKQ # VFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQKFSLGENCDKSESTETTQNQCNNENTSETVRDDIWNKPKNS # QRTRKRMVRYEVLKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDRKDNVRPDLLNEPPTNKLEERIKLNQQDRPPINLIDETNKQVVNEAIGVEK # PINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGNPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFA # WEPSEAGTFKNEFFPPVKVPVIPHEPWVEKNIPIPLGIFEDVCKIIKSKIDSGIYEPSNASYRLKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPP # ATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPE # GGYETIPENPGIRRFVWKHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCCDKTEVRAFLGTASQLRMFIA # NFAKKAAPLTKLTSNVPFEWNEKCDKAMDKLKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRE # LYGLKLALEASYYHVYGCRHLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGG # EPINFIMGDGETEEPYQLDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLEAKNATCEVFSRNLFPTFDKEFVQNNPYPEAHRS # SEGNRLDELIPLIGKYLSNLSDESLEEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRF # WWPDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVRHENARTLGEWFFDDIICRWGC # PEEVVTDNAGQMKNMLAWLEEKYGIKGIRISACNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLP # FDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVQRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPIV # VIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGED # Q] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g99 ### # start gene g100 3_related_000015F_2 AUGUSTUS gene 15869 16501 0.53 - . g100 3_related_000015F_2 AUGUSTUS transcript 15869 16501 0.53 - . g100.t1 3_related_000015F_2 AUGUSTUS stop_codon 15869 15871 . - 0 transcript_id "g100.t1"; gene_id "g100"; 3_related_000015F_2 AUGUSTUS CDS 15869 16501 0.53 - 0 transcript_id "g100.t1"; gene_id "g100"; 3_related_000015F_2 AUGUSTUS start_codon 16499 16501 . - 0 transcript_id "g100.t1"; gene_id "g100"; # protein sequence = [MEARGMDLTKGSNKDEKSAVNNVSPRLSKVHCHTDSHVSSNCMSCLAEDKGESIQFKSVSNGFLFHDLVTHSKHINHA # LAQVISSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTP # TENAVPVPKTVERATTPFTRGVTPMMEDKEHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g100 ### # start gene g101 3_related_000015F_2 AUGUSTUS gene 19954 23517 0.97 - . g101 3_related_000015F_2 AUGUSTUS transcript 19954 23517 0.97 - . g101.t1 3_related_000015F_2 AUGUSTUS stop_codon 19954 19956 . - 0 transcript_id "g101.t1"; gene_id "g101"; 3_related_000015F_2 AUGUSTUS CDS 19954 23517 0.97 - 0 transcript_id "g101.t1"; gene_id "g101"; 3_related_000015F_2 AUGUSTUS start_codon 23515 23517 . - 0 transcript_id "g101.t1"; gene_id "g101"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHPDSPQTSVPSAINPVAAKVAV # PLPEPSPSVSPTILETPPGDSLRPRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPKEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YNTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILAFPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g101 ### # start gene g102 3_related_000015F_2 AUGUSTUS gene 23850 25541 0.98 - . g102 3_related_000015F_2 AUGUSTUS transcript 23850 25541 0.98 - . g102.t1 3_related_000015F_2 AUGUSTUS stop_codon 23850 23852 . - 0 transcript_id "g102.t1"; gene_id "g102"; 3_related_000015F_2 AUGUSTUS CDS 23850 25541 0.98 - 0 transcript_id "g102.t1"; gene_id "g102"; 3_related_000015F_2 AUGUSTUS start_codon 25539 25541 . - 0 transcript_id "g102.t1"; gene_id "g102"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHEDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g102 ### # start gene g103 3_related_000015F_2 AUGUSTUS gene 27587 28251 0.27 - . g103 3_related_000015F_2 AUGUSTUS transcript 27587 28251 0.27 - . g103.t1 3_related_000015F_2 AUGUSTUS stop_codon 27587 27589 . - 0 transcript_id "g103.t1"; gene_id "g103"; 3_related_000015F_2 AUGUSTUS CDS 27587 28140 0.99 - 2 transcript_id "g103.t1"; gene_id "g103"; 3_related_000015F_2 AUGUSTUS CDS 28203 28251 0.27 - 0 transcript_id "g103.t1"; gene_id "g103"; 3_related_000015F_2 AUGUSTUS start_codon 28249 28251 . - 0 transcript_id "g103.t1"; gene_id "g103"; # protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTTRELFLRSILDLQNAGEDPVVVLEALKAAEPNRRAIN # LNEWTLLATLFRWPSPFNLSGLDFDNRTPGEWIELLCSIHSGESTAHIDENGHLVESSPPPDSATEAFEGLNEVEKGSADEGTSSRVGGSVPMELDLP # TIESLAEQTLSPEKGAEPAQILES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g103 ### # start gene g104 3_related_000015F_2 AUGUSTUS gene 32831 34009 0.56 - . g104 3_related_000015F_2 AUGUSTUS transcript 32831 34009 0.56 - . g104.t1 3_related_000015F_2 AUGUSTUS stop_codon 32831 32833 . - 0 transcript_id "g104.t1"; gene_id "g104"; 3_related_000015F_2 AUGUSTUS CDS 32831 34009 0.56 - 0 transcript_id "g104.t1"; gene_id "g104"; 3_related_000015F_2 AUGUSTUS start_codon 34007 34009 . - 0 transcript_id "g104.t1"; gene_id "g104"; # protein sequence = [MSRQSMLSSAGTLRRGTPNKTRPESVNGILEPTDTDNTPTVTATKEQIAREYLTSKAAIIGTNALLTKDDIYDAMLRA # TRLPKKELDVALKTVEHGITLLRDMDEKQNQHQLLGEIKGAVESSFAKLDIEKQLQHQLTQVRNEFNERLDSIAANINGTEEKINSIAKNSQPAAPEA # SYADVMRTNGKGTMAPTQAMARQRMRAHIEVKRQQVLILNVGNEAGKEISGEILEYLNNMLIKMGALNKGTFVSATKLKNTDNLLTEVSLPELADWIH # RVEQMIQFTTLSGQALTIADKEYEIILHFVLITFGADDAFELQRLEDINNLPTCSITQVKWAKAIQRQTEGQRVVSLLLYLNNANAVNQLLLSGAVIS # NKRVEAKKTVKEERRCYKCQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g104 ### # start gene g105 3_related_000015F_2 AUGUSTUS gene 35383 36413 0.38 + . g105 3_related_000015F_2 AUGUSTUS transcript 35383 36413 0.38 + . g105.t1 3_related_000015F_2 AUGUSTUS start_codon 35383 35385 . + 0 transcript_id "g105.t1"; gene_id "g105"; 3_related_000015F_2 AUGUSTUS CDS 35383 35681 0.53 + 0 transcript_id "g105.t1"; gene_id "g105"; 3_related_000015F_2 AUGUSTUS CDS 35738 36413 0.42 + 1 transcript_id "g105.t1"; gene_id "g105"; 3_related_000015F_2 AUGUSTUS stop_codon 36411 36413 . + 0 transcript_id "g105.t1"; gene_id "g105"; # protein sequence = [MDFSSPTPSLTPSIGSPPPFIPVQPDHFYRLDDSSGLPSSPRSLDGTTWYEPEDDRLASRGIPVFKPTMEEFRDFEAY # MNMVECWGKYSGIVKVIPPKECDALPSVKEQLSSVQIKTPIEQLMLGQTGLFRQQNMEKRKTMSVREWAEFCSQPEYRAPSVDEVGIHARTTVKAKTR # RTRKSKVTAKDEAGDLDLANQVLIKEEPVDSLTHDHILLSHSATPAGDDIKPKVKNNRRQQEKLTEVEKLERDASFLENFDPALDWLPFSMSPEDYTP # EFCAKLERHYWRNLGLGKAPWYGADTQGMLHRSSRLTTPLTTDLRLSFHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g105 ### # start gene g106 3_related_000015F_2 AUGUSTUS gene 37016 37633 0.77 + . g106 3_related_000015F_2 AUGUSTUS transcript 37016 37633 0.77 + . g106.t1 3_related_000015F_2 AUGUSTUS start_codon 37016 37018 . + 0 transcript_id "g106.t1"; gene_id "g106"; 3_related_000015F_2 AUGUSTUS CDS 37016 37633 0.77 + 0 transcript_id "g106.t1"; gene_id "g106"; 3_related_000015F_2 AUGUSTUS stop_codon 37631 37633 . + 0 transcript_id "g106.t1"; gene_id "g106"; # protein sequence = [MLSVVIDVGQLIADRAREKETAETYPSDILPSSLRAKPYARKSPTRAPPILVKEQEIYVSISPLAKNKRKATSSANHT # PAAKRPRKSKPTTITLPPIASSHTVVTQPFPKLSIKLKLGPRPIPEVFPCCLCVSMSNEGLLHVHDPPFDRKEALEACSNPSVWMAHERCANIIPETW # VDEVEKVSGEREKMVFGVDGIVKDRWNLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g106 ### # start gene g107 3_related_000015F_2 AUGUSTUS gene 38393 39202 0.91 + . g107 3_related_000015F_2 AUGUSTUS transcript 38393 39202 0.91 + . g107.t1 3_related_000015F_2 AUGUSTUS start_codon 38393 38395 . + 0 transcript_id "g107.t1"; gene_id "g107"; 3_related_000015F_2 AUGUSTUS CDS 38393 39202 0.91 + 0 transcript_id "g107.t1"; gene_id "g107"; 3_related_000015F_2 AUGUSTUS stop_codon 39200 39202 . + 0 transcript_id "g107.t1"; gene_id "g107"; # protein sequence = [MGASLTPYSTSSTPQVTASQLPPVEATTTSPSYSTTSQYPYAAYNLYDYGKYLPQPSHASHSAPNMSASSTNHVSGPS # FTASYTHLAQSHYLQSAWQQQYQQLNLAQKYRPPAVYIAPQLSTQSGSPSLALNQTPSTSISPIASSTPTPIPTPISTPSYNSVSSSVNLMPTCIHPT # PIRTTGSISNTIQTSTPTLPSPIMQDPPSVTLPHAQSPSIAYTLPQSHMTHDPSTQAPVFDFDALKSLRPEQLAQLVRDNAQFRDIFQSAFQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g107 ### # start gene g108 3_related_000015F_2 AUGUSTUS gene 43693 45948 0.68 - . g108 3_related_000015F_2 AUGUSTUS transcript 43693 45948 0.68 - . g108.t1 3_related_000015F_2 AUGUSTUS stop_codon 43693 43695 . - 0 transcript_id "g108.t1"; gene_id "g108"; 3_related_000015F_2 AUGUSTUS CDS 43693 45948 0.68 - 0 transcript_id "g108.t1"; gene_id "g108"; 3_related_000015F_2 AUGUSTUS start_codon 45946 45948 . - 0 transcript_id "g108.t1"; gene_id "g108"; # protein sequence = [MHGKVSRIRHDDRGCFRGVSQSIQSIRYHSLSAALTSLPSHLVVTAASEESGVIMGIRHRQFTLESVQYHPESILSEG # GDDLLRNFLALRGGSWEENPEARVLDTTLPPFHLDLPVTNKGTTSKSKVPSILNKIYTQRLADVSEAQKTPGTTLADLQTLLSLNIAPPLIPLLPRLK # QNTEDRPSLLAEIKRASPSKGPISVATSPAAQALTYALAGANTISVLTEPKWFLGSLQDMLHARMSVANLPNRPAILRKDFILSRYQVLESRIWGADS # ILLIVSMLSETLLRDLYQYSLELGMEPLVEVNNAKEMELALSLPAKVIGVNNRNLHDFQVDMTTTSRLSEMVKGKDVFLCALSGIVSADDVKKYASEG # VSAVLVGESLMRAKDPAGYIRKLLSLPEPELAPREWRSEAPLVKICGVRNTEEALFIAEAGADMLGLMFVKKSSRYIDFDTGKSISEAIHTSKPTPSP # SNSLDDSSLNVPWFTSQVNRLSSTISRPLVVGVFQDASLSTILHAVSYCNLDMVQLHGSEPTEWARHIPVPVIRAFHVGKDSGIDGITRGGNHHFILL # DSMRDDGSGVSGGTGKVVDWNLAKRVIDAGEIIPDGATYNIAAAELAPEVVPTGSVETTTSESNGNIAEEPSPVRTNGDLNGHTTGHANGYANGHAKH # GTLSSSPTTPSKYPLPVILAGGLTPANIAEAVSQVRPWAVDVSGGVENAEKTGKDMEKVRAFIQGAKGFSSLGAQEEKIPQHVEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g108 ### # start gene g109 3_related_000015F_2 AUGUSTUS gene 52599 53490 0.26 + . g109 3_related_000015F_2 AUGUSTUS transcript 52599 53490 0.26 + . g109.t1 3_related_000015F_2 AUGUSTUS start_codon 52599 52601 . + 0 transcript_id "g109.t1"; gene_id "g109"; 3_related_000015F_2 AUGUSTUS CDS 52599 52612 0.27 + 0 transcript_id "g109.t1"; gene_id "g109"; 3_related_000015F_2 AUGUSTUS CDS 52773 53490 0.26 + 1 transcript_id "g109.t1"; gene_id "g109"; 3_related_000015F_2 AUGUSTUS stop_codon 53488 53490 . + 0 transcript_id "g109.t1"; gene_id "g109"; # protein sequence = [MDDLYKTFSLVREGRSSLVYALESDGTNTTSHNDQQILLVSGLFPLSKSKHSAEDYRSWLTLFLGSVTTDIYFFTTPE # LAELVADVRGSLPIIINTTFSTPFDIPPLANLKESYERMHAIDRERSRHSAELYAIWNGKPYYLDEAVKNSEKQYSYAFWSDAGSFRSDHVYRGWPSS # ARIEEVWDEGSRVSGVAKEDLLFFPMWEPPHASMKDWQEALGPVDTDFSEGMILILSILQSSMIFIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g109 ### # start gene g110 3_related_000015F_2 AUGUSTUS gene 60791 61636 0.91 - . g110 3_related_000015F_2 AUGUSTUS transcript 60791 61636 0.91 - . g110.t1 3_related_000015F_2 AUGUSTUS stop_codon 60791 60793 . - 0 transcript_id "g110.t1"; gene_id "g110"; 3_related_000015F_2 AUGUSTUS CDS 60791 61636 0.91 - 0 transcript_id "g110.t1"; gene_id "g110"; 3_related_000015F_2 AUGUSTUS start_codon 61634 61636 . - 0 transcript_id "g110.t1"; gene_id "g110"; # protein sequence = [MSYLYGVRFSAPENDLILSLREELYPQNFYSIDWPAQRNNVSEADLYAPHSKIFDGINIALSSYEMCSFPPLRKLALQ # KVYDLIVMEDENTAYQTLGPVSKMFNLIARVHNEGRESEAFKLHAEKRADFMWLGAEGMMMCGTNGSQLWDLAFISQAVVETGLADLEENQGELIKAL # DWLEKGQMLDNPEHFEKAFRHRTKGAWGFSTREQGYTVSDCTGEGLKSAIYLQRLEYVLCHVLLPNCFSTVLVSFLNLYPRNECAGPLTQCFPFKIPM # ADLLRMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g110 ### # start gene g111 3_related_000015F_2 AUGUSTUS gene 74112 75382 0.72 + . g111 3_related_000015F_2 AUGUSTUS transcript 74112 75382 0.72 + . g111.t1 3_related_000015F_2 AUGUSTUS start_codon 74112 74114 . + 0 transcript_id "g111.t1"; gene_id "g111"; 3_related_000015F_2 AUGUSTUS CDS 74112 74731 0.73 + 0 transcript_id "g111.t1"; gene_id "g111"; 3_related_000015F_2 AUGUSTUS CDS 74789 74921 0.73 + 1 transcript_id "g111.t1"; gene_id "g111"; 3_related_000015F_2 AUGUSTUS CDS 74978 75382 1 + 0 transcript_id "g111.t1"; gene_id "g111"; 3_related_000015F_2 AUGUSTUS stop_codon 75380 75382 . + 0 transcript_id "g111.t1"; gene_id "g111"; # protein sequence = [MPYNRYAFDEYFHVHGDNPIIDPYTGKYCADTLHEDWSPTTPPVDEFDTPSKTNNSPYNPASSRPPAPLGNNNPYQNG # FRLPPITSFYPPPVLDQSRITPPLSQFKPTPTSPGKENEGIQRAHVSGGPEAGKKVGARIWTAKDLIELAKICVEYKPFLQPYGNKGKVWDKIFYALS # ERGFRLSKVPALSLRHKAESLVGYWKVGITIIKAIAKILDNSMDKITIAALMDSVEAQWDEAKNKSDKAKADIQKDEDNEGGEAIRIASMQAFRSHKR # DAKPLDDEDTDTDTDNNSGSRKSGTKRKFSDSNVTKSHKRQRSSVRRTSNNTKILDFLESDAEERRSHQDKVVMLMERGQKLTQEHEKEVASILHGFL # ELDRARFEQERRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g111 ### # start gene g112 3_related_000015F_2 AUGUSTUS gene 79062 79922 0.52 - . g112 3_related_000015F_2 AUGUSTUS transcript 79062 79922 0.52 - . g112.t1 3_related_000015F_2 AUGUSTUS stop_codon 79062 79064 . - 0 transcript_id "g112.t1"; gene_id "g112"; 3_related_000015F_2 AUGUSTUS CDS 79062 79922 0.52 - 0 transcript_id "g112.t1"; gene_id "g112"; 3_related_000015F_2 AUGUSTUS start_codon 79920 79922 . - 0 transcript_id "g112.t1"; gene_id "g112"; # protein sequence = [MATPSGITYKAKCSNREVLRERLQNNSALRDHFESSRDVHHYKKLTHPTIHNHENVKGHYRDFAAYVQEIFEEGRSET # QAQPAEIVIGTPLPPLGPSTSDCMRSSHSCFTEYVKDFVCYLASALLGRDASTFIRLETLRGYMYTFLALWPRYANVHPTPEMRYQVRSYLLSKELQA # FVKLSMKIRTLKHIEPQCLQIIMETLHSATNIFRSNRTRLQMAFLILFSAASAARPGSVVELACYRGSNEALTWGDVDFYLIPDDEDPAHPFLVVDIQ # LNLVKGYRDVDH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g112 ### # start gene g113 3_related_000015F_2 AUGUSTUS gene 81979 84596 0.69 + . g113 3_related_000015F_2 AUGUSTUS transcript 81979 84596 0.69 + . g113.t1 3_related_000015F_2 AUGUSTUS start_codon 81979 81981 . + 0 transcript_id "g113.t1"; gene_id "g113"; 3_related_000015F_2 AUGUSTUS CDS 81979 83289 0.85 + 0 transcript_id "g113.t1"; gene_id "g113"; 3_related_000015F_2 AUGUSTUS CDS 83346 84596 0.74 + 0 transcript_id "g113.t1"; gene_id "g113"; 3_related_000015F_2 AUGUSTUS stop_codon 84594 84596 . + 0 transcript_id "g113.t1"; gene_id "g113"; # protein sequence = [MSPTPTRPSSRTPSPLLPPLTALGEVPSPAPESDGEVEADELAFTIESPSRPQLQLFETVFNTGKSLSAYCQDDPLWP # ILAEVASPCTNCLKTPGKCKVLPSSPRCTNCSSKKTCSLGKILRYRYFAHRCNQDLAYSRRFLELHGTPAHKSTWGIPLTAWREYDSALHARTSSTSI # LLELNMLDEQDAVDVDQQELQQFLTLQRDEAAVAAKRKRNHSPMPVAGPSSKKIRSDASKKRSRRKSPAVEVNVEPFRRVRLVVPPVRSVAPTSIPVP # PPASPSLMGVLHRDLPMQGPSDLVRLADAAEVHPGLVQQAGSSSPARTPIKGTGQDLLSSTMPPILRPALVPRNPASHPYRAENQRLAARVRLLETQL # ADSQRENSSLTSALRDTSHALESRQREVEQLRSSSQEFLQRQEEYRRIIDQFNTLDRALSGPSDQSLLERFQKVEEELRISQKDRDDATGKLSTSSRR # ISELTTALLYQHGITDEGNALSTRQRAHLEKLQEEVHRTRGRAAFVERMIKEYPDEGYYEVVLPPLSQLEGDLVKVQADLRRVATLAHRLYRSDPATV # LHHHNRYIGAIIEAVVAFLRRALETEDPDVMEHNIRLALDYMQTARGVHGDLHIWSISSIQWFFNNAVDQDEGLYTLMLENSRFDSDRPFLTAAQHAG # FTSPPPDSLEPPLHCRMLSLSTALPHRGGAGRWDDLVPAIPSDDQLTQDWEQLMLQYMHHITDTPLPVPDPPVPMSSTGPVPESSVEANVEQSLEAPI # VQVSSPSGGSHPPVPLFLSEQESPTSPSPPPHSPVLPLLFGSVASLSIDLTGDDDELYETEEAYASRIDVAMEGTELAVGQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g113 ### # start gene g114 3_related_000015F_2 AUGUSTUS gene 85384 86550 0.85 + . g114 3_related_000015F_2 AUGUSTUS transcript 85384 86550 0.85 + . g114.t1 3_related_000015F_2 AUGUSTUS start_codon 85384 85386 . + 0 transcript_id "g114.t1"; gene_id "g114"; 3_related_000015F_2 AUGUSTUS CDS 85384 86550 0.85 + 0 transcript_id "g114.t1"; gene_id "g114"; 3_related_000015F_2 AUGUSTUS stop_codon 86548 86550 . + 0 transcript_id "g114.t1"; gene_id "g114"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQGKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPTPFSLFPNESVQIASSTPTSASAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g114 ### # start gene g115 3_related_000015F_2 AUGUSTUS gene 86601 90317 0.85 + . g115 3_related_000015F_2 AUGUSTUS transcript 86601 90317 0.85 + . g115.t1 3_related_000015F_2 AUGUSTUS start_codon 86601 86603 . + 0 transcript_id "g115.t1"; gene_id "g115"; 3_related_000015F_2 AUGUSTUS CDS 86601 90317 0.85 + 0 transcript_id "g115.t1"; gene_id "g115"; 3_related_000015F_2 AUGUSTUS stop_codon 90315 90317 . + 0 transcript_id "g115.t1"; gene_id "g115"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEWE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDCGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSSIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVNKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g115 ### # start gene g116 3_related_000015F_2 AUGUSTUS gene 91075 92064 0.68 - . g116 3_related_000015F_2 AUGUSTUS transcript 91075 92064 0.68 - . g116.t1 3_related_000015F_2 AUGUSTUS stop_codon 91075 91077 . - 0 transcript_id "g116.t1"; gene_id "g116"; 3_related_000015F_2 AUGUSTUS CDS 91075 92064 0.68 - 0 transcript_id "g116.t1"; gene_id "g116"; 3_related_000015F_2 AUGUSTUS start_codon 92062 92064 . - 0 transcript_id "g116.t1"; gene_id "g116"; # protein sequence = [MPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNN # TPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQEQIGVANKAYAKYANQKRQEALDWKEGDQVWLNMENIRTRRPMKKLDHKW # TGPYTILSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEDILDSKPKKGRPEEVEYLVKWEGYNDEFNSWVDG # KVWWARSSSYVAGTNTTRGNANHRICNGLPWNGKHGKMRRRDREAREDEEEGPGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g116 ### # start gene g117 3_related_000015F_2 AUGUSTUS gene 95287 95775 0.71 + . g117 3_related_000015F_2 AUGUSTUS transcript 95287 95775 0.71 + . g117.t1 3_related_000015F_2 AUGUSTUS start_codon 95287 95289 . + 0 transcript_id "g117.t1"; gene_id "g117"; 3_related_000015F_2 AUGUSTUS CDS 95287 95775 0.71 + 0 transcript_id "g117.t1"; gene_id "g117"; 3_related_000015F_2 AUGUSTUS stop_codon 95773 95775 . + 0 transcript_id "g117.t1"; gene_id "g117"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITKVMQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g117 ### # start gene g118 3_related_000015F_2 AUGUSTUS gene 95856 96747 0.26 + . g118 3_related_000015F_2 AUGUSTUS transcript 95856 96747 0.26 + . g118.t1 3_related_000015F_2 AUGUSTUS start_codon 95856 95858 . + 0 transcript_id "g118.t1"; gene_id "g118"; 3_related_000015F_2 AUGUSTUS CDS 95856 96174 0.26 + 0 transcript_id "g118.t1"; gene_id "g118"; 3_related_000015F_2 AUGUSTUS CDS 96278 96747 0.28 + 2 transcript_id "g118.t1"; gene_id "g118"; 3_related_000015F_2 AUGUSTUS stop_codon 96745 96747 . + 0 transcript_id "g118.t1"; gene_id "g118"; # protein sequence = [MSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKV # EDEFKDLLGIKLESLIPRELMENNSRWLPVMAQMAKENAKGMINSIPPSGPSNQSNKFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGW # MMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIENYQIDLGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g118 ### # start gene g119 3_related_000015F_2 AUGUSTUS gene 97394 97732 0.32 + . g119 3_related_000015F_2 AUGUSTUS transcript 97394 97732 0.32 + . g119.t1 3_related_000015F_2 AUGUSTUS start_codon 97394 97396 . + 0 transcript_id "g119.t1"; gene_id "g119"; 3_related_000015F_2 AUGUSTUS CDS 97394 97732 0.32 + 0 transcript_id "g119.t1"; gene_id "g119"; 3_related_000015F_2 AUGUSTUS stop_codon 97730 97732 . + 0 transcript_id "g119.t1"; gene_id "g119"; # protein sequence = [MRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIV # ESFLRDLSIDDERRNIAIVANQRWHMKTIVIIQW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g119 ### # # ----- prediction on sequence number 9 (length = 83079, name = 3_related_000066F_1) ----- # # Predicted genes for sequence number 9 on both strands # start gene g120 3_related_000066F_1 AUGUSTUS gene 684 1424 0.92 + . g120 3_related_000066F_1 AUGUSTUS transcript 684 1424 0.92 + . g120.t1 3_related_000066F_1 AUGUSTUS start_codon 684 686 . + 0 transcript_id "g120.t1"; gene_id "g120"; 3_related_000066F_1 AUGUSTUS CDS 684 1424 0.92 + 0 transcript_id "g120.t1"; gene_id "g120"; 3_related_000066F_1 AUGUSTUS stop_codon 1422 1424 . + 0 transcript_id "g120.t1"; gene_id "g120"; # protein sequence = [MLCDNWSHLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVQPKVDMKSDLAKDFVINLDELHVFLREEILLAQSHY # KEQADRKRISHPEFPIGSEVFVLAKHIRSTHPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRCIHPVFHVSQLEPVTPNPTPNPFPTHTQSPPPPI # EVNGEEKYNVAKILDSKLDRRYKCCPLRYYIQWASYEGTKDEFSWVAADELHADELVPAFHAHYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g120 ### # start gene g121 3_related_000066F_1 AUGUSTUS gene 4647 7736 0.97 - . g121 3_related_000066F_1 AUGUSTUS transcript 4647 7736 0.97 - . g121.t1 3_related_000066F_1 AUGUSTUS stop_codon 4647 4649 . - 0 transcript_id "g121.t1"; gene_id "g121"; 3_related_000066F_1 AUGUSTUS CDS 4647 7736 0.97 - 0 transcript_id "g121.t1"; gene_id "g121"; 3_related_000066F_1 AUGUSTUS start_codon 7734 7736 . - 0 transcript_id "g121.t1"; gene_id "g121"; # protein sequence = [MATEKLQDEEMQDDLSIIHTIVSVGKPLTCQTIAELLHAEVESVSNLINRLHAVFYMTEADGPIIIFHKSFYDFFASS # KDSKYKYNARTQHESLTFSCLQIMESLCFNICNLPSSFMKDDDVPGFKDKVSKKIPETLNYCCQFWTDHFEIGQTDQLFQKVQEFLIEKGIYWLEAMS # LLKSLPRCSKMLDAILKTSNDNADYSSIQSIVGYLQNLMRQFMNGDVYGMTPHLYLSIMPFWENDVGCKPQLQRGIKLINRVIDWLPETTVTVNVSAS # VNSVHYSPIGDKIGTACNDNTVRIWDARTGTQIGEPLQGHDDWVTSVAFSPDGARIVSGSNDKTLRIWDARIGTQLGEPLQGHADWVNSVAFSPDGTR # IVSGSNDETLRIWDTRTGTQFGEPLQGHTEDVTSVAFSPDGIRIVSGSNDKTLRIWDARTGTQIGEPLQGHIDWVNSVAFSPDGTRIVSGSDDGTLRI # WDARTRTQIGDPLQGHDDWVTSVAFSPDGARIVSGSNDETLRIWDARTRTQFGEPLQGHDHNVNSVAFSPDGTRIVSGSYDKTLRTWDARSGTQFGEP # LQGHTDWVNSVAFSPDGTSIVSGSNDETLRIWDARTGTQLGEPLQGHADWVNSVAFSPDGTRLVSGSYDKTLRIWDTRTGTQIGEPLQGHDQNVNSVA # FSPDGARIVSGSWDKTLRTWDARTGTQLGEPLQGHTDWVNSVAFSPDGTRIVSGSDDGTLRIWDARTTTQIGEPLQGHTDWVNSVAFSPDGTRIVSGS # YDETLRIWDVRTGTQIGEPLQGHTHWVDSVAFSPDGTRIVSGSYDKTLRTWDARSGTRIGEPLQGHDHNVNSVAFSPDGTRIVSGSNDKTLRIWEART # GTQFSEPLQSHAHNVTSVASSPDGTRLLFGSQDKTLRIWDTGTGTETGGVLRDHIHQLYSTTHSSKEIEVTLRFKDVTKPLPDPVHRYHSIIPYNGKL # PHVPDLHWTINEYGWIFLPHIPHSIVWVPLPFRNTLWRARTQCIISSKGFTKFLLKDCVYGEDWVKCIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g121 ### # start gene g122 3_related_000066F_1 AUGUSTUS gene 7790 8308 0.32 - . g122 3_related_000066F_1 AUGUSTUS transcript 7790 8308 0.32 - . g122.t1 3_related_000066F_1 AUGUSTUS stop_codon 7790 7792 . - 0 transcript_id "g122.t1"; gene_id "g122"; 3_related_000066F_1 AUGUSTUS CDS 7790 8308 0.32 - 0 transcript_id "g122.t1"; gene_id "g122"; 3_related_000066F_1 AUGUSTUS start_codon 8306 8308 . - 0 transcript_id "g122.t1"; gene_id "g122"; # protein sequence = [MSVKEILAQEPDIVTKRPEVQIGKLLIEPWKAVMKAAQMGSFHPVLVLDALDECQDIAKVLQPLVSAISKKELQGLKF # FITSRPEPKIQAELKAYSASGMKEFILHNVEEDIVQKDISVYLQKELQHISPTEEQLCILTKLSQQLFIYAATVVRFVKEVDGIARKRKGCLVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g122 ### # start gene g123 3_related_000066F_1 AUGUSTUS gene 12237 13841 0.11 - . g123 3_related_000066F_1 AUGUSTUS transcript 12237 13841 0.11 - . g123.t1 3_related_000066F_1 AUGUSTUS stop_codon 12237 12239 . - 0 transcript_id "g123.t1"; gene_id "g123"; 3_related_000066F_1 AUGUSTUS CDS 12237 13064 0.61 - 0 transcript_id "g123.t1"; gene_id "g123"; 3_related_000066F_1 AUGUSTUS CDS 13155 13295 0.32 - 0 transcript_id "g123.t1"; gene_id "g123"; 3_related_000066F_1 AUGUSTUS CDS 13539 13841 0.3 - 0 transcript_id "g123.t1"; gene_id "g123"; 3_related_000066F_1 AUGUSTUS start_codon 13839 13841 . - 0 transcript_id "g123.t1"; gene_id "g123"; # protein sequence = [MVFFLATALVATEYITAAKSKGEVLVFRRGHIPVQESKSSDDEESAQPVQQLVVDVDEKVKRASAVSGLQKQTSIFHW # EDVCYDIKIKGEGRRLLDNVDGWTSTVREALIFSARLRQPQDVPDAEKVAYCSEVIRLLGMEKYADAVVGRKRLTIGVELAAKPKLLLFLDEPTSGLD # SQTAWSICSLLRDLANNGQAILCTIHQPSALLFQEFDRLLFLAKGGRTVYFGDIGENSKTLTSYFERQGASPCPPDANPAEWMLQVIGAAPGAVADRD # YADAWRQSDDYLAMKKELSKKRELSQSRPQPSVQEKRKSKDYSAFSASFQKQFQLCLYRVFQQLYRTPSYIYSKTFLSVTTVSIFESPTVVHCPLTCF # AVPFHWLHILQSGQHAPRSPKPDVLCLHAHDDLWKLGQSDHASFCHSTLSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g123 ### # start gene g124 3_related_000066F_1 AUGUSTUS gene 15223 16542 0.82 - . g124 3_related_000066F_1 AUGUSTUS transcript 15223 16542 0.82 - . g124.t1 3_related_000066F_1 AUGUSTUS stop_codon 15223 15225 . - 0 transcript_id "g124.t1"; gene_id "g124"; 3_related_000066F_1 AUGUSTUS CDS 15223 15928 0.87 - 1 transcript_id "g124.t1"; gene_id "g124"; 3_related_000066F_1 AUGUSTUS CDS 16052 16542 0.83 - 0 transcript_id "g124.t1"; gene_id "g124"; 3_related_000066F_1 AUGUSTUS start_codon 16540 16542 . - 0 transcript_id "g124.t1"; gene_id "g124"; # protein sequence = [MASEKWALGHSNASSDNSHADAATLEGSQADHVAQLARTVTKMSMKNVHADDHNPFLGTTDESLNPLSGKFDYKKWIH # SILAITSRDPERYPTRTAGISFTNLNVHGYGSAADHQKTVGNVLLDIPSMVAGLFGRKGKRVDILRDFEGVVRQGEMLVVLGPPGSQTQLSRCVWDPK # MAATKTLIITLLGIPWETMHKDFRGEVVYNAETDVHFPNLTVGQTLSFAARARTPRARLPGVTREQWAEHMRDVVMAVFGLTHTINTRVGNEFIRGVS # GGERKRVSIAEVALSGAPLQCWDNSTRGLDSATALEFVKTVNMSAKYMGSTAVIAIYQASQSIYDVCALLSLLQFILNMLDRSSTRLRCFMRVDRYIL # DERRTQRNSSSIWVSNALTVKQLQIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g124 ### # start gene g125 3_related_000066F_1 AUGUSTUS gene 18178 18423 0.43 + . g125 3_related_000066F_1 AUGUSTUS transcript 18178 18423 0.43 + . g125.t1 3_related_000066F_1 AUGUSTUS start_codon 18178 18180 . + 0 transcript_id "g125.t1"; gene_id "g125"; 3_related_000066F_1 AUGUSTUS CDS 18178 18423 0.43 + 0 transcript_id "g125.t1"; gene_id "g125"; 3_related_000066F_1 AUGUSTUS stop_codon 18421 18423 . + 0 transcript_id "g125.t1"; gene_id "g125"; # protein sequence = [MGRTEQAAGKGLQALFKYAKLAVEEVLREVCDMVLELDEDTSGIGREKAVLTAVALQTLGKAYVRVGTRKEQIDASST # STV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g125 ### # start gene g126 3_related_000066F_1 AUGUSTUS gene 22954 24039 0.56 + . g126 3_related_000066F_1 AUGUSTUS transcript 22954 24039 0.56 + . g126.t1 3_related_000066F_1 AUGUSTUS start_codon 22954 22956 . + 0 transcript_id "g126.t1"; gene_id "g126"; 3_related_000066F_1 AUGUSTUS CDS 22954 23209 0.56 + 0 transcript_id "g126.t1"; gene_id "g126"; 3_related_000066F_1 AUGUSTUS CDS 23282 24039 0.61 + 2 transcript_id "g126.t1"; gene_id "g126"; 3_related_000066F_1 AUGUSTUS stop_codon 24037 24039 . + 0 transcript_id "g126.t1"; gene_id "g126"; # protein sequence = [MPPKTRAQSRANSKENTFFTTAQSFAPFSDSISAIGQPRRRNHGFGPATVPTTSTLPEAMEEEQQFKYSTLYTGDGQP # VQVLTPRSIACHTGKQPQRRATSESPHEPPPHFDLDAGDHDDQEPPVDPDNPGADNDNNNNNDLDDNSGSLPRGEPGDPSGPGGPSGPGGPGGPGGPR # SPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGCPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLTLVFNDRPKYFTDQRKVNYTLSYLSGSAK # EWFVPDILNPDLDLLPAWTSFFKALVKELQDNSGVYNAQGEAEDSLGNLKMKETKNIRKYNIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g126 ### # start gene g127 3_related_000066F_1 AUGUSTUS gene 26183 26677 0.85 + . g127 3_related_000066F_1 AUGUSTUS transcript 26183 26677 0.85 + . g127.t1 3_related_000066F_1 AUGUSTUS start_codon 26183 26185 . + 0 transcript_id "g127.t1"; gene_id "g127"; 3_related_000066F_1 AUGUSTUS CDS 26183 26677 0.85 + 0 transcript_id "g127.t1"; gene_id "g127"; 3_related_000066F_1 AUGUSTUS stop_codon 26675 26677 . + 0 transcript_id "g127.t1"; gene_id "g127"; # protein sequence = [MVRLPEPAMLANYHQEVLCIDNRYWKCKETRKCEAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGFSAPFTPKPNNN # GKPQNSSNSSQSGGQCPVFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPETTPIVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g127 ### # start gene g128 3_related_000066F_1 AUGUSTUS gene 26941 27651 0.39 + . g128 3_related_000066F_1 AUGUSTUS transcript 26941 27651 0.39 + . g128.t1 3_related_000066F_1 AUGUSTUS start_codon 26941 26943 . + 0 transcript_id "g128.t1"; gene_id "g128"; 3_related_000066F_1 AUGUSTUS CDS 26941 27651 0.39 + 0 transcript_id "g128.t1"; gene_id "g128"; 3_related_000066F_1 AUGUSTUS stop_codon 27649 27651 . + 0 transcript_id "g128.t1"; gene_id "g128"; # protein sequence = [MTKISPINLCLFDGSLSSEPITDMANITVRFPSGALLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNIMFRNT # SHFDSPQTSVPSATNTVDAKVAVLLPELSPSVLLTILETPPGNSLRSRPWTLQAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRAC # KDTSMEPILLRAIHSEVAARAADCSSTAPAVPPLHHSIPEEYAEFADVFNEIAADSLPED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g128 ### # start gene g129 3_related_000066F_1 AUGUSTUS gene 28250 30120 0.33 + . g129 3_related_000066F_1 AUGUSTUS transcript 28250 30120 0.33 + . g129.t1 3_related_000066F_1 AUGUSTUS start_codon 28250 28252 . + 0 transcript_id "g129.t1"; gene_id "g129"; 3_related_000066F_1 AUGUSTUS CDS 28250 29417 0.74 + 0 transcript_id "g129.t1"; gene_id "g129"; 3_related_000066F_1 AUGUSTUS CDS 29507 30120 0.34 + 2 transcript_id "g129.t1"; gene_id "g129"; 3_related_000066F_1 AUGUSTUS stop_codon 30118 30120 . + 0 transcript_id "g129.t1"; gene_id "g129"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFYRCFIYNYSDIVVPMTRLTRKGALWIWDNNC # QEAFENLKIAFTSAPILAHWEPNRPIIVETDTSDYAIAAILSIQTVDGEIHPLAFLSRPLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDII # IDHKNLEYFSTTKILTHRQVHWSEYLHQFNMVIRFRPGKLGKKPDSMMRHWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTTSLRATVLEGPMLRASII # MDIEALHQAIILALPKDPSSVVGLELAKDPSNERWSLGSDGLLRLDNHIYVPNHGDLCLQVLCYFHDHPLSGHFGQNRTLEAVRPGLRSETSFVTTLL # PALLVVAISLAVIGLTSSILVVVDRSSKQAIFIPTFNTITSKQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFLRALGKALSMELHYTSGYHPETNG # QTERVNQTLEQYIRIYCSYQQDDWSHLLPIAKFAYNNAPNAPTSITPFFVNKGYHPNITVRPEVDMKSDLARDFIVNLDELHVFLREEILLAQSRYKE # QADRKRILHPEFPIGSEVFALAKHI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g129 ### # start gene g130 3_related_000066F_1 AUGUSTUS gene 31388 31926 0.58 - . g130 3_related_000066F_1 AUGUSTUS transcript 31388 31926 0.58 - . g130.t1 3_related_000066F_1 AUGUSTUS stop_codon 31388 31390 . - 0 transcript_id "g130.t1"; gene_id "g130"; 3_related_000066F_1 AUGUSTUS CDS 31388 31468 0.64 - 0 transcript_id "g130.t1"; gene_id "g130"; 3_related_000066F_1 AUGUSTUS CDS 31522 31926 0.58 - 0 transcript_id "g130.t1"; gene_id "g130"; 3_related_000066F_1 AUGUSTUS start_codon 31924 31926 . - 0 transcript_id "g130.t1"; gene_id "g130"; # protein sequence = [MSASRTTTATISSTASPLRSRPVLLPPANPVEEDEEDLEEDEEEIIRRAEEKVRRMKARKAAAVAKKKAEEEAARKAA # EEAQKQKETAVRELEERWRKLVEAVTARSRRGSLPGGSSVPPRRLVVEIRKEKGKAQPVGGDPDDGGDGDDDDDEEDDRAPCE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g130 ### # start gene g131 3_related_000066F_1 AUGUSTUS gene 33704 34654 0.7 - . g131 3_related_000066F_1 AUGUSTUS transcript 33704 34654 0.7 - . g131.t1 3_related_000066F_1 AUGUSTUS stop_codon 33704 33706 . - 0 transcript_id "g131.t1"; gene_id "g131"; 3_related_000066F_1 AUGUSTUS CDS 33704 34654 0.7 - 0 transcript_id "g131.t1"; gene_id "g131"; 3_related_000066F_1 AUGUSTUS start_codon 34652 34654 . - 0 transcript_id "g131.t1"; gene_id "g131"; # protein sequence = [MRRAREPVQRMKGRKAEEAARKKAAEEAAKKKEAAARAGVARRKVAQEAQEWAIQAQQQEEEIVEQRRLLANAATTRS # QRGTSSSEVSASPRRPIVETRRTVKGKGRAKAQVSDNTLLISSSLTLLFSLLVGTLMMTKMRGLLMNDAGVRRSLVRCRLARGVPSYANPVPELVEQL # GSHDAKVRCSYSRWPSTVKQEGGGNPTGGHLAVLESQMAQLLADNQQLQEGQVKANTYHCHIDRKLDWLMMDAARQRSSLPEMLEAGPSELPRKRKMV # VDSKEEEEEEREKEREGEEEEEVDKEPVPRKAQSEKGKEREE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g131 ### # start gene g132 3_related_000066F_1 AUGUSTUS gene 38339 39184 0.8 - . g132 3_related_000066F_1 AUGUSTUS transcript 38339 39184 0.8 - . g132.t1 3_related_000066F_1 AUGUSTUS stop_codon 38339 38341 . - 0 transcript_id "g132.t1"; gene_id "g132"; 3_related_000066F_1 AUGUSTUS CDS 38339 39184 0.8 - 0 transcript_id "g132.t1"; gene_id "g132"; 3_related_000066F_1 AUGUSTUS start_codon 39182 39184 . - 0 transcript_id "g132.t1"; gene_id "g132"; # protein sequence = [MVPEQYRDFKKVFSESASKRLPAHQPWDHAIDLIPGALATMRTKIYPMSLNEQEELDHFLEENLQKGYIVPSKSPISS # PVFFVKKKDGKLHFVQDYQKLNKYTVKNRYPFPLFADIISRLQGARYFMKFDVRWGYNNIWIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPITFQAL # MNAIFADLIAAGKVAVYLDDILIFSNDLEEHQQVVREVLTRLEKHHLYLRPEKCELEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPIPTNLRELRGF # LGFANFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g132 ### # start gene g133 3_related_000066F_1 AUGUSTUS gene 39212 41162 0.21 - . g133 3_related_000066F_1 AUGUSTUS transcript 39212 41162 0.21 - . g133.t1 3_related_000066F_1 AUGUSTUS stop_codon 39212 39214 . - 0 transcript_id "g133.t1"; gene_id "g133"; 3_related_000066F_1 AUGUSTUS CDS 39212 40023 0.65 - 2 transcript_id "g133.t1"; gene_id "g133"; 3_related_000066F_1 AUGUSTUS CDS 40196 40369 0.6 - 2 transcript_id "g133.t1"; gene_id "g133"; 3_related_000066F_1 AUGUSTUS CDS 40425 40804 0.49 - 1 transcript_id "g133.t1"; gene_id "g133"; 3_related_000066F_1 AUGUSTUS CDS 40921 41162 0.28 - 0 transcript_id "g133.t1"; gene_id "g133"; 3_related_000066F_1 AUGUSTUS start_codon 41160 41162 . - 0 transcript_id "g133.t1"; gene_id "g133"; # protein sequence = [MSTPVPPAPNISAEDLMAQPIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARCFMAQFQNWASEQPDLAKSQVK # LINQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLREHFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPT # MTGRNSGYPLPHTAHTTPADPHAMDIDATHTTMVPKVMSSKTAHTKKPPAITVDAEDIWKQSAKTSSWDSDETKADANRYPLRDPHHSPWFLKRVPAL # AAPRVPHNQFVMFATSLHDLHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFATRNHVRCAPLHKPINVFNIDGTPNWA # GRITHFACLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGQLSVKPPQVAIEEVPDEEILYSHLAATNTESPILELPNLEPPAEPPH # IEVPLEATLEESESAVVEEPPIHRIRANHKTRRTWVKAGILEEQTEEVWCAAGFTYSQQLAGEAN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g133 ### # start gene g134 3_related_000066F_1 AUGUSTUS gene 56593 56928 0.27 + . g134 3_related_000066F_1 AUGUSTUS transcript 56593 56928 0.27 + . g134.t1 3_related_000066F_1 AUGUSTUS start_codon 56593 56595 . + 0 transcript_id "g134.t1"; gene_id "g134"; 3_related_000066F_1 AUGUSTUS CDS 56593 56928 0.27 + 0 transcript_id "g134.t1"; gene_id "g134"; 3_related_000066F_1 AUGUSTUS stop_codon 56926 56928 . + 0 transcript_id "g134.t1"; gene_id "g134"; # protein sequence = [MKANHSGNPIYRIPNGSVGVSSDHKDLHIPRRKAKSHGWYAFRFKFIVKQEGSIPLTPRRSSNNILIAYEIIVVSRHS # TVWRGRNAPKSSRSGSNNNPISQKLFTVSSTKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g134 ### # start gene g135 3_related_000066F_1 AUGUSTUS gene 60593 61720 0.73 - . g135 3_related_000066F_1 AUGUSTUS transcript 60593 61720 0.73 - . g135.t1 3_related_000066F_1 AUGUSTUS stop_codon 60593 60595 . - 0 transcript_id "g135.t1"; gene_id "g135"; 3_related_000066F_1 AUGUSTUS CDS 60593 60898 0.98 - 0 transcript_id "g135.t1"; gene_id "g135"; 3_related_000066F_1 AUGUSTUS CDS 61037 61720 0.78 - 0 transcript_id "g135.t1"; gene_id "g135"; 3_related_000066F_1 AUGUSTUS start_codon 61718 61720 . - 0 transcript_id "g135.t1"; gene_id "g135"; # protein sequence = [MSRIEKDIKTTGAACDHYSKKNALGKLLMSGKAGQFLIAVLVRTLKARVYEDRLASHADVFTKHREEFQFLLSLYTAL # GVQSANHKLDGVTDQLKSIENKLDDVHAIFRHLDSPHERDLRNFIDERGGPDALLNNAFLLAEVLEKGEDMDESDLMGHKRRSTNLADLKADLLRELE # EDLDATLQKNFDIFDRKLEMQHQQLLDAQRQQENIILTEIRAGFLHERIKHEGWKGSVKARHFVLALRDYFVEKSAKKDPANVESGNPELNNPVSDHV # APDWDPESEDDRWTHSYISVAHVQSILEAIDDDATGFITIKEVNEFTSSRPTGWT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g135 ### # start gene g136 3_related_000066F_1 AUGUSTUS gene 63755 64525 0.42 - . g136 3_related_000066F_1 AUGUSTUS transcript 63755 64525 0.42 - . g136.t1 3_related_000066F_1 AUGUSTUS stop_codon 63755 63757 . - 0 transcript_id "g136.t1"; gene_id "g136"; 3_related_000066F_1 AUGUSTUS CDS 63755 64238 0.92 - 1 transcript_id "g136.t1"; gene_id "g136"; 3_related_000066F_1 AUGUSTUS CDS 64383 64525 0.42 - 0 transcript_id "g136.t1"; gene_id "g136"; 3_related_000066F_1 AUGUSTUS start_codon 64523 64525 . - 0 transcript_id "g136.t1"; gene_id "g136"; # protein sequence = [MALFNSVIVLLVNMWRGKHFIGSSSSDFSKELADVHRAINTFHLHENRDILMEVISVSHFHQSSQPRTISLKRPRIEN # NILPSSLATSEAVDNEDLYTTGRNGLSVAANIGNPPTASIQELAAKFALPLNSNELGSLPICEPFDWSTPQNQWGSTSANQTVDDSWAATIPYNASQF # GFYSTSSGTFTDFSREGQEVFRSVFVTLTIPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g136 ### # start gene g137 3_related_000066F_1 AUGUSTUS gene 66022 66682 0.47 - . g137 3_related_000066F_1 AUGUSTUS transcript 66022 66682 0.47 - . g137.t1 3_related_000066F_1 AUGUSTUS stop_codon 66022 66024 . - 0 transcript_id "g137.t1"; gene_id "g137"; 3_related_000066F_1 AUGUSTUS CDS 66022 66529 1 - 1 transcript_id "g137.t1"; gene_id "g137"; 3_related_000066F_1 AUGUSTUS CDS 66669 66682 0.67 - 0 transcript_id "g137.t1"; gene_id "g137"; 3_related_000066F_1 AUGUSTUS start_codon 66680 66682 . - 0 transcript_id "g137.t1"; gene_id "g137"; # protein sequence = [MVLRRLPQGRHSVQATVDAILSTRRSFEVPKDPVITKEILVNLANYIKDLEEDIAQLRQGLGTSSGTHREPPPSTALQ # LNEKGEITRSSLVPDNPFQSPDDYSIDDLTRSFKMFGEFDDNCVRHFGSSSSRALVKDALDMKKEYTGDADFVNAKPSFKRLEFWSVHPVSDFDF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g137 ### # start gene g138 3_related_000066F_1 AUGUSTUS gene 67389 69204 0.66 - . g138 3_related_000066F_1 AUGUSTUS transcript 67389 69204 0.66 - . g138.t1 3_related_000066F_1 AUGUSTUS stop_codon 67389 67391 . - 0 transcript_id "g138.t1"; gene_id "g138"; 3_related_000066F_1 AUGUSTUS CDS 67389 68624 0.97 - 0 transcript_id "g138.t1"; gene_id "g138"; 3_related_000066F_1 AUGUSTUS CDS 68692 69204 0.68 - 0 transcript_id "g138.t1"; gene_id "g138"; 3_related_000066F_1 AUGUSTUS start_codon 69202 69204 . - 0 transcript_id "g138.t1"; gene_id "g138"; # protein sequence = [MSGKRMTPGARHTTHGMHNNIIHKPGFSSSQTLLHNPSNSSRAAERMLRSTLARDETNSISEKRRRHSSATPNLVVGN # GGLESSESATTLKPHEKILRARLERVLLANVQADGTSLYGVDDGRKVRASSIEAVDMGRRRSRSRAGSDTGMLGWFWSKGSTIDDEYEDGGDEAIPLP # VPPIACPHVQAFSQTSHFARFTSPQQPALPSSPSASSPQNPSRMRSHTSPVPSNSHNAFQSSSQSLRPQHAFSLETVPSVGEMSVEEMESDVDIQADT # TKADTTRANGNTSRGVTQSLNQAQKTPRMPTPPPTPPLRRLETSGIRSTGQTPSVSGSSASNTRQNRTRRSTEPMHTTQQSALATAIRSPSRSSTPAT # ASAFLTEAKSRRKSTPVSSSVQAVKISERRRSIPASTGAGPDPRCHPQNVNNSAGQIDFVQSGNHHLVVQKPDARTQHVRQSTMPVNLSSSLPSPSSA # SYLQTRHRLSNSTSNPLPHSPIHPSSSSSMSTPSPTSPSPPSSSVPPSPSTTSSFNAHTASMRCRQIDGYVSFAAVAGLEEPHGDDEYADGPEGLAGR # SSSDRGWVGRLLGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g138 ### # start gene g139 3_related_000066F_1 AUGUSTUS gene 74906 75238 0.77 - . g139 3_related_000066F_1 AUGUSTUS transcript 74906 75238 0.77 - . g139.t1 3_related_000066F_1 AUGUSTUS stop_codon 74906 74908 . - 0 transcript_id "g139.t1"; gene_id "g139"; 3_related_000066F_1 AUGUSTUS CDS 74906 75238 0.77 - 0 transcript_id "g139.t1"; gene_id "g139"; 3_related_000066F_1 AUGUSTUS start_codon 75236 75238 . - 0 transcript_id "g139.t1"; gene_id "g139"; # protein sequence = [MYSAVENIAKQVPTATTSQIASGDFNNCFYFATEVPRRLGTANVEEFVNYHNEFAAKVKEKTNAGTQRFCARGNSTCG # DTQHQPSSTKGGKSGNTTSASTVHPITKHPSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g139 ### # start gene g140 3_related_000066F_1 AUGUSTUS gene 78843 79067 0.98 - . g140 3_related_000066F_1 AUGUSTUS transcript 78843 79067 0.98 - . g140.t1 3_related_000066F_1 AUGUSTUS stop_codon 78843 78845 . - 0 transcript_id "g140.t1"; gene_id "g140"; 3_related_000066F_1 AUGUSTUS CDS 78843 79067 0.98 - 0 transcript_id "g140.t1"; gene_id "g140"; 3_related_000066F_1 AUGUSTUS start_codon 79065 79067 . - 0 transcript_id "g140.t1"; gene_id "g140"; # protein sequence = [MWRRRWSDEEEEVEFDVEEEFDVEEEFDVEEEFDVEEEFDEEVDEEGELEFDEEVDEEGEEEEVEEFDEELEFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g140 ### # # ----- prediction on sequence number 10 (length = 142834, name = 3_related_000110F) ----- # # Predicted genes for sequence number 10 on both strands # start gene g141 3_related_000110F AUGUSTUS gene 3352 3642 0.79 - . g141 3_related_000110F AUGUSTUS transcript 3352 3642 0.79 - . g141.t1 3_related_000110F AUGUSTUS stop_codon 3352 3354 . - 0 transcript_id "g141.t1"; gene_id "g141"; 3_related_000110F AUGUSTUS CDS 3352 3642 0.79 - 0 transcript_id "g141.t1"; gene_id "g141"; 3_related_000110F AUGUSTUS start_codon 3640 3642 . - 0 transcript_id "g141.t1"; gene_id "g141"; # protein sequence = [MNTRSITKLVTAAIDIDSKPVDSVSDNSSLWQVQRKPSLVSPLHDLEAVEEDGGLHLASPPYGLEVGEAVDSTSSPLR # NPEAGEVVEEEEAVDSTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g141 ### # start gene g142 3_related_000110F AUGUSTUS gene 4958 6589 0.78 + . g142 3_related_000110F AUGUSTUS transcript 4958 6589 0.78 + . g142.t1 3_related_000110F AUGUSTUS start_codon 4958 4960 . + 0 transcript_id "g142.t1"; gene_id "g142"; 3_related_000110F AUGUSTUS CDS 4958 6589 0.78 + 0 transcript_id "g142.t1"; gene_id "g142"; 3_related_000110F AUGUSTUS stop_codon 6587 6589 . + 0 transcript_id "g142.t1"; gene_id "g142"; # protein sequence = [MSDPVGQVRVCYTPLASAIVDTPEASLIACTGGKTSPFTRAIYKDFGDGKLHPPRLATATLEAIDSIQAWNIFPQDLP # AYQRASVTARTNGVVSPFWRDWPLAEPCEFLTPEPLHHWHKMFWDHDAKWAIQAVGASHIDFRFSIHQPIVGYRSFKEGISSLKQVTGRVQRDVQRYL # IPLISGAVIPKFVAALRALMDFCYAGQAPRFNQASTLRVQTALNEFHKNKDIIQDLKAHVNPKGVPIVHWEIPKFEFMQSVAPSISASGPIMQWTADT # TEHAHITLVKDPARSGNNHDFEVQICRHLDRQSRVRRFDLVTAMVDTGVDFRLDDIEGDEGRGDIGHDREERDERDKEDKEVDAKISSSEELMTRLHP # VSQKLFGSFRPKQNFFLKARLLKQDASALLPLRIFTDNISGEISAFKVNRDPDLKTLTIEQVSNLYSLPDFSGACLDFLERIQAKTQTFVIGGRRSLN # QLISLPFTRVKVWSRIRIQTKTYFNTDLLVDSHTIFAAPPSPGWEFGRQNAAVVNINSSFEWPRSSLEGGLNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g142 ### # start gene g143 3_related_000110F AUGUSTUS gene 11944 12731 0.43 - . g143 3_related_000110F AUGUSTUS transcript 11944 12731 0.43 - . g143.t1 3_related_000110F AUGUSTUS stop_codon 11944 11946 . - 0 transcript_id "g143.t1"; gene_id "g143"; 3_related_000110F AUGUSTUS CDS 11944 12534 0.67 - 0 transcript_id "g143.t1"; gene_id "g143"; 3_related_000110F AUGUSTUS CDS 12606 12731 0.58 - 0 transcript_id "g143.t1"; gene_id "g143"; 3_related_000110F AUGUSTUS start_codon 12729 12731 . - 0 transcript_id "g143.t1"; gene_id "g143"; # protein sequence = [MQTSESINFLAAFGGYGFTSRQWGLALDTIFAINAVLANGTISLTPIQALKGAAPSFAITTSIEINTYAAPSYAIVME # YTWSNMDYETAGQSMYSFQNFSLSGPASPFAGELVISAGSEEGQVTFGFTGAWYGEEGSAIPTIQPWLDTMPTPTQTSLIGDGSYIDTVSQLSGTSLN # TSQATDSTDTFYAKSIMTPENDPMTLESCTAFMQYLATQGFHSNTVSHSHSFSKFYLRQLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g143 ### # start gene g144 3_related_000110F AUGUSTUS gene 16239 16607 0.67 + . g144 3_related_000110F AUGUSTUS transcript 16239 16607 0.67 + . g144.t1 3_related_000110F AUGUSTUS start_codon 16239 16241 . + 0 transcript_id "g144.t1"; gene_id "g144"; 3_related_000110F AUGUSTUS CDS 16239 16607 0.67 + 0 transcript_id "g144.t1"; gene_id "g144"; 3_related_000110F AUGUSTUS stop_codon 16605 16607 . + 0 transcript_id "g144.t1"; gene_id "g144"; # protein sequence = [MVDRAENPTMDTDVLTKVLGKGSEALEYLGSENKALDDNESDSKEDIEEYGVFKDVFYGDIVLTDCLRPPDENNDPAA # AMIPQIVRELVDFEDDPTMPVITWRYEAIVKYRVSRSIHTLAMT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g144 ### # start gene g145 3_related_000110F AUGUSTUS gene 21534 22646 0.18 - . g145 3_related_000110F AUGUSTUS transcript 21534 22646 0.18 - . g145.t1 3_related_000110F AUGUSTUS stop_codon 21534 21536 . - 0 transcript_id "g145.t1"; gene_id "g145"; 3_related_000110F AUGUSTUS CDS 21534 22229 0.39 - 0 transcript_id "g145.t1"; gene_id "g145"; 3_related_000110F AUGUSTUS CDS 22542 22646 0.3 - 0 transcript_id "g145.t1"; gene_id "g145"; 3_related_000110F AUGUSTUS start_codon 22644 22646 . - 0 transcript_id "g145.t1"; gene_id "g145"; # protein sequence = [MSRKGSKGSKTEVASYEVGDIVLGKVRGYPPWPGRGYKIARDPTEWAQDLAEKAATKAEEEEARGDIDEEDELVDDGE # RPAGSKKRKAPNASASTATKKRKRNSEPGTTTKKGAGKGRKSKAAIESEDEEGAQEAQAASKSAPTASPPPLKRTKTTTSGKEENPDDGQLSMSSIHN # FISFYCVSFANCCSAELSKDPEATKVREWRHKLQKVFLSSKVQAPKADDMPDMNDLFTQIETYDKINIAYLSVSLSQVPKLPSILSYFSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g145 ### # start gene g146 3_related_000110F AUGUSTUS gene 26841 27697 0.45 + . g146 3_related_000110F AUGUSTUS transcript 26841 27697 0.45 + . g146.t1 3_related_000110F AUGUSTUS start_codon 26841 26843 . + 0 transcript_id "g146.t1"; gene_id "g146"; 3_related_000110F AUGUSTUS CDS 26841 26959 0.45 + 0 transcript_id "g146.t1"; gene_id "g146"; 3_related_000110F AUGUSTUS CDS 27028 27697 0.74 + 1 transcript_id "g146.t1"; gene_id "g146"; 3_related_000110F AUGUSTUS stop_codon 27695 27697 . + 0 transcript_id "g146.t1"; gene_id "g146"; # protein sequence = [MAYASALGIATVGANNGHNGTSGKAFLRNPDVVEDYASRSVHTGVVIGKAISKQFYGKSHTKSYYLGCSTGGRQGLKS # VQDFPEDFDGVIAGAPANAFSGLLSWSGRHYGITGPPGSESFITEEQWKNLVHPDIMQQCDTIDGVADGVIEDPNLCDYKPERLICSSNVRDKSKCLS # GGQARAIRKIFSPLYSPEGELWFPRQQPGSEDASIIAAMYSGKPFPFTVVRIKRSKPSHRGSRSHYARRIGSVIVFTMIQNSTLPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g146 ### # start gene g147 3_related_000110F AUGUSTUS gene 37657 38022 0.66 - . g147 3_related_000110F AUGUSTUS transcript 37657 38022 0.66 - . g147.t1 3_related_000110F AUGUSTUS stop_codon 37657 37659 . - 0 transcript_id "g147.t1"; gene_id "g147"; 3_related_000110F AUGUSTUS CDS 37657 38022 0.66 - 0 transcript_id "g147.t1"; gene_id "g147"; 3_related_000110F AUGUSTUS start_codon 38020 38022 . - 0 transcript_id "g147.t1"; gene_id "g147"; # protein sequence = [MKLIHHGGYNDNERESYKEIIFSNTVQSMRAILDALPSLDLSLNPSNDARRATILALPLQLEVDVMPRDVADSIKGIW # NDPAVKEAVRRSREFQLNDSAVYYFNSIDRMSGPVCSRAIGSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g147 ### # start gene g148 3_related_000110F AUGUSTUS gene 39113 39906 0.66 + . g148 3_related_000110F AUGUSTUS transcript 39113 39906 0.66 + . g148.t1 3_related_000110F AUGUSTUS start_codon 39113 39115 . + 0 transcript_id "g148.t1"; gene_id "g148"; 3_related_000110F AUGUSTUS CDS 39113 39129 0.66 + 0 transcript_id "g148.t1"; gene_id "g148"; 3_related_000110F AUGUSTUS CDS 39234 39906 1 + 1 transcript_id "g148.t1"; gene_id "g148"; 3_related_000110F AUGUSTUS stop_codon 39904 39906 . + 0 transcript_id "g148.t1"; gene_id "g148"; # protein sequence = [MKEQQNNAIEGELEALCDAYYEELQSNTLTIYQPRYVSSGGTIPPPPGPGPFPCSVELDINGAVVGHPGYPQHVAPHN # HRPNNANAKVVRGGKGQLQPQRTKFPVNGRGNPPPESEFDDADDGPNVDPDADLGVDEYEEEDDDGEDYEEEDEEDEEEDPNPDPDDEELGPNPNSPV # HPGVNDVGIGRGRGTPIRPGTTSQLGVRGGAGGGRGRGCGAESPLNGTENRKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g148 ### # start gene g149 3_related_000110F AUGUSTUS gene 40280 41285 0.22 + . g149 3_related_000110F AUGUSTUS transcript 40280 41285 0.22 + . g149.t1 3_related_000110F AUGUSTUS start_codon 40280 40282 . + 0 transcript_id "g149.t1"; gene_id "g149"; 3_related_000110F AUGUSTUS CDS 40280 40453 0.23 + 0 transcript_id "g149.t1"; gene_id "g149"; 3_related_000110F AUGUSTUS CDS 41010 41285 0.79 + 0 transcript_id "g149.t1"; gene_id "g149"; 3_related_000110F AUGUSTUS stop_codon 41283 41285 . + 0 transcript_id "g149.t1"; gene_id "g149"; # protein sequence = [MMEQLAERRMQREEEAVGDLDSEDEEDKDKEDGSEDEEVLESEDDDEDLDRRRQRRMKELAKESEKARRDAEKPASTN # AAKAQQTAPEEEQRKKREERVEREALRKAQEFEKAKKEEEKRKTKDEERKKRIEVEKEQEKELGRKWFRRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g149 ### # start gene g150 3_related_000110F AUGUSTUS gene 42854 43183 0.91 - . g150 3_related_000110F AUGUSTUS transcript 42854 43183 0.91 - . g150.t1 3_related_000110F AUGUSTUS stop_codon 42854 42856 . - 0 transcript_id "g150.t1"; gene_id "g150"; 3_related_000110F AUGUSTUS CDS 42854 43183 0.91 - 0 transcript_id "g150.t1"; gene_id "g150"; 3_related_000110F AUGUSTUS start_codon 43181 43183 . - 0 transcript_id "g150.t1"; gene_id "g150"; # protein sequence = [MVAGEALKDFEPLYGEFHLPRKFKVAIAVPPTNDVGVFANDLGIIAIVDDNGELTGFNVTVGGGLGVTHGNKKTYPRT # GDLIGFCTPEQGKYVAEMVMLTRRDNGNRAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g150 ### # start gene g151 3_related_000110F AUGUSTUS gene 57057 57592 0.4 + . g151 3_related_000110F AUGUSTUS transcript 57057 57592 0.4 + . g151.t1 3_related_000110F AUGUSTUS start_codon 57057 57059 . + 0 transcript_id "g151.t1"; gene_id "g151"; 3_related_000110F AUGUSTUS CDS 57057 57231 0.4 + 0 transcript_id "g151.t1"; gene_id "g151"; 3_related_000110F AUGUSTUS CDS 57309 57592 1 + 2 transcript_id "g151.t1"; gene_id "g151"; 3_related_000110F AUGUSTUS stop_codon 57590 57592 . + 0 transcript_id "g151.t1"; gene_id "g151"; # protein sequence = [MKHSTTTTGELLSEQDKRNLAATDEKAAGCSTLPRLTPGISEHTHIVSTSPHNDRQQRLIHETTETTETTETTETTET # TETTETNETNETNETNETNETNETNETNETNETNETNETNETNETNVTYLPDTSSLFAPESYLLGTSSLFAPES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g151 ### # start gene g152 3_related_000110F AUGUSTUS gene 57753 60168 0.44 - . g152 3_related_000110F AUGUSTUS transcript 57753 60168 0.44 - . g152.t1 3_related_000110F AUGUSTUS stop_codon 57753 57755 . - 0 transcript_id "g152.t1"; gene_id "g152"; 3_related_000110F AUGUSTUS CDS 57753 58632 1 - 1 transcript_id "g152.t1"; gene_id "g152"; 3_related_000110F AUGUSTUS CDS 58697 60168 0.44 - 0 transcript_id "g152.t1"; gene_id "g152"; 3_related_000110F AUGUSTUS start_codon 60166 60168 . - 0 transcript_id "g152.t1"; gene_id "g152"; # protein sequence = [MSSANTPLATYLHHVEGFLYRRRQAIYTSANEDRTVVKTWRDARIPVFWQTSHLRMPIHHLIPQCDSLLELKGSLKFP # TGSWVEIQNHLYKGDMGCVITSDNDARMKDAAETMRLVLLVPRLPTNARILEDFLKDQKKLHKRLRRNGRSRTSLFTTRPEPALFDIEFTQTFTASVK # IEKPQHVGCFDCNNPQSCLPFHRSLYWYLDHLLEARLTTVVLDESDMKKAPPLMDPKVFDMFADSKHPLLNSIATSAMPPPSNWIFEQHDRVRVAHFD # GNKLPLHSAFTRLQDLDGVLEEVLELECVVVFGEFDRERIPKVSLRKSFSVGDCVQTPAQDSVGLVIGDGDKPWSKVVFFHNLSLAFHVNVLRQVSGG # KAAPIHQDTGAEHGPNLPSGSVNNFAEVSPEAPYISKQDQNSLNHEPLSIEKTVNTPPPPWVGIRCICIKHSARKGFHAVVKDVGRDLSLKSGLKVLI # SYDNPNFPEDWVDYDDLRRQETFRFLDDDPIQKEATRDSYYHFKSGYEPRYTNYETDALQEARLANEKADVEAQYKCSAHAELSRAVSYPIPTSADNW # MLDPRLKLSLGFLQFYVIIRRGPYALDPPVDTPVYLAYNIDNELQIFLRTGRQQSDTVEVPITDIYEPGAPKTQKIPRTVARLRGLYMIVDGEEENPM # LNDNIGKLVRRITNVPDGSLEGNDLVVCKVVRVHRLPGRGMNYAEELTREPLLTVPRRYLVEVEESEYMRQKGNSLVAQIRLKAQPPGQVLQLDLDFS # GRRTKKRKPKEVSQHHLNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g152 ### # start gene g153 3_related_000110F AUGUSTUS gene 77408 78622 0.39 + . g153 3_related_000110F AUGUSTUS transcript 77408 78622 0.39 + . g153.t1 3_related_000110F AUGUSTUS start_codon 77408 77410 . + 0 transcript_id "g153.t1"; gene_id "g153"; 3_related_000110F AUGUSTUS CDS 77408 78622 0.39 + 0 transcript_id "g153.t1"; gene_id "g153"; 3_related_000110F AUGUSTUS stop_codon 78620 78622 . + 0 transcript_id "g153.t1"; gene_id "g153"; # protein sequence = [MNWQRKDRMLSFSKRNSGWVERMFASIFAPETLAGYWIVQNSDAEFPGDETDDEDDLPYLDLSEVHKVQASSSYPSVD # TRKIAMPLTSPTPKPTTQPHGIPRRALSSVFAGPPKSSFLKDIKFRKKPSCSTTPIAIAQYADPGSSCESLSTSSASYPSVSVPTSFSEPISTQSWSS # SSLSAQSLRKSYSQPEPLKFVECHSLPVKAQQFSIQPGARLLNPPGLSEEALGKRKALNDRVKPHVKRGGPAKPRPSTVLANSSTSRYQSHVSHTHHD # AYHAQNLYEARDDHLIPGCIGQRGFSSRTSAVSASGPSTRFGGPQVSNDLVKIPSSQGNQNGHIHQFYSPHAHVQTSTQTNAHIPGLTSPPPIAVVGS # AFLGDGAESGVEAEATIGQRGHDEPDTHCDGC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g153 ### # start gene g154 3_related_000110F AUGUSTUS gene 78678 79169 0.56 + . g154 3_related_000110F AUGUSTUS transcript 78678 79169 0.56 + . g154.t1 3_related_000110F AUGUSTUS start_codon 78678 78680 . + 0 transcript_id "g154.t1"; gene_id "g154"; 3_related_000110F AUGUSTUS CDS 78678 78704 0.58 + 0 transcript_id "g154.t1"; gene_id "g154"; 3_related_000110F AUGUSTUS CDS 78759 79169 0.97 + 0 transcript_id "g154.t1"; gene_id "g154"; 3_related_000110F AUGUSTUS stop_codon 79167 79169 . + 0 transcript_id "g154.t1"; gene_id "g154"; # protein sequence = [MLQLQRPGQTIATCNTLPQPQLNGSLDGFLNMPRRDPGIGHEITNRNSSVHGDHRGVDVGEWLIPSLGTGRIPEAGDQ # VNSGIEPGLYSGLSRNSRAEIEISTPDHPAIQFGQQKHTSMPPDAGSNATIHQSLYFVLRGGQACYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g154 ### # start gene g155 3_related_000110F AUGUSTUS gene 83567 83902 0.93 - . g155 3_related_000110F AUGUSTUS transcript 83567 83902 0.93 - . g155.t1 3_related_000110F AUGUSTUS stop_codon 83567 83569 . - 0 transcript_id "g155.t1"; gene_id "g155"; 3_related_000110F AUGUSTUS CDS 83567 83902 0.93 - 0 transcript_id "g155.t1"; gene_id "g155"; 3_related_000110F AUGUSTUS start_codon 83900 83902 . - 0 transcript_id "g155.t1"; gene_id "g155"; # protein sequence = [MHETEPNHDSNHKEEEIPHQVSESHNLNAKVKTTLMPAEQDNQQRANSVNEPLNDVDSSIKDFVDVNSPVDQFKKNEK # TYTKQENERLHRELKGEPITTPGFFLDATRQTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g155 ### # start gene g156 3_related_000110F AUGUSTUS gene 102834 103580 0.19 - . g156 3_related_000110F AUGUSTUS transcript 102834 103580 0.19 - . g156.t1 3_related_000110F AUGUSTUS stop_codon 102834 102836 . - 0 transcript_id "g156.t1"; gene_id "g156"; 3_related_000110F AUGUSTUS CDS 102834 103466 0.7 - 0 transcript_id "g156.t1"; gene_id "g156"; 3_related_000110F AUGUSTUS CDS 103560 103580 0.19 - 0 transcript_id "g156.t1"; gene_id "g156"; 3_related_000110F AUGUSTUS start_codon 103578 103580 . - 0 transcript_id "g156.t1"; gene_id "g156"; # protein sequence = [MSNSILRDKIITIDSLDLASPKFLPPTTYATVLRHDINISTLAGHQMLGMFTKFAPNAQTEAAIKKFNTNKEVYHEIV # ANDCSKAGEVLQLPVPPKKDRNGCDNPADTSMKRSLHSSASGSPHTKHALIKAETPLTKMPHQLDFKLQVKMQYKYQADGDKKSRQDAESKKIESEKK # IQLLPFAQRRYKNLHFLDDALAEEEEEPSAFTSALEFPLIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g156 ### # start gene g157 3_related_000110F AUGUSTUS gene 104015 104626 0.82 - . g157 3_related_000110F AUGUSTUS transcript 104015 104626 0.82 - . g157.t1 3_related_000110F AUGUSTUS stop_codon 104015 104017 . - 0 transcript_id "g157.t1"; gene_id "g157"; 3_related_000110F AUGUSTUS CDS 104015 104626 0.82 - 0 transcript_id "g157.t1"; gene_id "g157"; 3_related_000110F AUGUSTUS start_codon 104624 104626 . - 0 transcript_id "g157.t1"; gene_id "g157"; # protein sequence = [MDQEPTLDSNLQPTLFPETILAPAPIHPNCVRFASNPVDRGSGGVWIVDLGYQRLISMTVFQLPDLLHLLSPTNLDPL # LSINGTSPLLSLTTPPSLSLLTSPAVSNSYDFPKEYTIGIRQFVSLRKPRQNSTSLPLVCDPEEYDFGTPNTVPEDRAVFFVMATTEKVNQPTTLSSS # CRTSKTSPSSSVKALTIFPVSNMSPSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g157 ### # start gene g158 3_related_000110F AUGUSTUS gene 113964 115079 0.61 - . g158 3_related_000110F AUGUSTUS transcript 113964 115079 0.61 - . g158.t1 3_related_000110F AUGUSTUS stop_codon 113964 113966 . - 0 transcript_id "g158.t1"; gene_id "g158"; 3_related_000110F AUGUSTUS CDS 113964 115079 0.61 - 0 transcript_id "g158.t1"; gene_id "g158"; 3_related_000110F AUGUSTUS start_codon 115077 115079 . - 0 transcript_id "g158.t1"; gene_id "g158"; # protein sequence = [MNQTLNLLIENSKRWKSAKIDIADSGFTPNFLLSRSLKNTCGILELSVPTPNLEDLEIDNHNWRNTACKIFPVCPRLK # KFTANHLSWGPAFTGHNFFELVELHMGSDGGLFGPSIAHFLLGMPSLQTASIAKFCKTDDVAAELTSPHESSVTSLRIWTGTFQCPTAWRGLEFPQLK # TLEVFHPATTIDLEYTCFTSILHSASSLQVLELKCLPEEMAVAFLAACPSISTLSLLLQYPDGTELLKRMMLGLTEYPIASKLSSLIIRVSTLNYRFL # QMPGSHLRFRQFRTQLSETLRLLLKSRSASLQSGLHCSSYHLEHFVLDVTDVDEGREEAWSKLSLLAPGFKTFKIIRRRFRVGNEWTSESLQSALEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g158 ### # start gene g159 3_related_000110F AUGUSTUS gene 131226 131585 0.96 + . g159 3_related_000110F AUGUSTUS transcript 131226 131585 0.96 + . g159.t1 3_related_000110F AUGUSTUS start_codon 131226 131228 . + 0 transcript_id "g159.t1"; gene_id "g159"; 3_related_000110F AUGUSTUS CDS 131226 131585 0.96 + 0 transcript_id "g159.t1"; gene_id "g159"; 3_related_000110F AUGUSTUS stop_codon 131583 131585 . + 0 transcript_id "g159.t1"; gene_id "g159"; # protein sequence = [MWTTSTPKYSEIKNVRASLSSFAAQISIQHAVLQAKRAVKPENGLHIRLTAKSDSGASKNHIQSEWKDIGANTVSQVS # KIIHTHEPFLFDFLSCIASGTSDVGDIAARKTRPIDIVRAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g159 ### # start gene g160 3_related_000110F AUGUSTUS gene 132128 133036 0.47 - . g160 3_related_000110F AUGUSTUS transcript 132128 133036 0.47 - . g160.t1 3_related_000110F AUGUSTUS stop_codon 132128 132130 . - 0 transcript_id "g160.t1"; gene_id "g160"; 3_related_000110F AUGUSTUS CDS 132128 133036 0.47 - 0 transcript_id "g160.t1"; gene_id "g160"; 3_related_000110F AUGUSTUS start_codon 133034 133036 . - 0 transcript_id "g160.t1"; gene_id "g160"; # protein sequence = [MYHQDKKSGGDPRTVLKRMREYTSLSAEYNEQTRVFMQSGDCLVVFATSSLAVGVDVDNVQDVIVFGDPEDVNELIQM # IGRIRPRWQQSGNRPTHRGIIYFFPNASERAERAIILKDVTASSKFSELENAANEMDKGLAQLYRARCKTAEIDAQFQNPSNDKLCQCPTCRNFPFLP # TQITCICSGCVPEETMSAKTKPSKISSDESELPKKHNLRISKAMRTHGTRQLKQFRLHIFRTADPRTAGLLSPAMFFSDDEIKSVLDHFDQIKEVSDV # SQVVKSNHHLNAHHQELLTWGTHTEKGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g160 ### # start gene g161 3_related_000110F AUGUSTUS gene 139734 140210 0.4 + . g161 3_related_000110F AUGUSTUS transcript 139734 140210 0.4 + . g161.t1 3_related_000110F AUGUSTUS start_codon 139734 139736 . + 0 transcript_id "g161.t1"; gene_id "g161"; 3_related_000110F AUGUSTUS CDS 139734 140210 0.4 + 0 transcript_id "g161.t1"; gene_id "g161"; 3_related_000110F AUGUSTUS stop_codon 140208 140210 . + 0 transcript_id "g161.t1"; gene_id "g161"; # protein sequence = [MNSIIWAMKHSARDLGDTGLHSKSIAQMSRFTISNTSRFTTDYTLLFNIVCFEILEAFSSSSPEVAEVAHAFYSQYFL # VIVQEIFYVMTDSEHKSGFSLQASVLARMFKIVNETGMPAEVLNPTANVITGTSTSNMTTEFFQNYCVKLLSSAFPHVHG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g161 ### # # ----- prediction on sequence number 11 (length = 5052648, name = 4) ----- # # Predicted genes for sequence number 11 on both strands # start gene g162 4 AUGUSTUS gene 692 2223 0.59 - . g162 4 AUGUSTUS transcript 692 2223 0.59 - . g162.t1 4 AUGUSTUS stop_codon 692 694 . - 0 transcript_id "g162.t1"; gene_id "g162"; 4 AUGUSTUS CDS 692 1234 0.82 - 0 transcript_id "g162.t1"; gene_id "g162"; 4 AUGUSTUS CDS 1282 2223 0.62 - 0 transcript_id "g162.t1"; gene_id "g162"; 4 AUGUSTUS start_codon 2221 2223 . - 0 transcript_id "g162.t1"; gene_id "g162"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQRPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSRDTKRSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRCNNFRRQQLIAGTHPNRSSWDGSSTEGGNPSILPSHIAHEGGSPTEEILRASGSNDPERVQQPKDPENGNPG # LEQGGVVKELDEEVSKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGSYDPPVP # PRELLSCLPRKRMVLYDSASTIEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g162 ### # start gene g163 4 AUGUSTUS gene 2903 6339 0.17 - . g163 4 AUGUSTUS transcript 2903 6339 0.17 - . g163.t1 4 AUGUSTUS stop_codon 2903 2905 . - 0 transcript_id "g163.t1"; gene_id "g163"; 4 AUGUSTUS CDS 2903 4048 0.81 - 0 transcript_id "g163.t1"; gene_id "g163"; 4 AUGUSTUS CDS 5362 6339 0.24 - 0 transcript_id "g163.t1"; gene_id "g163"; 4 AUGUSTUS start_codon 6337 6339 . - 0 transcript_id "g163.t1"; gene_id "g163"; # protein sequence = [MESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAVSEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSS # LLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEILGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQW # LMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRILYRASNYRSGAVRFEPPPSRVNIPNYQAIQILR # NANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRSIERSRTTSESRGTGSKRTGRRSGGGAPPPPPPPPPPSGGPGDSNS # EGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHHKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAW # KTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFI # RFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLHGEKVLQGWLSRFPGLELAPEAPYKSPLRREE # SQLMYGPPIRNQLRQEGSKAGPTGKRDDRGRPQLGGRRKLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g163 ### # start gene g164 4 AUGUSTUS gene 11208 12460 0.22 - . g164 4 AUGUSTUS transcript 11208 12460 0.22 - . g164.t1 4 AUGUSTUS stop_codon 11208 11210 . - 0 transcript_id "g164.t1"; gene_id "g164"; 4 AUGUSTUS CDS 11208 11408 0.89 - 0 transcript_id "g164.t1"; gene_id "g164"; 4 AUGUSTUS CDS 12173 12460 0.3 - 0 transcript_id "g164.t1"; gene_id "g164"; 4 AUGUSTUS start_codon 12458 12460 . - 0 transcript_id "g164.t1"; gene_id "g164"; # protein sequence = [MAAKSKGEVLVFRRGHIPVQESKSSDDEESAQPVQQLVVDVDEKVKRDGTVSGLQKQTSIFHWEDVCYHINIKGEGHR # LLDNVDGWVEPGTLTALMTSTVREALIFSAHLRQPQDVPDAEKVAYCSEVIRLLGMEKYADAVVGVPGEGACSGSEIVESFFYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g164 ### # start gene g165 4 AUGUSTUS gene 26068 27771 0.26 + . g165 4 AUGUSTUS transcript 26068 27771 0.26 + . g165.t1 4 AUGUSTUS start_codon 26068 26070 . + 0 transcript_id "g165.t1"; gene_id "g165"; 4 AUGUSTUS CDS 26068 26643 0.38 + 0 transcript_id "g165.t1"; gene_id "g165"; 4 AUGUSTUS CDS 26725 27771 0.41 + 0 transcript_id "g165.t1"; gene_id "g165"; 4 AUGUSTUS stop_codon 27769 27771 . + 0 transcript_id "g165.t1"; gene_id "g165"; # protein sequence = [MLVVHEEAVPLQGAPLGTPFVTGVQTNRPGMVVDSAHSQESVAMIQQQARVIEMLQEQLREVKKGFTAGEVPTGGPLS # KTGNTAGLFGRAPRVMREYTRGGPSPVVPQPRSWQAMEPISFNQNTPTGAKDGNPQVEQAGQIPATPSVDQRRIHEWGARVQRAELGEYGRPEGGAYA # LENEGGGKGGFNPPPRGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSDEGEQNQSSRNGGRREEDRGELPTGAPEVPPTRYDLDQPWYYNPRQGWHRKA # APRPPNEGRSTWESNEEKNQITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLKGEYTCL # KDWTEFKREFGSKFGPIDEADEARRRLAWMKQMLEESFANFFIRFNEYAPLTGFNDKALITYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGA # VRAQAESLRNLHGKKPLQGWLSRFPGLELGPEAPYKSPLRREREPADVWTSNPKPAATGRFQNRPNWKEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g165 ### # start gene g166 4 AUGUSTUS gene 28497 28955 0.71 + . g166 4 AUGUSTUS transcript 28497 28955 0.71 + . g166.t1 4 AUGUSTUS start_codon 28497 28499 . + 0 transcript_id "g166.t1"; gene_id "g166"; 4 AUGUSTUS CDS 28497 28955 0.71 + 0 transcript_id "g166.t1"; gene_id "g166"; 4 AUGUSTUS stop_codon 28953 28955 . + 0 transcript_id "g166.t1"; gene_id "g166"; # protein sequence = [MRHPKNLVNLTNSIPLELFDGQPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHSPVIDWKE # LCLTFQDQNVRISAALASEIVQPGAKGGTEELGRGVNGEGIHKGTLQPPPEAPQPPPEVPQQSPEAPLRAPRTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g166 ### # start gene g167 4 AUGUSTUS gene 29057 30343 0.83 + . g167 4 AUGUSTUS transcript 29057 30343 0.83 + . g167.t1 4 AUGUSTUS start_codon 29057 29059 . + 0 transcript_id "g167.t1"; gene_id "g167"; 4 AUGUSTUS CDS 29057 30343 0.83 + 0 transcript_id "g167.t1"; gene_id "g167"; 4 AUGUSTUS stop_codon 30341 30343 . + 0 transcript_id "g167.t1"; gene_id "g167"; # protein sequence = [MGINKWLAFASESTEEEVEEILEAGRSAMEKVTPKPAKDSEEAYQKWKSRDTERSSSWPGAKQKVQWRKKRRKHGPYP # DLPTLDIESLNIPKIPSRTGLTPKGSIRRNNLRRKQLIAGTHVVERKSDPTIQEKPISLIGVAGMDCLLRKGTPAYFLHISPTKEESPTEEILRASDS # NDPERVQQPKDPESGNPSPGQGGVVKELDEEVSKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSL # KEYIDEMLGKGFIRSSSSPTGAPVLFAKNKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRY # GSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEESHVEHC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g167 ### # start gene g168 4 AUGUSTUS gene 31038 31907 0.61 + . g168 4 AUGUSTUS transcript 31038 31907 0.61 + . g168.t1 4 AUGUSTUS start_codon 31038 31040 . + 0 transcript_id "g168.t1"; gene_id "g168"; 4 AUGUSTUS CDS 31038 31907 0.61 + 0 transcript_id "g168.t1"; gene_id "g168"; 4 AUGUSTUS stop_codon 31905 31907 . + 0 transcript_id "g168.t1"; gene_id "g168"; # protein sequence = [MDWPKPRTVKELQAFLGFANFYRRFIDNYLGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPV # VLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISVELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAEL # LSGYDFVINYCPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALRRIARNEEESLVCEDRL # IKRGGRIYVPDIGIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g168 ### # start gene g169 4 AUGUSTUS gene 32517 33275 0.99 + . g169 4 AUGUSTUS transcript 32517 33275 0.99 + . g169.t1 4 AUGUSTUS start_codon 32517 32519 . + 0 transcript_id "g169.t1"; gene_id "g169"; 4 AUGUSTUS CDS 32517 33275 0.99 + 0 transcript_id "g169.t1"; gene_id "g169"; 4 AUGUSTUS stop_codon 33273 33275 . + 0 transcript_id "g169.t1"; gene_id "g169"; # protein sequence = [MAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYTSNLKELHAYLQERIGVANKVYAKYANQKRQEAL # DWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTILSKVGSHAYRLDLPGDLHKIHNVFHVDRLRPHFHNKFKQQTSPPPPIFVKGETEHFVEDILDSK # PKKGQPEEVEYLVKWEGYNDEFNSWVGWEGMVGSIELLRSWHKHHPRKRQPSRLQWASLEREAQEDEEEDREGRRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g169 ### # start gene g170 4 AUGUSTUS gene 34970 36157 0.39 - . g170 4 AUGUSTUS transcript 34970 36157 0.39 - . g170.t1 4 AUGUSTUS stop_codon 34970 34972 . - 0 transcript_id "g170.t1"; gene_id "g170"; 4 AUGUSTUS CDS 34970 36157 0.39 - 0 transcript_id "g170.t1"; gene_id "g170"; 4 AUGUSTUS start_codon 36155 36157 . - 0 transcript_id "g170.t1"; gene_id "g170"; # protein sequence = [MSPTPTRPLSRTPSPLLPTLTALGEVPSPAPESDGEVEADQLAFTIKLPSRLQLQLFETVFNTGKSLSAYCQDDPLWP # ILAEVASPCTNCLKTPGKCKVLPSSPRCTNCSSKKICSLGKILRYRYFARHCNQDLAYSRRFLELHGTPAHKSTWGIPLTAWREYDSALHARTSSTSI # LLELNMLDEQDAVDADQQELQQFLTLQQSEAAVAAKRKCNRSPMPVAGPSSKKIRSDAPKKRSHRKSPAVEVNAEPFRRVRLVVPPVCSVAPTSLPVP # PPASPSLMGVLNRDLPTQGPSDLVWLATVVELHSGLVQQAGSSPSARTPIKGAGQDLLSSPMPPTPRPALVPRTFTAHPYRAENQHLAARVRELESQL # ADSQRENSSLTSALRDTSHALKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g170 ### # start gene g171 4 AUGUSTUS gene 38182 39230 0.21 - . g171 4 AUGUSTUS transcript 38182 39230 0.21 - . g171.t1 4 AUGUSTUS stop_codon 38182 38184 . - 0 transcript_id "g171.t1"; gene_id "g171"; 4 AUGUSTUS CDS 38182 38838 0.45 - 0 transcript_id "g171.t1"; gene_id "g171"; 4 AUGUSTUS CDS 38935 39103 0.35 - 1 transcript_id "g171.t1"; gene_id "g171"; 4 AUGUSTUS CDS 39151 39230 0.37 - 0 transcript_id "g171.t1"; gene_id "g171"; 4 AUGUSTUS start_codon 39228 39230 . - 0 transcript_id "g171.t1"; gene_id "g171"; # protein sequence = [MVQQSSERYYASSTQYPLPADKAETQRLNRQHDIIVRAFDDRLSVAPISLRNGDRVLESAAGSGDSTHCPMSLFSLIR # LVLVHFPHTHPPEMHFSVNTITDLPPEWTNTFSYVHQRLLVTAMTDSLWRSAIAEISRVVQPGGWVEFLEIDFEYLRWGVGPQSKKLTTLVRNMCTQK # GMVRDMSVYLPALLEDAGFLDVQCVTQHVSIGGELNYSGNGEVNGEGRNYEQNEKVRNGYSTEEWRNLCLGMKGPIVQAGGYGIVQSGEEYEVLLEAS # SLEWKTSGETDTSFYTITARKPCESLY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g171 ### # start gene g172 4 AUGUSTUS gene 51230 53976 0.09 - . g172 4 AUGUSTUS transcript 51230 53976 0.09 - . g172.t1 4 AUGUSTUS stop_codon 51230 51232 . - 0 transcript_id "g172.t1"; gene_id "g172"; 4 AUGUSTUS CDS 51230 52270 0.99 - 0 transcript_id "g172.t1"; gene_id "g172"; 4 AUGUSTUS CDS 52349 52478 0.8 - 1 transcript_id "g172.t1"; gene_id "g172"; 4 AUGUSTUS CDS 52557 52591 0.61 - 0 transcript_id "g172.t1"; gene_id "g172"; 4 AUGUSTUS CDS 52773 53093 0.85 - 0 transcript_id "g172.t1"; gene_id "g172"; 4 AUGUSTUS CDS 53148 53189 0.93 - 0 transcript_id "g172.t1"; gene_id "g172"; 4 AUGUSTUS CDS 53497 53523 0.99 - 0 transcript_id "g172.t1"; gene_id "g172"; 4 AUGUSTUS CDS 53569 53976 0.5 - 0 transcript_id "g172.t1"; gene_id "g172"; 4 AUGUSTUS start_codon 53974 53976 . - 0 transcript_id "g172.t1"; gene_id "g172"; # protein sequence = [MDPHHRQRIHTLEDLLGNKENELKSLALDIDLKNSTVTALESKIADLHMDMEDAKQHYELQNSGAWAKVEELDVTHKK # VESMSRLLPAFTDVETKLLQKNIGLIERIFDQDTELHDLRTRLSAGKAELDKMQASSQKNLHPEALETERQTLQDSLDSMNGTTEKLSKLQSDYLQLG # DDLTFVTQQKTKLGDKLSRASEEIKRLEDNNSKLALEASDAQTKLQRAETEKNSIEEDNQQISNDFDMLKEDHDALKADHDALKVNFRHCTDTEIERI # QHALDRPRRSPSSRMIEIKYENCPRELPVLTMRKKDKCKRFENLSVCQSEKDSSEARLEDLKRKLKDAYARNLELVGEADKAHQIAQDLVDEKTRLLN # EAVEARRKVQELEDEMGQLALGDTATIDKLRDDTATANRRIQELIDEKATLERESVDAVTTAGQKVRDLEQERQRLVDGTTAAHQEIQKLVNDKATLD # RELVDAAAATRRKIQDLDKEKASLVDETAAANEEIQRLVNHKATLERRLVDEAAAASRKIQDLNNEKARLVDEGASANKRIQGLVDEKATRDQESALA # LAAANQKIQGLDDEKKKLVDQAAAAVQESASALAAANQKIEVLDDEKKGLLDNAAAAVQKFRDLDEERTKLAQCFERQKLELQSFKVSVLALFLSSSK # Y] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/7 # CDS introns: 0/6 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g172 ### # start gene g173 4 AUGUSTUS gene 56668 57321 0.87 - . g173 4 AUGUSTUS transcript 56668 57321 0.87 - . g173.t1 4 AUGUSTUS stop_codon 56668 56670 . - 0 transcript_id "g173.t1"; gene_id "g173"; 4 AUGUSTUS CDS 56668 57321 0.87 - 0 transcript_id "g173.t1"; gene_id "g173"; 4 AUGUSTUS start_codon 57319 57321 . - 0 transcript_id "g173.t1"; gene_id "g173"; # protein sequence = [MSQEIRSLFHTKPRCMLSSFVSMFNTQISSFKLPSYPQDALQSENAQKWFPSAFEYLNQDLGDDYNDLFKNWVKFERL # KDWVSSTKGLARHNRPKELSKWILNCRYDRPGNEPQLKKEHLVQFRKSFSCWWRDLRSSGWQQNSATEDPCGKLEKERESLDRSGKNGWLSVLACLKW # WGTALGDNDDRNGPLGEEWRSMVKDVSFVLNNLIAVVPNKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g173 ### # start gene g174 4 AUGUSTUS gene 57474 57988 0.4 - . g174 4 AUGUSTUS transcript 57474 57988 0.4 - . g174.t1 4 AUGUSTUS stop_codon 57474 57476 . - 0 transcript_id "g174.t1"; gene_id "g174"; 4 AUGUSTUS CDS 57474 57773 0.79 - 0 transcript_id "g174.t1"; gene_id "g174"; 4 AUGUSTUS CDS 57824 57988 0.42 - 0 transcript_id "g174.t1"; gene_id "g174"; 4 AUGUSTUS start_codon 57986 57988 . - 0 transcript_id "g174.t1"; gene_id "g174"; # protein sequence = [MVSALIFSNAHSFMNSYQKVRLIAQPSREARELQRQLLDKDRLLKELDDELDELMNCDSDQLQILEDERKQLFQQKTV # AEIKSERLQRRVDELEAELHRLKPQKLDSTGPNRASGLSANANPAGNTEVIEAKNQVFKLSSLSDDVDLIERSLEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g174 ### # start gene g175 4 AUGUSTUS gene 62690 63154 0.42 - . g175 4 AUGUSTUS transcript 62690 63154 0.42 - . g175.t1 4 AUGUSTUS stop_codon 62690 62692 . - 0 transcript_id "g175.t1"; gene_id "g175"; 4 AUGUSTUS CDS 62690 63154 0.42 - 0 transcript_id "g175.t1"; gene_id "g175"; 4 AUGUSTUS start_codon 63152 63154 . - 0 transcript_id "g175.t1"; gene_id "g175"; # protein sequence = [MLSNSKSCSSVTEDDSLESLLVPDAQGRLQFGDPKKRHKRTIQALVTVSSLTEAIRKLEERTRDLSPSRTTEEIHEAL # CTVEDGSEILRHQLLSVTHPAISEELKQAREMLDALDQVTSTWRLEYPDSSPVKINNRMHLFNLNSLVNSFSFFHI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g175 ### # start gene g176 4 AUGUSTUS gene 75574 77724 0.95 + . g176 4 AUGUSTUS transcript 75574 77724 0.95 + . g176.t1 4 AUGUSTUS start_codon 75574 75576 . + 0 transcript_id "g176.t1"; gene_id "g176"; 4 AUGUSTUS CDS 75574 77724 0.95 + 0 transcript_id "g176.t1"; gene_id "g176"; 4 AUGUSTUS stop_codon 77722 77724 . + 0 transcript_id "g176.t1"; gene_id "g176"; # protein sequence = [MAENDSLQLVWQIGEIWLKPVPVSFKDTRKGGENEMADPETDTVSFLADKDSHADVKYQQKQVFYRRMLGWADEQRAS # ENVFSKTVPLPITLSDKKMDNIEMEDASNHQNPTSTPARKIRTRSSTISERKCPTSAKRTLNEKEDREDVRISKKGRLTKPSQGFPSTPSTPRKSRYS # NRNRNAVETIDLEPEISAYPSLAFEVQVADGQDFLLDFISSQIAALRHDSRVDCDAKLSSNKDDNEIADIAFRVLENQTADGEIAGDFLWESDTKTTP # GTTSKSRLSISKTPSSTKKTPLRKRSSTLVLAHVEIPVENPTPSTPSQIQKVRNTSNTRSMTLDTLRSDSDTYTETTTPIRGRSVAPATAPRSSSNAK # KLIDIRARSVLPLSTRSMRISSSLNAITTKITTSPSLDMSANEAEPMRGNHPNTVNSDANDQSTFIHIGRQIMFERLAQEFGKTVDEISGIYSDLGNL # DNTRKVLVRLSGIGTPLGPQTSSSLGHSASRSDVSNFLPGSRQESLSVASSVKSNRNVLARSQSVAPPSRSPSLYSSTASPSFLSIPTRNESRSFLTH # PQPWSPSISSLISPSPSIASFSKLRHVNNSENDSSGSRNSADESDVLLERKKRSMQKRSTKKKRKTVNESSSLIQASTSSSSSSAQSLRKTNLTSTER # EIKNDTEAEKARNLGIATSEQQYEGSHVYMHEHRLDSLARSIELILRNGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g176 ### # start gene g177 4 AUGUSTUS gene 83969 84868 0.94 + . g177 4 AUGUSTUS transcript 83969 84868 0.94 + . g177.t1 4 AUGUSTUS start_codon 83969 83971 . + 0 transcript_id "g177.t1"; gene_id "g177"; 4 AUGUSTUS CDS 83969 84868 0.94 + 0 transcript_id "g177.t1"; gene_id "g177"; 4 AUGUSTUS stop_codon 84866 84868 . + 0 transcript_id "g177.t1"; gene_id "g177"; # protein sequence = [METDLRDDPRLNTQHNMIINAFGSKLSVAPTNLTTGDRVLESAAGSGELIIIHSSMIKRLDSLIGIWALEFFEKNRAE # GVTLDIECIDISSAQFPSTHPPEIHFSVNSIVNLPNPDWTDMFSFAHQRLLVAAMNDTLWRSAVAELFRVVKPGGWVELVEIEAQDFSSWSVGPNSTK # LASLINALYGGKGVIGDLSVYLPVILKEAGFVNVQCDPRRVTIGGEVDATPHKVTEVKGYGSDMWRNLWMGTMGPVIEAGGYGVVDTVEEYEALVRGT # EVELKNSKEAYTTFFAILARKPENT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g177 ### # start gene g178 4 AUGUSTUS gene 85359 85799 0.54 - . g178 4 AUGUSTUS transcript 85359 85799 0.54 - . g178.t1 4 AUGUSTUS stop_codon 85359 85361 . - 0 transcript_id "g178.t1"; gene_id "g178"; 4 AUGUSTUS CDS 85359 85799 0.54 - 0 transcript_id "g178.t1"; gene_id "g178"; 4 AUGUSTUS start_codon 85797 85799 . - 0 transcript_id "g178.t1"; gene_id "g178"; # protein sequence = [MLISYNIEKPLGKAVVGLKIDCEGYHNEGIYLLQRDYTNSKIPVSKTAVIVKVMDEVDNNALGEVRALKDVDLYIDSG # MAIIHKKRKPVILMGEVDGVSILNTVQFKDAVREGNEKEIDGWLEQMRPLVKEQVVFWALGQKRLLHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g178 ### # start gene g179 4 AUGUSTUS gene 97596 98176 0.75 + . g179 4 AUGUSTUS transcript 97596 98176 0.75 + . g179.t1 4 AUGUSTUS start_codon 97596 97598 . + 0 transcript_id "g179.t1"; gene_id "g179"; 4 AUGUSTUS CDS 97596 97689 0.79 + 0 transcript_id "g179.t1"; gene_id "g179"; 4 AUGUSTUS CDS 97746 98176 0.93 + 2 transcript_id "g179.t1"; gene_id "g179"; 4 AUGUSTUS stop_codon 98174 98176 . + 0 transcript_id "g179.t1"; gene_id "g179"; # protein sequence = [MNSASRISQPPWILGFYGNESYLNKDDKKAFSKVLSLSPQDIGDPINGDRGQWSSGVAKLTKNYWKLKGGFRRYSKDN # IVMKKLNVPVGNNDMGEVKALKDVGLYVDSGFARIGPHDGQVPVILMKKVVGVVMLETVEFKDANREQKLELLEEAKPLVRKQVVHWAVTKQLLHA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g179 ### # start gene g180 4 AUGUSTUS gene 101971 105261 0.51 + . g180 4 AUGUSTUS transcript 101971 105261 0.51 + . g180.t1 4 AUGUSTUS start_codon 101971 101973 . + 0 transcript_id "g180.t1"; gene_id "g180"; 4 AUGUSTUS CDS 101971 102434 0.66 + 0 transcript_id "g180.t1"; gene_id "g180"; 4 AUGUSTUS CDS 102519 105261 0.69 + 1 transcript_id "g180.t1"; gene_id "g180"; 4 AUGUSTUS stop_codon 105259 105261 . + 0 transcript_id "g180.t1"; gene_id "g180"; # protein sequence = [MDTPDIESSPTPAVKNLLSRFESLAVDNSATASQRKSLQVPMPPSPARAPSDASSPAVSPGLRTVSSSSSLKSSTSDT # NVSTKRPPPPPPPSSTRSYSRGLSPAPPSPSVSPLLRPVPIPNVLNTSVNRVPQHGLPHSPNVSINENEHEEGLTPTNVASNTPSRPITHSPKPSISS # MIDKPLAPPRVHTSSEPLISFDNPEEYHSQSSSNSMSDLDDPFSEDTTDSATDDPDSSTTAVAPPLPARKPHHHHHHQESTSSSSRNSSESDSGHLSS # YNGSASSSQSSILPPRPPPRPRALALPEPEVFISNSNSLNTPPPLPVRRSTVAQAEDLAAPRTPRPSARLAPLPPHSSHPSTNHLAHVSVSDLDHPPC # SAPTTSERKPFGKLPPPPTRTIALGDKLPPKRSNNAEGAVNGDSDDDESGDEDDDKGSSADLLPDATRASRRPPYLITPHDEDHGAYPTQPCKIVVPA # HTGHLAMSGVYVVVGSTHHIRLYNTNLSQEVPAKSMDTKDFGIKDGKVTAVEFKTEFLVWIALKEGHIFEIDVRNGDLLGVKHCAHMNPILYLFRYAG # SMISIDEVGKVLIWSPDPSTGDIKLLHHTPRVMRTTDKLDFAKIIGGVLWTAGRSEQHGAGTLARTPIIRLYDLFNPASTGKTVMPTEHVGPVTSATI # VPTHPEHVYLGHEEGYITIWSLEDVATGGGYPRCIEVMKVASTDVTSLEGINDRLWAGGRNGMITVYDIVPRPWIATNSWAAHPGLPVLQISADPFGI # EKYRRLGVVSVGRDELVGLWDGLLALNWQDTELQKHEQFYSTFRELKVLIISWNCDSAKPDSLHGHPANINFFHDVLNSVDRPDIISFGFQEVIDLES # RKMAAKNMLMSARSDARGRKDEGTLLGLSDKVTGAYKRWYDALVLAVKLAMPPDCPYSVVHTESMVGLFTCVIVKNTEKAAVKDIAINTVKRGMGGRY # GNKVRRVWYLSTLSTKRMYVQGGILSRFLIDDSSLCFVNCHLAAGQHAVRARNADAAGMLEQQLIFPPAAEHLAFVGGGDGSMVLDHEIVFVRRTITF # HLDSRPDFLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g180 ### # start gene g181 4 AUGUSTUS gene 108683 109021 0.75 + . g181 4 AUGUSTUS transcript 108683 109021 0.75 + . g181.t1 4 AUGUSTUS start_codon 108683 108685 . + 0 transcript_id "g181.t1"; gene_id "g181"; 4 AUGUSTUS CDS 108683 109021 0.75 + 0 transcript_id "g181.t1"; gene_id "g181"; 4 AUGUSTUS stop_codon 109019 109021 . + 0 transcript_id "g181.t1"; gene_id "g181"; # protein sequence = [MRSFNCARNDAHAEDGIFVASDNNPDNVLLEFTEKSVTSVELIDYGPPYTYLIDKNTDKQKIVSANEFNSGICSSSPK # ITILGGCLCSFQCMDSTVVTSSWWDVSVGSASYY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g181 ### # start gene g182 4 AUGUSTUS gene 109542 110342 0.97 - . g182 4 AUGUSTUS transcript 109542 110342 0.97 - . g182.t1 4 AUGUSTUS stop_codon 109542 109544 . - 0 transcript_id "g182.t1"; gene_id "g182"; 4 AUGUSTUS CDS 109542 110342 0.97 - 0 transcript_id "g182.t1"; gene_id "g182"; 4 AUGUSTUS start_codon 110340 110342 . - 0 transcript_id "g182.t1"; gene_id "g182"; # protein sequence = [MSSSTTHKNLLIPRGVNEPTPLTQSVFVLFRALDLPLQYAILSSRSLVAPLIHALGGTSISSTIGHPLFFMGTNTGLS # PQRAILFSMAIGSFIKQSYWVIAISQDALPPRASAYIGTFNALANSLNTVLFANTATSVLNSVGGDETRLSAPTIVGISLYAIGMVLEWGSELQRFKF # KKDPRNKGRVYTGGLFALARHINYGGYVLWRAGFAMAAAGWAWGAFIGGLHTYYFVKAGIPELDDYCSKKVGLLLESMYTIVFFLPICYF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g182 ### # start gene g183 4 AUGUSTUS gene 111007 111825 0.56 + . g183 4 AUGUSTUS transcript 111007 111825 0.56 + . g183.t1 4 AUGUSTUS start_codon 111007 111009 . + 0 transcript_id "g183.t1"; gene_id "g183"; 4 AUGUSTUS CDS 111007 111825 0.56 + 0 transcript_id "g183.t1"; gene_id "g183"; 4 AUGUSTUS stop_codon 111823 111825 . + 0 transcript_id "g183.t1"; gene_id "g183"; # protein sequence = [MVIGSFVKQSYWVTAISQEPMTPRAAALIGAFYAVASSLNTILFTNTATSVLGYASVAGDETRLPIQTLVGIGLYALG # MVLEWASELQRLRFKKDPKNKGRAYTGGLFGLARHINYGGYVLWRVGSSIAAAGWIWGAAVGGFHTYYFLKDGIPELDAYCSKRVSCSLAAPQYILLT # LCDIPVQRAVERVQEGSSIQALSLYFVNELNFEPQATFVSIFIAAEYTLNEKAVGRLSQITRDVIDNVYAFRSFNFTSTYHPRWYHTTLPSSSFSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g183 ### # start gene g184 4 AUGUSTUS gene 113830 114330 0.4 + . g184 4 AUGUSTUS transcript 113830 114330 0.4 + . g184.t1 4 AUGUSTUS start_codon 113830 113832 . + 0 transcript_id "g184.t1"; gene_id "g184"; 4 AUGUSTUS CDS 113830 114330 0.4 + 0 transcript_id "g184.t1"; gene_id "g184"; 4 AUGUSTUS stop_codon 114328 114330 . + 0 transcript_id "g184.t1"; gene_id "g184"; # protein sequence = [MIRYTNCESARIYIGNSNSFLPILQDEPGATGAGGNTNSEIFIGRHLLDVRCVVKPIAVVDFETVKRNHVYMDLKTLH # GLSKWDYIAKAMGYLQQEEGLRFKFENGGEEMWNGLLEKCGGKQEPKTSEVHSSTAGSGYDNPVSPKKLPTLSNILIGGEAGNVTNAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g184 ### # start gene g185 4 AUGUSTUS gene 125784 127475 1 + . g185 4 AUGUSTUS transcript 125784 127475 1 + . g185.t1 4 AUGUSTUS start_codon 125784 125786 . + 0 transcript_id "g185.t1"; gene_id "g185"; 4 AUGUSTUS CDS 125784 127475 1 + 0 transcript_id "g185.t1"; gene_id "g185"; 4 AUGUSTUS stop_codon 127473 127475 . + 0 transcript_id "g185.t1"; gene_id "g185"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGVYDAQGEAEDALGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLAAYRLEVLRIDNRYWKREETKKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSANSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g185 ### # start gene g186 4 AUGUSTUS gene 127808 131371 1 + . g186 4 AUGUSTUS transcript 127808 131371 1 + . g186.t1 4 AUGUSTUS start_codon 127808 127810 . + 0 transcript_id "g186.t1"; gene_id "g186"; 4 AUGUSTUS CDS 127808 131371 1 + 0 transcript_id "g186.t1"; gene_id "g186"; 4 AUGUSTUS stop_codon 131369 131371 . + 0 transcript_id "g186.t1"; gene_id "g186"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHPDSPQTSVPSAINPVAAKVAV # PLPEPSPSVSPTILETPPGDSLRPRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g186 ### # start gene g187 4 AUGUSTUS gene 131733 132113 0.84 - . g187 4 AUGUSTUS transcript 131733 132113 0.84 - . g187.t1 4 AUGUSTUS stop_codon 131733 131735 . - 0 transcript_id "g187.t1"; gene_id "g187"; 4 AUGUSTUS CDS 131733 132113 0.84 - 0 transcript_id "g187.t1"; gene_id "g187"; 4 AUGUSTUS start_codon 132111 132113 . - 0 transcript_id "g187.t1"; gene_id "g187"; # protein sequence = [MTTSRTQTITTSSSTAGPSRSRPIPPPPIDLTAHEEEDLENEDEDEIIRRAQARVERVRARKAAAAAKKAAEEKEEEK # EVEGEVEQDGEGEAGEMEVEEEGEGEAPVPPTAKAVASEKGKEKEVVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g187 ### # start gene g188 4 AUGUSTUS gene 137493 137834 0.63 - . g188 4 AUGUSTUS transcript 137493 137834 0.63 - . g188.t1 4 AUGUSTUS stop_codon 137493 137495 . - 0 transcript_id "g188.t1"; gene_id "g188"; 4 AUGUSTUS CDS 137493 137834 0.63 - 0 transcript_id "g188.t1"; gene_id "g188"; 4 AUGUSTUS start_codon 137832 137834 . - 0 transcript_id "g188.t1"; gene_id "g188"; # protein sequence = [MVFQDLETVVQGSSKWDYIAKAMKYLQTKATESQLEFKFETGGEERWQKLLEKCGGKGSEQQGELKTSEVHTSSGSNE # ERKPSYGEFGKKGKMPTFTDILVGGSAGDATESKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g188 ### # start gene g189 4 AUGUSTUS gene 139590 141662 1 - . g189 4 AUGUSTUS transcript 139590 141662 1 - . g189.t1 4 AUGUSTUS stop_codon 139590 139592 . - 0 transcript_id "g189.t1"; gene_id "g189"; 4 AUGUSTUS CDS 139590 141662 1 - 0 transcript_id "g189.t1"; gene_id "g189"; 4 AUGUSTUS start_codon 141660 141662 . - 0 transcript_id "g189.t1"; gene_id "g189"; # protein sequence = [MAAAASSAQSDPVAQAVVSTIEIMSDGAMDVVQESIQTQPQRDPSLNGQVNGAEVSPAGFDIDPSQTQSHPKPLDAVQ # TTPHLPSPPPQPSLYDMDLEKMHELLYKDRYLTPEEFLADVRKIVHNAAMYSHRDPDRHYKAQAMLTATEVSMQDNFDLILREECERMAGRVRKRRME # YKMKRKEEKEKEKEKEREKEGVEAQAPPFLNGTRRSARNNGQRPELAITDPVALERKLKRQREGADGAVGDAGPRGEMDQDGARDAKRSRTFGDSNDR # DPLDIITPITTPPRPGGVRFAPSVGSVNPDHPHQPQYQSQYQPPMFDRFQQQYGSMNMNINQFQPSMGLMGQSSSSSHLQPPFYNPSIASGSNTNPYP # RQNSFENGLINEQSGSFPSQQTTYSQQSFSYSSQQDFSNQPQQQSSFPQQRFHPQSSFQDVTFQPQPQYHQQVPFPLQQQQEPPFYPQRPSSSYLPQL # LPPPGPTGYQSSSNPTPVPYIMQNDNSMSVDQPQPPSTPRGGGVAMLLNPVHPGEERERTVSARPSPAPQNSHQPSAPVPGDDGNPFLTVSDATRNVP # NRKSASPLPEIPAHPTSILKSPAPPEKAASPMPIIERTPTPLPNFHVDTLLLEQLHASLRESTFGLTIEELEQLRATCLGCVWRHRTEWDRDALVREL # QDVVSDFVAEISANANASDLDESP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g189 ### # start gene g190 4 AUGUSTUS gene 141722 142174 0.78 - . g190 4 AUGUSTUS transcript 141722 142174 0.78 - . g190.t1 4 AUGUSTUS stop_codon 141722 141724 . - 0 transcript_id "g190.t1"; gene_id "g190"; 4 AUGUSTUS CDS 141722 142174 0.78 - 0 transcript_id "g190.t1"; gene_id "g190"; 4 AUGUSTUS start_codon 142172 142174 . - 0 transcript_id "g190.t1"; gene_id "g190"; # protein sequence = [MLDTLAPTDSILLLAIVDGKFSSLPRDVRAWFGPTAIKDNSVEILSPSPNQRSTFFEPLIDDIKRPPNKFADGMGAKR # KKRVLETLPIAPPLEPRKPTEKELAVQEENDQKTITILRYRLGPIISELKRKFKRFTKRAQVSSLSSLDSFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g190 ### # start gene g191 4 AUGUSTUS gene 142883 143596 0.61 - . g191 4 AUGUSTUS transcript 142883 143596 0.61 - . g191.t1 4 AUGUSTUS stop_codon 142883 142885 . - 0 transcript_id "g191.t1"; gene_id "g191"; 4 AUGUSTUS CDS 142883 143596 0.61 - 0 transcript_id "g191.t1"; gene_id "g191"; 4 AUGUSTUS start_codon 143594 143596 . - 0 transcript_id "g191.t1"; gene_id "g191"; # protein sequence = [MTVLAFFMRKGADALSKWVGEAERQLRLLFSQARSSAPSIIFFDEIDGLAPVRSSKQDQIHASIVSTLLALMDGMDGR # GQVVVIGATNRPDAIDPALRRPGRFDREFYFPLPDLIARQRILSIMTKGWIGWGSGEEDPRVKARVNGLAELTKGYGGADLRVGYVVRLYIPEILILL # LSCAQALCTEAALNAIQRKYPQIYKSEDRLLLQPETISVALRDFMVAIKSMCVLFFVERCH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g191 ### # start gene g192 4 AUGUSTUS gene 143942 145270 0.58 - . g192 4 AUGUSTUS transcript 143942 145270 0.58 - . g192.t1 4 AUGUSTUS stop_codon 143942 143944 . - 0 transcript_id "g192.t1"; gene_id "g192"; 4 AUGUSTUS CDS 143942 145270 0.58 - 0 transcript_id "g192.t1"; gene_id "g192"; 4 AUGUSTUS start_codon 145268 145270 . - 0 transcript_id "g192.t1"; gene_id "g192"; # protein sequence = [MNSSPSGQPRNPESNDTDAPRLKIKIPNILGSMAIKPAAGSQPIPLRRSSRNHRGSEPSGSEYQQSEKSMMDEEPEVE # DEEEEEEAPVIMKTQRGRMIQKKSYVESDGDEDGEGELEAQDDDLLNFKEEVDAPGRRITRGSKRASASAEDTREGLRRSTRSRNLPDFVVPDEGEEE # YDDDEADNRPHTRSRLTRNRPSGRSRSRQANGRTLTTKSEDHNRGTGRRRTRATTKKEDDYNPGSSSPHSADADGSDDDNAPGTDDLDLELEPPPEPE # PEPEDDVSGPDGTGNGKPYALRQRQRINYAIPPPLEDLSRPPAHRSNNANNNRLYNRAGGGRGVGGGYHGGRRKGGLGWSASGAELGKWMGLPADDSD # SDVPTRTPRKPFGGVGMTGGFEGAVAGGGGLLSGDLAAAGTPSNLGKVDDSSKCLVFPATCVILIFFHFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g192 ### # start gene g193 4 AUGUSTUS gene 149389 150759 0.12 + . g193 4 AUGUSTUS transcript 149389 150759 0.12 + . g193.t1 4 AUGUSTUS start_codon 149389 149391 . + 0 transcript_id "g193.t1"; gene_id "g193"; 4 AUGUSTUS CDS 149389 149607 0.24 + 0 transcript_id "g193.t1"; gene_id "g193"; 4 AUGUSTUS CDS 150025 150759 0.98 + 0 transcript_id "g193.t1"; gene_id "g193"; 4 AUGUSTUS stop_codon 150757 150759 . + 0 transcript_id "g193.t1"; gene_id "g193"; # protein sequence = [MISDLAFLQSEHEASLAELKATSTELRATLGLFNSRDVPTTVSAPESPISNANPAVLATPEDPVDGYTSESSIVGSSV # PRSVPQSLLSASTATPVLETTIATSDTVLPTPLAPVETATAVPDGTPESDKPRSNEPSIAASFPKPSSSALGPTAPAVPESSNATFNRLNGTSFSSSV # FGRSSSPASVPTVTPIPQSSNAISAQSNGTSSVAVPSTSIAPTTPKGSNSNTPVPAMPKASSSASVPTASAVTKKPIPLSSKASALVPATTATPVPKS # TNPITAKPNGPPPVIATSSVRLPFHVSELYLICASECSGLQPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g193 ### # start gene g194 4 AUGUSTUS gene 153160 154951 0.28 - . g194 4 AUGUSTUS transcript 153160 154951 0.28 - . g194.t1 4 AUGUSTUS stop_codon 153160 153162 . - 0 transcript_id "g194.t1"; gene_id "g194"; 4 AUGUSTUS CDS 153160 154412 0.52 - 2 transcript_id "g194.t1"; gene_id "g194"; 4 AUGUSTUS CDS 154476 154838 0.34 - 2 transcript_id "g194.t1"; gene_id "g194"; 4 AUGUSTUS CDS 154948 154951 0.31 - 0 transcript_id "g194.t1"; gene_id "g194"; 4 AUGUSTUS start_codon 154949 154951 . - 0 transcript_id "g194.t1"; gene_id "g194"; # protein sequence = [MKSWHLLSLNLEMDFRPIQRKFFPYDDRAHRLDYREFTQFHGRRKPPRSLGAPGDIYINEKAGNLHVHLDDPQGWSLP # WDGSFKNRIPHPLYQNRYLWIVDSRLEFSTNSIIQLPKNKFFLRDYKKVLKSVIDSSKVEAEIDLPTASESPAPKRKHSSVDDDCSSVCASNSKRCRI # SVVSPPPATLRNSVSPTRSRRKDDHESFHSFLAKNVQCTPLVNSDGLPIRPGIKAAESHVDANHSKIGVVEPAPISALSFVARSGSEVRQDCSQPFSE # PPTGPASGPHMLPMSSGPIHLSPVNQYSSLPLPKIHAFSEREFTDDSVETELSEDEVDELFSDEGDLNSKLDEEKAKNDSKGFRSNPSTQTECSSCST # EITKETDKLECHKDTVEERRQGLQASNRKFTPIMIESDDDDTKVLQGTVSQLTNVPSPDAISNGRRDTLTDPGKIRQRNEKLSSFIDLTTLDNFGEYD # SGVMDFPVGKQRIQSDSRGDSPDIVDLSLEEYQTNVQASQRRSRENSSLNRKNRSTSNFRARKMPMLSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g194 ### # start gene g195 4 AUGUSTUS gene 157722 158858 0.96 + . g195 4 AUGUSTUS transcript 157722 158858 0.96 + . g195.t1 4 AUGUSTUS start_codon 157722 157724 . + 0 transcript_id "g195.t1"; gene_id "g195"; 4 AUGUSTUS CDS 157722 158858 0.96 + 0 transcript_id "g195.t1"; gene_id "g195"; 4 AUGUSTUS stop_codon 158856 158858 . + 0 transcript_id "g195.t1"; gene_id "g195"; # protein sequence = [MFCGSVATAATSTPSIDLSQGNTISFYWESGYSTSNWPHNTGPIFLYMAKCDSDCTSQTASSTNFIKIEQQGFVNGAW # AQAALNTGSPVTFTIPSDLASGNYLIRHEIINLASTDENFPACSQFAITGGSNTYSSAQTAQFPGAYSATDAGLADAGSAIYSVKTNAEYTFPGPDPV # LSSDGSDSSSASGSSSDSNSASSSSSTVASTSSSVGATATVATGATSSSSTATGVVVLPSSVRLASASVTLATTTSSVSVSAVTTPAAAAGSSSSSDI # DTCATQWTTCNAAYMSATASDNSTTVAYSCQTAYVNCVAQAESAVESSSVATAVTSEVASSSSATDAMATIDTAAATSTPVVNSRAFAKHLRRHHAGV # SRLDFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g195 ### # start gene g196 4 AUGUSTUS gene 165333 165713 0.81 - . g196 4 AUGUSTUS transcript 165333 165713 0.81 - . g196.t1 4 AUGUSTUS stop_codon 165333 165335 . - 0 transcript_id "g196.t1"; gene_id "g196"; 4 AUGUSTUS CDS 165333 165713 0.81 - 0 transcript_id "g196.t1"; gene_id "g196"; 4 AUGUSTUS start_codon 165711 165713 . - 0 transcript_id "g196.t1"; gene_id "g196"; # protein sequence = [MSRRSLRIQEKTVASKGANAISKNSSATATKAGRKRVKEPPSEGVAGREQEKGRPPRKRARKNTSNTAQPLSDVEDEE # DEDEDATSTKKKQRMPKQFRKVRGKLGLLERLAKDVPLDVIFEVCSAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g196 ### # start gene g197 4 AUGUSTUS gene 171221 172550 0.5 - . g197 4 AUGUSTUS transcript 171221 172550 0.5 - . g197.t1 4 AUGUSTUS stop_codon 171221 171223 . - 0 transcript_id "g197.t1"; gene_id "g197"; 4 AUGUSTUS CDS 171221 171714 0.54 - 2 transcript_id "g197.t1"; gene_id "g197"; 4 AUGUSTUS CDS 171841 171862 0.99 - 0 transcript_id "g197.t1"; gene_id "g197"; 4 AUGUSTUS CDS 171996 172550 0.92 - 0 transcript_id "g197.t1"; gene_id "g197"; 4 AUGUSTUS start_codon 172548 172550 . - 0 transcript_id "g197.t1"; gene_id "g197"; # protein sequence = [MSLPKGSPGRPSEGLISTVYLLGFHLSGLNVGDVQQREQAYLSRALLDVANILSSPHRDRTVHAIQAEILLAGHFFST # GRILEGKYHLHAALSITIAAKLHKIRSQNTDPGFPGMSSSDIFGNISQLDVPLDQIAEGERINAFWTTFTMSNCWAVAADSPQNFIVESFGPTVDTPW # PLDMDGYEQEIILSSPYMWQQRAEIFSVQFTALDNLLSSFNSSLIPLSQNAPASSEYFSYAFVTHLTTKAAIITLHSKLRDISSESAEKVLSAAEACT # DMIAGNISSDSTAHANPLLPSLWMTVGQVLIEELRRLRSEHQFRAVARAPGREEAVDVKLQQVLTTMRHTPAHSPLNGEIGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g197 ### # start gene g198 4 AUGUSTUS gene 174108 174404 0.34 - . g198 4 AUGUSTUS transcript 174108 174404 0.34 - . g198.t1 4 AUGUSTUS stop_codon 174108 174110 . - 0 transcript_id "g198.t1"; gene_id "g198"; 4 AUGUSTUS CDS 174108 174404 0.34 - 0 transcript_id "g198.t1"; gene_id "g198"; 4 AUGUSTUS start_codon 174402 174404 . - 0 transcript_id "g198.t1"; gene_id "g198"; # protein sequence = [MEQHDNNKVAEGEETVGEGKYIGNTAKNDKLQMNAEKEPEKVQIQTSSPVPPEEDVEGMDPVILPALNDEKAKENGPL # GEADAAADKVAKELFPEEAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g198 ### # start gene g199 4 AUGUSTUS gene 175419 176030 0.55 - . g199 4 AUGUSTUS transcript 175419 176030 0.55 - . g199.t1 4 AUGUSTUS stop_codon 175419 175421 . - 0 transcript_id "g199.t1"; gene_id "g199"; 4 AUGUSTUS CDS 175419 176030 0.55 - 0 transcript_id "g199.t1"; gene_id "g199"; 4 AUGUSTUS start_codon 176028 176030 . - 0 transcript_id "g199.t1"; gene_id "g199"; # protein sequence = [MRIKLRHISTEKMLHSHDIRPPVSEVEFQNEVSAYGAPGFQGDANDDWILEIDEVASRDRRDREAVKRLRTLRTKFRL # RHALTGCYLFSHKVKLPEWGFEQQEVTCNKNAVRANSLWFVETAMHPDRKYRPCLAFWNFSVILSVITVPADAPKVNYRLPGFFAKFLELQQVMWTTN # AGLTDRHLFDSRPDAWPRLRRGIVSRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g199 ### # start gene g200 4 AUGUSTUS gene 180120 180957 0.24 + . g200 4 AUGUSTUS transcript 180120 180957 0.24 + . g200.t1 4 AUGUSTUS start_codon 180120 180122 . + 0 transcript_id "g200.t1"; gene_id "g200"; 4 AUGUSTUS CDS 180120 180171 0.42 + 0 transcript_id "g200.t1"; gene_id "g200"; 4 AUGUSTUS CDS 180313 180338 0.35 + 2 transcript_id "g200.t1"; gene_id "g200"; 4 AUGUSTUS CDS 180445 180957 0.5 + 0 transcript_id "g200.t1"; gene_id "g200"; 4 AUGUSTUS stop_codon 180955 180957 . + 0 transcript_id "g200.t1"; gene_id "g200"; # protein sequence = [MALFNASIVLLVNVWRGHGSKQAVSSCPPDTGPCSMKRSLEAASDDTTEDSSSVRARGSNTPEEYCDRQISSDHNSMD # TATLPRWMQSPPFQSSGTHNDTDFESMSLLPTHSSELGSLPIYESFTDWSMDEQWSFDAGTSSSNSQQTWSNADPHIHASMTMQTQSATSLLHNRSST # YSPTLVFDSLNTTSLGTFIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g200 ### # start gene g201 4 AUGUSTUS gene 182030 182999 0.93 + . g201 4 AUGUSTUS transcript 182030 182999 0.93 + . g201.t1 4 AUGUSTUS start_codon 182030 182032 . + 0 transcript_id "g201.t1"; gene_id "g201"; 4 AUGUSTUS CDS 182030 182274 0.94 + 0 transcript_id "g201.t1"; gene_id "g201"; 4 AUGUSTUS CDS 182540 182999 0.97 + 1 transcript_id "g201.t1"; gene_id "g201"; 4 AUGUSTUS stop_codon 182997 182999 . + 0 transcript_id "g201.t1"; gene_id "g201"; # protein sequence = [MAGNNGNLKASNDDFREQSLSHSEKIGDVDSTANTKSQLEEEDISDKHDSQTHSKNENTGKSIELDAGDLKVRIRGRW # WQFCGVVKGSQKLKVLGYQRTLQASDLWKMDHSQESGYLSEQLDAAWARRAEAANEWNIKLTSGELKPGILKRILWQIQATLKLGSTVKGSRRERIEE # LEIQWREIDGRKEPSLAWSVNDVFGNMFWIAGIYKVNATYLMTALSEYFARYSVILVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g201 ### # start gene g202 4 AUGUSTUS gene 189640 190826 0.32 + . g202 4 AUGUSTUS transcript 189640 190826 0.32 + . g202.t1 4 AUGUSTUS start_codon 189640 189642 . + 0 transcript_id "g202.t1"; gene_id "g202"; 4 AUGUSTUS CDS 189640 189661 0.58 + 0 transcript_id "g202.t1"; gene_id "g202"; 4 AUGUSTUS CDS 189757 189873 0.5 + 2 transcript_id "g202.t1"; gene_id "g202"; 4 AUGUSTUS CDS 189949 190826 0.4 + 2 transcript_id "g202.t1"; gene_id "g202"; 4 AUGUSTUS stop_codon 190824 190826 . + 0 transcript_id "g202.t1"; gene_id "g202"; # protein sequence = [MLVDIEDIDYDDDDDDDDDYFWDSTGSDDESEEDDFGDSCDEDGGRLERLCNLFELEPSPALYLAILAVSDQPGKTTA # ELMKTVSRIATNSSSTFAAALAIYAIECEALKISKLLDTHSHLLRSQDVKPYQAAVIVLIQETKYRSRAIKIIEKELQETVHSLRLLVQSSFCGLKVE # SNKTELRRILKLQMASQPRIDRVNNWVDAVITPSSALIHPVAFAAAMVMGFPPGLEDGDDNDVMSYLDLDPDDPDLEDLREEFRPQLRDRFDGWVSIA # LGFTGGQTLLSKLYIKMAEEMPFLSTADVSQEMLNRYVLSILSGGLIIILLRLLFALIYCLLTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g202 ### # start gene g203 4 AUGUSTUS gene 197105 199200 0.86 - . g203 4 AUGUSTUS transcript 197105 199200 0.86 - . g203.t1 4 AUGUSTUS stop_codon 197105 197107 . - 0 transcript_id "g203.t1"; gene_id "g203"; 4 AUGUSTUS CDS 197105 197860 0.89 - 0 transcript_id "g203.t1"; gene_id "g203"; 4 AUGUSTUS CDS 197911 199200 0.86 - 0 transcript_id "g203.t1"; gene_id "g203"; 4 AUGUSTUS start_codon 199198 199200 . - 0 transcript_id "g203.t1"; gene_id "g203"; # protein sequence = [MNRVPPPQFLSNLHDLEQNWQMTDELMAEIERADLQQAQGLAAAAHIYPSYPVGSGYNATNVKTDSSLRDPGVERVRA # AEKSSPKAVDGQLGRRPSVRESRESPKARDRPSFSPNQSQTPERRKSPPYITPLGSPGEQYNQYHHEPASVARRPAHDSRPNLTLATQTPPLQAISAR # TPDKSLPLQEEPEEEVPVAIKAEVNGREHSRYMHQIHQQREPELGSPTPSSDLNPEGSYIQDGRSSRAAIRPEDEDTLYEKSDKQESSNDGSGTPRSP # SAGIPTAENTEQNRFRPAQQTQPRGAVPAPHRGRGRNGSTDQLGLRGLDTSLFEQVEQARTSEMPPQYAEAPKPIPRPDPIQESYAHYYAQHMHPDDF # QGLMDDPTSAYIQAYLRSPRPDAPIPPTPHSQTSPPSPSPMLSGRYENTKDSYPPFSPEYELLWSLANELQSWFKPCGNPRAIRQAIPDVRPESFWQY # NRLNSFALLDALPAHIQSVGVLAHSTSHGRANSGYRDKTVESKPRAHPAPSSSPMVSLRRKSDSSNLRAYRPAPKANRKPPPRVDSTQPRETSPEPST # SGEETAGEDTRFAVSEEGNWVNGTTSAIPIPIPIPIPIVDDTASAEWVDEDEEEDEEDLLELEYHPTYVNNVEKRRRRWETKWDALLQAVSENFVKSS # SKGHFLSKWVQFRQF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g203 ### # start gene g204 4 AUGUSTUS gene 201504 201980 0.73 - . g204 4 AUGUSTUS transcript 201504 201980 0.73 - . g204.t1 4 AUGUSTUS stop_codon 201504 201506 . - 0 transcript_id "g204.t1"; gene_id "g204"; 4 AUGUSTUS CDS 201504 201980 0.73 - 0 transcript_id "g204.t1"; gene_id "g204"; 4 AUGUSTUS start_codon 201978 201980 . - 0 transcript_id "g204.t1"; gene_id "g204"; # protein sequence = [MLLFIKDVVARFTLDSATEFLFGKDVGSLGANLPYPESSPLANDPSILNHPSNVFVRAFMQGQIHTAFRARFGMLWPL # KEIWSDKVSPYRQQVDEFVNPILEERKQHLAAEKPSDDDNEGETFLDHLIKHTAGPSRVSFVEVNADADNVRSRQSSHQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g204 ### # start gene g205 4 AUGUSTUS gene 213860 214711 0.56 + . g205 4 AUGUSTUS transcript 213860 214711 0.56 + . g205.t1 4 AUGUSTUS start_codon 213860 213862 . + 0 transcript_id "g205.t1"; gene_id "g205"; 4 AUGUSTUS CDS 213860 214711 0.56 + 0 transcript_id "g205.t1"; gene_id "g205"; 4 AUGUSTUS stop_codon 214709 214711 . + 0 transcript_id "g205.t1"; gene_id "g205"; # protein sequence = [MGVRLEAFFRHATDLNFFLHTPRFRRAVLLPVDSPGRPCQGLISVVLLLGFSLSERYILKPEESHSHNNILNDEVFAS # ASVSSQEALYLSRAQIDVAGILSSSHPDRIVHGIQAELLLSTYLFRSGRILEGKYHLSAATSIAFGAKLHKIRSLNGDRDILTSAALPWVVCLTSSTS # KFENRLNVDSAKDPEPLFPHSVDPISEGERINAFWTVITMSNCWALAADSSPNPILERYMEDIDTPWPMDIEDYEKVSIYSPGPSNLINTSPVMRIYL # RTIWIVLPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g205 ### # start gene g206 4 AUGUSTUS gene 214885 215613 0.86 + . g206 4 AUGUSTUS transcript 214885 215613 0.86 + . g206.t1 4 AUGUSTUS start_codon 214885 214887 . + 0 transcript_id "g206.t1"; gene_id "g206"; 4 AUGUSTUS CDS 214885 215613 0.86 + 0 transcript_id "g206.t1"; gene_id "g206"; 4 AUGUSTUS stop_codon 215611 215613 . + 0 transcript_id "g206.t1"; gene_id "g206"; # protein sequence = [MQSLPATEFATSFIELDSVIDHFKTTLKLPISNDSNESILFTTHMIAHLATILLHSKIATMAPTLDSSLNSFPLEASE # SGQKRLNAAVAIAEFSRKRWSLKRNSGFETSTKIADPNPNPFLGSLWLAVGQVLIEEVNLVRVLSNGTGFTLNVELDSDENSPSEREAELMDKLECVF # ESAQMSRVYHSPLAGQCVSNYSCFNISPWNMSVDYLFNKLQKIHRSRLHNVDDALPNQANNQMGKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g206 ### # start gene g207 4 AUGUSTUS gene 216307 217525 0.45 - . g207 4 AUGUSTUS transcript 216307 217525 0.45 - . g207.t1 4 AUGUSTUS stop_codon 216307 216309 . - 0 transcript_id "g207.t1"; gene_id "g207"; 4 AUGUSTUS CDS 216307 217200 1 - 0 transcript_id "g207.t1"; gene_id "g207"; 4 AUGUSTUS CDS 217286 217525 0.45 - 0 transcript_id "g207.t1"; gene_id "g207"; 4 AUGUSTUS start_codon 217523 217525 . - 0 transcript_id "g207.t1"; gene_id "g207"; # protein sequence = [MVAIHDPAALGTTSLSPQFSSSPSSTSHSKTSLHSFNIRSLIIPTAAGLGIAIAFAAFGFIFYKRFYSSSGTGRAYLV # SQVKSDGGDKYSKLKPLKLLCAKNQIALEEKHAIHTNTNTIAHAKRSSLFQGISEIHLAQANIQSSLPSRPPGSLRLNRSYRSRQLDAKKPPSMSRAP # LTTRPALASSALNPSLPLPACTFNEIPALCSPPSTSPKEIFEWIQSDSVLNSHDGYLRAREDSRLYVCPSFPESGTPTSILAQQARISSMLSSSTMNR # TYGVREQSLPRSLRSPLCGDPSPTNPRGQTSSKSKGAAHVPSIEHLFKEDCYLGPLEQGTRWGSISYTLDKPISKRKDTKTLQKSLKAGKAGKENKGS # IALAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g207 ### # start gene g208 4 AUGUSTUS gene 218659 219582 1 + . g208 4 AUGUSTUS transcript 218659 219582 1 + . g208.t1 4 AUGUSTUS start_codon 218659 218661 . + 0 transcript_id "g208.t1"; gene_id "g208"; 4 AUGUSTUS CDS 218659 219582 1 + 0 transcript_id "g208.t1"; gene_id "g208"; 4 AUGUSTUS stop_codon 219580 219582 . + 0 transcript_id "g208.t1"; gene_id "g208"; # protein sequence = [MSASTGEAELRQNSHSENSATSPEHQSSPNSWTLGDRTSNDHSRAKSPHQTASEEPEGHDRSDKDSLQGSTEKSKPKD # KVKANATAEKFKGKEKAIEKEKVTSPQKKPMPNRRSSTRLQTNDNSSLSILSDDDDPSPPSSECLPDDQAAIADALKVQILGKKRSTAVVASALNRNT # LALGGHQLELVEIQRKNEERVRGEIGELRVRVDALEVSGLGAHVDESVISDGSGSPKVPAASLLRDIRTRIKALEGNNHLLKDSVDWKRTLDKEFRTL # KDKVEVYEGFRKLSPSQRMSWRYAHTPQRSLRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g208 ### # start gene g209 4 AUGUSTUS gene 224901 226032 0.35 - . g209 4 AUGUSTUS transcript 224901 226032 0.35 - . g209.t1 4 AUGUSTUS stop_codon 224901 224903 . - 0 transcript_id "g209.t1"; gene_id "g209"; 4 AUGUSTUS CDS 224901 225467 0.7 - 0 transcript_id "g209.t1"; gene_id "g209"; 4 AUGUSTUS CDS 225802 226032 0.49 - 0 transcript_id "g209.t1"; gene_id "g209"; 4 AUGUSTUS start_codon 226030 226032 . - 0 transcript_id "g209.t1"; gene_id "g209"; # protein sequence = [MFARNAARAFTAPSARLFSSSSARQTKVTVLGAGGGIGQPLSLLLKLDPLVSNLSLYDIRGAPGVAADVSHVDTPSET # NASIVRDLAAAVARVAPTAHILVISNPVNSTVPIVAATLEKAGVFDPSRVFGVTTLDVVRASRFLASVSGTTPSECNVPVVGGHSGPTIVPLLSQVAK # GKGLQGETYEQLVHRIQFGGDEVVKAKDGAGSATLSMAYAGAKFTNSLLRGLNGEKGVITPTFVKNPLFADKGIDFFSSPVELGVCSQY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g209 ### # start gene g210 4 AUGUSTUS gene 227832 228509 0.71 + . g210 4 AUGUSTUS transcript 227832 228509 0.71 + . g210.t1 4 AUGUSTUS start_codon 227832 227834 . + 0 transcript_id "g210.t1"; gene_id "g210"; 4 AUGUSTUS CDS 227832 228509 0.71 + 0 transcript_id "g210.t1"; gene_id "g210"; 4 AUGUSTUS stop_codon 228507 228509 . + 0 transcript_id "g210.t1"; gene_id "g210"; # protein sequence = [MCPNPNLVDNDPETLAHFVPLDPVCRRAYALSCEHLPPAILNHSLRVWVYAATLSELEKLSSSRLPLLFTACILHDIG # ATPAFSNLDSEKLQRFEIEGADAAASLLREAGDSSISQDDIEEVWRAIALHSTPQIPERMAGLVRIVRLAVLSDFQRGTVAGKEGLQEETEAHFERLE # IEKVLGDAVVQQALCSRVPEAKAPAASWPHDLLRAHREYPEWEGVNKGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g210 ### # start gene g211 4 AUGUSTUS gene 229650 230099 0.38 - . g211 4 AUGUSTUS transcript 229650 230099 0.38 - . g211.t1 4 AUGUSTUS stop_codon 229650 229652 . - 0 transcript_id "g211.t1"; gene_id "g211"; 4 AUGUSTUS CDS 229650 230099 0.38 - 0 transcript_id "g211.t1"; gene_id "g211"; 4 AUGUSTUS start_codon 230097 230099 . - 0 transcript_id "g211.t1"; gene_id "g211"; # protein sequence = [MYFSRVARIFEDAEVSKPDIKRMIDACGRGGSHFQHSQTNATATTHNIDAANAGTNMKMPLPNNTLSTTAGADLRSTS # APNLVAAASVVDLPLPLPEEWSLPLVSSSLIRFKLSWEAFVDSLMREWKTLNVVSALLLSYEILFFDDIHD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g211 ### # start gene g212 4 AUGUSTUS gene 233900 234289 0.98 + . g212 4 AUGUSTUS transcript 233900 234289 0.98 + . g212.t1 4 AUGUSTUS start_codon 233900 233902 . + 0 transcript_id "g212.t1"; gene_id "g212"; 4 AUGUSTUS CDS 233900 234289 0.98 + 0 transcript_id "g212.t1"; gene_id "g212"; 4 AUGUSTUS stop_codon 234287 234289 . + 0 transcript_id "g212.t1"; gene_id "g212"; # protein sequence = [MCPALNTAVDSYEQTKYPDAFAAAEAVDFDLFISFDMTYEWEATDMVSLVKSYATSSSYYHWEGKPLVSTFGGDSDTN # DFWNTFKTTLATEGISISLAPAFIDYRDPDEAAQMFSNFVAIDGFFNWWSW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g212 ### # start gene g213 4 AUGUSTUS gene 236436 236774 0.34 + . g213 4 AUGUSTUS transcript 236436 236774 0.34 + . g213.t1 4 AUGUSTUS start_codon 236436 236438 . + 0 transcript_id "g213.t1"; gene_id "g213"; 4 AUGUSTUS CDS 236436 236774 0.34 + 0 transcript_id "g213.t1"; gene_id "g213"; 4 AUGUSTUS stop_codon 236772 236774 . + 0 transcript_id "g213.t1"; gene_id "g213"; # protein sequence = [MAASSIGQDRYPECMGKFYIINAPWLFNGVWAIIRPWLDEVTVSKIDIIGSGYKDKLLAQIPKENLPKEFGGTCRCEK # GCSLSDAGPWNEEKWQKLEAEMSKGTANGNIAPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g213 ### # start gene g214 4 AUGUSTUS gene 253096 253938 0.98 + . g214 4 AUGUSTUS transcript 253096 253938 0.98 + . g214.t1 4 AUGUSTUS start_codon 253096 253098 . + 0 transcript_id "g214.t1"; gene_id "g214"; 4 AUGUSTUS CDS 253096 253938 0.98 + 0 transcript_id "g214.t1"; gene_id "g214"; 4 AUGUSTUS stop_codon 253936 253938 . + 0 transcript_id "g214.t1"; gene_id "g214"; # protein sequence = [MRGDPHKLVEGCLVAGRGMNANAAYIYIRGEFYQEASHVQQAINEAYADGLLGPNACGSGYAFDVYLHRGAGAYICGE # ETALIESLEGKQGKPRLKPPFPADVGLFGCPTTVANVETVSVAPTICRRGGAWFASFGRERNQGTKLFCISGHVNNPCVVEEEMSIPLRELIDKHCGG # VIGGWDNLLGIIPGGCSVPVLNQQKSGEVLMDYDSLKDAGSGLGTGAVIVMDKSTDIVSAIARFSQVLSRVLEPCQTLTEREFGSFTNMSRAVSVLLA # EKVQPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g214 ### # start gene g215 4 AUGUSTUS gene 254864 255220 0.72 - . g215 4 AUGUSTUS transcript 254864 255220 0.72 - . g215.t1 4 AUGUSTUS stop_codon 254864 254866 . - 0 transcript_id "g215.t1"; gene_id "g215"; 4 AUGUSTUS CDS 254864 255220 0.72 - 0 transcript_id "g215.t1"; gene_id "g215"; 4 AUGUSTUS start_codon 255218 255220 . - 0 transcript_id "g215.t1"; gene_id "g215"; # protein sequence = [MEIFHQPTEVDSNPPPGMVQVNAITHSEEYVKEYLSRPYRKDSRYVEESVDDNMKSKNGLPVMIMEFVLRGDVSSSVS # VFTSLTPQAMEVARKRQPYTQISSVRGTFHVPFSADSTIE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g215 ### # start gene g216 4 AUGUSTUS gene 258356 258760 0.88 + . g216 4 AUGUSTUS transcript 258356 258760 0.88 + . g216.t1 4 AUGUSTUS start_codon 258356 258358 . + 0 transcript_id "g216.t1"; gene_id "g216"; 4 AUGUSTUS CDS 258356 258760 0.88 + 0 transcript_id "g216.t1"; gene_id "g216"; 4 AUGUSTUS stop_codon 258758 258760 . + 0 transcript_id "g216.t1"; gene_id "g216"; # protein sequence = [MGPGRTGVKGVIRDRDEAEEINRQRRITEMDEIRRKMEKSSLGGKTFLEEEREKGGDEKVDELVAKEREKENERRDVF # GRPREGKFGHLREVDVHNYLNAVEKEEKGVWVVVHLYEPVSNLLLNQELLLTFIIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g216 ### # start gene g217 4 AUGUSTUS gene 261568 262647 0.91 - . g217 4 AUGUSTUS transcript 261568 262647 0.91 - . g217.t1 4 AUGUSTUS stop_codon 261568 261570 . - 0 transcript_id "g217.t1"; gene_id "g217"; 4 AUGUSTUS CDS 261568 262647 0.91 - 0 transcript_id "g217.t1"; gene_id "g217"; 4 AUGUSTUS start_codon 262645 262647 . - 0 transcript_id "g217.t1"; gene_id "g217"; # protein sequence = [MFIQILCFGKLIEGFQQLVASLSPTDYNINIGVLQTGHSIFRHWRAHVRSDLLFTEINLVFSKFMTPFLQLFRQTASL # LTQPGQSKDQYTLLAQSMVLLVDIYYDFTCQDLPPSIEDTHLEFFGANGGYFTVLMSWDPAELKGDSEDTTASLPSQIKTRILEVLELFIKLFPETLQ # TSNAVETFVQAVWSLIGSNRLPNVSDDMLVSQSLKFISTALRSGFYKSSIFSAPGIIPTLIEGIVVPNTTLREHDIEQFEDDPLEYVRLDLAVSAAGT # DTATRRQSAMDVLQTLVSSGYEVEATEIVGGWINKGLTEYQSNKEVNWKAKDTAIYLLTAVATRGVTTQVLFQNILCICLLTCTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g217 ### # start gene g218 4 AUGUSTUS gene 265959 267611 0.27 + . g218 4 AUGUSTUS transcript 265959 267611 0.27 + . g218.t1 4 AUGUSTUS start_codon 265959 265961 . + 0 transcript_id "g218.t1"; gene_id "g218"; 4 AUGUSTUS CDS 265959 266607 0.35 + 0 transcript_id "g218.t1"; gene_id "g218"; 4 AUGUSTUS CDS 266976 267155 0.61 + 2 transcript_id "g218.t1"; gene_id "g218"; 4 AUGUSTUS CDS 267427 267611 0.62 + 2 transcript_id "g218.t1"; gene_id "g218"; 4 AUGUSTUS stop_codon 267609 267611 . + 0 transcript_id "g218.t1"; gene_id "g218"; # protein sequence = [MDTSQLPNYQCLAIDDPSALSDKLIAVGRAPSTGYIIGFISSVLVKIPDFSEGEVLHIGLACLSPSSKLETVSGLAKH # LMASIVYGYLLKNPSTNKVWVTNRSSNLSTLGRFAQTVDEVFPSPSHPTSPPTSLHVTIANEIIGSSSRSLNVTPGELDPRTFIVRKSLFHAGKDEDQ # RNDRYHYSNPEMWEFYRGYLDENGSREDESVILQVGHISPPSQNTVSAFKADASPESGRGKYTGNGMRRMLGDGGSIEFDTSREALRSVGTADGVTEA # ARENDPSPTTSTVTADEAKPAGTEKGGKTTIPVSKADLDSGILLSGSASPDINESWVGVRVKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g218 ### # start gene g219 4 AUGUSTUS gene 267819 268752 0.72 - . g219 4 AUGUSTUS transcript 267819 268752 0.72 - . g219.t1 4 AUGUSTUS stop_codon 267819 267821 . - 0 transcript_id "g219.t1"; gene_id "g219"; 4 AUGUSTUS CDS 267819 268629 0.72 - 1 transcript_id "g219.t1"; gene_id "g219"; 4 AUGUSTUS CDS 268685 268752 0.87 - 0 transcript_id "g219.t1"; gene_id "g219"; 4 AUGUSTUS start_codon 268750 268752 . - 0 transcript_id "g219.t1"; gene_id "g219"; # protein sequence = [MDDEGAFDVIVIGTGLTESITAAALAKAGFKVAHLDENVYYGGDEASLSLDEYIDWATQPKTSTQFSSFSSLSPSDTL # PDSRQYSISLSPSVIPATGPLISSLVASGVSRYGGFRLVEHVAVYSSDHKVKTVPGSKEDIFKDKTISLLDKRRLMRFLVFASGDEEFEGRVELEGTN # VNMPFLEFLKATFSLNQEIAETITYALSYCTSPTGTNNAIFTLFDDVNHLFRQNPSCPTSSSALPPLYRSLWSFSLSHRALWQFWGDCTRILSYCCSR # WSCIHSRKTYIFHNSKPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g219 ### # start gene g220 4 AUGUSTUS gene 271418 272346 0.77 - . g220 4 AUGUSTUS transcript 271418 272346 0.77 - . g220.t1 4 AUGUSTUS stop_codon 271418 271420 . - 0 transcript_id "g220.t1"; gene_id "g220"; 4 AUGUSTUS CDS 271418 272010 1 - 2 transcript_id "g220.t1"; gene_id "g220"; 4 AUGUSTUS CDS 272094 272346 0.77 - 0 transcript_id "g220.t1"; gene_id "g220"; 4 AUGUSTUS start_codon 272344 272346 . - 0 transcript_id "g220.t1"; gene_id "g220"; # protein sequence = [MGVWSTQPYTPTDKNKKNDDSGVDVPVISDEMYIVNKVWDFAMQLAEKANVEWRIVIAKSGNMSVIELDGKSSLHDMD # DTNIFQLPWIILPFPAPQSTGHSAPNSKNPTLFRSTPGSVKISSKNQFFVDTATTTYGLLQKDTLPISVPPTLNDIGLSTDLVINKPLSIDDDDYSLV # DDYPLLPLSSSTLICIPDSSVLPQMVNIHLIYATKSEECAYPNITSDAADSPQNLLHDITNSFYSLSVLSTARRDIAGTSLPFHLSAVETMRKALSTR # NGVDSIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g220 ### # start gene g221 4 AUGUSTUS gene 273008 276671 0.46 - . g221 4 AUGUSTUS transcript 273008 276671 0.46 - . g221.t1 4 AUGUSTUS stop_codon 273008 273010 . - 0 transcript_id "g221.t1"; gene_id "g221"; 4 AUGUSTUS CDS 273008 273351 0.6 - 2 transcript_id "g221.t1"; gene_id "g221"; 4 AUGUSTUS CDS 273440 276671 0.46 - 0 transcript_id "g221.t1"; gene_id "g221"; 4 AUGUSTUS start_codon 276669 276671 . - 0 transcript_id "g221.t1"; gene_id "g221"; # protein sequence = [MNIPGSTTSTLHQTAAEVSAYVEYVAREREKERERLKEVQAQRNRVTSSSSVANSGASTSASSNSNFGLRSVPPISIP # PSIPPPFTGAIMHSGTDAQLFYPSPPTNPPSVSAAGVAVSPTAYQGTALLPQIPQGLPSMHDASVASSRISPSVSGTTSEVNKIVEGIMDISTIEISH # DTTQGPLPETDASGTDIDNGIVNTGLPLTNDSAPPLVTTERLSSAPMTAPEPIVRSAPATNSDPTSGWTYFGSEGADFDGLGMLGNIGMNGIDNLTGN # GMTTDNVDMTLFGAGGGNTFNFENLDSFGGGMDWNMDSTFSFGSGLTPSTSTSDQVTKSSTGVHTGMYADTRSTNTSFSSFQSADVFSQPMPPPTAPA # VTAPTQTNASGTQQLGGGPGSGLGIGMDFEADFTDDDFSFFDNKASNTVNPVEPTSDSLILSASAPPNAATSPDPLAFLNSDDSSSFFSSLGLAPPLP # IGSAPTPGFYGYPSHPTPFSISHPTPGGPTGFTPLTVDVEVEVEMNPGLPSPPEETNHPFARAYEVQLEQGTETSPFRLSSVHTPPPTLTSYSPPAPS # SPSKDKKFAPIPFAKSHSQADGKYRVAGGKFALLRNSGRWLHKKYRPAYFTLDAPRRARAASWTGIMQGESSNGCFGEQVDLSEKDSRINGPSQGRWC # LPSPPVDSDTTDSSAGESDDDQPHTSLEPPPPPTSISDASPPPPGSTDISMSSSYTHKTSRPGWRPRYDRATDPRIGVVRRLTGSKQRSKKRLKRAGW # SEIHTRPKWLKDWEDDTGRHIDVANTGQSQEDEAEDDEDEDGGTADEEQDTDGGTLEELDDTPDMKASRRSGGREWSRSATPLPAYLPPGPSLVSTCF # HWVHLASMAVGDNVSQTSTIEGMIHDSAPTPIHLNRGVGTTHGGMSSILLSVSVPVSILRTNVAPTPVSPVALAGSSAASFPTPAPTWPQALTPSADI # DFIPEEEKAWSLETAVNCIAQECVENPFWADAWKSMDEFMGNSKNGAVNPESSRCRNGRCPVELQWDINESLECVWPSDVYGVKQLLAKAVLGDQMLS # LGDLFEGIVIFAFHFTCLIRSTPSTSSCILTPLSPPLLSVAKSEAIIHIMPAALRFWDKLGLGPKSGKKDVTVFVLYEQGYPEAEQHDRLGKAKIWRD # EQIGFWLRNACALYKVGPLSWQLAIFGINNVPFDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g221 ### # start gene g222 4 AUGUSTUS gene 276742 278409 0.79 - . g222 4 AUGUSTUS transcript 276742 278409 0.79 - . g222.t1 4 AUGUSTUS stop_codon 276742 276744 . - 0 transcript_id "g222.t1"; gene_id "g222"; 4 AUGUSTUS CDS 276742 278167 0.81 - 1 transcript_id "g222.t1"; gene_id "g222"; 4 AUGUSTUS CDS 278246 278409 0.84 - 0 transcript_id "g222.t1"; gene_id "g222"; 4 AUGUSTUS start_codon 278407 278409 . - 0 transcript_id "g222.t1"; gene_id "g222"; # protein sequence = [MTLTSPSLNASILASSIPLHSDNVKYLAYEGDHTAVWDVRRKIIEEDEANHTEIFNPNSKPLQDQRLVKVFESTIVPR # YLYPCSEECSFHDTPCINCHSPDYHSTYPAARYLPRRPWRRPWHAFLDAVRAALIRGVNYNNTASDETQKHWALALKNGFIVANMTMRPDSDEWVTSG # WEQTRPLLYVHVQIHPTLDPSPRLIVHPTVLQTPYCTLGQRPIAGTALTLLPHGTPAYFVAAYSGPTSALTAQFRNALRGLAVDGWEGPDCSKRNSRG # RGEAQDVVKYVIVFIPVHTGSEGHKGLTIIYPSLLALAIPPSVRPTMNASLLPTLPAPLQPSPMVPAAIVSGTPSVATNGALSSPLAGPRSAYQFPPP # GPSYPPATANTFPTLNSPVVFAPGLNRNQPPPQRQQQLQPPLYSQAANNSGNIGGTGTNAGPGTPFPLSTSAPSTLASPFTQSHSVSPSMDSHTNRSG # TLSNNDLLRAHRVASTASRLFALASPSPVNTPAAVPTPGVPTPGTVSVPTPGGRSSPCE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g222 ### # start gene g223 4 AUGUSTUS gene 278808 280903 0.11 + . g223 4 AUGUSTUS transcript 278808 280903 0.11 + . g223.t1 4 AUGUSTUS start_codon 278808 278810 . + 0 transcript_id "g223.t1"; gene_id "g223"; 4 AUGUSTUS CDS 278808 278812 0.26 + 0 transcript_id "g223.t1"; gene_id "g223"; 4 AUGUSTUS CDS 278915 279343 0.48 + 1 transcript_id "g223.t1"; gene_id "g223"; 4 AUGUSTUS CDS 280020 280147 0.66 + 1 transcript_id "g223.t1"; gene_id "g223"; 4 AUGUSTUS CDS 280308 280903 0.86 + 2 transcript_id "g223.t1"; gene_id "g223"; 4 AUGUSTUS stop_codon 280901 280903 . + 0 transcript_id "g223.t1"; gene_id "g223"; # protein sequence = [MFVPGCTIDDGAAAGSLAPFVDSTSATKDNNDLSEPYLLLVVSVLGSPWFSLVLTTIFGSIIYFMATISLDSMDVDQT # VQPSSFPTSLSTTASPPFEIVRFEGQEFRVCRPIELQPEDALVLPERYEEEEEIFYVRYQDLCVDIFEQKRTNEKIDSLASMVGTLVQRLPTLFSAPS # AASPVCSTSSLKFNPNDNNASVDDEAVAKKNYGHMGETDNRRIIEKCGEHMIGKDAVPTRETCSLSMGEKDDITMADAENIVGVIRVHHNSSTQPEAV # GIVNRTEVPTPAVKGITTIKIAHGQLLHFKSADVHDPRQISFATNISRLERVWDDEGPNWDPVDCGTNLLSISGTPIALRYWPEVFSGKKDARWRALK # KNWTEWKVSFNSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g223 ### # start gene g224 4 AUGUSTUS gene 282722 283130 0.62 - . g224 4 AUGUSTUS transcript 282722 283130 0.62 - . g224.t1 4 AUGUSTUS stop_codon 282722 282724 . - 0 transcript_id "g224.t1"; gene_id "g224"; 4 AUGUSTUS CDS 282722 283059 0.72 - 2 transcript_id "g224.t1"; gene_id "g224"; 4 AUGUSTUS CDS 283100 283130 0.63 - 0 transcript_id "g224.t1"; gene_id "g224"; 4 AUGUSTUS start_codon 283128 283130 . - 0 transcript_id "g224.t1"; gene_id "g224"; # protein sequence = [MIFHLRPCAQRGEATIYEPGVFAKPLLITPFPSFSMAINILEDDAYIGVIQSINDYESMKPADILDDLEEAHDNVGLD # LKDIAPIQSDDEPAVDMSELLDSIKEVSKGVSEKTGQEYGRYVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g224 ### # start gene g225 4 AUGUSTUS gene 289470 289832 0.51 - . g225 4 AUGUSTUS transcript 289470 289832 0.51 - . g225.t1 4 AUGUSTUS stop_codon 289470 289472 . - 0 transcript_id "g225.t1"; gene_id "g225"; 4 AUGUSTUS CDS 289470 289832 0.51 - 0 transcript_id "g225.t1"; gene_id "g225"; 4 AUGUSTUS start_codon 289830 289832 . - 0 transcript_id "g225.t1"; gene_id "g225"; # protein sequence = [MWMSSPLTDFNAPILAANATNATDIDSTLPLAFSQPPEISLPPVPPTQGARPSRSPKTPTFAKLEEDISDFDDIPLTK # LGKRNRPASPSNKATQDTSARPARRGVRSPIYSCCLVSDVRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g225 ### # start gene g226 4 AUGUSTUS gene 290096 291653 0.86 - . g226 4 AUGUSTUS transcript 290096 291653 0.86 - . g226.t1 4 AUGUSTUS stop_codon 290096 290098 . - 0 transcript_id "g226.t1"; gene_id "g226"; 4 AUGUSTUS CDS 290096 291301 0.99 - 0 transcript_id "g226.t1"; gene_id "g226"; 4 AUGUSTUS CDS 291438 291509 0.97 - 0 transcript_id "g226.t1"; gene_id "g226"; 4 AUGUSTUS CDS 291627 291653 0.88 - 0 transcript_id "g226.t1"; gene_id "g226"; 4 AUGUSTUS start_codon 291651 291653 . - 0 transcript_id "g226.t1"; gene_id "g226"; # protein sequence = [MRSNKSTFRVLQERFDSQAITLKLAKDHSGDLQVKLESTHGQYKKELAVLEEQKNNLHNVVGRLQDDVCKLESTIDKL # RTDNAAVQIQLESTHGKYKTDLRVLGEQKSSLQNVIGQQQEDICKLESTVDKLRAANAAAGLQQNELQIELDTLRQNASNLESSSEKLRIQNSSLAEE # RTNLQSSLDRYRHDSSKLKSDVDIRISEISSLRERVGSLQEQNSDLARLKEERTLLQSTLTKKELENAVLYSEKTSLQKRLEKLLDDLAQLRQTMEKN # RTELSEMLEQRLLLHTTIEGLQEDMKLQMQARDEASKEYQANLIKQEEATERLLSAVTKRAETAEQGLGELTRELTSRIASMEIQLETVNVASGSSGK # QKGDVADAKIGQLEGVIQRLREREQNLEKRYHEGDLVSLGKSLRYISFLIEDIVRMTRKSAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g226 ### # start gene g227 4 AUGUSTUS gene 292948 293395 0.26 - . g227 4 AUGUSTUS transcript 292948 293395 0.26 - . g227.t1 4 AUGUSTUS stop_codon 292948 292950 . - 0 transcript_id "g227.t1"; gene_id "g227"; 4 AUGUSTUS CDS 292948 293246 0.69 - 2 transcript_id "g227.t1"; gene_id "g227"; 4 AUGUSTUS CDS 293320 293395 0.26 - 0 transcript_id "g227.t1"; gene_id "g227"; 4 AUGUSTUS start_codon 293393 293395 . - 0 transcript_id "g227.t1"; gene_id "g227"; # protein sequence = [MHRKLTEAKANKNQLAEEVGIRFYPSTCDEQKRHIVELEVAAQSNLENSHLKDRQLSELQLMFDETLSAKESQLEMNT # DKDEQIRVGQEKLRCAEEKIRATEDRVTKVKDAAKRGIENMSKKFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g227 ### # start gene g228 4 AUGUSTUS gene 295351 296291 0.18 + . g228 4 AUGUSTUS transcript 295351 296291 0.18 + . g228.t1 4 AUGUSTUS start_codon 295351 295353 . + 0 transcript_id "g228.t1"; gene_id "g228"; 4 AUGUSTUS CDS 295351 295386 0.21 + 0 transcript_id "g228.t1"; gene_id "g228"; 4 AUGUSTUS CDS 295447 295823 0.43 + 0 transcript_id "g228.t1"; gene_id "g228"; 4 AUGUSTUS CDS 295874 296291 0.91 + 1 transcript_id "g228.t1"; gene_id "g228"; 4 AUGUSTUS stop_codon 296289 296291 . + 0 transcript_id "g228.t1"; gene_id "g228"; # protein sequence = [MKKAKAAYERARLTSSIKENPRLRAAAEELRNTGVKVSDAVSEALKTMEESEIMRAISKASAAVSSTIEKSTEPIRKT # AAYKSLAETVIDALDDSGSAKHAGFEEKEARRLRRQRRLEKAGRSGNGLGVGGRVAANAEAGSALVLHASSPKQEKWETLKQTNPLLRTLSSWKSAYD # DSENPVVSSMRSVTDTVAGWFEENETAQVARMMKALDPGFTQDGFERELREYIVPEVVDAYLSADQEALRAWCGEGVSDTSFISQASPCFVSLTETCL # DL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g228 ### # start gene g229 4 AUGUSTUS gene 296968 297904 0.47 + . g229 4 AUGUSTUS transcript 296968 297904 0.47 + . g229.t1 4 AUGUSTUS start_codon 296968 296970 . + 0 transcript_id "g229.t1"; gene_id "g229"; 4 AUGUSTUS CDS 296968 297151 1 + 0 transcript_id "g229.t1"; gene_id "g229"; 4 AUGUSTUS CDS 297306 297904 0.47 + 2 transcript_id "g229.t1"; gene_id "g229"; 4 AUGUSTUS stop_codon 297902 297904 . + 0 transcript_id "g229.t1"; gene_id "g229"; # protein sequence = [MGKSDKKVSKKAEKADTKVVEKATDKKAGKTSKAIKSKAAFKQTPTSSKDILAKAVNSIFYFAANSICFQAKAPASSN # ESSEDSSSEDEKPKAVQVKKALAAAKKGSSSEEDSSDSDSKPQSKAKKPTPAAKLSKTAPSSSSADSDSDTSASDGEGAKKPLGKKAAVTASPAEKDS # SSESESDDEEKEDLVAAAPTKKDSSSSSSDSSSDESSTKKTTTSKTTKDESSDSDDSDVEMEEGVKVAPVVNGQFHFFNIFYVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g229 ### # start gene g230 4 AUGUSTUS gene 298116 298808 0.37 + . g230 4 AUGUSTUS transcript 298116 298808 0.37 + . g230.t1 4 AUGUSTUS start_codon 298116 298118 . + 0 transcript_id "g230.t1"; gene_id "g230"; 4 AUGUSTUS CDS 298116 298808 0.37 + 0 transcript_id "g230.t1"; gene_id "g230"; 4 AUGUSTUS stop_codon 298806 298808 . + 0 transcript_id "g230.t1"; gene_id "g230"; # protein sequence = [MDRNTGRSRGFGYVHFTSSDAVTKALEMNGKEIDGRPVKVDKSTPPNKDSVREKRAQTFGDQTSPPSHTLFVGNLSFS # ANEDSVWEFFNDYGVKTVRLPTDRETGKPKGYGYVEFDDIEGAKKAFEAMSGQELDGRSVRLDYSQPRDSAGGGRGGGRGGRGGFGGGGGRGGFGGGG # GRGGFGGGGGRGGFGGGRGGGDRGRGGRGGRGGPRGGNPRSGGIVPHESKKITF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g230 ### # start gene g231 4 AUGUSTUS gene 305666 306184 0.81 - . g231 4 AUGUSTUS transcript 305666 306184 0.81 - . g231.t1 4 AUGUSTUS stop_codon 305666 305668 . - 0 transcript_id "g231.t1"; gene_id "g231"; 4 AUGUSTUS CDS 305666 305856 0.82 - 2 transcript_id "g231.t1"; gene_id "g231"; 4 AUGUSTUS CDS 305929 306184 0.87 - 0 transcript_id "g231.t1"; gene_id "g231"; 4 AUGUSTUS start_codon 306182 306184 . - 0 transcript_id "g231.t1"; gene_id "g231"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRCNRRFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRPIARRTGKQPQRRAASESPHDPPPHFDLDAGDHDDQEPPVDPDDPGADNDNDNLDDDSGGLPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g231 ### # start gene g232 4 AUGUSTUS gene 308439 309056 0.62 + . g232 4 AUGUSTUS transcript 308439 309056 0.62 + . g232.t1 4 AUGUSTUS start_codon 308439 308441 . + 0 transcript_id "g232.t1"; gene_id "g232"; 4 AUGUSTUS CDS 308439 309056 0.62 + 0 transcript_id "g232.t1"; gene_id "g232"; 4 AUGUSTUS stop_codon 309054 309056 . + 0 transcript_id "g232.t1"; gene_id "g232"; # protein sequence = [MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAFYVAIQAVLSLYASGRTTGIVLDSGDGV # THTVPIYEGFALPHAILRLDLAGRDLTDFLIKNLMERGYPFTTTAEREIVRDIKEKLCYVALDFEQELQTAAQSSALEKSYELPDGQVITIGNERSVA # VPDEIDVLMNEIFVDSVLLRPSSSLPSLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g232 ### # start gene g233 4 AUGUSTUS gene 310726 312351 0.3 - . g233 4 AUGUSTUS transcript 310726 312351 0.3 - . g233.t1 4 AUGUSTUS stop_codon 310726 310728 . - 0 transcript_id "g233.t1"; gene_id "g233"; 4 AUGUSTUS CDS 310726 312351 0.3 - 0 transcript_id "g233.t1"; gene_id "g233"; 4 AUGUSTUS start_codon 312349 312351 . - 0 transcript_id "g233.t1"; gene_id "g233"; # protein sequence = [MRKTLYMVFSKLEAEIQRSAEAESQAQAYIKRFKELNAEKLNVERESHTLEAELTLYKIQYDLAQKEIVKTRDTVLAL # QTQLDAAENDARRARGDARKVKEALEIWKAREEGRRQGFEAGWNRAREEFGALNAQTVLEYGNEYSDNLPPPELSSFQRTDAQGSGDGGDSISYRTYP # PPDQRGLLQFPEVPMVPASIFNDPPPQSLPIAESISRHSSVSERPQQAIPTHVSSRPSSTRPDMATPAVQMYSLPIPPANEVEFHNRPQSSIRRTNSK # QPQPQLQPWLAETPITRASSPRPPDNFIPAASEDGHIALPPPHELAEYPPSPQPTVNTLPGNTAYSSHGGASMEEGPRREYTSSKGKARATDSWYNHR # GEVDSRAHTPDIAVAKGVLQPEASTSWYQDRPRRASMSSRYSANSSGGLLDAWGYPIQTETKRSGGLGNTLKNIFKGKGKDARMLSMIKENPLSRQGS # LNVGPVLPPSVEPSGSFRGHTYQGTSPTGSYQRFTEDIRYDNPDPTKRERPRPLEVRFEISMHCILLPIQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g233 ### # start gene g234 4 AUGUSTUS gene 313211 315486 0.6 + . g234 4 AUGUSTUS transcript 313211 315486 0.6 + . g234.t1 4 AUGUSTUS start_codon 313211 313213 . + 0 transcript_id "g234.t1"; gene_id "g234"; 4 AUGUSTUS CDS 313211 313219 0.6 + 0 transcript_id "g234.t1"; gene_id "g234"; 4 AUGUSTUS CDS 313277 313756 0.99 + 0 transcript_id "g234.t1"; gene_id "g234"; 4 AUGUSTUS CDS 313804 315486 1 + 0 transcript_id "g234.t1"; gene_id "g234"; 4 AUGUSTUS stop_codon 315484 315486 . + 0 transcript_id "g234.t1"; gene_id "g234"; # protein sequence = [MLYEFGIDIIGEDNKTIVHHKVAARVMCILSEQDAQIAARAEQYQMQQMQQFAGPSSSLSPASNGSMINQTGPSSGPG # SSNSASFNFSGQQPPRRPQMSQQGISGMGGMGGSMRPPGKSGLTFDHILNRLQGELQKSRETGAELHTLTGAMSDIHDTLGGGNLPTTAPPFPHALPP # VRPPQSAAPPPSQPDVPSAPSTQDQQELMSNEPLTTSTTTTHFQMSSASSSALLVELQTQLKDTQTSLSQHIDKIRVLEDALKEQEAIRREVRLLRDM # MDAVQRHDEPSQNTTSHKTRRQSNVEPQGGFDVDEEEETDNFDDEFEDDSRSVGTAVPHELERVDEEDEESASTADDESLPSQVDELDLEMAVREEAR # LQPSAPDGAFDGEFEDNEVEEEEQPQELGRPRTPEPSHLGMGTSRSKALNSPPKHSQGLSSTVVDELTTRLTTLSAQLESALALSSTLQAQHSTAQST # ISALESKVEALESLVTATLSAQQRQPAVTTEEQTAPQRAERESLISMVVEWKKSVEGQWSNVQEEWNQERERLNRAREEWESKVRLVDDGLERMERMR # NVALSKDTPLFHGNGDIKHGLVTPPSPRSLSSDSNRPRRKRSGSGRGRTGSKKRSLSRGAETDDTEATLANEEPHVFEKAASKLIASTQTNQHSELTS # GSPLAVSEPSANPFAHSDHAEDSLVPARTTKAPSINDHNVSIAHCILAIKITDQLSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g234 ### # start gene g235 4 AUGUSTUS gene 323053 324313 0.43 + . g235 4 AUGUSTUS transcript 323053 324313 0.43 + . g235.t1 4 AUGUSTUS start_codon 323053 323055 . + 0 transcript_id "g235.t1"; gene_id "g235"; 4 AUGUSTUS CDS 323053 323612 0.51 + 0 transcript_id "g235.t1"; gene_id "g235"; 4 AUGUSTUS CDS 323726 323871 0.68 + 1 transcript_id "g235.t1"; gene_id "g235"; 4 AUGUSTUS CDS 324018 324313 0.75 + 2 transcript_id "g235.t1"; gene_id "g235"; 4 AUGUSTUS stop_codon 324311 324313 . + 0 transcript_id "g235.t1"; gene_id "g235"; # protein sequence = [MIIQAIALLDQLDKDVNLFSMRVREWYGYHFPELVKLVPDNYTYARVIFFLGDKDTFTEDKLSGLEELLEEAQSAAKS # SGETITGLESTSTTASNILSAARNSMGSSLSPVDMLNISAFAQRVVSLSQYRRSLVAYLATKMNDVAPSLTALLGERVGARLISHAGSLTNLSKYPAS # TVQILGAEKAFMVCYTIQPSLAGLNLNIKEESHVFSPTSVQLQVESTAILVGQNYNLPLLLEDLSLEDDADVDMDNAEPALTTLEASPKKKSKKEKES # KKKRKLDAIDVDRDDDGSDEEVVVKKVKLSKDEKKALKKEKKAKAKAEVNEQVSPTGYV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g235 ### # start gene g236 4 AUGUSTUS gene 325974 326734 0.13 - . g236 4 AUGUSTUS transcript 325974 326734 0.13 - . g236.t1 4 AUGUSTUS stop_codon 325974 325976 . - 0 transcript_id "g236.t1"; gene_id "g236"; 4 AUGUSTUS CDS 325974 326434 0.83 - 2 transcript_id "g236.t1"; gene_id "g236"; 4 AUGUSTUS CDS 326560 326734 0.13 - 0 transcript_id "g236.t1"; gene_id "g236"; 4 AUGUSTUS start_codon 326732 326734 . - 0 transcript_id "g236.t1"; gene_id "g236"; # protein sequence = [MIMLLVNLTQQRMSDRLMYLSELECTVLEVKVIEGLGTTIDVVLSNGILREGDKIVVCAYVHHKEVKAALGVKITAPD # LEKAIAGSRLLVCGPDEDEDDLKEEVMSDLATLLNNIDKSGRGVCVQASTLGSLEALLDFLKSSKIPVSGINIGPVHKKDVMRSATMLEKARELACIL # CFDVPVDKDAERMAEEMGIRLFKGNKWLLFPLVAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g236 ### # start gene g237 4 AUGUSTUS gene 327447 329394 0.54 - . g237 4 AUGUSTUS transcript 327447 329394 0.54 - . g237.t1 4 AUGUSTUS stop_codon 327447 327449 . - 0 transcript_id "g237.t1"; gene_id "g237"; 4 AUGUSTUS CDS 327447 327886 0.83 - 2 transcript_id "g237.t1"; gene_id "g237"; 4 AUGUSTUS CDS 327941 328358 0.94 - 0 transcript_id "g237.t1"; gene_id "g237"; 4 AUGUSTUS CDS 328481 328870 0.93 - 0 transcript_id "g237.t1"; gene_id "g237"; 4 AUGUSTUS CDS 328972 329036 0.7 - 2 transcript_id "g237.t1"; gene_id "g237"; 4 AUGUSTUS CDS 329115 329394 0.92 - 0 transcript_id "g237.t1"; gene_id "g237"; 4 AUGUSTUS start_codon 329392 329394 . - 0 transcript_id "g237.t1"; gene_id "g237"; # protein sequence = [MFNQPLTYSSLKSAIKASSNKPKKDKKKTKKDYVSAEPSDNEATSKQATVVTADDFVDDEWGPLKDKGKKIKKGKSNQ # HKAVEENIEDVETKPESIAELHDEGVVDEIPGESLGEAKKKAQAAKKVNVTEAALPDTQEPLLPSEPIPEENDREVDEGGKADSKNKKKKKKTKKDEE # PPPPPPPTTKKKGGISALKAMMEEKKRLEEEARRAEEEERRRIEEEERKAEEEAKRKEEEKQRKKEKEKAAAEIRKQALLASGVQIEGLQQSTNMPTK # KVVYSNRKKKGPTANGASPASSRPRTPESPVVQEEKEDSILNLADGSLAPANKLEEAEEASAKDDWDASSDEETKPASDGKKDSWDASSDGGAELKPT # PSYSSTGKSPSKPTPNDPRQLDAKVAPVASNAKPPRNAVPVSKAANPKTKASDDEDSAEYSDSDASSEEDSSEEDSDSDEESSEDELSTAQKLAAQRK # VEAAARRAKAHEAALAARSKDDLRSPICCILGHVDTGKTKLLDKVGWVARITMYRTLTRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g237 ### # start gene g238 4 AUGUSTUS gene 335612 338250 0.96 - . g238 4 AUGUSTUS transcript 335612 338250 0.96 - . g238.t1 4 AUGUSTUS stop_codon 335612 335614 . - 0 transcript_id "g238.t1"; gene_id "g238"; 4 AUGUSTUS CDS 335612 337478 0.96 - 1 transcript_id "g238.t1"; gene_id "g238"; 4 AUGUSTUS CDS 337529 338250 0.96 - 0 transcript_id "g238.t1"; gene_id "g238"; 4 AUGUSTUS start_codon 338248 338250 . - 0 transcript_id "g238.t1"; gene_id "g238"; # protein sequence = [MKSNLQLSISAGDLVAATESSPATRPESPASSIEADDVDWTFAQREAAFARLGLDPTLDSLPDDDLNRLFEKVTKAKT # FREHHLKSRPESSLSQADDVWSETGRPVPSEAATDDTSLEAPTSHYSPETGNGALKDVQDQLESRLEAITTEGSKEAEDLKLEKEHMEYQLRLVRTQM # KRMIDARSRGETELEQLDFEPVIYSAKQLRLIRKVVDKWRTHRSFSMAEVVLSKAVLIKEANIISKELSKQVSYNFTISSGGPLASPASSVDTIAGLD # QFGDVSDPILRSATQPSVAIKVLDGRHNAIYIWSLDRMQQQLQRMRNITAYIDRPSFTQHFSSDEPFYDSPPPQYSFIGSALISLAPISRSLSCTYTV # PIFCRSTAEAIGSCRVDIKLVNIALPSKHASGQPSGSTSQGSGIIPTGTKLSFFFTVDTVKGLSLHDFSAVHLQVRLSSFVGPTLSAEEVFPSTAVDL # ESSSLSELRFRRSFSIVASPKVLNHLRQGYAPIEFFAAVTPTYLERMERWDEMREQKIYFPGSQESRLSSPDSQSTNTPPMRRSETDFVVEQNHDVIV # WIQVCELAPDGQYAPVPVLSQGTLDPGSFSLHQGLQRRIVISLSSNSGQQFPWSEFTKVRIGNVRVIDAKGRVQESSSKALITLPLLQEQNIEFKPDG # TGSLFGQALWDSSVHNSSLLNKVTPMNQRVLLQLTCAVSVETCADPVQFNIDVAITIGTRDARPPSKLLTFFGSKKILSKSSHLFRVRLSPPLTRSVK # ELWRLDTAEKYVRGEESLGAWRPRGISVVEDYLRLIMMEQRAADVQATRAILTTSRPLVTQPDALAWRADDLVRKALELWQRRYYGNVCVFYQHPTCN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g238 ### # start gene g239 4 AUGUSTUS gene 338975 339888 0.81 - . g239 4 AUGUSTUS transcript 338975 339888 0.81 - . g239.t1 4 AUGUSTUS stop_codon 338975 338977 . - 0 transcript_id "g239.t1"; gene_id "g239"; 4 AUGUSTUS CDS 338975 339264 0.97 - 2 transcript_id "g239.t1"; gene_id "g239"; 4 AUGUSTUS CDS 339303 339888 0.81 - 0 transcript_id "g239.t1"; gene_id "g239"; 4 AUGUSTUS start_codon 339886 339888 . - 0 transcript_id "g239.t1"; gene_id "g239"; # protein sequence = [MFSSSRSHAVFTLLLTMKRHDSDTNLDTEKVSRISLVDLAGSERANSTGATGQRLKEGANINKSLTTLGKVISSLALA # SSADTKKGKKGKSEDFVPYRDSVNSTVLFCFAANLHTCIKVLTWLLKDSLGGNSKTAMIAAIAPADYEETLSTLRYADQAKKIKNKAVVNEDPNAKLV # RELKEELEMLRGLLNISICFSGSSAEDTFDPKVPPEKQKVTYQTKDGRIKTVTKAELQEQMETSEKLMQSLNETWEQKMVRTQEVQKEREKALEELGI # SVEKNMVGVHTPKKVCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g239 ### # start gene g240 4 AUGUSTUS gene 341377 341682 0.65 + . g240 4 AUGUSTUS transcript 341377 341682 0.65 + . g240.t1 4 AUGUSTUS start_codon 341377 341379 . + 0 transcript_id "g240.t1"; gene_id "g240"; 4 AUGUSTUS CDS 341377 341682 0.65 + 0 transcript_id "g240.t1"; gene_id "g240"; 4 AUGUSTUS stop_codon 341680 341682 . + 0 transcript_id "g240.t1"; gene_id "g240"; # protein sequence = [MQGGSAQLNSTTLPAATEVPSSITTSDLSSDVSPAGSTMQVKHVGVDPSVLDATSLKPLSSLKWPYIADEEPIYPDPL # ERNDPKPLRTRHYEAIGIHIFAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g240 ### # start gene g241 4 AUGUSTUS gene 349998 351325 0.91 - . g241 4 AUGUSTUS transcript 349998 351325 0.91 - . g241.t1 4 AUGUSTUS stop_codon 349998 350000 . - 0 transcript_id "g241.t1"; gene_id "g241"; 4 AUGUSTUS CDS 349998 350634 0.98 - 1 transcript_id "g241.t1"; gene_id "g241"; 4 AUGUSTUS CDS 350677 351164 0.97 - 0 transcript_id "g241.t1"; gene_id "g241"; 4 AUGUSTUS CDS 351323 351325 0.94 - 0 transcript_id "g241.t1"; gene_id "g241"; 4 AUGUSTUS start_codon 351323 351325 . - 0 transcript_id "g241.t1"; gene_id "g241"; # protein sequence = [MFALTRGIASTTVGVSATIVDAALFGGVTVTRPVIGGAVSAAIGLVEQLTLVPIHLGEYLTSTSVIAAHSSINLLSVI # FPGSHEASFSLASFITLVKREWAQPIDGENLPEKQFGVTSIARAVSAWAALQGVTQEWQERRWFKYLKEIDVKNTPKHFDSLRNRKSMQCRGSRVRVT # SDVIFPGNLGQLVAADIGEAPKRAQSISISNRVISPPPNTQVKGVPHSSRRLSNTELKVELRRLSKMVLAGYGGASLLFFGIPLSSSIGANVSSSSPQ # AKAEEAQLANAVNASEAEAEGDGLRPEIMHEEQYSWWDVLLGRHDHDILAKSANDPNETIQTEIKIGREHLMPRFWVLTDHSRAQVVLILRGRSFNGI # TGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g241 ### # start gene g242 4 AUGUSTUS gene 353983 356346 0.79 + . g242 4 AUGUSTUS transcript 353983 356346 0.79 + . g242.t1 4 AUGUSTUS start_codon 353983 353985 . + 0 transcript_id "g242.t1"; gene_id "g242"; 4 AUGUSTUS CDS 353983 356346 0.79 + 0 transcript_id "g242.t1"; gene_id "g242"; 4 AUGUSTUS stop_codon 356344 356346 . + 0 transcript_id "g242.t1"; gene_id "g242"; # protein sequence = [MDNGVPLNPKTFEAVLEAMVTSDGNIPRSTGNELFNFLKTLLPKSTILSLNPTFTGGRGSRAALHLFMSARNMKQQQR # TERMYRTLIGSFLFHGELIAASLLITIILKDCAVRDAIGRQLASPDIKEDAKLEQESLVHYRFLRRSSPSPPFDILKDLIESIAGVLSRDPVEDDAYQ # ISFQAALQALANLAYLFDIRQIPYSHLSSLIRLLYNCPKGDDLVWVTKIDGHPVQVKAYDYFHHVLERIVRYPPRMRIEKMKPNKLLTRWKPVLDNSR # PLDLPACNSLLHYALRHRLSPSYANNILQYMQDPFWKHSGYRRPIPNTVTYNIILSAGRLLRSPIMVDTVLRMLKDMNEHGLGTIDLSPAASPANFDL # TRGSSNDRFSSALRRLGSESHELSLPCPPTTKKFGADTHTLTAYITYLVSVGRADVVPNILFGLLPELAIVDHPSWGDLGPEQIKHLRQQSRMDCLRR # VVAYGPYFFVAILNAVVKDGRTGLAERVWYLAKEAERASWLPEFNHGREPWCLPVHAYTLMLVCYGNESRKHPYRSPLPSTATAWQPRSNRYVVGWAH # YIQQQNARSRQPLDRSVAGHKSGVSVYQSMLRGARSVYKALQAFKVSNNDKEVHSWGDLQLPEPDERFFNAMLRIVSRDARKRPRRARTTPSHWKQHI # RFANWLYRQYGQSQSQQNTDLILLVAEDMVKAGFELPVGVQYMLIGQDINNQLLRQRRRRPVVSRYRGPWAFPVAQMAQTPFALRVEKQKGLPLGRIP # NVLRRRKGISRRHKEEFAFIENR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g242 ### # start gene g243 4 AUGUSTUS gene 356416 358963 0.56 - . g243 4 AUGUSTUS transcript 356416 358963 0.56 - . g243.t1 4 AUGUSTUS stop_codon 356416 356418 . - 0 transcript_id "g243.t1"; gene_id "g243"; 4 AUGUSTUS CDS 356416 356947 0.62 - 1 transcript_id "g243.t1"; gene_id "g243"; 4 AUGUSTUS CDS 358266 358303 0.62 - 0 transcript_id "g243.t1"; gene_id "g243"; 4 AUGUSTUS CDS 358556 358963 0.56 - 0 transcript_id "g243.t1"; gene_id "g243"; 4 AUGUSTUS start_codon 358961 358963 . - 0 transcript_id "g243.t1"; gene_id "g243"; # protein sequence = [MTLFSSGSDSNKEQWDGANTTFADARRVFQVDDARHIDDFPSHLRSVVHQYSNVYVDLPSSRTRRTSKATTKSLLKYL # SGRSEADLVVESLGKSRPKPLAPEVGRLRAIKSASEQKLMRMAADISGRAHAKAGNFLEELILVDAGCEYKYNKLKNEKIPFAEVHLVEDSGQLVKIA # LRDLLAKVDKEVSYVELQAAEPLAVVKIIDKKEAAARRKQAKEQQKMNAKKNVKKEFQFTWGMAIGDLEHKLDRAKAELKRGSRVDLVFAPKSGQKSP # PMAQMRERMQLIADKVADVGVEWKSRELSRGIGALFVQSLGLQCEEEGSAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g243 ### # start gene g244 4 AUGUSTUS gene 359690 361447 0.4 - . g244 4 AUGUSTUS transcript 359690 361447 0.4 - . g244.t1 4 AUGUSTUS stop_codon 359690 359692 . - 0 transcript_id "g244.t1"; gene_id "g244"; 4 AUGUSTUS CDS 359690 361447 0.4 - 0 transcript_id "g244.t1"; gene_id "g244"; 4 AUGUSTUS start_codon 361445 361447 . - 0 transcript_id "g244.t1"; gene_id "g244"; # protein sequence = [MYMNHQKVNSLISDATRCVDEVAFSTAPAPGTAPPVHQGMADYLAPPQGLGTGQFLDTSDITGNMGSSIPPSPTSLNA # YPEASRSADDFGVASRNSPIASRFSTFPTTSGNGGAGFSLRDGSSYHAEDDSFSSSIAAALDARKSTEEPAPSYETHQVHLTRPPAGAAPPLMMPSPW # ELQESASQNTNQRAVSAYGDDVGLAYMTNPEEEPHPDHGLDHQRNTSKEVHFGQVQDIAIELDNRHEQGNIENYQADGIAPPGEARSSPKRVPPPSMS # PEEEERALNADAARKLSREMDSFSFDPSSSALSAIPPPIVQPSQERGVERPSSLTPEFETNNRSTSPLIPPVAPFAQQRGVSPSPIDINSHHDDIEKT # SSPIHNSPPRLTISDRTASSISNGSSYRTPPEYPRSIGTSPFGQRSNSSFSGSMPSSPAIGAPRTISAAAFRRPAGAPGRTTSADLGSGSGLSGSHLA # DVSPLQPKKRGLPNAPSSSLSHSNPSLRPYEAHNLNAGNRVSQAGSDDYDYISAYTDAPQDTGSPQRNDYGSLGQVRVTNDLNPTSPGTPVEGQHPNR # PGYGEGRFATNLEGELR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g244 ### # start gene g245 4 AUGUSTUS gene 361490 361861 0.88 - . g245 4 AUGUSTUS transcript 361490 361861 0.88 - . g245.t1 4 AUGUSTUS stop_codon 361490 361492 . - 0 transcript_id "g245.t1"; gene_id "g245"; 4 AUGUSTUS CDS 361490 361861 0.88 - 0 transcript_id "g245.t1"; gene_id "g245"; 4 AUGUSTUS start_codon 361859 361861 . - 0 transcript_id "g245.t1"; gene_id "g245"; # protein sequence = [MKGIRSREEALDELKRRRKALISKADTAEKKLSKMSPEHKNLGVQTDTLNRLRDEIRSMDSEIMSDEASLGDYKRSRT # KAWMGLKFGGLLECCEKGTIIGEFGRLVINVSETSRNQSLCLSFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g245 ### # start gene g246 4 AUGUSTUS gene 367456 368050 0.47 - . g246 4 AUGUSTUS transcript 367456 368050 0.47 - . g246.t1 4 AUGUSTUS stop_codon 367456 367458 . - 0 transcript_id "g246.t1"; gene_id "g246"; 4 AUGUSTUS CDS 367456 367843 0.74 - 1 transcript_id "g246.t1"; gene_id "g246"; 4 AUGUSTUS CDS 367893 368050 0.47 - 0 transcript_id "g246.t1"; gene_id "g246"; 4 AUGUSTUS start_codon 368048 368050 . - 0 transcript_id "g246.t1"; gene_id "g246"; # protein sequence = [MVRLPARLHLGHGALCTLGLLLQDFALAQNLTDSQISDVETRLAEGATHPCVNWELGTRAQALLEHNVRDFSVFSLTL # PSTSVPSDTSSAIAPVFSIAKGVVNNRTAVNGNITGPQPLVTDDSAADPASIGPAVLLANWTNLGDGVDYAGAALDQLNFLYEKVPKTSDGAISHRTG # EVQLW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g246 ### # start gene g247 4 AUGUSTUS gene 372648 373622 0.49 + . g247 4 AUGUSTUS transcript 372648 373622 0.49 + . g247.t1 4 AUGUSTUS start_codon 372648 372650 . + 0 transcript_id "g247.t1"; gene_id "g247"; 4 AUGUSTUS CDS 372648 373622 0.49 + 0 transcript_id "g247.t1"; gene_id "g247"; 4 AUGUSTUS stop_codon 373620 373622 . + 0 transcript_id "g247.t1"; gene_id "g247"; # protein sequence = [METQLLGFLDYDLRFDEEEACHMFAPFMATPAQRASTRALAVDRVVKAGRARVQAQQIPDSSVEAIPSHLPSQSSSTS # SGLASTVRTLAKRISNTHISSSRSQSTTSTASSPMYTSLSTTSTLSSSSSDVGSLIEDSGSSSGSSSGWNTSDSESDLEEYAEPEVYSNSSMSLYPRD # EQVPERLIKSSSIVRSMPSYAQKSQQLRSRKPSDASSICTVTQSPLISAAHSRRCSNKRAVSISVAGTDHVKDSGISSSATMPIISRGTSGNFLARMW # GAAKGQAWQDKTLDDGDHAESQGSSTFRRLVLVHSRSGLSRGASSSGVDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g247 ### # start gene g248 4 AUGUSTUS gene 384190 385097 0.68 - . g248 4 AUGUSTUS transcript 384190 385097 0.68 - . g248.t1 4 AUGUSTUS stop_codon 384190 384192 . - 0 transcript_id "g248.t1"; gene_id "g248"; 4 AUGUSTUS CDS 384190 384913 0.99 - 1 transcript_id "g248.t1"; gene_id "g248"; 4 AUGUSTUS CDS 385015 385097 0.68 - 0 transcript_id "g248.t1"; gene_id "g248"; 4 AUGUSTUS start_codon 385095 385097 . - 0 transcript_id "g248.t1"; gene_id "g248"; # protein sequence = [MEDSVAGGDLLVCRGLQKRSLPLESAFMVSGLNPNKTKPSTSRVPANNDDSDDSNDDYYGDAELAASTTPQVEPRNYR # EAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLPPGAKAIGSTWVFRIKHNADGSIERFKARLCAQGFSQRPGFDYLETYASTLRWSSLRLVLAFVKV # MTENKVTRLGIEPRTFWLYSRCSNQLSYPTLVQLMRLMHMVTLTVQSTLLGLTLSSAYASFHSRGGVFSQNLSPRAPKLRIMKRPTTWYMVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g248 ### # start gene g249 4 AUGUSTUS gene 387391 388728 0.93 - . g249 4 AUGUSTUS transcript 387391 388728 0.93 - . g249.t1 4 AUGUSTUS stop_codon 387391 387393 . - 0 transcript_id "g249.t1"; gene_id "g249"; 4 AUGUSTUS CDS 387391 388728 0.93 - 0 transcript_id "g249.t1"; gene_id "g249"; 4 AUGUSTUS start_codon 388726 388728 . - 0 transcript_id "g249.t1"; gene_id "g249"; # protein sequence = [MEFTLNGFVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYGDVSKLSKNKMVEGFKLE # SSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFKRFKAWAEKVTGLKVKIL # RHDKGGEYISKEFEKFLQDEGIEVQRTARNRPQQNGVAERLNTTLAELLTAMLLESGLPKTFWVECLAALVHVLNRCPTSAVPDVTPYEVFYKKKPNV # ENLRVWGCMAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVPPEPTPKQQPLKVTSSAP # NELFTLPIPIDESESDSDSNSDVDKANQPNSPRLEHTPGPDIPVTEDESDEQPIAIRRPVRTRKPPGEWWKTC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g249 ### # start gene g250 4 AUGUSTUS gene 389214 389486 0.77 - . g250 4 AUGUSTUS transcript 389214 389486 0.77 - . g250.t1 4 AUGUSTUS stop_codon 389214 389216 . - 0 transcript_id "g250.t1"; gene_id "g250"; 4 AUGUSTUS CDS 389214 389486 0.77 - 0 transcript_id "g250.t1"; gene_id "g250"; 4 AUGUSTUS start_codon 389484 389486 . - 0 transcript_id "g250.t1"; gene_id "g250"; # protein sequence = [MSENRHRSITTVCSTVVRDFIGQIQEIQRDHLRASRERVAAAKAARVAAAAASKSRISDGPLVSTEKAVNEAAWALME # RELAENALLSIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g250 ### # start gene g251 4 AUGUSTUS gene 911018 912658 0.23 + . g251 4 AUGUSTUS transcript 911018 912658 0.23 + . g251.t1 4 AUGUSTUS start_codon 911018 911020 . + 0 transcript_id "g251.t1"; gene_id "g251"; 4 AUGUSTUS CDS 911018 911028 0.66 + 0 transcript_id "g251.t1"; gene_id "g251"; 4 AUGUSTUS CDS 911141 911556 0.57 + 1 transcript_id "g251.t1"; gene_id "g251"; 4 AUGUSTUS CDS 911642 912177 0.76 + 2 transcript_id "g251.t1"; gene_id "g251"; 4 AUGUSTUS CDS 912311 912658 0.62 + 0 transcript_id "g251.t1"; gene_id "g251"; 4 AUGUSTUS stop_codon 912656 912658 . + 0 transcript_id "g251.t1"; gene_id "g251"; # protein sequence = [MIIQPIDSYRSRNYLGSRIHDQNARCKWKIESDSWFSRNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIK # TFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSQYNEPKNVTPDNEKSTGEHDSKGKFHGYKQCEQETFSKKELSEAYVLASREHLKSQDDQ # AEKIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNNQFNLNPIKSFFLQNGRIKPKPIQREVQKRQFVEPVLQNFSLGENCNKSEATETTQNQCNN # KNTSETIRDDNWNKPKNSQRTRKRMVRYEVLKRGTESFQRSQPSFEKQDKSPINLIHEMIKQMVNEAIEVEKPINLNTEEVFTKYKPVDKKVNSIKAT # LPDEFRIERHIHGDPLLELPELSKHPKLFVPMGRYTEERKEIIDKNHPEGFLWERERSYAQNEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g251 ### # start gene g252 4 AUGUSTUS gene 913360 916919 0.13 + . g252 4 AUGUSTUS transcript 913360 916919 0.13 + . g252.t1 4 AUGUSTUS start_codon 913360 913362 . + 0 transcript_id "g252.t1"; gene_id "g252"; 4 AUGUSTUS CDS 913360 914305 0.35 + 0 transcript_id "g252.t1"; gene_id "g252"; 4 AUGUSTUS CDS 914388 914727 0.14 + 2 transcript_id "g252.t1"; gene_id "g252"; 4 AUGUSTUS CDS 915983 916919 0.69 + 1 transcript_id "g252.t1"; gene_id "g252"; 4 AUGUSTUS stop_codon 916917 916919 . + 0 transcript_id "g252.t1"; gene_id "g252"; # protein sequence = [MQEEPLMEPRHFFVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVP # FEWNEKCNKAMDELKDGIQDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPSEKKKFFNYFGSITLNEREALFSQCKRELYDLKLALEASYYHVYG # CRRLTVETNASYIKGMLDNPSCGPNATINCWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQ # FNNFKGQIDPRSGYLYETTQEADDIELDVQEALDEERSYEIHAHRSSEGNRLDELIPLIGNYLSNPTDEFLGEMLKEERIKFIRLIKKFQVDDQGRLY # HKNTDQPDQPQLVVEKEKHMHMLNSAHDCLGHKGVFAMNDFLQKRFWWPDIYKDVEXTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGI # KGIRISAYNSQANGKIERAHLDICQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAELLLPFDIVESTWLVNPPNRILTRDELIGY # HAQALSEYNSFIEEVRQRVDANKVAELRRFEQKYRHTIKDWNFKPGQLVQVRNSGIEKSLDRKMYPRYRGPILIIRRTKGGSYIIAEMDGTVLKEKVG # AFRVLPHFTRNEPIELPNNIHELIDLTAKQLDLMVEDEDEYWMTPENDYIFDAISHLRLPDTNSDEELSAEEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g252 ### # start gene g253 4 AUGUSTUS gene 920935 921723 0.99 - . g253 4 AUGUSTUS transcript 920935 921723 0.99 - . g253.t1 4 AUGUSTUS stop_codon 920935 920937 . - 0 transcript_id "g253.t1"; gene_id "g253"; 4 AUGUSTUS CDS 920935 921723 0.99 - 0 transcript_id "g253.t1"; gene_id "g253"; 4 AUGUSTUS start_codon 921721 921723 . - 0 transcript_id "g253.t1"; gene_id "g253"; # protein sequence = [MSTPAPPAPPTSAEDLMTQLIRQVANLATAMEEHSSSKLSMNKPKVFKGKDGSKAHRFMAQFQNWASEQPGLAKSQVK # LIKSALGFFTESAGDWATPYLLHFSTENPPFRGNWDMFLKEFGQQFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDQTEMSDIDLRECFFTA # LLPEIQQHLITVNIAQGIAPTLKEAIKWAISVDVHLHDPTMTGQNNGHTPAHTAHITPADPHAMDIDATHTSTGNSREAFLAHMRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g253 ### # start gene g254 4 AUGUSTUS gene 926173 926915 0.37 + . g254 4 AUGUSTUS transcript 926173 926915 0.37 + . g254.t1 4 AUGUSTUS start_codon 926173 926175 . + 0 transcript_id "g254.t1"; gene_id "g254"; 4 AUGUSTUS CDS 926173 926458 0.53 + 0 transcript_id "g254.t1"; gene_id "g254"; 4 AUGUSTUS CDS 926515 926915 0.66 + 2 transcript_id "g254.t1"; gene_id "g254"; 4 AUGUSTUS stop_codon 926913 926915 . + 0 transcript_id "g254.t1"; gene_id "g254"; # protein sequence = [MPLVPRDRFFMPPRTRAQSRANSEENTFFTTAQSFAPFSESISAIGQPCCRNCSFSPATVPTTSTLPEAMEKEQQFKY # SILYTGDGQPVQVLTPCSIACCTGKQPQCHATSHSPCNPPFHFDLNAGDHDDQDPPVDPDDPGADNNNSDNNNPDDDSGGLLQGGPGDPSGPGSPCTP # ISPDIPNEQHAMLELLSVLLKPLVLLAALNQPSDSSESKSKVKELEVFDGPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g254 ### # start gene g255 4 AUGUSTUS gene 931537 931929 1 + . g255 4 AUGUSTUS transcript 931537 931929 1 + . g255.t1 4 AUGUSTUS start_codon 931537 931539 . + 0 transcript_id "g255.t1"; gene_id "g255"; 4 AUGUSTUS CDS 931537 931929 1 + 0 transcript_id "g255.t1"; gene_id "g255"; 4 AUGUSTUS stop_codon 931927 931929 . + 0 transcript_id "g255.t1"; gene_id "g255"; # protein sequence = [MDFADNTGANTTFNSQFNIEQNDIKIEYHPNSGKPPVIERFDIHTADHDHVPSNDSRLRPWLPFRTRMDFEVATLALE # CSMNDKQTEKLIMLLNHVQQGFDKCTLKDYKEVQDTWDLAAEKSTKVCNSIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g255 ### # start gene g256 4 AUGUSTUS gene 941494 942441 0.7 - . g256 4 AUGUSTUS transcript 941494 942441 0.7 - . g256.t1 4 AUGUSTUS stop_codon 941494 941496 . - 0 transcript_id "g256.t1"; gene_id "g256"; 4 AUGUSTUS CDS 941494 942441 0.7 - 0 transcript_id "g256.t1"; gene_id "g256"; 4 AUGUSTUS start_codon 942439 942441 . - 0 transcript_id "g256.t1"; gene_id "g256"; # protein sequence = [MEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYP # LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLVSDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDE # WKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHQEHVKEVLRRLRHHRLYANPEKCEFNMDTVEYLGYIL # SPDGLTMSKEKVQTVLEWPVPRKVKDIQSFWVLQILSSFYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g256 ### # start gene g257 4 AUGUSTUS gene 943255 944928 1 - . g257 4 AUGUSTUS transcript 943255 944928 1 - . g257.t1 4 AUGUSTUS stop_codon 943255 943257 . - 0 transcript_id "g257.t1"; gene_id "g257"; 4 AUGUSTUS CDS 943255 944928 1 - 0 transcript_id "g257.t1"; gene_id "g257"; 4 AUGUSTUS start_codon 944926 944928 . - 0 transcript_id "g257.t1"; gene_id "g257"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSITRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDAGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # GPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYF # TDQRKVNYTLSYLSGSAKEWFVPDILDPGLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETKNIRKYNIRFNTLAASTNWDSAALKW # AYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSSNQHNNSQPSGSTAPFTPKPKPFSGGKPNN # NGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g257 ### # start gene g258 4 AUGUSTUS gene 946194 947427 0.34 + . g258 4 AUGUSTUS transcript 946194 947427 0.34 + . g258.t1 4 AUGUSTUS start_codon 946194 946196 . + 0 transcript_id "g258.t1"; gene_id "g258"; 4 AUGUSTUS CDS 946194 946242 0.34 + 0 transcript_id "g258.t1"; gene_id "g258"; 4 AUGUSTUS CDS 946535 947427 0.8 + 2 transcript_id "g258.t1"; gene_id "g258"; 4 AUGUSTUS stop_codon 947425 947427 . + 0 transcript_id "g258.t1"; gene_id "g258"; # protein sequence = [MRTASEHGSAQTDVDRPMVCLTLPAACSAHTDGFVPSKASRTCVRGKCESQFMLELITLCSIAEKRNQFESDLYPLWD # TVWNNFASLLNNPDSETIISVAAQYTLDHKFLNARGSMSHHVKIPDDMILKLDDTPQRKFIFWAELKRLRDDFDDWFTIDGKIAANNVIENTVKQTNT # QAQYALAHFNLQGNASMYTFIISGPYFVLVEYRVESMSPGFFTREHARRGAAVTRSQTQNDEFEEDPLEDDHTTPFYPYGTDPYCLFDVTDAELEAGN # YRLTQGVKLNPMLLQALRMVLRNHEDIRSRMQRVDWFDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g258 ### # start gene g259 4 AUGUSTUS gene 947853 948065 0.93 + . g259 4 AUGUSTUS transcript 947853 948065 0.93 + . g259.t1 4 AUGUSTUS start_codon 947853 947855 . + 0 transcript_id "g259.t1"; gene_id "g259"; 4 AUGUSTUS CDS 947853 948065 0.93 + 0 transcript_id "g259.t1"; gene_id "g259"; 4 AUGUSTUS stop_codon 948063 948065 . + 0 transcript_id "g259.t1"; gene_id "g259"; # protein sequence = [MLYDDEDLGGHEPGQQQNQQTDEDGGSSESDNNLYESSEPEREDWQDEIDTEKDWDMKIVGVEVANGDEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g259 ### # start gene g260 4 AUGUSTUS gene 948328 949810 0.96 + . g260 4 AUGUSTUS transcript 948328 949810 0.96 + . g260.t1 4 AUGUSTUS start_codon 948328 948330 . + 0 transcript_id "g260.t1"; gene_id "g260"; 4 AUGUSTUS CDS 948328 948816 0.96 + 0 transcript_id "g260.t1"; gene_id "g260"; 4 AUGUSTUS CDS 948878 949810 1 + 0 transcript_id "g260.t1"; gene_id "g260"; 4 AUGUSTUS stop_codon 949808 949810 . + 0 transcript_id "g260.t1"; gene_id "g260"; # protein sequence = [MSSNTRYRAQLFDEKLAITEGRLNRKRNSAVRVEYDLGEGLEREMLRLLKKEIGEEETRKMLKEYNDDEDSDDDDGKD # TDNEDGDNDNDENQDDRSVQRRTRSETASSRTRSTAPSTSNSASISRAQSTISSGPSGLSRSQLKNVSNVRSNPRIPQAQGSGGQVKLSAPGPSSSLI # PPGRSAFSPAPPSFGPQVSRKIPPASPLHSSPTTSSSTFSTGLASSRSPASTVHTTPPPPSSSLFLSSTSHSASTTRTRISSISKKPWATSPMTKLPT # KIGSSAVSFLNPSLPTSSSSSFSSYSSSKPLSIMSSTFASSLSSMSTVSTPTLGRSTSALSFSGSETLPKHTIPILADSIPLGAAESRPMKALPHRKT # QTQIQTFNSETTSTTASTTSKPTLSHNSRTRTKITTTSAETVRDGLGSKSRASTDSMNLDANQNNDVELGEDNARVKPNRKGKTRETRRFVLPASICF # GFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g260 ### # start gene g261 4 AUGUSTUS gene 952894 953334 0.92 + . g261 4 AUGUSTUS transcript 952894 953334 0.92 + . g261.t1 4 AUGUSTUS start_codon 952894 952896 . + 0 transcript_id "g261.t1"; gene_id "g261"; 4 AUGUSTUS CDS 952894 953334 0.92 + 0 transcript_id "g261.t1"; gene_id "g261"; 4 AUGUSTUS stop_codon 953332 953334 . + 0 transcript_id "g261.t1"; gene_id "g261"; # protein sequence = [MPFSGSSSYVVPHSASCPSASSTPTTSPSSSTSSSSSESGAIAGEVIGVLGFLAALIFFGMWFRLYRQQHRKPEFAQT # FMQTSGNNGNGHGVVLTPVIVTPYDGPAPTQRIASWMRRLYRPSKYLDEADMKEANIRDDSDTTRSMR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g261 ### # start gene g262 4 AUGUSTUS gene 955690 956400 0.98 - . g262 4 AUGUSTUS transcript 955690 956400 0.98 - . g262.t1 4 AUGUSTUS stop_codon 955690 955692 . - 0 transcript_id "g262.t1"; gene_id "g262"; 4 AUGUSTUS CDS 955690 956400 0.98 - 0 transcript_id "g262.t1"; gene_id "g262"; 4 AUGUSTUS start_codon 956398 956400 . - 0 transcript_id "g262.t1"; gene_id "g262"; # protein sequence = [MQWSHPITNGDLPPPSRAHTATLVDRKIYVFGGGQAASYSDSVYILDTVTRKWTKPIISGAIRDPNTGEVIGSAPGPP # GSGGSNHSNGTNSRSSPISSTVYGEIPAPRRAHTAVYYNGKIWMFGGGNGMMALNDVWTLDVSKMIWERMNVRGRDSALSPEDYQDGGKGGRYHGLGG # IPSPRGYHTANLVGNMMIIVGGSDGKDCFAEIWCLNLGKFLFLKLSPLTLTYSWILNFLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g262 ### # start gene g263 4 AUGUSTUS gene 958971 959484 0.87 + . g263 4 AUGUSTUS transcript 958971 959484 0.87 + . g263.t1 4 AUGUSTUS start_codon 958971 958973 . + 0 transcript_id "g263.t1"; gene_id "g263"; 4 AUGUSTUS CDS 958971 959178 0.88 + 0 transcript_id "g263.t1"; gene_id "g263"; 4 AUGUSTUS CDS 959243 959484 0.88 + 2 transcript_id "g263.t1"; gene_id "g263"; 4 AUGUSTUS stop_codon 959482 959484 . + 0 transcript_id "g263.t1"; gene_id "g263"; # protein sequence = [MYSSYNIGTTVWSALASGLLTGKYNDGIPEGSRFDVEKSFFSGTLKELQSPEGQEKIRKVKELTKLAQEELQTTPSAL # ALAWVARNPNTSTVILGATKPEQLLENLKAIEVIPKLTPEILEKIEAILGNKPGGVVSSCLLVLLPCVTYM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g263 ### # start gene g264 4 AUGUSTUS gene 962262 962828 0.63 - . g264 4 AUGUSTUS transcript 962262 962828 0.63 - . g264.t1 4 AUGUSTUS stop_codon 962262 962264 . - 0 transcript_id "g264.t1"; gene_id "g264"; 4 AUGUSTUS CDS 962262 962828 0.63 - 0 transcript_id "g264.t1"; gene_id "g264"; 4 AUGUSTUS start_codon 962826 962828 . - 0 transcript_id "g264.t1"; gene_id "g264"; # protein sequence = [MSSLSRSQLLQSATAFCDVFAQKKDLNVILSHFSTTHQVSAVEHGEKALAPFLGRSFEGLDGIRAYFETIAALLSYED # MEFSEFTVDTEARRVACKGKAKFTWNQTKESWDEMFAYLLDFDDSGKITHYQVWADSGAAYLARNGQLDKIRKVCKQSSFFRDVNEPFRRVSRSYGAT # LSIHRTTLGRSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g264 ### # start gene g265 4 AUGUSTUS gene 963789 965342 0.58 - . g265 4 AUGUSTUS transcript 963789 965342 0.58 - . g265.t1 4 AUGUSTUS stop_codon 963789 963791 . - 0 transcript_id "g265.t1"; gene_id "g265"; 4 AUGUSTUS CDS 963789 964122 0.97 - 1 transcript_id "g265.t1"; gene_id "g265"; 4 AUGUSTUS CDS 964807 965342 0.6 - 0 transcript_id "g265.t1"; gene_id "g265"; 4 AUGUSTUS start_codon 965340 965342 . - 0 transcript_id "g265.t1"; gene_id "g265"; # protein sequence = [MDICRSAGVKRKRSEDPGPIASSSRQRLDDRGWTSAGYDTSLDRNTDEERYEQQQFSNLMRTSSIRTPMSNDISLPPT # PSDTVPGHVLSNFRGDPALTLNSGKQALPSFEQLVKSQGYTELPTQISLDINAWSTGRNHSIDEYSGYDFLGEDLFALLGSVVKPLEQPSPHTFEENA # QAFAWRHWGCVTSKVLSNVKSEHPEASDVDGFEDLRPEDQDKVTKAWEVGNVADEDIPETARKADGDGDEEEEDDKPKKKSRATKKKADDDGEEKPKK # PRATKAKAQVSASSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g265 ### # start gene g266 4 AUGUSTUS gene 967267 968237 0.32 - . g266 4 AUGUSTUS transcript 967267 968237 0.32 - . g266.t1 4 AUGUSTUS stop_codon 967267 967269 . - 0 transcript_id "g266.t1"; gene_id "g266"; 4 AUGUSTUS CDS 967267 967492 0.69 - 1 transcript_id "g266.t1"; gene_id "g266"; 4 AUGUSTUS CDS 967543 968237 0.47 - 0 transcript_id "g266.t1"; gene_id "g266"; 4 AUGUSTUS start_codon 968235 968237 . - 0 transcript_id "g266.t1"; gene_id "g266"; # protein sequence = [MARYITTLTGATSSISIDMSNRNHAHTVSHRANFAAVRGVPMLSVLPVLTYLVKDINDNAASARQCDPSNHPKVKQDP # HVVSRQSNSVELRLAKVEETILKLLPMAQAFEAWLRANNQLSTPGLPCVVCSYNNHVVSDFLAWFTSFRIDPDSTASNLQSPISRSPPVEDRPSTSTS # YRASNAIKDLCVNDVSESSYTPQYDPDLMESSSSYGPEKWSDRYSHLSKDSYGHLRYTGGAASFMLVDALASLQNHAAIDASSNSTLSAKTDIQLPFF # APDKTFRKQPALYVFRSFQKLKLTKVLRQAAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g266 ### # start gene g267 4 AUGUSTUS gene 970277 971074 0.56 + . g267 4 AUGUSTUS transcript 970277 971074 0.56 + . g267.t1 4 AUGUSTUS start_codon 970277 970279 . + 0 transcript_id "g267.t1"; gene_id "g267"; 4 AUGUSTUS CDS 970277 971074 0.56 + 0 transcript_id "g267.t1"; gene_id "g267"; 4 AUGUSTUS stop_codon 971072 971074 . + 0 transcript_id "g267.t1"; gene_id "g267"; # protein sequence = [MAPLCYDPDSLDELEVALPSSPLITLSSNAYLQPPLTRRGTGPGMIAFLPPSSAYKPNIENTLDPEPVQKWAEEGFAV # VGVTSGEGWSIEEALTKGVEALLSLEELDTRDKFAVYGEFLHTASADKSVCTILHISCLVYDPNAVSEVLLRIQQANDTRLSCIVAIGNPEKLPPVPT # YLHLPPTADYPQIPNTISHRFTKSPYFLLPQSSEYVPGEATLAHSRVLEFLRRILGGPVFDIEAIWEEHTYFEFEVRSVAKTMGTMVVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g267 ### # start gene g268 4 AUGUSTUS gene 984265 986449 0.67 + . g268 4 AUGUSTUS transcript 984265 986449 0.67 + . g268.t1 4 AUGUSTUS start_codon 984265 984267 . + 0 transcript_id "g268.t1"; gene_id "g268"; 4 AUGUSTUS CDS 984265 984366 0.67 + 0 transcript_id "g268.t1"; gene_id "g268"; 4 AUGUSTUS CDS 984461 986449 0.96 + 0 transcript_id "g268.t1"; gene_id "g268"; 4 AUGUSTUS stop_codon 986447 986449 . + 0 transcript_id "g268.t1"; gene_id "g268"; # protein sequence = [MCKGVAVMRRRSDAWLNATQILKVAGFDKPQRTRITDPNGISLGTWIPLERGFSLAKQYNCDTLLRPLIDFQPAAKSP # PLAPKHLVSATAPRPARRTATGDGPGGSVVNTRSSRRQAHQEVDQASEGQETLSVVGTEDGSMTPSPSEASSSSRTPSPINSPGPYSLNTVGSSRQRR # KSIDDRYNEYEDEVPDGGINDARAYGDQILEYFISDTNQVPAILINPPIDFDPNMAIDDDGHTSLHWACAMGRLRIVKLLLTAGADIFKVNKAGQTPL # MRSVMFANNYDVRKFPELYELLHRSTLNIDNYNRTVFHHVVDVAMSKGKTHAARYYMETILTRLAEYPKELADVINFQDEDGETALTMAARCRSKRLV # KLLIDHGADPKIVNNDGKSTEDYILEDERFRSSPVPPSRAMTMSFRNAQVAFLPPNAPPNYSFGPSNGDRPPLHHSVAGQRASTRCVNDMTSMLDSLA # ASFDQELRDKERDTTQAHALLSNIQGEILESQRAVGQLQRVAEGMGHTKQSLSALEKELNDRMCRRYRMGCEKWVKDEEGREIRIRDASGGVLELTPG # TATFIINGGPSSEDPLLNNDDGTASKRQVGIQIDETVSDLLVLHDNIPTDPEALKRACDGLREELGAHRKRRKVIFDELVEFQAEAGTKGRMKDYRRL # IGAGCGGIPPSEVDGVLGMLLEVCGFCGGC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g268 ### # start gene g269 4 AUGUSTUS gene 987627 988241 0.31 + . g269 4 AUGUSTUS transcript 987627 988241 0.31 + . g269.t1 4 AUGUSTUS start_codon 987627 987629 . + 0 transcript_id "g269.t1"; gene_id "g269"; 4 AUGUSTUS CDS 987627 988241 0.31 + 0 transcript_id "g269.t1"; gene_id "g269"; 4 AUGUSTUS stop_codon 988239 988241 . + 0 transcript_id "g269.t1"; gene_id "g269"; # protein sequence = [MIVQRRAPWEAFHPIAEVEFMPFRDAGRGPSDFNLNIQDCLWGIWKAMQNGLCDMNEFDIDDYEYYEKVENGDWNWIT # PNFIAFASPVDQNWIKRQKEAAKDPASPSALASSTNSNLALQGKLPTPFLNCLDYFEKRNIKMVVRLNNQLYDRTTFLDRGIDHMELYFDDGTNPTDE # IVRTFLDVADRVIEDGGVVAVHVREHSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g269 ### # start gene g270 4 AUGUSTUS gene 988361 989488 0.43 + . g270 4 AUGUSTUS transcript 988361 989488 0.43 + . g270.t1 4 AUGUSTUS start_codon 988361 988363 . + 0 transcript_id "g270.t1"; gene_id "g270"; 4 AUGUSTUS CDS 988361 989488 0.43 + 0 transcript_id "g270.t1"; gene_id "g270"; 4 AUGUSTUS stop_codon 989486 989488 . + 0 transcript_id "g270.t1"; gene_id "g270"; # protein sequence = [MRIVRPGSVVGPQQQYLYLKQLEWSKWAAMDEARKIQSAAAAATPPTITLVTPATPPADIDEEQLPRPTTPTGSAMPL # PPVTPSRHVAAAAARAREIAPPGQPRKTPNAKRSAPAHDSDDEDDPLGIRSDSDSDEMNDILPSLHTIVPAPSARLRARAGSTSKTTGKIKAGVVSRG # VTASEQRPTRVTRSTAGAAVIRKAGTTSTGAAVKPGAAGRSVVASPTKPTTGQRPNKIPRLAMGKSTVSLAAKAAAAKEVPKPILPRIAVATRSKLNP # APSPTPSRLPTLVPARGRLATHHSNSTSDAAAAALLHSKKSPAATDLKTKESADAPAWMATGKAAGVVVTSGTGNKSESRPGLRSSVRRRRSSFSSAD # VVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g270 ### # start gene g271 4 AUGUSTUS gene 989751 990637 0.25 - . g271 4 AUGUSTUS transcript 989751 990637 0.25 - . g271.t1 4 AUGUSTUS stop_codon 989751 989753 . - 0 transcript_id "g271.t1"; gene_id "g271"; 4 AUGUSTUS CDS 989751 990143 0.67 - 0 transcript_id "g271.t1"; gene_id "g271"; 4 AUGUSTUS CDS 990287 990637 0.28 - 0 transcript_id "g271.t1"; gene_id "g271"; 4 AUGUSTUS start_codon 990635 990637 . - 0 transcript_id "g271.t1"; gene_id "g271"; # protein sequence = [MGMEVLMNPGPSFPDPLNIPADVAKLRQNVDVEKELGYVFKAITQTRIELKGEVPLIGFCGAPWTLFAYMIEGGGSKT # FTKAKTWLFKYPKESEALLIQIADVCVDFLVGQVKAGAQGVREKLANQNIPQVPMTLFAKGANYALGELAQDSGYDVLGLDWCIEPSVARRTVNGKVA # LQGNMDPNVLYGGREAIESAVKRMCKEFQDGNNGGVSAWIANLGHGITPGVDPEDVRWYFECIHKYSASKQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g271 ### # start gene g272 4 AUGUSTUS gene 991658 992353 1 + . g272 4 AUGUSTUS transcript 991658 992353 1 + . g272.t1 4 AUGUSTUS start_codon 991658 991660 . + 0 transcript_id "g272.t1"; gene_id "g272"; 4 AUGUSTUS CDS 991658 992353 1 + 0 transcript_id "g272.t1"; gene_id "g272"; 4 AUGUSTUS stop_codon 992351 992353 . + 0 transcript_id "g272.t1"; gene_id "g272"; # protein sequence = [MPIFSDKSFDDSLKESILRALKDQPNENERNRESKEKVGDENDLASPRDSEHSNHKREDAMGESADNIREEKNTKAEE # ARILINGAINTNPPIRSNSSCAGNHNPADTTSPSPQSHLSVNGTKEFDNTPDVKDPTVSPPSLTRRSSSNLSSLSSVSSRSPSVIAETYTDKTTIVRV # PVPASLPESVPDDGRSHTTQDGSSMSQTERSIARTTQQTTEGSSDVVMSNAMAIK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g272 ### # start gene g273 4 AUGUSTUS gene 1004983 1005372 0.72 + . g273 4 AUGUSTUS transcript 1004983 1005372 0.72 + . g273.t1 4 AUGUSTUS start_codon 1004983 1004985 . + 0 transcript_id "g273.t1"; gene_id "g273"; 4 AUGUSTUS CDS 1004983 1005372 0.72 + 0 transcript_id "g273.t1"; gene_id "g273"; 4 AUGUSTUS stop_codon 1005370 1005372 . + 0 transcript_id "g273.t1"; gene_id "g273"; # protein sequence = [MFCHDTEPRALDDNVCIIAAMISPTTSSNNAALSRTIPGLVCRSSGLRSERVVPRDVELNDAPATKLGNMSYPNPKCT # TRIESAIGSKIPDPPTRIDEVELSYSRAMFVLNPASKTRSMRPMYPRIRRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g273 ### # start gene g274 4 AUGUSTUS gene 1006140 1007222 0.99 + . g274 4 AUGUSTUS transcript 1006140 1007222 0.99 + . g274.t1 4 AUGUSTUS start_codon 1006140 1006142 . + 0 transcript_id "g274.t1"; gene_id "g274"; 4 AUGUSTUS CDS 1006140 1007222 0.99 + 0 transcript_id "g274.t1"; gene_id "g274"; 4 AUGUSTUS stop_codon 1007220 1007222 . + 0 transcript_id "g274.t1"; gene_id "g274"; # protein sequence = [MYQRCRALDIPHRKTGKLVVAKDNQRPYIENLHLKALRSQWPPYSNAIDDSPVLPTRLISGDESRVMEPNLSQDISAA # LWCPETGIVDSHSFMESLEHDISESEVGNLAYATRVVRLDPYRSSKQMSEAERGWVVQTVTGNDEGSGTESDTILARTVFNASGLSGPFILNSLLPPE # RRIPMYYARGSYASYQGPGISGISHLIYPCPDTGPNAHAFASLGTHLTLDLNGKVKFGPDIEFLSPPSSEDSEENMDYWTRHLIPDDSSLEKMHLAVK # QYLPEVVADGLRPDYVGIRPKLVPAGAGFQDFVFRIDYPCQFGGGGTVGEGPMISLLGIESPGLTSCLAIAEYIVNDLLSSTNPAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g274 ### # start gene g275 4 AUGUSTUS gene 1008237 1010466 0.23 - . g275 4 AUGUSTUS transcript 1008237 1010466 0.23 - . g275.t1 4 AUGUSTUS stop_codon 1008237 1008239 . - 0 transcript_id "g275.t1"; gene_id "g275"; 4 AUGUSTUS CDS 1008237 1010004 0.93 - 1 transcript_id "g275.t1"; gene_id "g275"; 4 AUGUSTUS CDS 1010124 1010296 0.52 - 0 transcript_id "g275.t1"; gene_id "g275"; 4 AUGUSTUS CDS 1010443 1010466 0.28 - 0 transcript_id "g275.t1"; gene_id "g275"; 4 AUGUSTUS start_codon 1010464 1010466 . - 0 transcript_id "g275.t1"; gene_id "g275"; # protein sequence = [MVLLRDVSISTPLPLPSVSKPASAVTPPQKVIRATADYRSQAPQELSFKKGDFFYVLRDVDDRGSCLNLPNRSSRISQ # GSSLGNISIPTGIRSSDVPLTPKSPTKSQVFYAIVLHDFEAERADELDAKRGDAITVVAQSNREWFVAKPIGRLGRPGLIPVSFVEIHDPSTGRAVPD # VNALMDRGDLPKVEDWKRAMFNYKQSSIALGVIDAPAVPNSPFVNAQPPPLPPSSNLSIIEDPAARKQSTPSISSGPDSADCLPEGILLYAEAVSFHY # EMEEYWFRVNAIFQPYPPPGQDSLPNAKQLILFRVYNDFYDFQVSLLDTFPREAGRQPPHPRMLPYMPGPAENVNDQLTATRRSELDEYLRSLCDLNK # AGAKYILEHKVVREFLSLKPGDVESETEPRMQEIETLFATDDDEQYGNDDEYDEVRDTLGRMKVEDDRKSAGSEYGEDEGYAPSPQRTYDRHPYARVD # ERRPDDNNLRLHAHTQNHQRNGSTSSFNRTSSPYTSNSRSNSPIPERGESPLLDGEYSSRHSTGKTHNASSPSVSSVRSTNAPTVGRARSHSNANNPP # ISAANPQTAFVKIKIFDRVADDLIAIRVHPLVTHLELMDKVQTRLGGEVSNLRFRDSMSNAFVALDDDNQLRAWMDGTDKHVLYAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g275 ### # start gene g276 4 AUGUSTUS gene 1011442 1013053 0.43 + . g276 4 AUGUSTUS transcript 1011442 1013053 0.43 + . g276.t1 4 AUGUSTUS start_codon 1011442 1011444 . + 0 transcript_id "g276.t1"; gene_id "g276"; 4 AUGUSTUS CDS 1011442 1011612 0.49 + 0 transcript_id "g276.t1"; gene_id "g276"; 4 AUGUSTUS CDS 1011714 1012085 0.99 + 0 transcript_id "g276.t1"; gene_id "g276"; 4 AUGUSTUS CDS 1012151 1012286 0.99 + 0 transcript_id "g276.t1"; gene_id "g276"; 4 AUGUSTUS CDS 1012551 1013053 0.9 + 2 transcript_id "g276.t1"; gene_id "g276"; 4 AUGUSTUS stop_codon 1013051 1013053 . + 0 transcript_id "g276.t1"; gene_id "g276"; # protein sequence = [MQASSNQTQKEKLELDLKTQIKKLQRMRDQIKTWYASNDIKDKSALVENRKLIETVSQMEKFKACEKEMKTKAFSKEG # LTQAAKLDPKEQEKEEIMAWLQTKVEELQMQIEQAEAEIESLQGSGKKRGKSSSTAGRAEELEHLNDRRKWHISRLEIVLRLLNNGSLFTEKAVALKD # DVAYFEEDFDEYEGIYDELNLDEEEEKFRGLVHDDEDSDESDDASEGAFISKAQPITNILKTTVPHPAPVLAAPPPRPAVTLPPIRYAAAAAAAIAPV # PTPPSATKAAASTNSGPNATPAFSIPTSSSQASQDQVSVVPSSPSLTHPSVTSPMLSSAASVSQQFDGSFYSSQESPAMSEAVISSVGAPVATSSPHR # ASIARKGLLVILLLTIICSLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g276 ### # start gene g277 4 AUGUSTUS gene 1018676 1018999 0.4 + . g277 4 AUGUSTUS transcript 1018676 1018999 0.4 + . g277.t1 4 AUGUSTUS start_codon 1018676 1018678 . + 0 transcript_id "g277.t1"; gene_id "g277"; 4 AUGUSTUS CDS 1018676 1018999 0.4 + 0 transcript_id "g277.t1"; gene_id "g277"; 4 AUGUSTUS stop_codon 1018997 1018999 . + 0 transcript_id "g277.t1"; gene_id "g277"; # protein sequence = [MDTLPYLDPPSRGSGLNRSKSAAPARSRHNAPTPLMRSNTTGVQSQYGSHFGFQNGGYNELHDSCSNSIEEEEEGQQD # EQEWGLTKEMELFEVSAKDDLGESPIIPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g277 ### # start gene g278 4 AUGUSTUS gene 1020766 1022634 0.77 - . g278 4 AUGUSTUS transcript 1020766 1022634 0.77 - . g278.t1 4 AUGUSTUS stop_codon 1020766 1020768 . - 0 transcript_id "g278.t1"; gene_id "g278"; 4 AUGUSTUS CDS 1020766 1022634 0.77 - 0 transcript_id "g278.t1"; gene_id "g278"; 4 AUGUSTUS start_codon 1022632 1022634 . - 0 transcript_id "g278.t1"; gene_id "g278"; # protein sequence = [MTPASRISNIPEAENVHGPLHNVHAPNMTVTKGPKLKGLETFGKDVLEIEKPQQPVLEDPEMDLVHIMLERERKGWET # QKNPESLYVRQVLPYTTGKLPSPIPPLYGGKFKRGSSYKKSSAYSAPMLHPNTISEGGQQDDVEVFTANPIPDNMSNEDVYYHLCHVIANTTIVEDAW # SAYSTILTIHSPEDRRRGDPPIPFEHLHRLCRLLSQNQPKTRTQFLRLLSILYTLRKHGGMVHKFEWNALIANAGTGWRGSKAKDFQLALDVFDDMVS # GEPPGSSFSLSDYPPLSTPPQPIEPDIYSYNTLISIASKTLYGRAIGRATTMLRASGHPPDRITHLSLLVYFTHTQQLAGIRSTLLKMRQQNLELGLD # GINACIWAYGRNGKLEWANHIYRVLRHNTHPEPTEIIDPIIQALKDECVEISPLMTPNAITFSTMIQLMAWNGHLTRTYTVLMDMLSTFNMEPGAPLV # RGDDGEIHYTTYTALYTSFRSLFLGFSRHGIYLRNDFTSRLQDRKWTISNLQAIFDTYINLPDPIQPSVSMVYWILVAYDRTSDHNVELMRMVWRQLE # KRYKGPWGGPTHRLRVLREMLFSSNAEAHLRRHGFRTAKQESRSPFTYKYNADS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g278 ### # start gene g279 4 AUGUSTUS gene 1023602 1024168 0.72 - . g279 4 AUGUSTUS transcript 1023602 1024168 0.72 - . g279.t1 4 AUGUSTUS stop_codon 1023602 1023604 . - 0 transcript_id "g279.t1"; gene_id "g279"; 4 AUGUSTUS CDS 1023602 1024168 0.72 - 0 transcript_id "g279.t1"; gene_id "g279"; 4 AUGUSTUS start_codon 1024166 1024168 . - 0 transcript_id "g279.t1"; gene_id "g279"; # protein sequence = [MVVGVVGYVETPRGLRTLTTVWASHLSDEVKRRFYKNWYRSKKKAFTRYAKKHAEDGGKSISRELERIRKYCTVVRVL # AHTQIRKTGLSQKKAHLMEIQVNGGSIADKVEFAHGLFEKPVEVSSVFEQDECVDIIAVTKGHGFEGVTHRWGTKKLPRKTHKGLRKVACIGAWHPSK # VMFSVARAGQST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g279 ### # start gene g280 4 AUGUSTUS gene 1026710 1027567 0.93 + . g280 4 AUGUSTUS transcript 1026710 1027567 0.93 + . g280.t1 4 AUGUSTUS start_codon 1026710 1026712 . + 0 transcript_id "g280.t1"; gene_id "g280"; 4 AUGUSTUS CDS 1026710 1027567 0.93 + 0 transcript_id "g280.t1"; gene_id "g280"; 4 AUGUSTUS stop_codon 1027565 1027567 . + 0 transcript_id "g280.t1"; gene_id "g280"; # protein sequence = [MIVVDEDPFDHEVSSSSSAPVEEDEVGSLYAQIRTLQDALTTVSQENEDLRSSVQTLNQLSRHHTVSLNRMSRNVDNG # LVEIARLQSELLDKNSVLTRLPASLRLTEDLSRENTVLRLQIEELTSRLEISHGDVAAQELIAEELTRETERLKQQLDNLREASTHVPSVAGDEELQN # LINEDLSRENRQLRNQASELQETLSQLQIPNDELDSLKGITRVLTRENKRLQRRVREMESLSTAQEGMRQQVEQLNRDNERLRRELAQVRRPRQNTTD # VPPPAYEDIGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g280 ### # start gene g281 4 AUGUSTUS gene 1028340 1029287 0.73 + . g281 4 AUGUSTUS transcript 1028340 1029287 0.73 + . g281.t1 4 AUGUSTUS start_codon 1028340 1028342 . + 0 transcript_id "g281.t1"; gene_id "g281"; 4 AUGUSTUS CDS 1028340 1029287 0.73 + 0 transcript_id "g281.t1"; gene_id "g281"; 4 AUGUSTUS stop_codon 1029285 1029287 . + 0 transcript_id "g281.t1"; gene_id "g281"; # protein sequence = [MPASPPDIIKRPARTYGRPKPAIEVSTSKPSTNIYNSIASDDSLLNMGSDTPGEAPPTSEPSNSPLVEAENDGRNRDD # GGNKDASSGYPWKWTIDIKHIDESEDEGGGSSQKTESSGDKWSKPTDPEPLFSEQRDGHIPHTLASPSHETELLLSQDAFSDSLSKLAPSSFGHSHRT # SASPTPSPTFLRQRVSKHIKCVESDGEFERETDRSSYSSSPVKHPINTPQTRSSTTPPTSDAEDEMPSRKAKTHSKGKSVAIMNPLVLQPAVDLDVSK # AKGKRSQSNKVKVHYKLPSYVLILTNSACRLRRKKNVEIQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g281 ### # start gene g282 4 AUGUSTUS gene 1029399 1032455 0.06 + . g282 4 AUGUSTUS transcript 1029399 1032455 0.06 + . g282.t1 4 AUGUSTUS start_codon 1029399 1029401 . + 0 transcript_id "g282.t1"; gene_id "g282"; 4 AUGUSTUS CDS 1029399 1031030 0.64 + 0 transcript_id "g282.t1"; gene_id "g282"; 4 AUGUSTUS CDS 1031083 1031310 0.16 + 0 transcript_id "g282.t1"; gene_id "g282"; 4 AUGUSTUS CDS 1031436 1031796 0.54 + 0 transcript_id "g282.t1"; gene_id "g282"; 4 AUGUSTUS CDS 1031838 1032125 0.89 + 2 transcript_id "g282.t1"; gene_id "g282"; 4 AUGUSTUS CDS 1032178 1032455 0.65 + 2 transcript_id "g282.t1"; gene_id "g282"; 4 AUGUSTUS stop_codon 1032453 1032455 . + 0 transcript_id "g282.t1"; gene_id "g282"; # protein sequence = [MILRALISGISAGNTPAPLKGEDSMDPISEFSEYSSPRSNRSAVVPADTKLTEAETPRTSMPELPDGADSDEEQLPDI # DQLLKSLQEKKLLALQQQGQLRSSALASDDDDDLEIVDNPSTSIQVAIQKEADARKSGRPGITASTRILQKHAGISSSRRTGEVASASQARNSRELNE # VLLKRVNAENTRRTQQKTEEWISRGGKPLGPEIRASERHGLDWYAQKALEDLKKTDAENGNHHQGGTDDQEDEEWTSLRGSASPALVEQDSSNEYEEN # EGDDEEGFEDDQDITMVNEDTQDEDIPTQVDLPHRRAVRPIVNSDTEDEDNNENLFARRHSLGKVLVQDSMILDQDSDKVSPVPQFARRQSDSSYDGG # ATEDECDKENNDRLMYDRSEDKENTSVIQHELLNHGPSPGRRSSVHNLEEGLSSRLSVSLDGYATDEDKENPRSPLKTLSVSEIGPFTPAAVSFAIRL # ERATSTASIADKPPDPLLSPRVSRESQMSGFSQFSDGEGFRPKKLEAGFSGFFDSQIPSSSFSPLLGSLTEPGQSNNFFDKLRRNNPLALTQEVGLQP # ALEVDESLKRQADEVFEREQELIIETVNASTSKKPELYINDQGCALSFRNKNAISSQGLTRPPFRELSMSEAESTEDTPVRRNRLHRLKKRDESGSSS # SAQLSNIFGERSISPPLPSPRPRRHRPVESQIRKIGRRLEKSEFIEGEAQESDEDEMFGFRKVEEDEEDGEHLDHTDSRRQSSGEISVSVLSISYALY # SSSSREQRQADDAHVEDVAHKLAQGHFRNGKRSRGQASIDNSDDDDEEDETGRRVRWKMKKEPELRGDIKSLAGQDATRAFAEQYQAAINSDGDPELA # FLQGDDANDIIMTGPNYGQDDDDDANEDDEDDENTVNTSDIMRQLREAAKRGKVRANSLVNLMLYH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g282 ### # start gene g283 4 AUGUSTUS gene 1035149 1035789 0.37 - . g283 4 AUGUSTUS transcript 1035149 1035789 0.37 - . g283.t1 4 AUGUSTUS stop_codon 1035149 1035151 . - 0 transcript_id "g283.t1"; gene_id "g283"; 4 AUGUSTUS CDS 1035149 1035589 0.79 - 0 transcript_id "g283.t1"; gene_id "g283"; 4 AUGUSTUS CDS 1035679 1035789 0.37 - 0 transcript_id "g283.t1"; gene_id "g283"; 4 AUGUSTUS start_codon 1035787 1035789 . - 0 transcript_id "g283.t1"; gene_id "g283"; # protein sequence = [MSLLFDLFEVAILIGSCFLLNYVTEDSKTNWAEGVMLALSAWFYPQQPEIGIMLSRTSIAEVYKESSFGGNAHNIGSS # PLSSVASPSVSTLYDTATATVTTTMSNSQVTAAAASPIPTSGLSEELQRLVKLYGVLVDENKKLQGDIENALSSVSNPSRTSVATLPKETTKSTRQRR # SRYVKDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g283 ### # start gene g284 4 AUGUSTUS gene 1038578 1039030 0.51 + . g284 4 AUGUSTUS transcript 1038578 1039030 0.51 + . g284.t1 4 AUGUSTUS start_codon 1038578 1038580 . + 0 transcript_id "g284.t1"; gene_id "g284"; 4 AUGUSTUS CDS 1038578 1039030 0.51 + 0 transcript_id "g284.t1"; gene_id "g284"; 4 AUGUSTUS stop_codon 1039028 1039030 . + 0 transcript_id "g284.t1"; gene_id "g284"; # protein sequence = [MVDTGAGPDDDTVPPPDAASGAGPTGSKYIPPSLRAGARGTGETMRGPGGGNRDDLPTLRVTNISEDTQENDLRDLFG # HFGRVARVYVGRDRDTGAGKGFAFVSFEDRAVAQKAMEKVNGKGYDNLILSVQWSRTYFSFSKQVLAEVSFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g284 ### # start gene g285 4 AUGUSTUS gene 1041255 1041684 0.63 - . g285 4 AUGUSTUS transcript 1041255 1041684 0.63 - . g285.t1 4 AUGUSTUS stop_codon 1041255 1041257 . - 0 transcript_id "g285.t1"; gene_id "g285"; 4 AUGUSTUS CDS 1041255 1041625 0.86 - 2 transcript_id "g285.t1"; gene_id "g285"; 4 AUGUSTUS CDS 1041669 1041684 0.64 - 0 transcript_id "g285.t1"; gene_id "g285"; 4 AUGUSTUS start_codon 1041682 1041684 . - 0 transcript_id "g285.t1"; gene_id "g285"; # protein sequence = [MSLLISDAWNHHQIRTAGHKTLIALYELSREHAKTRGYWTGDPGDNVETASHPSYGLEDELEQGAPGDHQVSEEDGDD # IRVNENEDITDVHSILTGMGFDIEQEDGNWGIEVYCEAVLKLKVYVETQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g285 ### # start gene g286 4 AUGUSTUS gene 1047503 1048096 0.97 - . g286 4 AUGUSTUS transcript 1047503 1048096 0.97 - . g286.t1 4 AUGUSTUS stop_codon 1047503 1047505 . - 0 transcript_id "g286.t1"; gene_id "g286"; 4 AUGUSTUS CDS 1047503 1048096 0.97 - 0 transcript_id "g286.t1"; gene_id "g286"; 4 AUGUSTUS start_codon 1048094 1048096 . - 0 transcript_id "g286.t1"; gene_id "g286"; # protein sequence = [MTSTSSGNDAYVTGSSSSKGKERSMTPQPEDDLCPFPPNRRLRCVDLPASDDYSAQLFKGGLDAEMQLDPEAGQEDDN # DDMEVNYILTDPVEPDSDKTNAYASTFFPHILILIPLTLYSTDSYLTPRSKKQPTAGSSTSINKKDRDRVPRGSSDGMTTTADSGFFESTTPPPFPRH # TKNPPTTSLMAPLIQILLLDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g286 ### # start gene g287 4 AUGUSTUS gene 1050538 1051435 0.8 - . g287 4 AUGUSTUS transcript 1050538 1051435 0.8 - . g287.t1 4 AUGUSTUS stop_codon 1050538 1050540 . - 0 transcript_id "g287.t1"; gene_id "g287"; 4 AUGUSTUS CDS 1050538 1050963 1 - 0 transcript_id "g287.t1"; gene_id "g287"; 4 AUGUSTUS CDS 1051013 1051435 0.8 - 0 transcript_id "g287.t1"; gene_id "g287"; 4 AUGUSTUS start_codon 1051433 1051435 . - 0 transcript_id "g287.t1"; gene_id "g287"; # protein sequence = [MAPPFIAYYGALQAGDNESYLLQTAYEQISLYRDVLRDDDGLWRHVALGSWQDTTYVFEPVRAMNISKSTTVTGQLVS # IPVHSIIYADTHNFISGNGWAAAGMLRVLETLNHSSMTTDFADQTANLTQWIQEILSSSWQYQLENGTLLNTIDDSNSFADSSGTALLASVTYRMAVY # TNDTSLIPNADKAFQLVESNIDGDGWLRDTVDPETFDSPSAADSASPEGQAFVLLLQAAYSDYAEAVISGQVIPSSNSSSSSGSEGSGDDDDDGSILR # RCRLVRSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g287 ### # start gene g288 4 AUGUSTUS gene 1054284 1054661 0.15 + . g288 4 AUGUSTUS transcript 1054284 1054661 0.15 + . g288.t1 4 AUGUSTUS start_codon 1054284 1054286 . + 0 transcript_id "g288.t1"; gene_id "g288"; 4 AUGUSTUS CDS 1054284 1054661 0.15 + 0 transcript_id "g288.t1"; gene_id "g288"; 4 AUGUSTUS stop_codon 1054659 1054661 . + 0 transcript_id "g288.t1"; gene_id "g288"; # protein sequence = [MFNDNVDRLPLRKALKLALALAQEVRKTGYPLEDLSIPEDTTDERLDEFSNQNVMSTFHYSSSCRMDTEENLGVVDDE # LRVHGVAGLRIADASIFPRVPACHIQAPVVMVAERCAAFIHANTVST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g288 ### # start gene g289 4 AUGUSTUS gene 1055935 1059190 0.37 - . g289 4 AUGUSTUS transcript 1055935 1059190 0.37 - . g289.t1 4 AUGUSTUS stop_codon 1055935 1055937 . - 0 transcript_id "g289.t1"; gene_id "g289"; 4 AUGUSTUS CDS 1055935 1058033 0.5 - 2 transcript_id "g289.t1"; gene_id "g289"; 4 AUGUSTUS CDS 1058083 1059190 0.68 - 0 transcript_id "g289.t1"; gene_id "g289"; 4 AUGUSTUS start_codon 1059188 1059190 . - 0 transcript_id "g289.t1"; gene_id "g289"; # protein sequence = [MFIVQKIATPRKTTQPINFLCELGTVCLEHEIPMVVDVVRGQDYLFRASQSELGKSLRKLQSTNPTRLISILYLSCMV # HKADNAVVKYGKHKRTSKKTRQERSKAAREASLRSRAPTSPISDHPHKNTENPTDNYKENDDPQPGSSARMPKADLRADKLKKDVDKHRKKSTYWKGK # TVVLRGSLSETKKELNKHIEEEEQIKKIANGERQKMSRQIENLEDALESEMKRRKLDAEEQETQNAQWREQVRDHRRQIVALKKKIGRIPSRLATAIN # RIARTYNMNVENDRKFFLKNDGVVTDETRDIFLDLVSIEEVPANKVTRVFKRIASAFGIEVEGDVSRRSVGRIAKEGGVASKLQFGKAVLDPSTKGIT # ISSDGTTHKNETYETKQATVIQADQKLQFFLGLKMAVNHTSETQVGCWIETVEDIFHLLFESGMCSKDDARIFWNLVTGFHSDHAADQKKLFELLKKW # KERCDRELRGERAVKRLTDLEYACLIFQGSQALVQQVGGPAAWEVLTPKERSRRLEAMRNQIIRDIGEAEFAKLSEAEKAEVDFFLWAGCCMHKEMNA # FKGGCVGLDNFWKEHPELEPPKLLPNRDNAAAINKAAGTGAADRALECSERGAVKVASLAGSIFRHKDRKRGQQDTLRFFFDHKLGFNVSFPDTSNTR # FQSHAEACAVIIIYLDLFIEFLTYVKQNKGSGKLNHMEQNVFDGLQDIPTRHEFIVITLYWLAISVPYMREIRGPYATEDNILKLGPLHQRVIDHIDM # LIEHTEYLIGPDASAEKGSLDGRVWERPEAFYACQRYAPDLPHLKGLLVHFLKHARVLWVRFSAELLPGGALSKATPEQIESAWMEKTNDLNEADFGM # YRQAARTTPTISLAQYNARKMYKMNRTSEFLRNLSPEMRQWLRKVTRRQDASGSNRQQRIQLAEYRQKVAEDKTRKQEEQAQKRAKAAREIDAISPIQ # TVTELDFRVSLPVGSNGYLNVSDITKQLKWHKVHGAKDAITTVESKWGKRPQKLILLRSCIEMLVHARASVLSEESTSVEEEDDLEITVQDLEEFDSD # GYDSEEDYYK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g289 ### # start gene g290 4 AUGUSTUS gene 1062947 1064510 0.64 - . g290 4 AUGUSTUS transcript 1062947 1064510 0.64 - . g290.t1 4 AUGUSTUS stop_codon 1062947 1062949 . - 0 transcript_id "g290.t1"; gene_id "g290"; 4 AUGUSTUS CDS 1062947 1063976 1 - 1 transcript_id "g290.t1"; gene_id "g290"; 4 AUGUSTUS CDS 1064310 1064444 0.91 - 1 transcript_id "g290.t1"; gene_id "g290"; 4 AUGUSTUS CDS 1064503 1064510 0.64 - 0 transcript_id "g290.t1"; gene_id "g290"; 4 AUGUSTUS start_codon 1064508 1064510 . - 0 transcript_id "g290.t1"; gene_id "g290"; # protein sequence = [MYSLYKQGMFTLGFKGVEQYTNGVPSATVGNVKSPRPAMWDMLARAKCSHSLKSDSSGSSDDGQVRSSGFIHASQTQT # SDRQHQQEFEDSESDEDEDADEDEEEREDQAKELPVRPDLGASILNRPQSSLSSHRYRTPMAGSLAMSPPPNHSIPAIQPLPGFDTPSAFAEPSPTSI # PSSLYPVGSSYVGFSESSREGMTSPPQGLFPAHPQYRHQAQSLPLGQYGVVRPASTLAMERAVESVQSQLAAVTERLEILESVSPLPSRSYLGASPRG # TPTWGVGRGSPPHESHTEWDLDDLGMWTSVLNPISRAIERLKQLSRFFARNENRSPSMIVLRRLCLDVSFLFCIFGLIRFLWKRSGVRRREVNAALRV # LWRAILGRDERIMIDKGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g290 ### # start gene g291 4 AUGUSTUS gene 1065010 1065456 0.81 - . g291 4 AUGUSTUS transcript 1065010 1065456 0.81 - . g291.t1 4 AUGUSTUS stop_codon 1065010 1065012 . - 0 transcript_id "g291.t1"; gene_id "g291"; 4 AUGUSTUS CDS 1065010 1065456 0.81 - 0 transcript_id "g291.t1"; gene_id "g291"; 4 AUGUSTUS start_codon 1065454 1065456 . - 0 transcript_id "g291.t1"; gene_id "g291"; # protein sequence = [MPLALNEFISSWYFGFAEVGPYTLSYVSATPLDSSIVFNTGYLATDNAVLQNQCSVDGSKTTDISIIRPTGEMAGAEG # TIAPSGWTLNYIIDDGTEFEFLIVPTGVNPDIAIYQRWTGLISGGKKGEESYEGVATFEWLNPGLNVYPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g291 ### # start gene g292 4 AUGUSTUS gene 1067252 1069123 0.96 + . g292 4 AUGUSTUS transcript 1067252 1069123 0.96 + . g292.t1 4 AUGUSTUS start_codon 1067252 1067254 . + 0 transcript_id "g292.t1"; gene_id "g292"; 4 AUGUSTUS CDS 1067252 1069123 0.96 + 0 transcript_id "g292.t1"; gene_id "g292"; 4 AUGUSTUS stop_codon 1069121 1069123 . + 0 transcript_id "g292.t1"; gene_id "g292"; # protein sequence = [MLKSSQKVRFMNKNPFVAQSAYTPPPPLPPGPPPPQPTQPDYSAYWAAVQQQQQQQPQAGSYAPQQWPAQPRPPPEQN # PLYANYGYGPQNQWQRQQQQQQQQQQQFHAPPPVVQPPPPPQAAPGYNPYQPAVNYAQPYIPQAPQAMTQIQAPYNSMARPLQVPSQPMFNPHIPPQP # VPSMQQQQQRHVNHASPQHQPPAKRQRFDGPSHNQQPQQRQNGPQQQFQPPLPPNQPSGAFSGGRGGGPGSNQMPLGGRGGRGGNLGNMTRGRGSSMN # AGRGGGMGNRNTRGGASFNVGPNNSGRGGNGAGLRGHNSRGHLGPSKDFHNRRGGGSFNAGAGGSFSHQNPSFRGRGYSHSNSNRPQRHDGNNANVST # KESSAPGVVSGKKDENRRTLTDFKMMGLEIPELSWIWGIKHDDDSHAEEIDQSSQATVKMEEDETIIMASADSIESDAKIEPRRSNTAREAEHKETDT # DSKVIVSGSAPHSRIRIYFHTPVSADDSHPIVPNSLSLGTAPSDSRKGKRKKLDDDDDGDGEDGRRPPPPMNDDRSSVAASVTHSVAESGSEADWLMA # AITDGEQTQPDPDAEGDEDDDERLHVSEIVEYHDNMSELGEVDDHGGECRLLCVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g292 ### # start gene g293 4 AUGUSTUS gene 1069165 1070326 1 + . g293 4 AUGUSTUS transcript 1069165 1070326 1 + . g293.t1 4 AUGUSTUS start_codon 1069165 1069167 . + 0 transcript_id "g293.t1"; gene_id "g293"; 4 AUGUSTUS CDS 1069165 1069944 1 + 0 transcript_id "g293.t1"; gene_id "g293"; 4 AUGUSTUS CDS 1070000 1070326 1 + 0 transcript_id "g293.t1"; gene_id "g293"; 4 AUGUSTUS stop_codon 1070324 1070326 . + 0 transcript_id "g293.t1"; gene_id "g293"; # protein sequence = [MTHTTNSLSKASQGKDDGAASENHTFSASVDVTANVSEENEANDGKVEGTDNADSISAIGSPSHALVDVHSLSYIDDT # HSMASNTASVFETISHVSVPYASCSHSGEHVDRTERANPQVQPIAAPTENPTKTAASSDSTENTTTTAASSDLQSKSQLESSERGDSEHLPEPPASPV # SNTLLSASSSSTYGDSNSHNSDKDQLATQAPSANRLSISYSNGNRRIVINAEVVEKMEIYRSEGRIEAKMKIHRNPDNTIQGILVEGLSDVTKSYVPL # PFHEKSEQDGSDPTLPPFINDSASTTLTLVAHLDTKRPLSEPRWVRTGDIQEWLRSMFGRMFWVSGDAADGWEKKITVVDPDPVSSFTCIPTVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g293 ### # start gene g294 4 AUGUSTUS gene 1070941 1071325 0.47 - . g294 4 AUGUSTUS transcript 1070941 1071325 0.47 - . g294.t1 4 AUGUSTUS stop_codon 1070941 1070943 . - 0 transcript_id "g294.t1"; gene_id "g294"; 4 AUGUSTUS CDS 1070941 1071203 0.97 - 2 transcript_id "g294.t1"; gene_id "g294"; 4 AUGUSTUS CDS 1071256 1071325 0.48 - 0 transcript_id "g294.t1"; gene_id "g294"; 4 AUGUSTUS start_codon 1071323 1071325 . - 0 transcript_id "g294.t1"; gene_id "g294"; # protein sequence = [MSIGARSQSAKTYLEKHYESFADCSLEDLIKHGLHALRETLQQDKDLNVNNTSIGIVGAPSVHENTTGISFRILEGET # IQPFLDTMVPKDVPATAPAPAATTDEDVQMTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g294 ### # start gene g295 4 AUGUSTUS gene 1075132 1075587 0.72 - . g295 4 AUGUSTUS transcript 1075132 1075587 0.72 - . g295.t1 4 AUGUSTUS stop_codon 1075132 1075134 . - 0 transcript_id "g295.t1"; gene_id "g295"; 4 AUGUSTUS CDS 1075132 1075587 0.72 - 0 transcript_id "g295.t1"; gene_id "g295"; 4 AUGUSTUS start_codon 1075585 1075587 . - 0 transcript_id "g295.t1"; gene_id "g295"; # protein sequence = [MEWGHRVLGRLIGVAFVGPLVFFAVKKRISKPLANKLGGLALLIGAQGGLGWYMVKSGLDDALMETPGAVPRVSQYRL # AAHLGLALLLYAGMFSSGLAIVKEWKYATGAQWMGLTTSAFNEALNSPAVMRFKARSWVLTGLIFLTALSGKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g295 ### # start gene g296 4 AUGUSTUS gene 1080595 1081455 0.84 + . g296 4 AUGUSTUS transcript 1080595 1081455 0.84 + . g296.t1 4 AUGUSTUS start_codon 1080595 1080597 . + 0 transcript_id "g296.t1"; gene_id "g296"; 4 AUGUSTUS CDS 1080595 1081455 0.84 + 0 transcript_id "g296.t1"; gene_id "g296"; 4 AUGUSTUS stop_codon 1081453 1081455 . + 0 transcript_id "g296.t1"; gene_id "g296"; # protein sequence = [MSVKSPVSPAPPTPNVISTSTEAPNSPTVSSDAVHPGVPNGTSEGSPVLIAESTAAVTAPFEPSTHTPANAAPSSPQE # PSVDSAPSTETEVPPSEDSRSIEASTHTPAVAPATLSSEPSVDTPPATSAGPSVEASTHGPVVVPPSADADFNTTHVVTPTSTPAVEAVTTAIAVPTT # AASNDTEAASSVEPTTPTKKVFPVNGTGDLNASTPAGSPAPRASTSSILSTPSKRNSRILSFPSRGTPTPESSPSSKFDSPSIRAKRKSIFGKMSIKN # IFGKDKEKEKEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g296 ### # start gene g297 4 AUGUSTUS gene 1082951 1083238 0.34 - . g297 4 AUGUSTUS transcript 1082951 1083238 0.34 - . g297.t1 4 AUGUSTUS stop_codon 1082951 1082953 . - 0 transcript_id "g297.t1"; gene_id "g297"; 4 AUGUSTUS CDS 1082951 1083238 0.34 - 0 transcript_id "g297.t1"; gene_id "g297"; 4 AUGUSTUS start_codon 1083236 1083238 . - 0 transcript_id "g297.t1"; gene_id "g297"; # protein sequence = [MDIALQSLSTLHRQITILDAPGHKDFIPNMISGASQADCALLVVDAAIGEFEAGFDRGGQTREHILLVRSLGVSQVIV # AVNKLDQVRSYSNIPFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g297 ### # start gene g298 4 AUGUSTUS gene 1083921 1086015 0.36 - . g298 4 AUGUSTUS transcript 1083921 1086015 0.36 - . g298.t1 4 AUGUSTUS stop_codon 1083921 1083923 . - 0 transcript_id "g298.t1"; gene_id "g298"; 4 AUGUSTUS CDS 1083921 1085548 0.61 - 2 transcript_id "g298.t1"; gene_id "g298"; 4 AUGUSTUS CDS 1085664 1086015 0.45 - 0 transcript_id "g298.t1"; gene_id "g298"; 4 AUGUSTUS start_codon 1086013 1086015 . - 0 transcript_id "g298.t1"; gene_id "g298"; # protein sequence = [MQKYGDDTNDFGLGGRSRMPLIHLAQQQQQMMEQQQRQQQWEVQRQQMLQEEPEQITVEELHEEDNGNVDDESTRRLS # TISERTERTELSPYWPRRDYLPPPRTVSTFTDSSYGNLIVSPSGSAVHRLSTYEPAPSIASSGSYTQSSPPHPPSEAVPPLDTIPDIPDSHSSVVPPP # LPPKPTNQSSSTKQTSSVQQPSSPAPSSQPRAKQSKLAQLASSRASTRTKSSASLGTEVAGSIKTYPALRPESHRPPSSISTSTSTSNSTALPVPPPD # LRSIPRVPSSSGSITTPVSSPSQRSDRPRDTITSSLPSSTSLKVRQAVDAALELEALDRELAASRKTRRTHLEKKLPTDQSELNTPTRPPASTSPKVA # AGVPRNSTTSLSTRPTSKLVLLAQAKAQKAEAQHTISKAPLARPPPPNHLPPEHTEYLTPIANGSSVTTAITTSYQTLYSLTDPTRPQAMEAPFVVPL # AAPSYIKGAATSTNSNASTRTSMTKAPPSKLALKAKKAQEKSSPPSHTTVAEPEDNVIIVPSIFLPKSNRSSASPSAFASVLVVDDLIHSPQVSAGMS # RRETKGKQSITSETTEEASTPDMLRAHHTQRRIAPTLGTPTTVSSFAFDGPSPDDIVFNARRGTHSAQRKDRKDAISIGSITNKKTSTSKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g298 ### # start gene g299 4 AUGUSTUS gene 1091999 1093669 0.85 + . g299 4 AUGUSTUS transcript 1091999 1093669 0.85 + . g299.t1 4 AUGUSTUS start_codon 1091999 1092001 . + 0 transcript_id "g299.t1"; gene_id "g299"; 4 AUGUSTUS CDS 1091999 1093075 0.85 + 0 transcript_id "g299.t1"; gene_id "g299"; 4 AUGUSTUS CDS 1093133 1093669 0.99 + 0 transcript_id "g299.t1"; gene_id "g299"; 4 AUGUSTUS stop_codon 1093667 1093669 . + 0 transcript_id "g299.t1"; gene_id "g299"; # protein sequence = [MVCQSLLETNVSLNCLDIDNYNPLVYATLRGSVDCVKVLLDHGNASPQPTTPNGDLIPLSLASQSGHVDVVQLLLERG # AQCLANSNGEYPIHLAARAGHVDVCKLLLNHIGWDVPDKYHEWTPLFHAARYGRDQCVRVLIDAGARVNLADELGHFAMHYAAWYGHYQCLTYLIEES # ACVPLLPINTKILERSPGSDDPMSVESEIDLIPSLSLPPPIMPHRVYGHNYLDRSHLVQVSIGHSLGQNRDFSGVRLHHRLISPAFRDEYLLTTAPLK # LVMTTAPQVTSAPYSISLPPQDESGVFIFQTPSLDSLTLEFSVYPNFGTKTIGCAVALPSLFAGMESNEAFTLPILDQRLHIVGEVSFEINIISSFDG # VTLEVGGDVETYWKSTGISIIPHSLSPWPQRSYLIGSAQTSPSSQSLSTTSSQASTISSVRGKFLTVVIQVTRDLQPVVYTDWLLPDSDFDLSVCDVT # LEQFESLAKRSGRNIDEMTVLPSSNLPALISQAMMSLVRLLKVISLCILSIAIAILLPLSVRFSPPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g299 ### # start gene g300 4 AUGUSTUS gene 1095700 1098732 0.7 - . g300 4 AUGUSTUS transcript 1095700 1098732 0.7 - . g300.t1 4 AUGUSTUS stop_codon 1095700 1095702 . - 0 transcript_id "g300.t1"; gene_id "g300"; 4 AUGUSTUS CDS 1095700 1098732 0.7 - 0 transcript_id "g300.t1"; gene_id "g300"; 4 AUGUSTUS start_codon 1098730 1098732 . - 0 transcript_id "g300.t1"; gene_id "g300"; # protein sequence = [MSEGSPSVFTASSYCKLSLKDPSGAWTSRSVRALIVPSLCFPMILGIPFLAHNFLVTDYASRTVMDKTSGFDLMNPLS # CPRPVPSSPVQRRLEIHNTYKNTLELKKTVLLKLKGYVRDHPHLCKSDPVTPFDVAAAVRACIESLSELERLQVLGENVKARFTDVFGDIPHLDGLPT # DITCNITLKDVNMTIQSRGYASPRKYREAWSVLIEKHLQAGRIRPSSSQFSSPAFLVPKSDPAALPRWVNDFRKLNANTIPDRHPLPRIDSILSDCAK # GNIWGKMDMTDSFFQSRMDPASVPLVSVQTPLGQYEWLVMPQGLRNAPAIQQRRVTQVLREYIGRFCHVYLDDIIIWSKDEAEHAHHVELILEALRNA # KLFCNPKKCLFFQLEIDFLGHHISRHGVEAQHHKCEAIINYPSPTSASEVRRFLGMVRFIAGYLENLAEFTRILTPLTRKECDKNFPGWSIEHEHAFT # NIKTLVLSRQCLTTIDHDNPGDNRIFLVTDASDWRHGAVLMWGPTLDSARPVAFDSAQFSGPELNYPVHEKELLAIVRSLRKWRADCLGMHIHVLTDH # RTLENFETQKDLSRCQLRWQEELSQFDLEIAYIAGEKNSAADALSRIKAGALPSDSIASQSSEEATHCVEAWKSNPFVCSSVLSLSADATFLKQIQEG # HESDPFVKKLVEGGSLVPGIERKNGLWFLDNRLIIPDYLSLREDLFHLAHDTCGHFGADKSYSMLADSYYWPNMRRDLCKHYIPGCEDCQRNKGRTAK # NGKGPLHPLPVPEACCDSVAMDFIGPLPLDQGFNCILTMTDRLGSDLKIIPTTVDITAPALARLVFDTWYCDNGLPLEWVSDRDKLFVSEFWSVLNKL # SGVKIKMSSSFHPETDGSSERSNKTVNQAIRFYVERNQIGWVNALPKIRFDIMNSVNASTGLSMFQLRYGRSPRVLPHIVPDSDFKRSNPSQIASDAH # SLLVDIATTVREARDNLTLAKVVQAYQADKNRGPCELFKAGDLVMLSTWH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g300 ### # start gene g301 4 AUGUSTUS gene 1100717 1102090 0.77 - . g301 4 AUGUSTUS transcript 1100717 1102090 0.77 - . g301.t1 4 AUGUSTUS stop_codon 1100717 1100719 . - 0 transcript_id "g301.t1"; gene_id "g301"; 4 AUGUSTUS CDS 1100717 1102090 0.77 - 0 transcript_id "g301.t1"; gene_id "g301"; 4 AUGUSTUS start_codon 1102088 1102090 . - 0 transcript_id "g301.t1"; gene_id "g301"; # protein sequence = [MSIIQDSEHSILASGSKSCRVGLWSAEKNISTEPDKVVPVSEVALIPSSPTNSPANSSHSSILNSSDDDEMSTRVNES # GHIELSTGKNGPRVKVGCVLSPEDLDDLYEDARRYAKDDIENVRDTIAEAFSARVHRDWFHAEKTVHLALALEQVDPDSSVPPTFPFLDVLRRKFCGH # DWAQVHASRRDDLRMSGGGVGCFDKYLSQVEGCNNRLKGVRNYLTPPQLLTILARGVTPTLTAILSEQGIIIDEDTTYKSWVAACRDLEVLFKSRLSS # ADRQGRRGAFPYNASSATNNNNPAHKRNTTSEPSSYPNKRPSSANGTTANGSNGVFYMKSFKSMPEALQKEQRELLGRISACPKCRTAWATCGSNLDN # CAGATLSVPWKPLTPEMVDWAISAHKSTNRPILYNAILKQAATRTAVASVHGLPLDDISAYVDNTGVRAPVTAAIYGKLRYWSIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g301 ### # start gene g302 4 AUGUSTUS gene 1115779 1117868 0.23 - . g302 4 AUGUSTUS transcript 1115779 1117868 0.23 - . g302.t1 4 AUGUSTUS stop_codon 1115779 1115781 . - 0 transcript_id "g302.t1"; gene_id "g302"; 4 AUGUSTUS CDS 1115779 1117029 0.61 - 0 transcript_id "g302.t1"; gene_id "g302"; 4 AUGUSTUS CDS 1117086 1117868 0.32 - 0 transcript_id "g302.t1"; gene_id "g302"; 4 AUGUSTUS start_codon 1117866 1117868 . - 0 transcript_id "g302.t1"; gene_id "g302"; # protein sequence = [MLDEQDAVDADQQELQQFMTLQRDEAAVAAKRKRNRSPKPVAGPSSKKIRSDAPKTDAPKKRSRRKSPAVEVNVEPFR # RVRLVVPPVRSVAPTSLPVPPPSSPSLMGVLNRDLPMQGPSDLVRLADAAEVHPGLVQQAGSSSPVRTPIKGTGQDLLSSTMPPILRPALVPRNPASH # PYRAENQRLAARVRLLEAQLADSQRENSSLTSALRDTSHALESRQREVEQLRSSSQEFLQRQEEYRHIIDQFNTLDRALSGPSDQSLLERFQKVEEEL # RITRKDRDDATGKLSTSSRRISELTTALLYQHGITDEGNALSTRQRARLEELQEEVHRTRGRAAFVERMIKEYPDEGYYEVVLPPLSQLEGDLVKVRA # DLRRVATLAHRLYRSDPATVLHHHNRYIGAIIEAVVAFLRRALETEDPDIMEHNIRLALDYMQTARGVHGDLHIRSTSSIQWFFNNAVDQDEGLYTLM # LENSRFDSDRPFLTAAQHAGFTSPPPDSLEPPLHRRMLSLSTALPHRGGAGRWDDLVPAIPSDDQLTQDWEQLMLQYMHHITDTPLPVPDPPVPMSST # GPVPESSDETNVEQSFEAPIVPVSSPSGGSHPPVPLFLSEQESPTSPSPPPRSSVPPLLFGSVASLSIDLTGDDDELYETEEAYASRIDVAMEGTELA # VDQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g302 ### # start gene g303 4 AUGUSTUS gene 1121593 1122087 0.94 + . g303 4 AUGUSTUS transcript 1121593 1122087 0.94 + . g303.t1 4 AUGUSTUS start_codon 1121593 1121595 . + 0 transcript_id "g303.t1"; gene_id "g303"; 4 AUGUSTUS CDS 1121593 1122087 0.94 + 0 transcript_id "g303.t1"; gene_id "g303"; 4 AUGUSTUS stop_codon 1122085 1122087 . + 0 transcript_id "g303.t1"; gene_id "g303"; # protein sequence = [MAPSHSDLLAESLSKLETCQNQANGKADSGHPEGNSVSIGTPRIHEGYGFRPPSGISTPLIASASAASESLVPDSNGL # GWPGKSVIYNRISPEYCPAKSTYSRLTATNEEKAAREKKLAEAVRTILDCIGEDPNREGLLKTPERYAKAVMWMTKGYEDRLTGAM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g303 ### # start gene g304 4 AUGUSTUS gene 1123042 1124428 0.18 - . g304 4 AUGUSTUS transcript 1123042 1124428 0.18 - . g304.t1 4 AUGUSTUS stop_codon 1123042 1123044 . - 0 transcript_id "g304.t1"; gene_id "g304"; 4 AUGUSTUS CDS 1123042 1123410 0.93 - 0 transcript_id "g304.t1"; gene_id "g304"; 4 AUGUSTUS CDS 1123460 1123627 0.48 - 0 transcript_id "g304.t1"; gene_id "g304"; 4 AUGUSTUS CDS 1123739 1124428 0.24 - 0 transcript_id "g304.t1"; gene_id "g304"; 4 AUGUSTUS start_codon 1124426 1124428 . - 0 transcript_id "g304.t1"; gene_id "g304"; # protein sequence = [MSVEPKETTLHPPPSPPLGNERAIEESGPHVLPTMPPPSEPSQKPSAQELRVTAAQSRSDKTDDKNGRSNESPRATNG # SAAASPRHRSASPSTRPGTRNHSTESRTSAGRSRSERDKVELSGDKREREHGPRRDSLTHNRSDRSGRERTTTGDSDRDRERRDRHGDKERDRDRDRE # KERDREKDRDRHGDRHRRDDKNHTRDARKDRDGRTAESGNQAAVADPRVQTRPDADRGSKRSSRKDAHREERSRRPGDKIERDRNERPRDSDRRRRDG # ENPDNRADSSEKQVEGKRPPEGPQGETKRVERLDIPLRSGLKPPFPPNTPSAPRAMSSSDARNSGKADNGSGRRDNTSGTNSVPVEGGMGSLRSRISD # KEISSRPSSYHGQSRKDDRDSRKRPFNGMQVSSNLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g304 ### # start gene g305 4 AUGUSTUS gene 1126289 1126552 0.25 - . g305 4 AUGUSTUS transcript 1126289 1126552 0.25 - . g305.t1 4 AUGUSTUS stop_codon 1126289 1126291 . - 0 transcript_id "g305.t1"; gene_id "g305"; 4 AUGUSTUS CDS 1126289 1126552 0.25 - 0 transcript_id "g305.t1"; gene_id "g305"; 4 AUGUSTUS start_codon 1126550 1126552 . - 0 transcript_id "g305.t1"; gene_id "g305"; # protein sequence = [MQEQERLANEEAEKRLKAALTAKREPSVIQSRIASPMPSMSRELASEAKPMPDILSTSEYVSMEVDASSAAPAAPEVC # AVSIHPFSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g305 ### # start gene g306 4 AUGUSTUS gene 1128582 1129833 0.32 - . g306 4 AUGUSTUS transcript 1128582 1129833 0.32 - . g306.t1 4 AUGUSTUS stop_codon 1128582 1128584 . - 0 transcript_id "g306.t1"; gene_id "g306"; 4 AUGUSTUS CDS 1128582 1129197 0.97 - 1 transcript_id "g306.t1"; gene_id "g306"; 4 AUGUSTUS CDS 1129254 1129378 0.92 - 0 transcript_id "g306.t1"; gene_id "g306"; 4 AUGUSTUS CDS 1129426 1129833 0.36 - 0 transcript_id "g306.t1"; gene_id "g306"; 4 AUGUSTUS start_codon 1129831 1129833 . - 0 transcript_id "g306.t1"; gene_id "g306"; # protein sequence = [MLIAPHCNPSDAECHNVLETTYSTLLASTLTMWTYKQTLSAEGFVTFIRSVLDNLPSTSSPNRTSNFAIFGEHLVDLI # WSVDAELDEVLVDVKATIAAYDGQSADKPQAVLGKANRVKQSAEADKATIVLIVKKLLQYGVLSANVCRERLDTAILEGVGLMVKANLDKKEIRTRTG # LFYKQNKFNLLREQSEGYSKLTVELTSALGIGHLPSTGRPQDPYDSIQHRAHAVWGKIIGLIGFFDLDPNKALDILLDVMSVNLASHYTFFLALLSFS # PWARSPLQHDQLPLSEGQFKGKTLDEILELVNPRRMSSEKDINGGSRVLAQILGFKLNYYQPAEAHEPPKSLYLTAAILIREGFVALEDLYPHVRRCS # LKIVTLEFNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g306 ### # start gene g307 4 AUGUSTUS gene 1131066 1132840 0.37 + . g307 4 AUGUSTUS transcript 1131066 1132840 0.37 + . g307.t1 4 AUGUSTUS start_codon 1131066 1131068 . + 0 transcript_id "g307.t1"; gene_id "g307"; 4 AUGUSTUS CDS 1131066 1132357 0.37 + 0 transcript_id "g307.t1"; gene_id "g307"; 4 AUGUSTUS CDS 1132414 1132840 0.98 + 1 transcript_id "g307.t1"; gene_id "g307"; 4 AUGUSTUS stop_codon 1132838 1132840 . + 0 transcript_id "g307.t1"; gene_id "g307"; # protein sequence = [MFPITSYFQRKTKKENVNPPKKRKQILSDDDEISLQPSGSSKKAKVDAPRRQQLSNRTKSLNKEGFSAAASSSTSASH # TRTISRRTPPHHHYATPQSLARASDTGHTSDSIIDLTTGPSSSTQPQRDTNANPFLIQTPRPLPSMIVQSAPASSVHPPKASSPRHFKAAERFYSEMT # SSSLPSIRQALSRSLATITPNTPKRSNHTTEIVPATPESPLLRLPIVPNESPDLSVPSSQNQEAEMDFLVNRKHKALTPDATNELDDLSQVPTSQSQE # VEIDLYVHRKGVSLAADAITSDELFDLSQVPTSQSQEVEVDLSMYRKYNAKEHHSHPPSDEIVPCSQSQDFDGIFLEAVSPRRKRVLRELEQARQVAT # ATDLSSGSGSRTSPTGCDERYNRLLEPFFLETNLVPSQSVFHSPVEVQSMTDEAIKSLIENTIPYAAQEAISESPNIERPESNHAMVPINDEDIQSLF # ESEGLPITDNVINGRDGTKVELPSMPPSQAASVTESDSGDEQWMMQGLNTDARRPVLTSEVSRDPARPLTQREVQSWQTDVSAYSYPRDVLDFLDMLE # GGPD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g307 ### # start gene g308 4 AUGUSTUS gene 1137836 1139441 0.53 + . g308 4 AUGUSTUS transcript 1137836 1139441 0.53 + . g308.t1 4 AUGUSTUS start_codon 1137836 1137838 . + 0 transcript_id "g308.t1"; gene_id "g308"; 4 AUGUSTUS CDS 1137836 1138960 0.53 + 0 transcript_id "g308.t1"; gene_id "g308"; 4 AUGUSTUS CDS 1139022 1139441 1 + 0 transcript_id "g308.t1"; gene_id "g308"; 4 AUGUSTUS stop_codon 1139439 1139441 . + 0 transcript_id "g308.t1"; gene_id "g308"; # protein sequence = [MLREKDRYNQSRYDNDPDLRIARERDAASAATSLQRRSSFNQGYPTPSSVGFPPTGANPGGYPPGFATSDRLGYGGAG # GYPSSVNAPSPGMGYQRERKYSVGGGLSEQFADLGIDHDDRLPNAPLTRPRKYSTHEAVAERARRMSGNFGVERPSSAYGNAPGAYPVPTASSNAGFR # AGVPYSNPSPGLRSVEPSYMQAPRPSSPYATSNYPPMSASQDPYGARAASPYHRAASPFGRSTSPFAAGGGDVYPPGHIMEGRPIGSGARSRATTPIP # GMPPGMPASVAFPSTAGPYPQPGMSNNMSPHMSPMMAGVPTSGTLAAPECFSRPINAAHPYTPFEPMKIQDMDLFLESLPRMPIVLQTHDVYNADWTR # LMDDVRLAWAGRLPTPGTSVNGRPPKRATLVAKLIELWNHSFFERRGVELVLYKGRERRSGSQYGAFDIPHDEFDDDTSSSSDSDSGSSGRMINLPLD # FMEAILRRCRTPDRDAVQLKLRKGGAGRKRNIAGDRERRDIRSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g308 ### # start gene g309 4 AUGUSTUS gene 1139795 1140535 0.62 - . g309 4 AUGUSTUS transcript 1139795 1140535 0.62 - . g309.t1 4 AUGUSTUS stop_codon 1139795 1139797 . - 0 transcript_id "g309.t1"; gene_id "g309"; 4 AUGUSTUS CDS 1139795 1140535 0.62 - 0 transcript_id "g309.t1"; gene_id "g309"; 4 AUGUSTUS start_codon 1140533 1140535 . - 0 transcript_id "g309.t1"; gene_id "g309"; # protein sequence = [MLSANDLEHARNGGRGRGRGSGYDRGGRDRGGNDRNDPFHSRPPNYGNGRGNSREPYRGQYRGDNGSYNDRGRGRPSP # NNSYSNGYGNGRDVSSASNNSYGGYGGYGGGPARDYGNGPTGGYGSAPTGGYGVGNVRGGYGGTSRGYSGSAGNAGGGGARDYEGYGGYGNAGGAGGG # PAAYRNNGGYGNAGGNFPGASRGRGSYGDDNHSRYPANGYTNPSHGNGGYSNATQGGPYNTPSRGRGRGW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g309 ### # start gene g310 4 AUGUSTUS gene 1141451 1142979 0.44 - . g310 4 AUGUSTUS transcript 1141451 1142979 0.44 - . g310.t1 4 AUGUSTUS stop_codon 1141451 1141453 . - 0 transcript_id "g310.t1"; gene_id "g310"; 4 AUGUSTUS CDS 1141451 1142409 0.79 - 2 transcript_id "g310.t1"; gene_id "g310"; 4 AUGUSTUS CDS 1142481 1142979 0.48 - 0 transcript_id "g310.t1"; gene_id "g310"; 4 AUGUSTUS start_codon 1142977 1142979 . - 0 transcript_id "g310.t1"; gene_id "g310"; # protein sequence = [MLALATHEPHFRVLREDVFGESNSTACRKCGQEGHYAAQCTAELAQIQKKPPSEKKPFIFLDVAVLREYLEVELDVPQ # AYFPFDFERSIDDWVLLIFFVGNDFLPHLPSLEIREGAIDTLLRIWKQELPRMGGYVTNHGRLELPRVQIILEGLAKREDDIFRRRREGEERQEANAK # RRKLEEENSKNGFTAGPSSSLSLTASTSSLTNNTTVAHPSLPPRPDFAARADSIGLGAKPNAESIQNIPAATQALAGSNHDVVANRRAIRMANMSAAE # VLKAELAGLVPVKPTASNVDNVPNVLLPSGPEPSMIISDATATPSVDITMTVDSEDEVPGFGAQSVTDENAPSVSTDFDIPFSEKNNVGTFENGTVGA # DDVEADPNLAGTKRKLDEMNIEETDETVVVDDDEPPVDGPHSSLAFKVNPDGTVSQEDTVKCVALSMDGLRLLIQSELDFRLWEPGYRDRYYRQKFDV # EPNDKEFRRQYVFNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g310 ### # start gene g311 4 AUGUSTUS gene 1143044 1143373 0.68 - . g311 4 AUGUSTUS transcript 1143044 1143373 0.68 - . g311.t1 4 AUGUSTUS stop_codon 1143044 1143046 . - 0 transcript_id "g311.t1"; gene_id "g311"; 4 AUGUSTUS CDS 1143044 1143373 0.68 - 0 transcript_id "g311.t1"; gene_id "g311"; 4 AUGUSTUS start_codon 1143371 1143373 . - 0 transcript_id "g311.t1"; gene_id "g311"; # protein sequence = [MGKELSEEEKNKVAWDTNAITPGTPFMDLLAASLRYWVVSKMNTDDGWKGVRFANENTIAFQLMHLLRFKLSYLMQVC # QVKVNTRSWIGSVASAQTPDMIQIRDTLSTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g311 ### # start gene g312 4 AUGUSTUS gene 1144313 1144816 0.65 + . g312 4 AUGUSTUS transcript 1144313 1144816 0.65 + . g312.t1 4 AUGUSTUS start_codon 1144313 1144315 . + 0 transcript_id "g312.t1"; gene_id "g312"; 4 AUGUSTUS CDS 1144313 1144816 0.65 + 0 transcript_id "g312.t1"; gene_id "g312"; 4 AUGUSTUS stop_codon 1144814 1144816 . + 0 transcript_id "g312.t1"; gene_id "g312"; # protein sequence = [MPEPGLKPEPADADAQSLSKAQKRAEGRARQEQQRAAKAAQKQQQSGQGVSGTTGSSSSKPKGSATPKKPISESNKTP # SAAASTSKDAPTNIRDGAGGTDGSSDSPKSRGLRIFSHFGLPKTPGHQIKGDIHPAIVKLGLQFSEFKICGANARCIATLTAFKTVIFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g312 ### # start gene g313 4 AUGUSTUS gene 1147371 1149285 0.95 + . g313 4 AUGUSTUS transcript 1147371 1149285 0.95 + . g313.t1 4 AUGUSTUS start_codon 1147371 1147373 . + 0 transcript_id "g313.t1"; gene_id "g313"; 4 AUGUSTUS CDS 1147371 1147880 0.95 + 0 transcript_id "g313.t1"; gene_id "g313"; 4 AUGUSTUS CDS 1147933 1149285 0.95 + 0 transcript_id "g313.t1"; gene_id "g313"; 4 AUGUSTUS stop_codon 1149283 1149285 . + 0 transcript_id "g313.t1"; gene_id "g313"; # protein sequence = [MSSCQPADNPQSSQIQIASRTFHFVLPPPPPPEDTPSPSSNSSTNRPRSPSLDVTSISPPSSQPSHSPPPRQIKPPTP # PPELQLGNSNLIARSTKANAKKRKKSDISAIPVHPPPPPKPEEIPPKPSLTYAQLIYRAIKAYDGKATLQEICAWIAKEYDYYRYSDGTAWMSSVRHN # LSSGRAFKKMERCGGDRGKGFFWSLDEAHQHTLESQDSKLLSGAAEQASKSRKKDKTLEPPLKRSVKGDTKGVLPPPLNSTPLPMQNSSDSSAATTTT # ISHYNVSSSSTAQTSTLPQRSSMVSTPITSAGAATSPYSALTQPWNIFARPNTDVLTFTPSLSTALSAPAITTFNIPTAPATSTNLTSVPVTSTSSLV # TVPASLLPTSVTVPSLSVSTSTMPKKLAPSVPDIAIPIVLGPVPPTHPSYSASHPNNSAKEGYMILHERKLILDPDVFSSLTKEMLVELEKMGASKAI # EILTGHLVRVLKERRKNRKSARGRGRGGKGAGGPGRKSATAGTTVKPSSSVPAASTSLSSAQTCDVSDVPATMVVETSLAANPNPLIPVPIMQAPVGD # PGSPIVVVDSDDDGPATKKRKLGEGPSSPFVDLVVLKPVVPTFGASLTTIQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g313 ### # start gene g314 4 AUGUSTUS gene 1149719 1152040 0.59 - . g314 4 AUGUSTUS transcript 1149719 1152040 0.59 - . g314.t1 4 AUGUSTUS stop_codon 1149719 1149721 . - 0 transcript_id "g314.t1"; gene_id "g314"; 4 AUGUSTUS CDS 1149719 1152040 0.59 - 0 transcript_id "g314.t1"; gene_id "g314"; 4 AUGUSTUS start_codon 1152038 1152040 . - 0 transcript_id "g314.t1"; gene_id "g314"; # protein sequence = [MDSLVLLQATEHRSGFDISRSFSPLLPPEKHASDSFDFIDVPHALSSTNSPKHLGPSPAPRKENRKQNLPSLNQFKEV # RGTPSPALRYNLLPLIQKRGNTKRGRTSLYGNPKSSDTKPLVNDNTAIIASNVPLGTNVFDKLPEVALTPTLPFHSTLLCAEVHKANEPALCEVISSR # AIHSCDTLTPKSGEGNQSKISPLNQDRDPHVHSSTLLAVSPSSDVRCSSFASMQREILHHPLSPTQHTGPLIPVVFPVPPVEIGTDPSDFSIPPNDEG # RSCQVFWDAPQNEHFISAYNRGSSLVEEYEPPSVRRFSEAAASSETSEVAVREGDRERIINKILADQPLLRMHSVPSEVYSHSRPATPPPPHVKDEKD # EPATNDSTSTSTSLSIDLQDETTVAEVTDILVTSERFDDVQIPHTTGIKPLFGGSVPDVEYLPTPRNTPPSPNTLSTPSTFISCLAGKTSSPHESRVL # SINQSSHPPPPHLSISSDSSSSNLDLLPSSRNFPQTSNSAKISKRRRQAPASSLTSPSRSCIGKRLSFGQTSLCSQTTANVEPTRRPEPETVRSSGVK # KEQVVKKEEAVKEKCKEEKVVKKETTARELVKKEKAQEVKEEKVAKHEEKSVKREKVVREEKHVIREKRMKRRLDLIPSERNAARNPRPEKRHRLFLN # EIHVNLWINDIQRISYLDKSYQVLDHIDGLKLFNVLVDIEERRFEVTLELLGAGNPSLAKSLGQLRKHRTRYDTMFDLKIRYKASQLVDYFAQKYNVA # NPHDGGRQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g314 ### # start gene g315 4 AUGUSTUS gene 1153537 1153947 0.62 - . g315 4 AUGUSTUS transcript 1153537 1153947 0.62 - . g315.t1 4 AUGUSTUS stop_codon 1153537 1153539 . - 0 transcript_id "g315.t1"; gene_id "g315"; 4 AUGUSTUS CDS 1153537 1153947 0.62 - 0 transcript_id "g315.t1"; gene_id "g315"; 4 AUGUSTUS start_codon 1153945 1153947 . - 0 transcript_id "g315.t1"; gene_id "g315"; # protein sequence = [MQQYLPSVGPTPESLSRPRRNAVDISALTSNTRTSPIPSRFGRRNAIDYTSSLVKSDWWHAGQPHAFVPRHNYGANPA # VPFGSAEQVQAGVAMSELENHQDLNHSSALITSFLPRDWMPKRPFVRLVINVSGTSPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g315 ### # start gene g316 4 AUGUSTUS gene 1156542 1158663 0.61 - . g316 4 AUGUSTUS transcript 1156542 1158663 0.61 - . g316.t1 4 AUGUSTUS stop_codon 1156542 1156544 . - 0 transcript_id "g316.t1"; gene_id "g316"; 4 AUGUSTUS CDS 1156542 1157528 0.93 - 0 transcript_id "g316.t1"; gene_id "g316"; 4 AUGUSTUS CDS 1157581 1158663 0.61 - 0 transcript_id "g316.t1"; gene_id "g316"; 4 AUGUSTUS start_codon 1158661 1158663 . - 0 transcript_id "g316.t1"; gene_id "g316"; # protein sequence = [MDAPDATKSAHRREGAFSPSSEDTAAQFVTINVAEAETVIPPSLRRVDQHIQPIHDNVIESGTSITEVHPLKPPAFAS # SISAGSSSSSFGTVQSVGFGNATDQLQPGVTANPIQEDAWVDVHTVERSPSFEASVEHPRLSAEHSHHTRTIASHATSQSLSVDEHTTTTSVSRSSSV # SPALPRSHSPSINSQADSRSSSLSPAPSPPPKSFRHSITTGLKRMSLPRTPSAKSLGRTSHDRERSSNEDETSNHPLPDIPQARLLNFQPLIPLRNIQ # SYQQVTRPYITPLQPMRRKRKIDPNPAAMFCSEVTARQNAGERCMLYAQKINDLWGYDCGLEEWMENIRKRGMLRLGIIFPILITFSSTPTSPISTSF # NTMSPSTIPFTSTLRQTSRSSYTSVITEATFPRRPDASAATDLAMTFKDALSLSPPTGPPPLPYPSLVSTNQRFPGRSNSSVGSTSGSDSPARGYKSL # MPLTPASKTGAFFASLGRKASVSRKDKGLGSSTGSGLVSSSSRLTKQPHKHSSQNSHPPATVTAGPPSVPGGPRAPPNRMLRSQTMMISPMLSEGSNS # SSVKKLNVMGRRPSLYNIPSADSVHHSTPYNGHLSNPTVTGGPRSQSSSPSKQPLKPRYESPTPPESSWDLEFRRQVDKLSDLMPHADRIVLAGYLKR # SGQDILAIGQYLEDEKNGRLRRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g316 ### # start gene g317 4 AUGUSTUS gene 1159158 1160195 0.55 - . g317 4 AUGUSTUS transcript 1159158 1160195 0.55 - . g317.t1 4 AUGUSTUS stop_codon 1159158 1159160 . - 0 transcript_id "g317.t1"; gene_id "g317"; 4 AUGUSTUS CDS 1159158 1160053 0.57 - 2 transcript_id "g317.t1"; gene_id "g317"; 4 AUGUSTUS CDS 1160138 1160195 0.58 - 0 transcript_id "g317.t1"; gene_id "g317"; 4 AUGUSTUS start_codon 1160193 1160195 . - 0 transcript_id "g317.t1"; gene_id "g317"; # protein sequence = [MSNQDVDEDNDRRHIPTQQARSDTENLLSYYQSPLADSRYEDNEGKARKPTVPSRQLSIASSESDYSDSSHSDYTGAA # AQKRLNIPSEGGSDRRRVAIVEMDAVLETAKRNGSLRSRRGKDVFGSLALVAPPDASPKSYSQLTPPLTAPIEGKHGLELPNQDESRAHHRSQSEAVS # PKKPSRDVGIVGTTLQPIILDLDTVNAQGQVLQPPPLFIHPESRSPTPGDPSSPTSLMPPVKRRSTGQSITVVTPEIGAEKLIDVPVASPVVVRLDRM # DIVQTALPEASPPSNNGPQIAVQSGLHSPHVPPSYLNYKPGAY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g317 ### # start gene g318 4 AUGUSTUS gene 1161503 1162525 0.74 + . g318 4 AUGUSTUS transcript 1161503 1162525 0.74 + . g318.t1 4 AUGUSTUS start_codon 1161503 1161505 . + 0 transcript_id "g318.t1"; gene_id "g318"; 4 AUGUSTUS CDS 1161503 1162525 0.74 + 0 transcript_id "g318.t1"; gene_id "g318"; 4 AUGUSTUS stop_codon 1162523 1162525 . + 0 transcript_id "g318.t1"; gene_id "g318"; # protein sequence = [MVLLPVACIRYRGDEFAYGQYFQFPYISNFKCPSQQDAKNLIYFALSLSGACREELGYDPTVRRVQGKDRTGPCYIFT # IDGKQYITTEAITVRKAKFLLGCAARVFKVQQVLNDEGDLDTEVKVIKDYWLPEDSCTELEIRLAIEANVQKVNVVPNLDRSAFNKYFVRIEACEKVP # VPSTTEKGQTPDSTSNFIRGQTLPSDIKRFTVSTQSSTYQRVMSVSIPASIMMESGAERQRRQETVIREATATHLARLDRRTYAPKVHCRQLSEYAGK # PLDQMMDWDIILKALESLIIGKLVHPLLAVNLNYSPSSFIYAFCWLCSSRHQRCECVGKRWECQAY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g318 ### # start gene g319 4 AUGUSTUS gene 1162665 1163201 0.53 + . g319 4 AUGUSTUS transcript 1162665 1163201 0.53 + . g319.t1 4 AUGUSTUS start_codon 1162665 1162667 . + 0 transcript_id "g319.t1"; gene_id "g319"; 4 AUGUSTUS CDS 1162665 1163201 0.53 + 0 transcript_id "g319.t1"; gene_id "g319"; 4 AUGUSTUS stop_codon 1163199 1163201 . + 0 transcript_id "g319.t1"; gene_id "g319"; # protein sequence = [MTDRYLFRPPTHKFNFERVPSFPFWYHYIHDIESVLWVFTYFLLTKWPASESPPSEEQQNARDEFFSRAFIFGKRKEF # IDGDMDMNNRAVASTLPNFYSDWAWASHFAEVVKKKCCALQQSLPIDFKNAFHPSLCSDFQQAFIHCATEGWTGAVTHRGRAKQSAEDDSEKETKKSK # VT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g319 ### # start gene g320 4 AUGUSTUS gene 1165013 1165528 0.87 - . g320 4 AUGUSTUS transcript 1165013 1165528 0.87 - . g320.t1 4 AUGUSTUS stop_codon 1165013 1165015 . - 0 transcript_id "g320.t1"; gene_id "g320"; 4 AUGUSTUS CDS 1165013 1165528 0.87 - 0 transcript_id "g320.t1"; gene_id "g320"; 4 AUGUSTUS start_codon 1165526 1165528 . - 0 transcript_id "g320.t1"; gene_id "g320"; # protein sequence = [MSSKKTDREKTVIVIVGGGIGGLALLNALSASINPEKHTVVLVDARPAHMHLISSLRLIVSDADDLLKQAVHPYGDHT # FRNKFAGNGSFVHGSVTSVKFGDGGKGGQLILDSGEVVDYDLLVLATGSSWPRPLGFPTESKSAIENHIMARRAEFAEAKDILLVGGGSVGIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g320 ### # start gene g321 4 AUGUSTUS gene 1168475 1168792 0.52 + . g321 4 AUGUSTUS transcript 1168475 1168792 0.52 + . g321.t1 4 AUGUSTUS start_codon 1168475 1168477 . + 0 transcript_id "g321.t1"; gene_id "g321"; 4 AUGUSTUS CDS 1168475 1168792 0.52 + 0 transcript_id "g321.t1"; gene_id "g321"; 4 AUGUSTUS stop_codon 1168790 1168792 . + 0 transcript_id "g321.t1"; gene_id "g321"; # protein sequence = [MSMRFPVVGAMPMSPDESFDVDENGNVDWRLAWLKEIGHLQQVTAEQEKAGADPEWYRMMLVRVRTALMPPMMNPEAM # HMAPMVPPNGTVDPSQQSAQPQQQQSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g321 ### # start gene g322 4 AUGUSTUS gene 1169862 1170542 0.78 - . g322 4 AUGUSTUS transcript 1169862 1170542 0.78 - . g322.t1 4 AUGUSTUS stop_codon 1169862 1169864 . - 0 transcript_id "g322.t1"; gene_id "g322"; 4 AUGUSTUS CDS 1169862 1170542 0.78 - 0 transcript_id "g322.t1"; gene_id "g322"; 4 AUGUSTUS start_codon 1170540 1170542 . - 0 transcript_id "g322.t1"; gene_id "g322"; # protein sequence = [MFSPFDSLIRAPVLPMPPTALSITGTRPKTAYHRVSPSEPLLTALRNTHFVEYPTLDLWSQGEFSGVVADQHAESQLR # ETSGFSQKLVYERGDIVSEDEPGENPERRAKRRKIELKAGKKAISGLLGGYGSEDDSGQEEEERAEKDDGRAQNGLTLLGAYADSDEETKVEMDSDEE # DEDVAEVSPEVLLELMKKAQSGNSWMDDSKDDDRVDWGDGDSEAEQEEEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g322 ### # start gene g323 4 AUGUSTUS gene 1173087 1174037 0.99 - . g323 4 AUGUSTUS transcript 1173087 1174037 0.99 - . g323.t1 4 AUGUSTUS stop_codon 1173087 1173089 . - 0 transcript_id "g323.t1"; gene_id "g323"; 4 AUGUSTUS CDS 1173087 1174037 0.99 - 0 transcript_id "g323.t1"; gene_id "g323"; 4 AUGUSTUS start_codon 1174035 1174037 . - 0 transcript_id "g323.t1"; gene_id "g323"; # protein sequence = [MSPTAVEITPAVIPAAVPFKGAALAIGSLSTAQDGKYQALISDLESSRPVERQMLDRLVDGATSLKASTYASAHVILT # QSEYISLLPNISFLLSQLLAGLAPLGTLNLHNLSALDDLSPLTSALTLSGFTLLNTASSTIIAQKPAHSAAGPLRLLNRKKTDPAKKKALWALSSYAP # STPSIDPDALLTDADKARPVPTCEPVNPSTPRRKRACKNCTCGLAELEAEELRHSKVVLLDGKVDGSAVEVNQGKEQERLIQAAKAAPKATSSCGNCF # LGDAFRCASCPYLGEASSEVHLGFFEFSNFVRFTGLQARRKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g323 ### # start gene g324 4 AUGUSTUS gene 1174433 1176172 0.42 - . g324 4 AUGUSTUS transcript 1174433 1176172 0.42 - . g324.t1 4 AUGUSTUS stop_codon 1174433 1174435 . - 0 transcript_id "g324.t1"; gene_id "g324"; 4 AUGUSTUS CDS 1174433 1174780 1 - 0 transcript_id "g324.t1"; gene_id "g324"; 4 AUGUSTUS CDS 1174832 1175246 0.43 - 1 transcript_id "g324.t1"; gene_id "g324"; 4 AUGUSTUS CDS 1176111 1176172 0.82 - 0 transcript_id "g324.t1"; gene_id "g324"; 4 AUGUSTUS start_codon 1176170 1176172 . - 0 transcript_id "g324.t1"; gene_id "g324"; # protein sequence = [MFGLQEIPTALVSKADSPENKSGSISNHIEGLHPGPELSGIIRPIGTPNIVEADVFPPARSQAPDPSIFLPYIPEDIS # FEEEYEEYISDLGWTDEQTDGSSFGSASAWARFPEEFAADITDGISDSESIVTIGDLGDETRLDPSRDDPDVVDENLNNWEHMSPKTMAALPKSPAGR # SPASRSPAGRSPADKRRSSSGGGLRPVKPFGLDDEDGVVLDDEDEDGEEEEVLHAPRELSAFAAGEGVDEVEYAYGLVVFISQMIGQKLNFLQSVRQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g324 ### # start gene g325 4 AUGUSTUS gene 1176638 1176943 0.46 - . g325 4 AUGUSTUS transcript 1176638 1176943 0.46 - . g325.t1 4 AUGUSTUS stop_codon 1176638 1176640 . - 0 transcript_id "g325.t1"; gene_id "g325"; 4 AUGUSTUS CDS 1176638 1176943 0.46 - 0 transcript_id "g325.t1"; gene_id "g325"; 4 AUGUSTUS start_codon 1176941 1176943 . - 0 transcript_id "g325.t1"; gene_id "g325"; # protein sequence = [MWRTREDCMTHESGLEHLPGSEGEFASSTFTNPSAQYDSVKEDPEAAELLPDLALLDVKIAEATAALENAGTASEKRK # AKERREDLMRLKRVEQIYVSFVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g325 ### # start gene g326 4 AUGUSTUS gene 1182607 1183575 0.51 + . g326 4 AUGUSTUS transcript 1182607 1183575 0.51 + . g326.t1 4 AUGUSTUS start_codon 1182607 1182609 . + 0 transcript_id "g326.t1"; gene_id "g326"; 4 AUGUSTUS CDS 1182607 1183575 0.51 + 0 transcript_id "g326.t1"; gene_id "g326"; 4 AUGUSTUS stop_codon 1183573 1183575 . + 0 transcript_id "g326.t1"; gene_id "g326"; # protein sequence = [MANHIDVDPARIPCPNFSSNLYEVIRKALIADANTPDITNDEQAILQLRGQWEAENTILRAQYQAQLHEEQTANEQWG # AEEEEFSRQREAKEREKEAEIAKEIEKKRTPLPNFQQGVGHHSVPHHYHPYAEKLTTARKYVPLWYFLSDAEKEAKERMREVVDNNRFEFASDPTEAS # NSSLTLVSTTSIRASPNAIPDIQLTWNQVMRSKSGFLSSLSLGAFPSRHINMFAQFFANMEMHPELRKTNGERTMALYQAETRLSWYKENEKGAPFDL # AVIMEETLNECRNEIRSQDHAKALKGMFPPPLLTTEHPTNCHLPPPPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g326 ### # start gene g327 4 AUGUSTUS gene 1183975 1184517 0.82 + . g327 4 AUGUSTUS transcript 1183975 1184517 0.82 + . g327.t1 4 AUGUSTUS start_codon 1183975 1183977 . + 0 transcript_id "g327.t1"; gene_id "g327"; 4 AUGUSTUS CDS 1183975 1184517 0.82 + 0 transcript_id "g327.t1"; gene_id "g327"; 4 AUGUSTUS stop_codon 1184515 1184517 . + 0 transcript_id "g327.t1"; gene_id "g327"; # protein sequence = [MHQTFRDPFVRQTNRSYRGATGALAETDMTSVDAHAPHFGTGSKGSSATGTKAGTWKSQRAHTRDSNYAQTGSALMAA # PAKRTQRNIDAQAVPTPVTVLRAALKASETHIHTPLVAGAWHKALSELGLLSKYPTLLNSICHGFKIGILLIYHTFSPPNKLQDLESIRAFESIAENE # ISLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g327 ### # start gene g328 4 AUGUSTUS gene 1185965 1187480 0.86 + . g328 4 AUGUSTUS transcript 1185965 1187480 0.86 + . g328.t1 4 AUGUSTUS start_codon 1185965 1185967 . + 0 transcript_id "g328.t1"; gene_id "g328"; 4 AUGUSTUS CDS 1185965 1186669 0.86 + 0 transcript_id "g328.t1"; gene_id "g328"; 4 AUGUSTUS CDS 1186755 1187480 0.87 + 0 transcript_id "g328.t1"; gene_id "g328"; 4 AUGUSTUS stop_codon 1187478 1187480 . + 0 transcript_id "g328.t1"; gene_id "g328"; # protein sequence = [MFGLSSAGGAYGHVADAGVDICRGKGLGPITKWVDDHFWLRILVSHLEQYNELRSQLKNRIKETGGLKHHKGRLLFLG # QTLPNGQLEEFDDDFTFNIHDLSHTSPRSSEDQKYTYAFCDIDRITLLLGYQWAKEKDIGFCNDPTYFGFQWHISSRLVSVPLSKRMKYLKELKEWER # QPLHNSQQVSKLYGKLLHVSLVLPIGRSYLIELKKFEAELSHKEPFTKHHAPRGWHADLTPAAAMASAYASKVSGGHIVSFQDGKDLAMSEISGGQRQ # PDSTFLSAPSQTTLPPATTTKSGVTTKEWSKGGGVAGAEIEPQTYYSAALTRSLMHETSPSTPVTSQVLTTQPTLSREVTLVPSNYSSPASLFQSTSR # TSSSTMTNPSPPLNLLTTALTQAMTAHLSPNEPLKDPNLNNGDSKKKENCSLLSKMPGNRPATSQYPIASPISQSNIQKHIVHSYPSNLTLIPSVLCP # HCPARE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g328 ### # start gene g329 4 AUGUSTUS gene 1189903 1192265 0.53 + . g329 4 AUGUSTUS transcript 1189903 1192265 0.53 + . g329.t1 4 AUGUSTUS start_codon 1189903 1189905 . + 0 transcript_id "g329.t1"; gene_id "g329"; 4 AUGUSTUS CDS 1189903 1190946 0.53 + 0 transcript_id "g329.t1"; gene_id "g329"; 4 AUGUSTUS CDS 1191114 1192265 0.99 + 0 transcript_id "g329.t1"; gene_id "g329"; 4 AUGUSTUS stop_codon 1192263 1192265 . + 0 transcript_id "g329.t1"; gene_id "g329"; # protein sequence = [MPVPVPHHSKQPAHLVIKQHCSDDGVNHSFQDLTGILPVSPTGPPPSFGTREQWINSLPSWRRSKPRRIWEDDSHPFA # EQDFQTGLAAADNASAIKGSRAKACPPPFYIQPSAIAPTIKGAATSIEMVPHGPFDTAGMHANDKACSIATNMEIDVYDHQDRSAFTPIFEDDSPEFR # SVHEVSSSPIEPVTPFGDFVDRAVSSTSAALSCSYVSNASLAGAAKDTCQLQCYRSHPAAQPFTDLPVSVPAPELVTPTATSGYRKLSEPLSEWIANF # VWKACTTGTNIPSSIAKVRSVSLLILLPFVSLMLYQTCHSQGLCCGSPELSRYFDSFTVAFHLASTVSHIPCSVPTNGWTITRSQTRLGTLISAVSFG # FHSCSILRHSISNVPIKILNDLESRALDIFAYDLSISTADWSDWLLHVMSYHLSLSSPSHPQPISRPSANPHLIIKLALEEIINAPKACDSDSPQPRA # VFLGLEERRREKQEKEQAHKANVLEIDLDEDGPLREEYMPKRRVSEAGAPHGIENSFTIQRQIWETNKSAEKLLPPPARWSPAGDEPILRDSNRPHGR # YLAVQPTPGVFVPVTSYQGLPQYQSTHELNYVSQPWLPNVHFATAKPLPTTGHFLEFTSHQHPAHSVFNSCPPPLLLPFALPHSRSQSYSHDQDTSQS # YNHTRSYSQSQFEYRCCDLRMTPNELPPVQADVDMTWGLSGRHSYGPPAFAPHPSVTYQSTWLRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g329 ### # start gene g330 4 AUGUSTUS gene 1194380 1195257 0.53 - . g330 4 AUGUSTUS transcript 1194380 1195257 0.53 - . g330.t1 4 AUGUSTUS stop_codon 1194380 1194382 . - 0 transcript_id "g330.t1"; gene_id "g330"; 4 AUGUSTUS CDS 1194380 1194628 0.77 - 0 transcript_id "g330.t1"; gene_id "g330"; 4 AUGUSTUS CDS 1194681 1195013 0.66 - 0 transcript_id "g330.t1"; gene_id "g330"; 4 AUGUSTUS CDS 1195069 1195257 0.66 - 0 transcript_id "g330.t1"; gene_id "g330"; 4 AUGUSTUS start_codon 1195255 1195257 . - 0 transcript_id "g330.t1"; gene_id "g330"; # protein sequence = [MDQRCVFYEKPLIDSGTLGTKGNVQVVVPHLTESYASSQDPPEKETPSCTIKNFPNAIAHTIEWSRTAFDDLFVRPAQ # AVNSFLSEPDYLEKTLKYSGQQKEQIEQLVSFLVTNKPLTFEECIVWARLQFEEKYNNEIRQLLFSLPKDAVASNGQPFWSGPKRAPDPIIFNSNDPL # HLSYIIAAANLHAYNYGLKGETDSNVYRKVADSVIVPEFTPKSGVKVQINDNDPVAQNETSESGMSSLFYVLVYKFHSLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g330 ### # start gene g331 4 AUGUSTUS gene 1195376 1197401 0.21 - . g331 4 AUGUSTUS transcript 1195376 1197401 0.21 - . g331.t1 4 AUGUSTUS stop_codon 1195376 1195378 . - 0 transcript_id "g331.t1"; gene_id "g331"; 4 AUGUSTUS CDS 1195376 1196179 0.58 - 0 transcript_id "g331.t1"; gene_id "g331"; 4 AUGUSTUS CDS 1197249 1197401 0.39 - 0 transcript_id "g331.t1"; gene_id "g331"; 4 AUGUSTUS start_codon 1197399 1197401 . - 0 transcript_id "g331.t1"; gene_id "g331"; # protein sequence = [MSNLPLSANMDVDETAIDEGLYSRQLYVDFLVNLCARSDYPTSSATCWGTKKSLRESLQSPEFFITDFAKFDRPSTLH # AGFQALSEFHAQHKRFPKPRNAHDADAVVAIAKKLNADADENIVTQLAFQATGDLSPVIAVIGAFVAQEALKACSAKFHPMQQHMYFDSLESLPDVLP # SEAECQPTGSRYDGQVAVFGKTFQEKISNHRQFLVGSGAIGCEMLKNWSMMGLASGPKGAIQVTDLDTIEKSNLNRQFLFRPKDLGRFKAEVAATVVS # DMNKDLAGKITTRQDAVGPDTEGAISPKLPVIDSNNCLPSYRHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g331 ### # start gene g332 4 AUGUSTUS gene 1201271 1201861 0.93 - . g332 4 AUGUSTUS transcript 1201271 1201861 0.93 - . g332.t1 4 AUGUSTUS stop_codon 1201271 1201273 . - 0 transcript_id "g332.t1"; gene_id "g332"; 4 AUGUSTUS CDS 1201271 1201861 0.93 - 0 transcript_id "g332.t1"; gene_id "g332"; 4 AUGUSTUS start_codon 1201859 1201861 . - 0 transcript_id "g332.t1"; gene_id "g332"; # protein sequence = [MYTLYFRRKRDKSEERKARKAEKKRIKEEEEARQIAELSVYSATDNPFHDVNLGQQFRWHKKNEKERKQGLSLAEAQR # KDAIRKQEAKEELERLNKRRAEREVEQRLREEEEMRMQRLQESAQMSDWLSKEGDFQLEQERSRAAIRIKEKRAKAVDFLALNLKYVTLDDDSEDEEE # DAGLEIDLDEPYNILDVGDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g332 ### # start gene g333 4 AUGUSTUS gene 1204777 1205426 0.48 - . g333 4 AUGUSTUS transcript 1204777 1205426 0.48 - . g333.t1 4 AUGUSTUS stop_codon 1204777 1204779 . - 0 transcript_id "g333.t1"; gene_id "g333"; 4 AUGUSTUS CDS 1204777 1204958 0.81 - 2 transcript_id "g333.t1"; gene_id "g333"; 4 AUGUSTUS CDS 1205405 1205426 0.48 - 0 transcript_id "g333.t1"; gene_id "g333"; 4 AUGUSTUS start_codon 1205424 1205426 . - 0 transcript_id "g333.t1"; gene_id "g333"; # protein sequence = [MNKFSSRYAHEFKKEFEAAQKTNAALSGGAPAEAPLVEEKKDEAEKEKVDEEEKKDETKDEKKEEEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g333 ### # start gene g334 4 AUGUSTUS gene 1207647 1210232 0.7 - . g334 4 AUGUSTUS transcript 1207647 1210232 0.7 - . g334.t1 4 AUGUSTUS stop_codon 1207647 1207649 . - 0 transcript_id "g334.t1"; gene_id "g334"; 4 AUGUSTUS CDS 1207647 1210232 0.7 - 0 transcript_id "g334.t1"; gene_id "g334"; 4 AUGUSTUS start_codon 1210230 1210232 . - 0 transcript_id "g334.t1"; gene_id "g334"; # protein sequence = [MADLFQRIEDRKDDYIAEVVVTFLEIYNEEIHDLLADPSTSKPRGGLTIREDKVVKVAGLVELSPKSAEEVKEIVLQG # NLRRTQSPTHANETSSRSHAVLQVHVTQSPRTASLSEQKTMGTLSIIDLAGSERAAATTNMGQRMVEGANINKSLLALGNCINALCESGGAIRHVPYR # NSKLTRLLKFALGGNCKTVMIVCVAPTSNHFDDTHNTLIYAERATKIKTKVVTRNVVNVDRHVGRYVEAINRLNAEVAELKAKLAGKNSTENEVVKRK # RLEASAEVERAKNDLKVKVEQTKASIVDGAACSGRLSVAKAKLGAIRSRLAKISILESSSPSPLSADLEAERSFLEALAGPEEQALRTDSVLNTRIHR # SSNANAMFDATMRAVSERRSDKLDEVSIENVKLDAACRKAEMDKLKAEEERNVLANAVDEVAQVMVGLIGMLGRCNAMVGESSRLLQTPGDDGDVHGA # TQNVSAMLLKLKEKNDDAFQKLIGHSTENYSNSSDNFRGYGMSFTRRISSGPAAMQTTTKAGSRRSSTHGASSSFSLSSPGRHKTPRRSLRSSLAAQP # YRRTSDKERRGLKTSKNVHWRDETGQGDLDDSGLKTVPAIALTVIPASPLVDNQSSTSSTSSFKASPHRSSSLGGGSESEWEDDNEKTDENVSVNLSM # SLPASSRDSMSSSSAVPRLYGSLGKRPRPNRLDPSFLRSKLRTPALGSLAEDDENTQNGSPRRTSQPLGDRSLNSLDNEFNMNESSSKAYHGSPSKRM # PATPRSAMKSRRRSNLGVRSEKSRRRSSLIPQLSPPGGESNKPRRIILASPGKRPKRLSISRNSGVSSFRLKPSLPNLPLADTSADISMSRLKPTWR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g334 ### # start gene g335 4 AUGUSTUS gene 1213619 1215288 0.11 - . g335 4 AUGUSTUS transcript 1213619 1215288 0.11 - . g335.t1 4 AUGUSTUS stop_codon 1213619 1213621 . - 0 transcript_id "g335.t1"; gene_id "g335"; 4 AUGUSTUS CDS 1213619 1213976 0.35 - 1 transcript_id "g335.t1"; gene_id "g335"; 4 AUGUSTUS CDS 1214081 1215288 0.19 - 0 transcript_id "g335.t1"; gene_id "g335"; 4 AUGUSTUS start_codon 1215286 1215288 . - 0 transcript_id "g335.t1"; gene_id "g335"; # protein sequence = [MALKQEVGSLPDNVEVVSVNVQLKSLRNDIETSFTLLDRIDCLAALSEALCTCDDALSDLLEHIDSFPATPLGPLSSS # YTNLSSLIPEEQLSDRLSFTKSTIEAVTNAFEVVKGDPRAIVENERVLQTWSELEEMGNDRVHVTKSRPSSVMSTQSSGHDSRVSLNKSQLRFQPGPS # TSAKARKSGSYATLSVSSSTPRGRLNVPSPTPSQSRRAFSGSDEPGTRSNSRMSTRSSQQRTISGGSLYGTTYASRQRTTSLTGAAATPPPKRNFSGG # HTRSQTATASQKKRDPSPSLSDASLSFNGRSSTWSKAPRISFSGVPRVSTPQKRPSAPRKAYVANPKSKLDVAVGDVVNSLPIGINIEGVFGSWKDQS # GKYWIGDQEPKLCFCRILRSQTVMVRVGGGWLLAPPDSPGMHTSGEERWISSATLLEEREQNTPPGPPRTPEPRGPLLPSFSLSTPSGHSPQSMMSTP # STRGSPLTPLQFMRRAEPEAPFFARPETPTKSPSRPRTIPTTPARQSVWRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g335 ### # start gene g336 4 AUGUSTUS gene 1215500 1217929 0.86 - . g336 4 AUGUSTUS transcript 1215500 1217929 0.86 - . g336.t1 4 AUGUSTUS stop_codon 1215500 1215502 . - 0 transcript_id "g336.t1"; gene_id "g336"; 4 AUGUSTUS CDS 1215500 1217929 0.86 - 0 transcript_id "g336.t1"; gene_id "g336"; 4 AUGUSTUS start_codon 1217927 1217929 . - 0 transcript_id "g336.t1"; gene_id "g336"; # protein sequence = [MKDQFAAQTLLEDIESAMMQQPTARQSAAFMSRSDALLKRLLLRGNPASSTSTFPRPSHPLFTQQSEFNESLARTLSS # EIKSTTELLRNVESLTKMYRASYDAVSRVETLNEAVSSLIFTFQSIIDRLENGIASSEGDGTPPTLMSNECLDPSRHSVFIALLPSLLDELAKTDHSA # SELVRQVPAALLHLDFPGVDQEFKTNASTQLLRLKTIRERAQRLNEVTVGRVGRLREARRIWTTMDATLKEVEAIRREAVDEIDRCRWRQDTTINVNG # APPTPESPSTVPLPSDSLQQYTELEHQMTQLGARLQTAVDDPLTSLSTTLELPLKEHLSQSVQNLKSHSIRVQRMIDLLRSIHKQTTVMNGIREEFNA # LQLRLDDIMTRYESKTENVLDDTPIDEQVSDTDESLSSEFTATRSNTMVFINNLAQRVPLVGSSSQVPIVKRSFSTIDLTSTTRPEGLLIELPFDLHS # VDDSVRADCNSYTMRLNGQVHALEQKVHHFHLSQIAKELDASTSALLNEIDQASSQFTTLHGTFTGLQNAIDVINSLTKMTADIEQSSSTHRSRLNRS # LTAVREIHRRLESAPGILDSNVHDRVLLSRTRGISQLEGQITSWEANIESLRARVVAAQEAAVYRMQREKEEEEARLAAERERVAKEEAEHAQAEKFR # QEEEERRRLEQARLAEEEERARLEMEQQEETERIRLNEIRLAEEAQAKEEQKKLALEEAEKARLEKERIEMVSKLKDTEGKLLAERKLHAEKERMAAE # EARMARLEREKLDEERNHAIKELEAANISLEEGKQACTNSCIGPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g336 ### # start gene g337 4 AUGUSTUS gene 1217978 1219130 0.67 - . g337 4 AUGUSTUS transcript 1217978 1219130 0.67 - . g337.t1 4 AUGUSTUS stop_codon 1217978 1217980 . - 0 transcript_id "g337.t1"; gene_id "g337"; 4 AUGUSTUS CDS 1217978 1218613 0.83 - 0 transcript_id "g337.t1"; gene_id "g337"; 4 AUGUSTUS CDS 1218852 1219130 0.7 - 0 transcript_id "g337.t1"; gene_id "g337"; 4 AUGUSTUS start_codon 1219128 1219130 . - 0 transcript_id "g337.t1"; gene_id "g337"; # protein sequence = [MFEDTTIPGDGSSGTTASQADSIHINSINAVNLQPELPEVPTKARAGGDEEALESHQVIELQIFSERKAWIEEKIKVR # KRICYLMQAQSISPIQKTAATQRNLSPEDTDLIELTLTTIYALDKLLHLLRDRSETLDLLGVRISWEENRISSWVERRKIIADLQAFLESRAQWSASV # YDNPPKTDPTLEDHRRGSVSSLASVASDTSINSPAFSRSTRFRLAELLSRDAATLSARVSSLRHGSVAASGKFLDKLIDNSRKPVPEVLLDEQDRIDE # KCVNDMENIGKFVLNVVMQWRKYGCPFLDF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g337 ### # start gene g338 4 AUGUSTUS gene 1222465 1223472 0.46 + . g338 4 AUGUSTUS transcript 1222465 1223472 0.46 + . g338.t1 4 AUGUSTUS start_codon 1222465 1222467 . + 0 transcript_id "g338.t1"; gene_id "g338"; 4 AUGUSTUS CDS 1222465 1223472 0.46 + 0 transcript_id "g338.t1"; gene_id "g338"; 4 AUGUSTUS stop_codon 1223470 1223472 . + 0 transcript_id "g338.t1"; gene_id "g338"; # protein sequence = [MTLSKLSVQPNPFISPPPSLLSETRSFRRTLTRNKTSKSRLGQAVPRLMSPVKLIFENGVPSLFELCLRAFTTTSNSN # YSNNPFSSFSAANSSFPSFTPSPTKSFNSPTPNQTPTKNTPDATISFISPHVRRPKIELIYDLPPESTSFLPPSVQRRLHYAVPGSVKGYSSDVEYGD # LCQSQGRDHHSSLNDTNSISDLDEVTGVGFCPSPRHRHHGPNGLTSSLCYQHTEERFTWESTIAGVENLGEIPMRWRGCLKGCLGFLDVGDGDGEKAE # KGQTISTSIPTPIPTLGPGSDVATAGMTSSPPMDIDLDLEHAVKPVDLSGVEFTENDFDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g338 ### # start gene g339 4 AUGUSTUS gene 1224281 1225012 0.94 - . g339 4 AUGUSTUS transcript 1224281 1225012 0.94 - . g339.t1 4 AUGUSTUS stop_codon 1224281 1224283 . - 0 transcript_id "g339.t1"; gene_id "g339"; 4 AUGUSTUS CDS 1224281 1225012 0.94 - 0 transcript_id "g339.t1"; gene_id "g339"; 4 AUGUSTUS start_codon 1225010 1225012 . - 0 transcript_id "g339.t1"; gene_id "g339"; # protein sequence = [MAVPDTTTIPTPTSSTHPSTTSNPLPERRPTFPNFPLSTHITFLSGLTAVLLVPYLLFSRRIRQTTDKATRELTSLRR # DTKSIHRRVNDLELLVSNVQAGSNEVVNDLRKEIRDVRKELNSVCGIVDAERQRVDGLMSQTDQINAERELVLSLNQQATKATHDTEHLMNQFKIELN # EAKREAHDAKQLYTALHANLIELKQNLDQTRNMLQKANKLSNDKSATATAQYQSNLQFLLEEAKINR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g339 ### # start gene g340 4 AUGUSTUS gene 1225530 1226030 0.89 + . g340 4 AUGUSTUS transcript 1225530 1226030 0.89 + . g340.t1 4 AUGUSTUS start_codon 1225530 1225532 . + 0 transcript_id "g340.t1"; gene_id "g340"; 4 AUGUSTUS CDS 1225530 1226030 0.89 + 0 transcript_id "g340.t1"; gene_id "g340"; 4 AUGUSTUS stop_codon 1226028 1226030 . + 0 transcript_id "g340.t1"; gene_id "g340"; # protein sequence = [MVAQSESQSTHPPALNSTASYRISRPLLVGPSSPIYPGSPYPIRLQGPVCKGFGRGGKDLGCPTANLPDDDKGGIGTG # VQEMRGKVDTGVFYGFAKVIPPSSNDHIDHTTLPMVMSLGWNPFYKNERLTAEIHILHEFENDFYGYDMKVLVLGYIRPELDYVSRGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g340 ### # start gene g341 4 AUGUSTUS gene 1228568 1229593 0.55 - . g341 4 AUGUSTUS transcript 1228568 1229593 0.55 - . g341.t1 4 AUGUSTUS stop_codon 1228568 1228570 . - 0 transcript_id "g341.t1"; gene_id "g341"; 4 AUGUSTUS CDS 1228568 1229593 0.55 - 0 transcript_id "g341.t1"; gene_id "g341"; 4 AUGUSTUS start_codon 1229591 1229593 . - 0 transcript_id "g341.t1"; gene_id "g341"; # protein sequence = [MPSYRSDNYAYSISALVASHSQRWESLFLGRVQSFDSNNMVLSEDSFPLLRRLQVKLLEVLPLVDIPAPRLKSYSIVG # SGGLGSSITEAKLSTKLCSQITDCLISNISYKVALRVCEHLPNLCRLVLVQDLPLAFDPNSEDQIKVLPRLKELFVEQSNHPVFSYVTAVCKSITCPA # LTSLSIRVFHIDPLLKSTIKEFEKRSAFNLECLVINAWTDIYEDIQSTMTLKSLAVSELSYHRANNIFCKLKPLESATITPFPVLHQLKLHLWRMPIP # GGSYDLMENLYHCVLSRLSTANSSNHNNLSPHEVFITAPEKEARKMLDHPQLGTLRSLGMKIDIIAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g341 ### # start gene g342 4 AUGUSTUS gene 1233521 1235764 0.1 - . g342 4 AUGUSTUS transcript 1233521 1235764 0.1 - . g342.t1 4 AUGUSTUS stop_codon 1233521 1233523 . - 0 transcript_id "g342.t1"; gene_id "g342"; 4 AUGUSTUS CDS 1233521 1234145 1 - 1 transcript_id "g342.t1"; gene_id "g342"; 4 AUGUSTUS CDS 1234512 1234657 0.3 - 0 transcript_id "g342.t1"; gene_id "g342"; 4 AUGUSTUS CDS 1234725 1235175 0.32 - 1 transcript_id "g342.t1"; gene_id "g342"; 4 AUGUSTUS CDS 1235268 1235764 0.34 - 0 transcript_id "g342.t1"; gene_id "g342"; 4 AUGUSTUS start_codon 1235762 1235764 . - 0 transcript_id "g342.t1"; gene_id "g342"; # protein sequence = [MGPALSVRSKEIVAGYASMAGNSDIEQIHKEKGVNIPADASVEMCPHASAARAAARMADDLAHAAKGKEISSKAAAAA # GCPFHKAALEQTAKAAGVAPHPVPVSTASTSVSSSTRTGAYDYEAFYNTELEKKHKDKSYRYFNNINRLAHKFPVAHTAKVEDEVQVCSIPCSRTLDR # YGHGAGGTRNIAGNGAVHLGLERELATLHRKDAALIFSSCYVANDATLSTLGTKLPGCVMFSDKSNHASMIQGMRHSTAKRVIFKHNDLEDLENKLKE # YPKETPKIIAFESVYSMCGSISPISEICDLAEKYGALTFLDEVHAVGLYGPRGAGVAEHLDYEAQLAHGENPDPIPGSVMDRIDIITGQYTPGPSHIL # PVLVGDAALAKAASDKLLYDHSIYVQAINYPTVAVGEERLRITVTQRHTVEQIDKLVAAVDQVFTDLNINRIKDWKALGGRATVGVPGEDDVVEPIWT # KEQLGEETGTTPKTLRDGEKDVVDPQGVFVARSRFDHLLGPISGPLRSGYQVAAPAVTPNTTTSSAASVVPKTMKTGTKLMDFAPRARDIPVPPPSKL # SAVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g342 ### # start gene g343 4 AUGUSTUS gene 1238373 1239411 0.38 - . g343 4 AUGUSTUS transcript 1238373 1239411 0.38 - . g343.t1 4 AUGUSTUS stop_codon 1238373 1238375 . - 0 transcript_id "g343.t1"; gene_id "g343"; 4 AUGUSTUS CDS 1238373 1239282 0.66 - 1 transcript_id "g343.t1"; gene_id "g343"; 4 AUGUSTUS CDS 1239395 1239411 0.42 - 0 transcript_id "g343.t1"; gene_id "g343"; 4 AUGUSTUS start_codon 1239409 1239411 . - 0 transcript_id "g343.t1"; gene_id "g343"; # protein sequence = [MNANVSIDEEEIEKQVDELRTKLNANLKDAMPSTKRFKPSDTHAIAAAKKSELDKMARALGTRRDYTEGQAFDRERQE # QDKIKRQVEREERERRKEEDRAKMAEQKAKWDAERREKDRLRRREEDRLRREREEGGGGDSRRKQDNGSNMPPPPPPARDRSRERYRGRDRSPPRRPR # QDSRSRSPRRRSPSPLTRSSRRRSPSASRSPSRSRSPPRVRRRSVSTPRRRSGSPPSPPHGNRRDQRSVTAPSRRRRSPSDSVSPPRVRVEVKGRGRS # PSPRDSRRGRSRSRSVSSDSAMSVSTRSSSRSRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g343 ### # start gene g344 4 AUGUSTUS gene 1240239 1241351 0.49 + . g344 4 AUGUSTUS transcript 1240239 1241351 0.49 + . g344.t1 4 AUGUSTUS start_codon 1240239 1240241 . + 0 transcript_id "g344.t1"; gene_id "g344"; 4 AUGUSTUS CDS 1240239 1240898 0.49 + 0 transcript_id "g344.t1"; gene_id "g344"; 4 AUGUSTUS CDS 1240971 1241351 1 + 0 transcript_id "g344.t1"; gene_id "g344"; 4 AUGUSTUS stop_codon 1241349 1241351 . + 0 transcript_id "g344.t1"; gene_id "g344"; # protein sequence = [MISTSLFQSQSVSPSNPPATSPPPAVMLHGYGAGLGFYFNNFLPMAQWAARHNSSVYALDWLGMGRSSRPPFHIKASK # KDIPARVAEAESFFVDSLEDWRQQMHLEKMTLIGHSLGAYFSVVYALKYPQRVERLILLSPAGVPRGPDHTVPSSEVDPPTTTSSEDRAELASNAKVE # QVEANQRTAKAKESRSRRILTHLWEEGFSPFQVVRTMGVWAPWMYSSRRFSTLSEEETRDMHDYILNITLAKGSGEYCISHILAPGAHARMPLVDRIA # ALHKDIPVTFAYGDQDWMDPEGGAESVERLRQAGHGQGKMYIVNNAGHHGKHSSTRVLKMTLSTVSSCSIPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g344 ### # start gene g345 4 AUGUSTUS gene 1243127 1243327 0.58 + . g345 4 AUGUSTUS transcript 1243127 1243327 0.58 + . g345.t1 4 AUGUSTUS start_codon 1243127 1243129 . + 0 transcript_id "g345.t1"; gene_id "g345"; 4 AUGUSTUS CDS 1243127 1243327 0.58 + 0 transcript_id "g345.t1"; gene_id "g345"; 4 AUGUSTUS stop_codon 1243325 1243327 . + 0 transcript_id "g345.t1"; gene_id "g345"; # protein sequence = [MATAARKSLTIGLIPADGIGKEVIPAARTAIEALGSDIPTPKFVDLIAGFETFTRTGVALPEETVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g345 ### # start gene g346 4 AUGUSTUS gene 1247752 1249272 0.98 + . g346 4 AUGUSTUS transcript 1247752 1249272 0.98 + . g346.t1 4 AUGUSTUS start_codon 1247752 1247754 . + 0 transcript_id "g346.t1"; gene_id "g346"; 4 AUGUSTUS CDS 1247752 1249272 0.98 + 0 transcript_id "g346.t1"; gene_id "g346"; 4 AUGUSTUS stop_codon 1249270 1249272 . + 0 transcript_id "g346.t1"; gene_id "g346"; # protein sequence = [MSQRPLRRQKPIGHGGFPDEHLSTKAGSSPAAWPSASLAAATAWGTNVSHESHPMKTAVKEQKSSTASKSVNWAGGWG # GNDAGWGGGAADGWGGGIPEEDEEDEEYGDEEWDEEEEQEWEQEEPGWGPTTNASSWGVQPSTSKPSKSQPTQPGWKSWGKEVSHLSKVPSIAATTPV # VGPSKPNLSHQQHTQILNSLLSQPSSQNGYLAAAQQQQKLRQQQPAVNPYHQKPMPHPKQTAGAFAAAPPSQWPSNSKKEKKSQNEPSRHQRSQSEYQ # DTWGAASTGIWGKDSSGKGNDTGVRAKDYGGWGQDSVGWENDAGGRSKDVGDWGEDSIGWENGAGEWGTASGWGPIPEEDEEDYEEDDRRVHFTPRSS # KGGGGWGSESFAPSFRGSESSKVSIANLWGSDKPRDTSYTMPSKTLAHAYNGTTTSLNTGLPRNKINEYTNVQFHDSKGAALMPAQQALFGRARKAKD # RIHWMFPPNKDERVESLLTWIETVSRDLGTYGVSPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g346 ### # start gene g347 4 AUGUSTUS gene 1254979 1256521 0.17 + . g347 4 AUGUSTUS transcript 1254979 1256521 0.17 + . g347.t1 4 AUGUSTUS start_codon 1254979 1254981 . + 0 transcript_id "g347.t1"; gene_id "g347"; 4 AUGUSTUS CDS 1254979 1255161 0.31 + 0 transcript_id "g347.t1"; gene_id "g347"; 4 AUGUSTUS CDS 1255288 1255752 0.5 + 0 transcript_id "g347.t1"; gene_id "g347"; 4 AUGUSTUS CDS 1255808 1256521 0.87 + 0 transcript_id "g347.t1"; gene_id "g347"; 4 AUGUSTUS stop_codon 1256519 1256521 . + 0 transcript_id "g347.t1"; gene_id "g347"; # protein sequence = [MCRERYLETIKAKGQVNKGKAKAKAEDDDGNSGQETEGDEPREAIARSEWTKEEDEELVRMCRIRYKKLKNSTLSTDT # NRGSHPVSITNDQPSKPSAPPPPDLSPNAYLSLAPSGSRHALSFITSDSHPPILQLAPTSIAQSSTSPNVSVAQPSESSLALAKPRPKPKSKAKTNVP # PQSMTSHTNTTHNSHDNEQQPFSSNSAVVTSSVISSSATAPPRPARKRPSHRRAAVLSTAITENLETLQPTRGVTSVLSQAQIRGWEAEGHSSIESQV # TGWGAEKGWEAGPQVSEREADGLVQGWEGEGRVRELEANTNPALKIITGAAAEVMSDIEGPDPSERAGSHSLATGSPLSRKRRREELSDTMSLTPSKN # TVSVQNKNSSETGVESATNIEHGIGNTSTPQRRPARKKERSRKSTADWSVVPVSPTTRSLPSTPASGSSTLRRSTRLAGKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g347 ### # start gene g348 4 AUGUSTUS gene 1258905 1259654 0.63 - . g348 4 AUGUSTUS transcript 1258905 1259654 0.63 - . g348.t1 4 AUGUSTUS stop_codon 1258905 1258907 . - 0 transcript_id "g348.t1"; gene_id "g348"; 4 AUGUSTUS CDS 1258905 1259654 0.63 - 0 transcript_id "g348.t1"; gene_id "g348"; 4 AUGUSTUS start_codon 1259652 1259654 . - 0 transcript_id "g348.t1"; gene_id "g348"; # protein sequence = [MSQYFDIYIVILDSKVLVGLCMLSFRFPKMDIDPNIRHSDILNAIISVGHLVPEEPTGNKEQEQYSLPSALDTPVSYP # NAFKLPGHHPSRSNHLGPTEPVSASEFILPFHTRELGEGESSLYSSPDLYGQVSSTSSLTDAIPWTACPEITNGVVIHDVAAPHATSSQAEQYDPKVV # EFYNQYGMQGVIASVESYSSPFHTHTGLLPGMEIQHLDPGRSGIQNDLTVPRPRWNDSSDNYWGPDSRPSPDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g348 ### # start gene g349 4 AUGUSTUS gene 1264202 1264783 0.99 - . g349 4 AUGUSTUS transcript 1264202 1264783 0.99 - . g349.t1 4 AUGUSTUS stop_codon 1264202 1264204 . - 0 transcript_id "g349.t1"; gene_id "g349"; 4 AUGUSTUS CDS 1264202 1264783 0.99 - 0 transcript_id "g349.t1"; gene_id "g349"; 4 AUGUSTUS start_codon 1264781 1264783 . - 0 transcript_id "g349.t1"; gene_id "g349"; # protein sequence = [MSLSNDEVVATHEKKQRKEKVQKAKKAKSDESDFRPAENIVRKKVADIIEMEIDRKKKKKKEKKDKDKDKDKDKEPVV # DLEGAKEIKSFIQGAPEIEMVKQAEGEFEVISEKNKEGKRKGRERRRNSELDSEGAPTARRNKRKREESENADTEDMQGEDSKKKKPRNNTGFPDPVE # EALLSDQARLGQFVPIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g349 ### # start gene g350 4 AUGUSTUS gene 1266390 1267013 0.96 + . g350 4 AUGUSTUS transcript 1266390 1267013 0.96 + . g350.t1 4 AUGUSTUS start_codon 1266390 1266392 . + 0 transcript_id "g350.t1"; gene_id "g350"; 4 AUGUSTUS CDS 1266390 1267013 0.96 + 0 transcript_id "g350.t1"; gene_id "g350"; 4 AUGUSTUS stop_codon 1267011 1267013 . + 0 transcript_id "g350.t1"; gene_id "g350"; # protein sequence = [MLSSVRSAAKHGCRRLLGGYSGYATPSQPFNPLYPSVSAQSWPSSANGLMDELDHPPSAEGGYSRAHLTPKALGEDST # HMPPGRIPQYKLHCFSSRNNTIVTFTDPRGNPIAWYSGGSCGFKRGQRASYEAGYQCAVRIFKIIENTAATKGMVRIALFFNGFGQGRDAMQKALMTS # EGGNVKVLVEVVGDRTPIKIGGTRSKKMRRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g350 ### # start gene g351 4 AUGUSTUS gene 1271477 1272580 0.99 + . g351 4 AUGUSTUS transcript 1271477 1272580 0.99 + . g351.t1 4 AUGUSTUS start_codon 1271477 1271479 . + 0 transcript_id "g351.t1"; gene_id "g351"; 4 AUGUSTUS CDS 1271477 1272580 0.99 + 0 transcript_id "g351.t1"; gene_id "g351"; 4 AUGUSTUS stop_codon 1272578 1272580 . + 0 transcript_id "g351.t1"; gene_id "g351"; # protein sequence = [MTYVTSLPGTTADSYRPSDSTASTLDHSASFTTEAQSPLNQNLNIQDSASESSSLSVLTLSPVLNPENVDHSLHDARD # PNSSSLSHILSTDFEAHPTSNAPNFTDKYSSPPSPQLSPDTLSEGRSSFVEDSIAMNSSRLTGQQLQIFNLPSSTTSREALIFSLSSPSATVPAIKSL # SVNEIMLPEGYNNPDLYQNAHRDYPTMEPPSIGSQRLSVTTNFSLELSPHSPPSAPRPALMTLPNSGPEHDIPAIGALTSMHNLLTSLSQDQISGPTF # NTKNDAQEDESGYAHCKSGPEYSTLEPMLPSSSPDNTVLTSSSPPNSSPPQLFSSSPSGTPTTMPMSIVTERRSPPPVGPFKVHLAEIDSKML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g351 ### # start gene g352 4 AUGUSTUS gene 1273169 1273987 0.75 + . g352 4 AUGUSTUS transcript 1273169 1273987 0.75 + . g352.t1 4 AUGUSTUS start_codon 1273169 1273171 . + 0 transcript_id "g352.t1"; gene_id "g352"; 4 AUGUSTUS CDS 1273169 1273987 0.75 + 0 transcript_id "g352.t1"; gene_id "g352"; 4 AUGUSTUS stop_codon 1273985 1273987 . + 0 transcript_id "g352.t1"; gene_id "g352"; # protein sequence = [MLPAPKRSTIASHRRQHRKLATPFKSPLMTKQANLDAQGKVLMGPPVVPADKPSITMFEAGQSHASAPPSTRVLSPTN # STKRRFTVTARAAAQFKSPLSFISMANSSPSLPQVRLTPNMQSLERKIQILKRALKVKKDNEEKILADLTARWTEAGREVAWEVWELVKNNGDSPNAH # GSSSLGSKRALNDSWGWDVQGDQKRVKSEDSWGWSTADQTRETDETVILQDENAKPKIEDEEEERIEYTLGTMLRRLGIDPATLGWDDGNCVFEDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g352 ### # start gene g353 4 AUGUSTUS gene 1275843 1278694 0.31 - . g353 4 AUGUSTUS transcript 1275843 1278694 0.31 - . g353.t1 4 AUGUSTUS stop_codon 1275843 1275845 . - 0 transcript_id "g353.t1"; gene_id "g353"; 4 AUGUSTUS CDS 1275843 1278467 0.32 - 0 transcript_id "g353.t1"; gene_id "g353"; 4 AUGUSTUS CDS 1278538 1278580 0.55 - 1 transcript_id "g353.t1"; gene_id "g353"; 4 AUGUSTUS CDS 1278651 1278694 0.55 - 0 transcript_id "g353.t1"; gene_id "g353"; 4 AUGUSTUS start_codon 1278692 1278694 . - 0 transcript_id "g353.t1"; gene_id "g353"; # protein sequence = [MFYEEFAVQNLALGLLSSLQEQLSRFLLQIAVKSVDFYVGPQFGQGFFESCKDVKFDASNGYAMDFIGGGAKNYHDFF # RFLGEEKDLGSPFQINFPSTSTPSFTPLSPSPRNCSDNDLASRCTCIDCPSICPVLPDLPDVGSACHVGLLSCLSFTLILTYSIAVVGFILGFLIQGT # IRKRRERRYERLALSGETPTSPRALVGAASLDDHHADLARGLIDPVETVQPKQYKLNTLLRKSFYKLGFNTATYPMLTCAVVFTFIGLINIGWTKFDI # ETDPVRLWVAPNSETRVQKDFFDEHFGPFYRPQQIFITSTDQENHPVLSFEHLQYVSELEKHIRHKLVSLPNNLTLNDVCFSPAGPGSPCVVQSVMGW # FGGSLDGYDENTYKDRIERCARSPVECLPDFGQPLAPHYVLGGTRDANLNTYLDAPALVMTAVLSSSLSPPDPEQQQTFERAAEEWERTLRVFLEEVK # IRAPTEAGLNVDFSTGVSLEEEIGKEGNTDVRVVVGSYIAMFLYVGLTLGGGGSGPSSTRRASPNNTNRWRLHWRAAISWIRSYTLTSHTLLALFSLV # LVLLSISTSVALFSLMGVKVTLVIAEVIPFLVLAVGVDNVFLLMGELERVDAVHGLYAGNSNVLNGPGNWGHRGRGNERNAAADEDDGIAENGDAEAR # MMSPTRTTHSSRHFPNPSRHNHHTSSLSSYSSAPSSAYPNPSYLPPPARIALTLSLIGPSILLSTLAESVAFLLGALVPMPAVRNFALYAAGGVMINA # LLQVCLLAGVGMGLDARRIEAGRVDCIPCISLPGQISLPGDEDDRDTLNEQQTSPDRSNFNSDHGPSYGAFGAYGESLTRGGSVSGSGPPGWLGKFFR # RYYAPFLLRPVVKAVVLIVFGGIFVASIIGMQGIELGLGES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g353 ### # start gene g354 4 AUGUSTUS gene 1282752 1283810 0.28 - . g354 4 AUGUSTUS transcript 1282752 1283810 0.28 - . g354.t1 4 AUGUSTUS stop_codon 1282752 1282754 . - 0 transcript_id "g354.t1"; gene_id "g354"; 4 AUGUSTUS CDS 1282752 1282764 0.62 - 1 transcript_id "g354.t1"; gene_id "g354"; 4 AUGUSTUS CDS 1282824 1282974 0.43 - 2 transcript_id "g354.t1"; gene_id "g354"; 4 AUGUSTUS CDS 1283147 1283810 0.32 - 0 transcript_id "g354.t1"; gene_id "g354"; 4 AUGUSTUS start_codon 1283808 1283810 . - 0 transcript_id "g354.t1"; gene_id "g354"; # protein sequence = [MGRGSTASSGGSHYYGSQPGSVVGFGSGNANLDGYGGGHGRNYGAYSGDYNRGYENSYGQGGRSNKVDDGGYIAGHNM # SFGRSLSGVQGYGEGYREGYRGGYTGGYGGGYGGEYGGGYGGGYRGDYGGGYGGGFRSGYGGGYEYRRDGSTFSHADGVNMEALIGVHKEVSYASSSV # DNTPSQEQSQMSFHSEGTGSKATKGMCFFLIFEYESLQPPLRYPKEEDFINEELAEFEHDRYADDEDDENADAEDEDANNNGEDVTLTSREYKCRYTP # I] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g354 ### # start gene g355 4 AUGUSTUS gene 1288387 1288950 0.51 + . g355 4 AUGUSTUS transcript 1288387 1288950 0.51 + . g355.t1 4 AUGUSTUS start_codon 1288387 1288389 . + 0 transcript_id "g355.t1"; gene_id "g355"; 4 AUGUSTUS CDS 1288387 1288950 0.51 + 0 transcript_id "g355.t1"; gene_id "g355"; 4 AUGUSTUS stop_codon 1288948 1288950 . + 0 transcript_id "g355.t1"; gene_id "g355"; # protein sequence = [MALNVNGNANGNANVRVNGNANGNANMSVDGNANVSANVKASSTPNATSSPNASANPNASSNQNASSSPNTSSNPSST # SNPNASVDAWVNMDARVNQDDARANIDENVNSNASASANVSANVDANASTNVDAIVIMKEDAVANVDMVAIAEVDMVAIAKVDVVAIAKVDVRARVDG # TGKNKRLKMGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g355 ### # start gene g356 4 AUGUSTUS gene 1290929 1291558 1 + . g356 4 AUGUSTUS transcript 1290929 1291558 1 + . g356.t1 4 AUGUSTUS start_codon 1290929 1290931 . + 0 transcript_id "g356.t1"; gene_id "g356"; 4 AUGUSTUS CDS 1290929 1291558 1 + 0 transcript_id "g356.t1"; gene_id "g356"; 4 AUGUSTUS stop_codon 1291556 1291558 . + 0 transcript_id "g356.t1"; gene_id "g356"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY # PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g356 ### # start gene g357 4 AUGUSTUS gene 1397456 1398980 0.22 - . g357 4 AUGUSTUS transcript 1397456 1398980 0.22 - . g357.t1 4 AUGUSTUS stop_codon 1397456 1397458 . - 0 transcript_id "g357.t1"; gene_id "g357"; 4 AUGUSTUS CDS 1397456 1397732 0.22 - 1 transcript_id "g357.t1"; gene_id "g357"; 4 AUGUSTUS CDS 1397880 1398024 0.78 - 2 transcript_id "g357.t1"; gene_id "g357"; 4 AUGUSTUS CDS 1398149 1398980 0.96 - 0 transcript_id "g357.t1"; gene_id "g357"; 4 AUGUSTUS start_codon 1398978 1398980 . - 0 transcript_id "g357.t1"; gene_id "g357"; # protein sequence = [MFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKK # KFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSR # ITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDNFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVF # VGIYESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKERQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLS # SWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKTC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g357 ### # start gene g358 4 AUGUSTUS gene 1399481 1401309 0.2 - . g358 4 AUGUSTUS transcript 1399481 1401309 0.2 - . g358.t1 4 AUGUSTUS stop_codon 1399481 1399483 . - 0 transcript_id "g358.t1"; gene_id "g358"; 4 AUGUSTUS CDS 1399481 1400197 0.99 - 0 transcript_id "g358.t1"; gene_id "g358"; 4 AUGUSTUS CDS 1400251 1400530 0.62 - 1 transcript_id "g358.t1"; gene_id "g358"; 4 AUGUSTUS CDS 1400586 1400878 0.47 - 0 transcript_id "g358.t1"; gene_id "g358"; 4 AUGUSTUS CDS 1401079 1401309 0.49 - 0 transcript_id "g358.t1"; gene_id "g358"; 4 AUGUSTUS start_codon 1401307 1401309 . - 0 transcript_id "g358.t1"; gene_id "g358"; # protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTQ # NIVLDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNEQFNLNPIKSFFLQMEGSSLNPL # GENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADQDRSPI # NLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLW # EQERELMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRL # VHSLEPLNKVTIQHSGVPLPATADLVGGNLRFICWI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g358 ### # start gene g359 4 AUGUSTUS gene 1401369 1402367 0.8 - . g359 4 AUGUSTUS transcript 1401369 1402367 0.8 - . g359.t1 4 AUGUSTUS stop_codon 1401369 1401371 . - 0 transcript_id "g359.t1"; gene_id "g359"; 4 AUGUSTUS CDS 1401369 1402367 0.8 - 0 transcript_id "g359.t1"; gene_id "g359"; 4 AUGUSTUS start_codon 1402365 1402367 . - 0 transcript_id "g359.t1"; gene_id "g359"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRSLKKPSVTIE # DVDEPDDEDTIKLIPSSRPTNQINNEHRPYDHVQPRTYCPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DEQRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEELKVYWTKVHRLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g359 ### # start gene g360 4 AUGUSTUS gene 1402397 1403005 0.6 - . g360 4 AUGUSTUS transcript 1402397 1403005 0.6 - . g360.t1 4 AUGUSTUS stop_codon 1402397 1402399 . - 0 transcript_id "g360.t1"; gene_id "g360"; 4 AUGUSTUS CDS 1402397 1403005 0.6 - 0 transcript_id "g360.t1"; gene_id "g360"; 4 AUGUSTUS start_codon 1403003 1403005 . - 0 transcript_id "g360.t1"; gene_id "g360"; # protein sequence = [MKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNKFERNTTPRSSNGTQWACFLCKSTD # HFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELS # DRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g360 ### # start gene g361 4 AUGUSTUS gene 1403059 1405384 0.41 - . g361 4 AUGUSTUS transcript 1403059 1405384 0.41 - . g361.t1 4 AUGUSTUS stop_codon 1403059 1403061 . - 0 transcript_id "g361.t1"; gene_id "g361"; 4 AUGUSTUS CDS 1403059 1404365 0.58 - 2 transcript_id "g361.t1"; gene_id "g361"; 4 AUGUSTUS CDS 1405369 1405384 0.62 - 0 transcript_id "g361.t1"; gene_id "g361"; 4 AUGUSTUS start_codon 1405382 1405384 . - 0 transcript_id "g361.t1"; gene_id "g361"; # protein sequence = [MTNDRRKPRTSKNSEKAGILTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDLEEDRIELIAPESISTSSTSIESTRLIDTLHQTISPTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIQGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g361 ### # start gene g362 4 AUGUSTUS gene 1406309 1408192 0.34 + . g362 4 AUGUSTUS transcript 1406309 1408192 0.34 + . g362.t1 4 AUGUSTUS start_codon 1406309 1406311 . + 0 transcript_id "g362.t1"; gene_id "g362"; 4 AUGUSTUS CDS 1406309 1407311 0.71 + 0 transcript_id "g362.t1"; gene_id "g362"; 4 AUGUSTUS CDS 1407462 1407478 0.56 + 2 transcript_id "g362.t1"; gene_id "g362"; 4 AUGUSTUS CDS 1407529 1407566 0.52 + 0 transcript_id "g362.t1"; gene_id "g362"; 4 AUGUSTUS CDS 1407775 1408192 0.68 + 1 transcript_id "g362.t1"; gene_id "g362"; 4 AUGUSTUS stop_codon 1408190 1408192 . + 0 transcript_id "g362.t1"; gene_id "g362"; # protein sequence = [MHSHSHSDSHSRSHSDSRSHLDLDSRSHSNLDSRLHSNLDSHSRSHSSPRSRLDLDLDSCSRSHSRSRSRSDLDSHLR # SHSSPRSRSDSCSRSRSHSDLVSHLEPHLEPRSEPQPKRKRRRSQKTKVNSTDLTSGGPSDPTFIHCPRKSVRTRKRRRIDQYSYDDSTAGRFAVGDH # AAQPSRDVSVDLTKQLARLSFGTRTSIGHEDYLSWVSDLKGMIEGTIDNVKDLAVSSLVSIARRCDLAANVDGTARFVRMLHELYFSAKVNRYVWSYH # VLRRLGLTCYSRLNLMKFKDNSRRPKPSEVYKSLQTHSIPEHKSRDYMSAGSRWAFLANAECLIHQELREKLLGLTSYRSLPRDWEAWKQFDVSMKSE # RTLLSTSPLERRFLFFSPEQTGAAQHASAVSELSSEEETFTPPPTVPPISILFDRMGFQSQDSEGIHQVLFTPYKPAKTKEPFPLDYQGRSKWTENER # SLAQDCVTPDSLESYASKVGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g362 ### # start gene g363 4 AUGUSTUS gene 1408690 1409247 0.8 + . g363 4 AUGUSTUS transcript 1408690 1409247 0.8 + . g363.t1 4 AUGUSTUS start_codon 1408690 1408692 . + 0 transcript_id "g363.t1"; gene_id "g363"; 4 AUGUSTUS CDS 1408690 1409247 0.8 + 0 transcript_id "g363.t1"; gene_id "g363"; 4 AUGUSTUS stop_codon 1409245 1409247 . + 0 transcript_id "g363.t1"; gene_id "g363"; # protein sequence = [MNHSQLLVHPSEDIQKFSEPFKDLKQSLEETLRWVSEKVSETSLHELLCISNVSLKVLQIHPDTFHEICATVDLLPLQ # DTSPASPFTSIVFNINVSTLAHRDKNDKSACICITVGNPQGGELGLYEPKLLLETCNGDVVVFHSDRYTHFNLPYSGTRGSIVIHADKTGVSYQKDGF # GWFDNIYFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g363 ### # start gene g364 4 AUGUSTUS gene 1409791 1410027 0.45 + . g364 4 AUGUSTUS transcript 1409791 1410027 0.45 + . g364.t1 4 AUGUSTUS start_codon 1409791 1409793 . + 0 transcript_id "g364.t1"; gene_id "g364"; 4 AUGUSTUS CDS 1409791 1410027 0.45 + 0 transcript_id "g364.t1"; gene_id "g364"; 4 AUGUSTUS stop_codon 1410025 1410027 . + 0 transcript_id "g364.t1"; gene_id "g364"; # protein sequence = [MLLSLDNSVGACPATPNTPPSMELDYNDTYDDEDDICEPWEDEVKPHPPTTDGGKDQNTEICYFDEGCLFLPFVCFPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g364 ### # start gene g365 4 AUGUSTUS gene 1411234 1412256 0.18 + . g365 4 AUGUSTUS transcript 1411234 1412256 0.18 + . g365.t1 4 AUGUSTUS start_codon 1411234 1411236 . + 0 transcript_id "g365.t1"; gene_id "g365"; 4 AUGUSTUS CDS 1411234 1411734 0.19 + 0 transcript_id "g365.t1"; gene_id "g365"; 4 AUGUSTUS CDS 1411999 1412256 0.75 + 0 transcript_id "g365.t1"; gene_id "g365"; 4 AUGUSTUS stop_codon 1412254 1412256 . + 0 transcript_id "g365.t1"; gene_id "g365"; # protein sequence = [MGRGSTASSGGSHYYGSQPGPVVGFGSGNANLDGYGGGHGRNYGAYSGDYNRGYENSYGQGGRSDKVDDGGYIAGHNM # SFGRSLSGVQGYGEGYPGVDGGGYRGDILVDMEVDTEVNMEVDTEVNMEVDTEANMEGDTEGDTEVDTEVDTEVDTNIGGMVPPFLMQMVEGETEVLK # KRKRNLPKPPNLAILKIHSKSHVPTTEEDFINEELAEFEHDRYADDEDDENADAEDEDADNNGEDVTLTSREYKRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g365 ### # start gene g366 4 AUGUSTUS gene 1420483 1421127 0.76 - . g366 4 AUGUSTUS transcript 1420483 1421127 0.76 - . g366.t1 4 AUGUSTUS stop_codon 1420483 1420485 . - 0 transcript_id "g366.t1"; gene_id "g366"; 4 AUGUSTUS CDS 1420483 1421127 0.76 - 0 transcript_id "g366.t1"; gene_id "g366"; 4 AUGUSTUS start_codon 1421125 1421127 . - 0 transcript_id "g366.t1"; gene_id "g366"; # protein sequence = [MKIVRAIRQGRILPNRTKNTSQPLFYSIWGDSSSSNAPPLPAPKPSLPTNSESYNPPEEYLPTEEDKKQWEETDPEDR # EHDYLPQKYSALRLVPGYERFIKDRFNRQLDLYMAPRVQRVKLNIDPNSLIPKLPSPSSLKPFPTYKSLQVVHTHIARCISVSPDGAWVVSGDEGGVV # RLWEVNVGREVRKWKFDGKIGSIEWCPRTDVSYFVVGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g366 ### # start gene g367 4 AUGUSTUS gene 1421628 1422038 0.89 - . g367 4 AUGUSTUS transcript 1421628 1422038 0.89 - . g367.t1 4 AUGUSTUS stop_codon 1421628 1421630 . - 0 transcript_id "g367.t1"; gene_id "g367"; 4 AUGUSTUS CDS 1421628 1422038 0.89 - 0 transcript_id "g367.t1"; gene_id "g367"; 4 AUGUSTUS start_codon 1422036 1422038 . - 0 transcript_id "g367.t1"; gene_id "g367"; # protein sequence = [MTIQARSSKKRKQHGQDESADTFNEAVNLEMFSDEEDREDVDSDNGEVDEFPEIDAGSDESGEEDETYESEEDTGASE # EGSSSGSQEQLHIFPEAKTIVSDITGQEKRVYPEIEPDYDSDSSTEDVGSAALFQDII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g367 ### # start gene g368 4 AUGUSTUS gene 1425424 1426449 0.96 - . g368 4 AUGUSTUS transcript 1425424 1426449 0.96 - . g368.t1 4 AUGUSTUS stop_codon 1425424 1425426 . - 0 transcript_id "g368.t1"; gene_id "g368"; 4 AUGUSTUS CDS 1425424 1426449 0.96 - 0 transcript_id "g368.t1"; gene_id "g368"; 4 AUGUSTUS start_codon 1426447 1426449 . - 0 transcript_id "g368.t1"; gene_id "g368"; # protein sequence = [MLAQAQRQQQAQNRRSSLGFNPPATAGPLSTGFDIRAATLNAQMRRANQAEQQAQLGVGSDEHVPMTAALGGKFGSRN # ISLNVPNSVMARYDDGSEATLPPTPSSTTVISGGTSLGHPSSNNISGSTTQSKSDSATSWRRGGGKGNSVLANRSVTSPAVKVTPPPSEGTPPPPGAA # FSAAVTASKFRPQPLRFSVVAQQPLPSVTIDTSEVNDNDDSSSTSSDKSVGSHSSPTTPHSSSSNEMSLSLREEASKKLYEGLGIGRPASAVSNKDAP # SQQYAEALSNLGSHRMVSQPLRQPRGPPSGLDELQPKNFATRIRRQAIGGLGMLMDARERRDIVEVY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g368 ### # start gene g369 4 AUGUSTUS gene 1431401 1433005 0.93 + . g369 4 AUGUSTUS transcript 1431401 1433005 0.93 + . g369.t1 4 AUGUSTUS start_codon 1431401 1431403 . + 0 transcript_id "g369.t1"; gene_id "g369"; 4 AUGUSTUS CDS 1431401 1433005 0.93 + 0 transcript_id "g369.t1"; gene_id "g369"; 4 AUGUSTUS stop_codon 1433003 1433005 . + 0 transcript_id "g369.t1"; gene_id "g369"; # protein sequence = [MAGFTKKLTADRSQAAVNSLIMYSSGTPRIFISLISQISKEKNVQARNFAMGHFKAYIDIHGHRAKSAIESFGGVDIL # ESAIKKSLGDPNAGVKAAARAAFWSFNEIWRERGVAILETLTPLARKEVEKVCPNPELALSLPPTTPKPAKKSSVAAAIAASRAKAKAIATAPPSLRH # QATSASHIAPARRSASPSLSKSTSRSPPSRPSSPLRTSTGPSPPRSRIISNTMPRSISTTAITPSTSRPVPRSDSPPSPPSPVSDSFSRRLSSPLATG # ISPTRPTTIRRAMQTTLPASPHSTESPPHRSVSRVQPAFAAAAARMSSLMPTLNGSDEDSLLLATAIPLPDGDSDSDEHSINLMSFSAPYEIHHLPPA # SDSQVHSVSPNSADLNPIIGVSNALSTDSVTELAQGGGAPVVEDALRARAEQAESAAERLLELVEPEDDIPHPILPPSLLVGSPVSNGLSTPGKSKPP # PVSVAQFPVTPKNRASIVMRQAALFQDSPAYNGRAPSLLDVLQDRSKETGWWLKRKTCKNSPHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g369 ### # start gene g370 4 AUGUSTUS gene 1434368 1435528 1 + . g370 4 AUGUSTUS transcript 1434368 1435528 1 + . g370.t1 4 AUGUSTUS start_codon 1434368 1434370 . + 0 transcript_id "g370.t1"; gene_id "g370"; 4 AUGUSTUS CDS 1434368 1435528 1 + 0 transcript_id "g370.t1"; gene_id "g370"; 4 AUGUSTUS stop_codon 1435526 1435528 . + 0 transcript_id "g370.t1"; gene_id "g370"; # protein sequence = [MTTYTARPDNLDWKKNPHVNFRRSNSSITSSRQELLYELLSGIQADEDSARLLLQTYDIDEECDSEDENAFTPQTPLR # PVEDLNPPHETNAPQDSAAFNSPLRPSHSENPFLSTPLRVKYFPNLSPSILRQLLRSPSPNFYSSDGSFEAVSASPLSLSIPSSLELQNVRKTSCANP # QAGGPSSLIYPLTPPLTARIPCTDSHETPVRMLRSPLYLDVVSTPGLHIEGVDLDSVPDIRACLSSMTPFTAIESHQNRRQRQLFMNSAADPSAVFTT # TPNSQCVIQGIRAKTASGVKAVPLAETTASFGLPSTPASPLLQTSRTARISQNRRTPKPGRVLQREFVELLEARAMEEEKMAQVLDMMAKRLERLALQ # RRRLVALLIKETRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g370 ### # start gene g371 4 AUGUSTUS gene 1436912 1437516 0.82 - . g371 4 AUGUSTUS transcript 1436912 1437516 0.82 - . g371.t1 4 AUGUSTUS stop_codon 1436912 1436914 . - 0 transcript_id "g371.t1"; gene_id "g371"; 4 AUGUSTUS CDS 1436912 1437396 0.95 - 2 transcript_id "g371.t1"; gene_id "g371"; 4 AUGUSTUS CDS 1437465 1437516 0.86 - 0 transcript_id "g371.t1"; gene_id "g371"; 4 AUGUSTUS start_codon 1437514 1437516 . - 0 transcript_id "g371.t1"; gene_id "g371"; # protein sequence = [MQSSQTTELQRLRWPVHVEVRLKSRSTSRFETIRTHVQAWITSFDRINLSSSLDGWEDVPELAASVERIVTSESACPS # QSLSVDEMALQIHVYQPCESDAFEEFSNSTNEDDDETMAATVRELPNRSWEGLWDSLIYEDNIKLKLLDYIHATLVFSDAEVDCKFLYIFIMLEGYSN # IR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g371 ### # start gene g372 4 AUGUSTUS gene 1439163 1440806 0.81 - . g372 4 AUGUSTUS transcript 1439163 1440806 0.81 - . g372.t1 4 AUGUSTUS stop_codon 1439163 1439165 . - 0 transcript_id "g372.t1"; gene_id "g372"; 4 AUGUSTUS CDS 1439163 1440806 0.81 - 0 transcript_id "g372.t1"; gene_id "g372"; 4 AUGUSTUS start_codon 1440804 1440806 . - 0 transcript_id "g372.t1"; gene_id "g372"; # protein sequence = [MARPVPGHIHEDRFQNVIRNILSIGYTPSREDYHFILGQFAAVGHSIGSMGVYNEMRGNKGCLPNNVTIALVLQSIAH # RLGLPERKVDRQETANRARGLLKQILDDMRSRGIPWTNTNMDLTIRIMKYTSDEENFDTLLKLGYGIDLRYPDRPVLDDQSSALLPFTLHTLNTVINM # YGLGGNLSKLVQAFEVLTVPLPHAQKHFSASFEDEDDFGIVPPESSLSFRFPSAEPNTTTYTFLLRQISQHNKAHLARHYLLQAIKHDIEVSRDLRRK # VITTPNLEDVQAPRIAINRAMLVPVFGLSNRNKNVSLMRWLHDRIPSIIRRKKADILHFSNFIKHLERVGKWPPPPKPKSYHTTRRVPVSTSKDYIDV # DGVRWHRADVEDVLAVDPSIQQPVPVYTVKPIDLRLHLRILKTDVNDLTVYYGYVRSVLARTIERVKDKLGRRVWRGRNIYLKDVTLAGGTAAHPKSR # MKVSKDTWRQIVGYKPKLKTGFARPPSHFHHKVIRHQYWREVKSIREEQAKGSSAGHFTRSGQTSMLKPPGEKGREC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g372 ### # start gene g373 4 AUGUSTUS gene 1441934 1442839 0.9 - . g373 4 AUGUSTUS transcript 1441934 1442839 0.9 - . g373.t1 4 AUGUSTUS stop_codon 1441934 1441936 . - 0 transcript_id "g373.t1"; gene_id "g373"; 4 AUGUSTUS CDS 1441934 1442839 0.9 - 0 transcript_id "g373.t1"; gene_id "g373"; 4 AUGUSTUS start_codon 1442837 1442839 . - 0 transcript_id "g373.t1"; gene_id "g373"; # protein sequence = [MYGRLYIPTGRLDALYSTRLSANLQGIVAAISDPPSPLSAQANVSNLMLSLQHDVGKWCTEYTYSAEDSMWGIKALHN # FGRIAGSGNAADSSQTPTRVGLKRIDEEDAVEGGLRGRLSAGAEIYLSAKEKSAGGNFYHPSCSRGLTYSLKVSTGIRFSTIPEAKTPSTGGSTSIII # PPQPPTTITALFNPMLGHLSGAYSARVSPDLALSSRFDFNVYSYESEWTMGAEYWLRRDNDPDSELSSPAVESSKKRIHGVVKARASTNNVCTCSTIQ # FTAALNAAPLLSGCRNSLGRPNAKYAH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g373 ### # start gene g374 4 AUGUSTUS gene 1443049 1443282 0.69 + . g374 4 AUGUSTUS transcript 1443049 1443282 0.69 + . g374.t1 4 AUGUSTUS start_codon 1443049 1443051 . + 0 transcript_id "g374.t1"; gene_id "g374"; 4 AUGUSTUS CDS 1443049 1443282 0.69 + 0 transcript_id "g374.t1"; gene_id "g374"; 4 AUGUSTUS stop_codon 1443280 1443282 . + 0 transcript_id "g374.t1"; gene_id "g374"; # protein sequence = [MYPTEPFNDGIAFIEYVVLNKALGDLDIERCSPFGTLKSRMAVAEGEWLPSEAYARIPSEERVKLVNRLSSFHPVAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g374 ### # start gene g375 4 AUGUSTUS gene 1448282 1450114 0.67 + . g375 4 AUGUSTUS transcript 1448282 1450114 0.67 + . g375.t1 4 AUGUSTUS start_codon 1448282 1448284 . + 0 transcript_id "g375.t1"; gene_id "g375"; 4 AUGUSTUS CDS 1448282 1450114 0.67 + 0 transcript_id "g375.t1"; gene_id "g375"; 4 AUGUSTUS stop_codon 1450112 1450114 . + 0 transcript_id "g375.t1"; gene_id "g375"; # protein sequence = [MWLFVYVTIRTYTTLMSDSATPKPLSAVREWGRNNDESGSAFSGLGRGKRGGGSGRDIPRGGRGGRGGASFRARGRGR # GSGNNGTTITTTNTSAITSTVTKPAEVASKPSTATFKAKLSETTATPKNTPLGKTGGRRRSNAKTIPQITVPPPSTSTSTTITDEVNALVEHVRAGAL # TPNGPITPFTPSHIDWAGDEEEDGSLPDLDDWGVSTSSGGAPSTFEPASTVETTKGSNMKPDAISPILVEGLKSLPEPKVPEHPEPETEVKAASPVPY # PERLNSKQTSPSETISTSTSSSLYPSFPHKPSSGSVNRPPKNKLGMTGSSRDGSTPRPPRTSRGSRNNLAAIQPGPESSHDINTKNTGKPVSGGVSLS # TPTPLTNHGAISLTPPESPTKGLTDSMHAPKPGLASAEPVRSKANIPASLNINGGSASKVGSYVPPHTRNSRPAFVPTPAPPPSDNGSLTAEFTFPSL # SPSPISGHYPTGPRGPGGGGPSESAGSDRPHDRFNGRNGAFNGNGSGFNPRYNNHAPRHYQQDPNHAANHFSRDRPVHQPQTQSHHSDPLHPGLNRSD # SPHHTPRHTPHHSREHSASRPVITGDAISKLARTIAGSPAKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g375 ### # start gene g376 4 AUGUSTUS gene 1452905 1454593 0.88 - . g376 4 AUGUSTUS transcript 1452905 1454593 0.88 - . g376.t1 4 AUGUSTUS stop_codon 1452905 1452907 . - 0 transcript_id "g376.t1"; gene_id "g376"; 4 AUGUSTUS CDS 1452905 1454593 0.88 - 0 transcript_id "g376.t1"; gene_id "g376"; 4 AUGUSTUS start_codon 1454591 1454593 . - 0 transcript_id "g376.t1"; gene_id "g376"; # protein sequence = [MQEQQLLKRLTSLEDEMVKLKPVLLLDPFPATASESSLSHASAYLASLPYPAASGKEAVRAQRSRRKKLEAKHKDIDH # LDQEVDHVAANISASNDSPNSMGVGTQGTSLRTPNDLDGEISHSLSYIPDQLQDDSNVLPFKSVRSEKHVSRRTEPPGTLLLWPAHIQPPVTPPSLET # PSAILGAPSAPGLNERSENAAFDSAIEPPLASSLSKPARPLTSDARMEHLLLAARMIGRKRAAFAAGIVDAELEKGQKERKEKEKEWREKEKAKKQKE # REREKKEREIAEKSKSERSKEKTRSTATLRSSAGGSRSVKGKGKEKALPKSSGVGKTNSLKRTPSRSGRELEGILDDEVIAGSSKQRRTKQTRPKPRA # LSASSSAGSTQKTQLTGMDSLLSAARSMMDPGSNQFITRDKAHEGGIDIDSNVGSRRPASELGGYEDTDMLPPAKRQKSLVVSSNRPMRTPSALDVLA # DQAAAAVSTSAASSDMDSIILEVKMVKNDLEDEDAEGEYEDDPADSNSVTRLNSPTTNTDGPRRSSRRSASSRSVINTRVISSAKSPTKGLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g376 ### # start gene g377 4 AUGUSTUS gene 1454996 1455331 0.84 - . g377 4 AUGUSTUS transcript 1454996 1455331 0.84 - . g377.t1 4 AUGUSTUS stop_codon 1454996 1454998 . - 0 transcript_id "g377.t1"; gene_id "g377"; 4 AUGUSTUS CDS 1454996 1455331 0.84 - 0 transcript_id "g377.t1"; gene_id "g377"; 4 AUGUSTUS start_codon 1455329 1455331 . - 0 transcript_id "g377.t1"; gene_id "g377"; # protein sequence = [MLEFTLTTRSAATVIYSRLAADSAFISSSLQGSLGSVGSPAMLILDNSNDLINPQVTEQEIGSDLEPLQDEEVIQFRA # QVLNMGVLSSDGMNSRERELARMVRSLPNTLSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g377 ### # start gene g378 4 AUGUSTUS gene 1458370 1459965 0.81 - . g378 4 AUGUSTUS transcript 1458370 1459965 0.81 - . g378.t1 4 AUGUSTUS stop_codon 1458370 1458372 . - 0 transcript_id "g378.t1"; gene_id "g378"; 4 AUGUSTUS CDS 1458370 1459965 0.81 - 0 transcript_id "g378.t1"; gene_id "g378"; 4 AUGUSTUS start_codon 1459963 1459965 . - 0 transcript_id "g378.t1"; gene_id "g378"; # protein sequence = [MTASVPSIPAAATPANVKHAAPAAPKPFTKLNYNSQSLQPKKIPRRSQPIINWFQRKLAGTVKVKRDSASQTGMRNLA # VPGRPTNRITSSPLPSTVPTHVNRQQGRFDTAPGGRRNTISLNGDDDLRDSSISDSGCSDDESLARGSAWTPSRLEADEDASVRPLPPSSPPSPSPSR # SSSSYLSDPRTFKSIAASTKPTTLLSVDVHGGMAHIAEAPLTPNTQVTRFPHVRTSSTSTTPILSSGASITFSALPPSPQSSSRPSSTTTAPQNSMNS # VQAPLHTTHHPRNNPRPSSPPLDNASMLTLASSAYAIPGLRVGMGTPIGWSSAPPSAVGGGADSVSQFEGAYADAESQNDEEPLDDRDVDASLRALRP # RSTRRGSWESEVSRWSARIQPSLVRERSVWTTNSVRTGALGTDQVHGSEKLDEAGNSPVVEGRPITEDISSSTTAPSEAADAPTSPHTTSLPATKRAS # TPQEKLSSETVAQAEKPGVEKTPEPVVSLPKTGKTFAVTVNGSKEAPEEIKDQFADTAGVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g378 ### # start gene g379 4 AUGUSTUS gene 1460179 1462096 0.73 - . g379 4 AUGUSTUS transcript 1460179 1462096 0.73 - . g379.t1 4 AUGUSTUS stop_codon 1460179 1460181 . - 0 transcript_id "g379.t1"; gene_id "g379"; 4 AUGUSTUS CDS 1460179 1460707 0.73 - 1 transcript_id "g379.t1"; gene_id "g379"; 4 AUGUSTUS CDS 1460826 1462096 0.73 - 0 transcript_id "g379.t1"; gene_id "g379"; 4 AUGUSTUS start_codon 1462094 1462096 . - 0 transcript_id "g379.t1"; gene_id "g379"; # protein sequence = [MFSSAHGAFGSLAFGIGTSEVEHVLATQTLLQKKSKNMRITVDGELIEGVTSKDVVLHIIGVIGTAGGTGAVIEYAGS # VIRSLSMEARMSICNMSIEAGARAGMIAPDEITFAYLRNRPLSPKGETWDRAVTYWQTLKTDPDAKFDIEVNIPASDIIPTVTWGTSPQDVAPITGVV # PDPSTIEDPVKRASVTRSLTYMGLTPNTPMQDIKIDKVFIGSCTNSRIEDLRSAAKIVLAAGPEAKVAPGILAMIVPGSGLIKKQAETEGLDVVFKRA # GFDWREAGCSMCLGMNPDQLSPGERCASTSNRNFEGRQGAGGRTHLVSPAMAAAAAMTGKLTDVRKFLGATAEANIAAGPKLKLTSAFDFMDDPVLPS # PDPIQSTTPSTGGTNLPPSEAPSSVEKFIVLKGITAPLHIENVDTDMIIPKQLRFSFALAKTLDAEALVNMHHGVCKFTSCLKLNCQIDLVFCRNDFG # IRCVIAPSFADIFRNNSMQNGMLPVAVPQEDCMVLAQDAEAGLELEVDLEKQEIRRPNGMPSISFTTDPFRRHCLLNGLDDIALTLQDVDSIEVFEHR # RSELWPWLDGFGYKAGKIPVAAKRAPKKMDW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g379 ### # start gene g380 4 AUGUSTUS gene 1466792 1467643 0.99 + . g380 4 AUGUSTUS transcript 1466792 1467643 0.99 + . g380.t1 4 AUGUSTUS start_codon 1466792 1466794 . + 0 transcript_id "g380.t1"; gene_id "g380"; 4 AUGUSTUS CDS 1466792 1467643 0.99 + 0 transcript_id "g380.t1"; gene_id "g380"; 4 AUGUSTUS stop_codon 1467641 1467643 . + 0 transcript_id "g380.t1"; gene_id "g380"; # protein sequence = [MVDFQFLPDSDDPISRLRFAMDRMDGMVHRSPICASDMHASTVQAIASYRTPPENEDYRIASKSLFSNAVSTLGAPEM # NIDPQLVEEGIDTAKNTKPSSNQAFRSNLRLFPPPIFSRQGIAQSYKLVHRSTCTLRWGTLTVSCSFKGNPASIVSTVVNEETGEEKKRLINRMRWKG # YGPATIAFSDPIVSVAQWQYFLQINEIVCQAPDKPPTNVEAVREQVDKNILKKLDEVNHLMRLWVKISQNIAFQAFCPTSCLDPSLPFQPDIGYRRQR # DPQVSMAFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g380 ### # start gene g381 4 AUGUSTUS gene 1468019 1469357 0.82 + . g381 4 AUGUSTUS transcript 1468019 1469357 0.82 + . g381.t1 4 AUGUSTUS start_codon 1468019 1468021 . + 0 transcript_id "g381.t1"; gene_id "g381"; 4 AUGUSTUS CDS 1468019 1468446 0.95 + 0 transcript_id "g381.t1"; gene_id "g381"; 4 AUGUSTUS CDS 1468777 1468858 0.85 + 1 transcript_id "g381.t1"; gene_id "g381"; 4 AUGUSTUS CDS 1468911 1469357 0.99 + 0 transcript_id "g381.t1"; gene_id "g381"; 4 AUGUSTUS stop_codon 1469355 1469357 . + 0 transcript_id "g381.t1"; gene_id "g381"; # protein sequence = [MFDGVNLTKETAAFQLCDITDVMLKEMIEDPDDVREACDVSQPNDVLSQKGNPNWISQERDGWYSTHALERIKAVLRL # KFFSLLDGRPATDEECQAVLEQAEMESSKAVASSRNAKMRLGKHNMAKGALRPEEAAVSGRVLIFWRDSSKLSIMTTAAREIGTLVVVVLKANHLPNK # RHIGKQDPYCAVTFDGQTRRTKAIKKGGQHPEWDEEIRFQLYEDDEELSQAEPTTSGTPPPLPPKSDQPSKIKGGMFMKVAAYADDAREPDLIGEGLV # DLTEVITKGESDGANDNTLSTPIHKANHLLLRVVYPHLQGQICG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g381 ### # start gene g382 4 AUGUSTUS gene 1470123 1470992 0.82 + . g382 4 AUGUSTUS transcript 1470123 1470992 0.82 + . g382.t1 4 AUGUSTUS start_codon 1470123 1470125 . + 0 transcript_id "g382.t1"; gene_id "g382"; 4 AUGUSTUS CDS 1470123 1470992 0.82 + 0 transcript_id "g382.t1"; gene_id "g382"; 4 AUGUSTUS stop_codon 1470990 1470992 . + 0 transcript_id "g382.t1"; gene_id "g382"; # protein sequence = [MSAPYNPSSVMYDTGIHHVPSQTPLPPNGTSLGSYDAGGYPTALSQAPFPNSYTSHLPHLHSFDNGPTIPLTDSYTYP # QQGTFSIPPPPPLSSQLAPASPSTPVEAYTGYTVPSPSRDQIGSSNGSRPLPPQPHGVPPPPPPFPLDQQQFGTYNNSYINPPGQVGGNGYASVPPPP # PIPSPQSQSPLNGSPQSHFSSEGRISSVPSKNLPVPPPPHMPNRRVSLPQPPIHANSYPPLPQPPSDFRGIPPLQISHIQSFYPGPPPRPPTQPSYHH # ESTSQFQNAYHVYQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g382 ### # start gene g383 4 AUGUSTUS gene 1472430 1477073 0.52 - . g383 4 AUGUSTUS transcript 1472430 1477073 0.52 - . g383.t1 4 AUGUSTUS stop_codon 1472430 1472432 . - 0 transcript_id "g383.t1"; gene_id "g383"; 4 AUGUSTUS CDS 1472430 1477073 0.52 - 0 transcript_id "g383.t1"; gene_id "g383"; 4 AUGUSTUS start_codon 1477071 1477073 . - 0 transcript_id "g383.t1"; gene_id "g383"; # protein sequence = [MDIGLKDFGGRRTAVEAMVDDGAMVAAMDTKVYEGLRNKIGGWTTTQRKFRMANGTVVPGEASWAGRISVKGVEVDGE # FEVFDSGGSWKFLFGKPLLERFSAVHDYGKESIVLHGKRGDWKEVFNSGLGAVITPNTTPMLEGKGQQDIPRPNAIAQAVLEESAEPAGGVTVKALTP # LDREVNELHLVQQSFVTNDTGQYEPKVIPSRRCHTPQIEEVPDEELTRPRTEPGIYETAPDWEADADSEEGWLTEAELEEWLRETRQLRREEAIKRQE # ALEHRQKERRKVWEEEEERREADWVAWLRRQRAEPGLRKWFFWRNRLRNPSPPRRLRVDPLGGGNAPPSREVSTDAGGAVECHIDHVSAECQTHDVTN # PMAETTSGASSREEVGDNTKNMPNGSRVDSVGGFDVPPSREVLTEDSSADPQHADRSQTVPICILHNEEDYPSQSEMGLDFFPDALDQSEDINLFTRN # DGERGAFRPERVREILRKVKIGPNLSVDQRLRVEQLLSAYADCFALSVGEVRPVKDAVHRLNIPEGTTFPKKVRQKALTPPQREYLHAKIDELLEAGV # IERCNPEDVKCVSPLTLAQKAHEGAGLTVEELMHKLNDECVAAGLPASFDLPTRPVQPPEPTERTGSPKPAKWRICQNFMAVNKVTEIAPMPQGNIRS # KQQSLSGHTYICLFDFASGFYACEVERKSRPYTAFYVEGKGYFWCAKLPFGLTGAPSTFANMTALHLDDLIADGTIELFVDDGGSADDDFDAMFVKLT # RILDRVRSRNLSLSAAKSEFFMSEGIFAGGKISKEGVTVDPAKLTAIVEWKQPEDALNLASFVGLTGHFRDLIRNYARIEGPLRNLLKSVPLPQHYTK # STYRKAMESFKLAEKWTLDHTKAFIALKKALVSEPVLKAPRWDGSSFIITTDGCKEGFAAVVAQRFEVVHPNGTTTYKTHPVGFASKRTSTSEQNYKP # FLLEFAALKFGLDKFSDMIWGFPIEIETDCQALRDVIANDKLNAAHSRWRDGVLAHHIVDVRHIPGKLNVVADGLSRMWEGQDRVVGDGSEWTVSEDW # EAVTGLVNDVFGVSVAEGMMEDGEVTNWETLSGRFRGEPVFMEVIDALRVLESSADDKAKQRAKHKAARYMVAGNRLWKVGGNGGIRERARVECITRR # EAVELARVQHGEAGHWGRDAVKLALMDRIWSPKLDESVMDAITSCPECKNFGAAHIHALLNPITRRHPFELLVGDYLSMSKGKGGYKTVGLYLDTYSQ # RVWAFKFKVAGSGATTTSSLTSLFNGYLPPETFMTDNGSHFANKEVEMLCAKWGTKQHLTPAYSPWVNGLVEGTNKILLHVLKRLCAPKLGEDSEEFK # EMHWETLPEKWPEYLDDAIRIINNRILPSVKFSPNELLLGAVVNTRRTPVVDATSVLPPQQIEIQTAYVEQQQLDGYSAFVQHAVKRKSVFDRRVLKK # EGKEVVFEAGDLVQVYRSDLDYTFKTIKKIIPKWSRPYRVAERNVNSYTLRTTDGQLIEGKQFAARRLREFKPRLGTKLAIEQQEVVRKREESKGGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g383 ### # start gene g384 4 AUGUSTUS gene 1477202 1478338 0.52 - . g384 4 AUGUSTUS transcript 1477202 1478338 0.52 - . g384.t1 4 AUGUSTUS stop_codon 1477202 1477204 . - 0 transcript_id "g384.t1"; gene_id "g384"; 4 AUGUSTUS CDS 1477202 1478338 0.52 - 0 transcript_id "g384.t1"; gene_id "g384"; 4 AUGUSTUS start_codon 1478336 1478338 . - 0 transcript_id "g384.t1"; gene_id "g384"; # protein sequence = [MATQPLARFSGDPDDPIQPATFLQDFEVRMTELMTPRADLASRIKPYLERDSRAWEWYTEDLTATDRTGSWEGFETKF # HLRFPSQKKEKKSAKSYLTSLEAERITHEQIMTTSDDTNQPYHQWWADRLLRLAKGAEVEKTKQSIGTVWRNLPYALKKTIDEEHDTWMEFTDAIKKV # KWSVLKVEAEHEASKAPPLAVPETPRTKLATSFAAARIATPPSPSPSRTRPAYVASAGARRPRRLFTTLDELQKGTLRRGIVAKVQHPNTPEGLAAWK # AELLEWASRHGVEGALSEVTIVPLKPGTEAVCSGECFKCGGPRHGFEVPCPRPGTIPPVESDWRAYCQRELGGKPARVNVVQLVGPEAIFEGMVDSGN # GEGLTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g384 ### # start gene g385 4 AUGUSTUS gene 1489087 1489569 0.48 - . g385 4 AUGUSTUS transcript 1489087 1489569 0.48 - . g385.t1 4 AUGUSTUS stop_codon 1489087 1489089 . - 0 transcript_id "g385.t1"; gene_id "g385"; 4 AUGUSTUS CDS 1489087 1489569 0.48 - 0 transcript_id "g385.t1"; gene_id "g385"; 4 AUGUSTUS start_codon 1489567 1489569 . - 0 transcript_id "g385.t1"; gene_id "g385"; # protein sequence = [MAHKLLNLLAFTSLAIMACSFGAEPVNALSNTHHVRDGLRGHDALAKRKRSVNGKRCKVRSAPADSSTASSTDSSSVD # SSSTDYTPAPITTSTWSDSSSSTWSSTSSSAPAATSSASSSSSGSGKGCLAWPNGDQSYLGDYKTDKTSLSVTSPFHSRQPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g385 ### # start gene g386 4 AUGUSTUS gene 1491024 1491380 0.6 + . g386 4 AUGUSTUS transcript 1491024 1491380 0.6 + . g386.t1 4 AUGUSTUS start_codon 1491024 1491026 . + 0 transcript_id "g386.t1"; gene_id "g386"; 4 AUGUSTUS CDS 1491024 1491380 0.6 + 0 transcript_id "g386.t1"; gene_id "g386"; 4 AUGUSTUS stop_codon 1491378 1491380 . + 0 transcript_id "g386.t1"; gene_id "g386"; # protein sequence = [MSCSITAQVILRGTRSAGYGFVALSSVEAAQKAVDALDKQLLDGRQVIVELAKQSDQKDKEKKERKPKRRPGRRGSKA # VPGEVSEAEANGDDTKDDVAAGASESEKPKKKKSKKSVSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g386 ### # start gene g387 4 AUGUSTUS gene 1491408 1491908 0.97 + . g387 4 AUGUSTUS transcript 1491408 1491908 0.97 + . g387.t1 4 AUGUSTUS start_codon 1491408 1491410 . + 0 transcript_id "g387.t1"; gene_id "g387"; 4 AUGUSTUS CDS 1491408 1491908 0.97 + 0 transcript_id "g387.t1"; gene_id "g387"; 4 AUGUSTUS stop_codon 1491906 1491908 . + 0 transcript_id "g387.t1"; gene_id "g387"; # protein sequence = [MSQRKPKAKTEGEVAETLPPATTEPTTETPKKAPRQRKPRAPRTPRPAGEDPEGEQSKTVLFVANLGFNIDDAGLAAL # FTDAGISVTSARIVRRRWGHPRRSKGYGFVDVGSEEEQKKAIEALQGKEVGGRPIAVKVAVNSFHDEEAAEAAPPTDAVEVAPVTGAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g387 ### # start gene g388 4 AUGUSTUS gene 1495175 1495464 0.6 + . g388 4 AUGUSTUS transcript 1495175 1495464 0.6 + . g388.t1 4 AUGUSTUS start_codon 1495175 1495177 . + 0 transcript_id "g388.t1"; gene_id "g388"; 4 AUGUSTUS CDS 1495175 1495179 0.6 + 0 transcript_id "g388.t1"; gene_id "g388"; 4 AUGUSTUS CDS 1495254 1495464 0.6 + 1 transcript_id "g388.t1"; gene_id "g388"; 4 AUGUSTUS stop_codon 1495462 1495464 . + 0 transcript_id "g388.t1"; gene_id "g388"; # protein sequence = [MFYDSLYIATATIDGDIPTETSRCLTATQYAQPQRGAPNSPVQQIIQLSDHIMPEDEPLHRHSESQGIAFM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g388 ### # start gene g389 4 AUGUSTUS gene 1497720 1498331 0.91 + . g389 4 AUGUSTUS transcript 1497720 1498331 0.91 + . g389.t1 4 AUGUSTUS start_codon 1497720 1497722 . + 0 transcript_id "g389.t1"; gene_id "g389"; 4 AUGUSTUS CDS 1497720 1498331 0.91 + 0 transcript_id "g389.t1"; gene_id "g389"; 4 AUGUSTUS stop_codon 1498329 1498331 . + 0 transcript_id "g389.t1"; gene_id "g389"; # protein sequence = [MSDFNNFINRSETDTAWEGYQRRKKVIATTEILNPGQKRTADQDDSSTLNKKARTNDAADAGSSYSMLLPMSSSPITS # TTLYQGSNSHDGRTMFSDIMRNSNGSPMFMSGSSSSTSPQYGGPSSSNVTGYPYIPGGHMNLESSLPPISFPPTPSVTNTQSRSSDQPSPEQMEDDED # PNKNEAYKLIQYAGLISSANQNVDIFW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g389 ### # start gene g390 4 AUGUSTUS gene 1510411 1511883 0.99 + . g390 4 AUGUSTUS transcript 1510411 1511883 0.99 + . g390.t1 4 AUGUSTUS start_codon 1510411 1510413 . + 0 transcript_id "g390.t1"; gene_id "g390"; 4 AUGUSTUS CDS 1510411 1511883 0.99 + 0 transcript_id "g390.t1"; gene_id "g390"; 4 AUGUSTUS stop_codon 1511881 1511883 . + 0 transcript_id "g390.t1"; gene_id "g390"; # protein sequence = [MRKVNLRNVDPAIDDPDASTWSHPTLNRHSPPEVVANFKRRVPPRLPKPRKRDLQEQQQIIPPPRSAIPGLGPGSVSL # SVPSSGMNSSKLANHVGRSRGFSAPGSFTPLSQSAASGGWVSNYSRTSLPPLTVPSEPHHMPHSGYGHHPLSPSEDSPTSPSYNYPSRAEPLMHHNYS # YQDTSGSQWFPSNGNSSTSHNSSLSSLLNPSSNGSNAYNQNTRPTPTINTAVHSGSSYSSPFSSIPLHSSEQPHSASSLSPEGHSRSQSGYPITYDEY # ASSSRPNSSHRQISSPSPRLSRSPYHSTNTSTMMVRRHRRHSQVMSPYPSPYENGGGSSSSGSLTEHQRPSSSPQPEMHHGHPNTHNGHYQAHHNGMP # SSLPRARSMMQLSSDTSSPSPYSYHNAPSEFAYSPLPSASSISVPSLTSVPSSSSISSMSSIHDTYGRHGTGARPGTAASSMSVASSSSQANTPQWMA # GQAPMKLVSQVQGWAGTLPW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g390 ### # start gene g391 4 AUGUSTUS gene 1523073 1524269 0.52 + . g391 4 AUGUSTUS transcript 1523073 1524269 0.52 + . g391.t1 4 AUGUSTUS start_codon 1523073 1523075 . + 0 transcript_id "g391.t1"; gene_id "g391"; 4 AUGUSTUS CDS 1523073 1523613 0.72 + 0 transcript_id "g391.t1"; gene_id "g391"; 4 AUGUSTUS CDS 1523812 1524269 0.6 + 2 transcript_id "g391.t1"; gene_id "g391"; 4 AUGUSTUS stop_codon 1524267 1524269 . + 0 transcript_id "g391.t1"; gene_id "g391"; # protein sequence = [MEGGELFHQIVKLTYFSENLSRHVIIQVAQGIRYLHEERGVVHRDIKPENLLFERIPIVPSKTQIHRPYDEEKEDEGE # FTPGVGGGGIGRVKIADFGLSKVVWNEETMTPCGTVGYTAPEIVKDERYSKSVDMWALGCVLYTLLCGFPPFYDESINVLTEKVARGYYTFLSPWWDD # ISANANAPLDSPLLSAARGGRAEGRSPGIATLKEAFDITYAVHRMEEEGARRRKYNGRGGAGARGFLGGLNEEDDEDDEPAETTVITTPRKAAGGTRN # RKAGSSGFELDMDAATLLGRRHNRGGGRGAVGFSSPLAKAATPTVQEPPLDPGSPMRH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g391 ### # start gene g392 4 AUGUSTUS gene 1526571 1527222 0.56 - . g392 4 AUGUSTUS transcript 1526571 1527222 0.56 - . g392.t1 4 AUGUSTUS stop_codon 1526571 1526573 . - 0 transcript_id "g392.t1"; gene_id "g392"; 4 AUGUSTUS CDS 1526571 1527020 0.7 - 0 transcript_id "g392.t1"; gene_id "g392"; 4 AUGUSTUS CDS 1527082 1527222 0.6 - 0 transcript_id "g392.t1"; gene_id "g392"; 4 AUGUSTUS start_codon 1527220 1527222 . - 0 transcript_id "g392.t1"; gene_id "g392"; # protein sequence = [MFRSAISRTASLSASFTRQKVSSVTLRPVLSRGYHEKVISHYEKPRNVGSLPKNDINVGTGLVGAPAYVIETSVKASL # LILYPLPSSCGDVMKLQIRVDENGIISDVKFKTFGCGSAIASSSYMTERVKGLSLEEAGKIKNTEIAKELCLPPVKLHCSSVFILLCVQSCFNLYTLQ # CSLRMLSAQLSGITSPSGIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g392 ### # start gene g393 4 AUGUSTUS gene 1527409 1528232 0.52 + . g393 4 AUGUSTUS transcript 1527409 1528232 0.52 + . g393.t1 4 AUGUSTUS start_codon 1527409 1527411 . + 0 transcript_id "g393.t1"; gene_id "g393"; 4 AUGUSTUS CDS 1527409 1527649 0.52 + 0 transcript_id "g393.t1"; gene_id "g393"; 4 AUGUSTUS CDS 1527745 1528232 1 + 2 transcript_id "g393.t1"; gene_id "g393"; 4 AUGUSTUS stop_codon 1528230 1528232 . + 0 transcript_id "g393.t1"; gene_id "g393"; # protein sequence = [MTTTFRPADNLPPTARAIALILSSTPSVQDAQPGVLHQLLEFSSRYTQQVLTDAKVYADHAGRQDKLDIDDVILAVQA # RVATQTNAIPLPSVPEVFGVRLPQSSDCLTSLDFDLIPNKAPPGVKIYDEEIEEIEESESEEEEEEEMEPATIPNYARSSTNQSVPPESAQEAPFPIS # AIHMPSEADTDTRMGGENGSDAGEEEDGLFAGGDDDSDGMEEVQTSLNEGVNNEMKRKLVETDDYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g393 ### # start gene g394 4 AUGUSTUS gene 1537682 1539931 1 - . g394 4 AUGUSTUS transcript 1537682 1539931 1 - . g394.t1 4 AUGUSTUS stop_codon 1537682 1537684 . - 0 transcript_id "g394.t1"; gene_id "g394"; 4 AUGUSTUS CDS 1537682 1539931 1 - 0 transcript_id "g394.t1"; gene_id "g394"; 4 AUGUSTUS start_codon 1539929 1539931 . - 0 transcript_id "g394.t1"; gene_id "g394"; # protein sequence = [MTETTAATLATAEAGRADFATNEVAVTIPSPSQPISQEIANNACPPSSSTSQSVNEYNEPIRTDLSSGPPLDIADAPA # QSWWSYMGWSSSQSNVTRMEILDSELRTESHEDPTPNLNITQAQPDPLPERCASAPPVMEPSNGNPEPPEAETNSPSNPQSTSTAQPQTETQAYVKAP # SIFSLDVARAAGSWFNPWAWYGYGVVEPSSSDTVGSVALNGVPEESERVSDDGNGNRGSIDDKANMTEMTESEKIKEAALARDRPSGASSSIASATTQ # EDNTSTGQIDSPTVGLEREFQETPPSVNPINPIADSASYMASGWASFFSLSRGRGLITKNLSDTVPEIEGLKDEVKRDENGMEIMELTDDEAGSVHVN # LQEPERELEKAVTKVPASSALILMRALAGHDLKQQKTIEAPKDEKSQLEQDTTNTNSNSPRIPPSPSNSSKYNAGALGADSVSSSPTKVLSSRPGRAS # SVSTTQTSTSSVGTKPAPPLTISDELKASVVAAKKGKRAGVSPAGSSSLPKDGFSTPSGTDGPKKEKEKEKSKAVVKSGANTPAPPPPPPNLVLPAWE # DTFLTPPRNWVPEQYLPTTNNATGGLGTTIGKTMRYMSGMLLGADSGYTSGGESSRLGAGASATKRRSRKGSSRRRSISGENAIPGGNGVGSEAELIA # REREKLRELLNWGHNLPRAWEVIEKAIETRRKSVLEKKGKAKATTEQEGSHRDVTRGCKNVVIIGIHGWFPGMDFPYSSSLHC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g394 ### # start gene g395 4 AUGUSTUS gene 1540023 1541073 0.51 - . g395 4 AUGUSTUS transcript 1540023 1541073 0.51 - . g395.t1 4 AUGUSTUS stop_codon 1540023 1540025 . - 0 transcript_id "g395.t1"; gene_id "g395"; 4 AUGUSTUS CDS 1540023 1540986 0.54 - 1 transcript_id "g395.t1"; gene_id "g395"; 4 AUGUSTUS CDS 1541039 1541073 0.57 - 0 transcript_id "g395.t1"; gene_id "g395"; 4 AUGUSTUS start_codon 1541071 1541073 . - 0 transcript_id "g395.t1"; gene_id "g395"; # protein sequence = [MVDTDQGVAFPSPPSPERTGSTPLASTSADTTSITNAPVQSEPGPEPSSSSSPSRGSWLGSFGRSKGKEKAVGVTANN # TSSNSVADTPRPASKPLAEFPSTDEGVNNAEDLSSAIEALGSTQPYAFETIRADIQVPRVELPSLTEDTSRTVRASEGPKHSWFNPFAPYPSRPQNTS # AQPPPSQPSSSPVSSSTSPSSLRKTSSSYVGSIDDEVPGPVRTPAHSDDEDGREAQQEVNHLSSTLAPSGVSAAVAQCELPPVDNASQSFQPRERLDS # LNSLNPSTSRFSISIPLLGRPKMRLEDAVKRGKEIGDKAVKETPQKDAGASPTRLSSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g395 ### # start gene g396 4 AUGUSTUS gene 1541719 1542135 0.63 - . g396 4 AUGUSTUS transcript 1541719 1542135 0.63 - . g396.t1 4 AUGUSTUS stop_codon 1541719 1541721 . - 0 transcript_id "g396.t1"; gene_id "g396"; 4 AUGUSTUS CDS 1541719 1542135 0.63 - 0 transcript_id "g396.t1"; gene_id "g396"; 4 AUGUSTUS start_codon 1542133 1542135 . - 0 transcript_id "g396.t1"; gene_id "g396"; # protein sequence = [MLKLSETDGIRQYLVTSLVAQIDALVKLQDQATGLWHTILDDETSYLESSCTAGFAYGILKALRLRLLPKKERYMDSA # KKAIQGVLANITPEGELKLVSFGTPVFDDIEEYKKIPLTSMPYGQSLALLALTEYLRTFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g396 ### # start gene g397 4 AUGUSTUS gene 1549187 1550095 0.75 - . g397 4 AUGUSTUS transcript 1549187 1550095 0.75 - . g397.t1 4 AUGUSTUS stop_codon 1549187 1549189 . - 0 transcript_id "g397.t1"; gene_id "g397"; 4 AUGUSTUS CDS 1549187 1550095 0.75 - 0 transcript_id "g397.t1"; gene_id "g397"; 4 AUGUSTUS start_codon 1550093 1550095 . - 0 transcript_id "g397.t1"; gene_id "g397"; # protein sequence = [MRITSFSLNPRPESPLPKSPADNNLVQSTSRHLELLGDTPPYTSLLGTEPWMPPSILSRNTGLPFNPRLSLPKDASQR # EFMLTPDTLRYLATVVTRYSDQVREVELAQHGAEGRAALQIQEVIRQTTKCRELLAIVERIKESRREASQDRIQKVQQGQKILLKRLDRMLQVMMEKA # SPELSEHETKWFDELKRLKEAVIGADRYDESSLSTRIRTVRTCHIAMSFYLTMYQLEREYARLMPSLKALLEKERRRHNQAMTENPGLGFSQAFEFGE # RSNHEFVYLGVIDCTASNVSLSLLGVLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g397 ### # start gene g398 4 AUGUSTUS gene 1550578 1550979 0.7 - . g398 4 AUGUSTUS transcript 1550578 1550979 0.7 - . g398.t1 4 AUGUSTUS stop_codon 1550578 1550580 . - 0 transcript_id "g398.t1"; gene_id "g398"; 4 AUGUSTUS CDS 1550578 1550979 0.7 - 0 transcript_id "g398.t1"; gene_id "g398"; 4 AUGUSTUS start_codon 1550977 1550979 . - 0 transcript_id "g398.t1"; gene_id "g398"; # protein sequence = [MSMLYDYQHKYVDALIKQLPPGTVFPAPSRSVLIHPPTIIKAPPARQGPFLLQPSPRMLGESEGGDATDIVYLSYSQT # EETVSDAEDGVAENLDVVLITYQDGKIDVCLDVEKVEARWQSKVLESTSICPLPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g398 ### # start gene g399 4 AUGUSTUS gene 1555854 1557423 0.15 + . g399 4 AUGUSTUS transcript 1555854 1557423 0.15 + . g399.t1 4 AUGUSTUS start_codon 1555854 1555856 . + 0 transcript_id "g399.t1"; gene_id "g399"; 4 AUGUSTUS CDS 1555854 1555925 0.3 + 0 transcript_id "g399.t1"; gene_id "g399"; 4 AUGUSTUS CDS 1555983 1556403 0.23 + 0 transcript_id "g399.t1"; gene_id "g399"; 4 AUGUSTUS CDS 1556849 1557423 1 + 2 transcript_id "g399.t1"; gene_id "g399"; 4 AUGUSTUS stop_codon 1557421 1557423 . + 0 transcript_id "g399.t1"; gene_id "g399"; # protein sequence = [MYTEANTDSEPVTLIVVGCGQRGKAYGKYALQSDACQVVAIAEPRPQTRNMYAEQHKVDPTLVFGTWKDLHAASADTI # NTVGKRLADAVLIAVQDHMHVEVALAFAEQGYHILCEKPMATTMEDCIRIEEAINRAGIILEWVTVNPSFIILYTSVSMTSQSPVMLYLDSVSRGNTG # WPVSTLVDGIPDIENITAALKVGPYGQCVYESKNDVCDNQIVNLEFENGNTASFTMVAFTSAICERQLRMHFTHGEIVGDMNKYTVTDFRTNKTKTFH # PANEGGGHGGGDIGLIRTFVEAVRTGNQKLLGTDVGEVLKSHMTVFAAEASRREEKVVNCVAFEEKARASVRETRVQTVLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g399 ### # start gene g400 4 AUGUSTUS gene 1559987 1561041 0.54 - . g400 4 AUGUSTUS transcript 1559987 1561041 0.54 - . g400.t1 4 AUGUSTUS stop_codon 1559987 1559989 . - 0 transcript_id "g400.t1"; gene_id "g400"; 4 AUGUSTUS CDS 1559987 1560380 0.96 - 1 transcript_id "g400.t1"; gene_id "g400"; 4 AUGUSTUS CDS 1560479 1561041 0.54 - 0 transcript_id "g400.t1"; gene_id "g400"; 4 AUGUSTUS start_codon 1561039 1561041 . - 0 transcript_id "g400.t1"; gene_id "g400"; # protein sequence = [MHAALPVVPTVPLANLPNLSSPLKSSSLTRVFASMSPKSSSSLPKELVPPTPSSPSRTSSKSPTKRDSAITASFHSIM # PTKGTVLFPSTPTSSRAERTPRILNLRTPTSKISIDDLLSETSTPRGRDPASILQTPTTSRRQALYDRIRQRSLSASPSKSQRNAVIPGSKLTKDQIM # KMGQEEMRRRCLLFSSASGSTPTSTPSSRKRRTLPLVEVATAVMKSSPVPISQAEANESLELLITLCPFFLKQLTIGSEDWLEMPSSIPNDTGSPSKR # APPSPGKVESARELMTRSPKRVKREAGGLREVREIVRRELELHD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g400 ### # start gene g401 4 AUGUSTUS gene 1564669 1565116 0.27 + . g401 4 AUGUSTUS transcript 1564669 1565116 0.27 + . g401.t1 4 AUGUSTUS start_codon 1564669 1564671 . + 0 transcript_id "g401.t1"; gene_id "g401"; 4 AUGUSTUS CDS 1564669 1564716 0.43 + 0 transcript_id "g401.t1"; gene_id "g401"; 4 AUGUSTUS CDS 1564844 1565116 0.57 + 0 transcript_id "g401.t1"; gene_id "g401"; 4 AUGUSTUS stop_codon 1565114 1565116 . + 0 transcript_id "g401.t1"; gene_id "g401"; # protein sequence = [MLETEKQKEDLEARLKAGGLIAAQKISDSLIQHLSERYGSHQYQLWVYVFLNKKGLAETLGRLGSPQLKNNFEDFVTG # FNQAAERFSMLDVGNAKEAADAKIKCTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g401 ### # start gene g402 4 AUGUSTUS gene 1565370 1565840 0.55 + . g402 4 AUGUSTUS transcript 1565370 1565840 0.55 + . g402.t1 4 AUGUSTUS start_codon 1565370 1565372 . + 0 transcript_id "g402.t1"; gene_id "g402"; 4 AUGUSTUS CDS 1565370 1565840 0.55 + 0 transcript_id "g402.t1"; gene_id "g402"; 4 AUGUSTUS stop_codon 1565838 1565840 . + 0 transcript_id "g402.t1"; gene_id "g402"; # protein sequence = [MASGIAEMDLPILTIPDLFVAQKLGVTEVAASRFPSYSSATLVGETKETNKQIPANPQIVSPPTGYSSVNAVPYKRDS # TPDLDFSEGSTSGESDYDDDLPHNAVVAAMASSNSSSQSFSNSRYINPNIVECFPTAKKFSTDDVPFFVYHSHSGNVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g402 ### # start gene g403 4 AUGUSTUS gene 1575672 1576526 0.98 - . g403 4 AUGUSTUS transcript 1575672 1576526 0.98 - . g403.t1 4 AUGUSTUS stop_codon 1575672 1575674 . - 0 transcript_id "g403.t1"; gene_id "g403"; 4 AUGUSTUS CDS 1575672 1576526 0.98 - 0 transcript_id "g403.t1"; gene_id "g403"; 4 AUGUSTUS start_codon 1576524 1576526 . - 0 transcript_id "g403.t1"; gene_id "g403"; # protein sequence = [MENRFAADPPFSTFSSSSTITSTFSTITPTSSTITSRSTSSSVASSSSPTATSSSSTDILSSSASIYTSTSDGVRETI # TAFVTPSASPSPSQSPVSSTNGFLNNKPLEGFVFTLCGIVGIVILCLVTTFALRRSRRKRMLNEALSYEPTTTHGYTGHTDRDVNEKIRASYSSAGSS # SNGLGPPHSNGSVIAGGYYSAPGMAPQAAHQYEREYPAYAPRSPNPAYDNSRSHGPSYNYNMSGAPVMAGYIPPAQPAFIQPILATNSSRVPVPAMSP # DPTAATESAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g403 ### # start gene g404 4 AUGUSTUS gene 1580368 1581396 1 + . g404 4 AUGUSTUS transcript 1580368 1581396 1 + . g404.t1 4 AUGUSTUS start_codon 1580368 1580370 . + 0 transcript_id "g404.t1"; gene_id "g404"; 4 AUGUSTUS CDS 1580368 1581396 1 + 0 transcript_id "g404.t1"; gene_id "g404"; 4 AUGUSTUS stop_codon 1581394 1581396 . + 0 transcript_id "g404.t1"; gene_id "g404"; # protein sequence = [MNDLESNNFTVVANLPVECQVSSSSHFVAPDEQQLTACNDLFTTSDSFPNNLATSNPPSTFDNNTVDTTMFSPLENSF # NYSLPPLPPAPALTLLPAVDPLSPGPSPATAASSSTPAPPVTSASSTSTLSSPFTSTPLVRRPNAGNAKPKTTSKSKLKINTNLRRKPPSPSHRFVKP # LNQSPPAPAPAAAVTVSAPPSVPPKLPTLPPLTLNTLHCSYYSAHVRQPASSSNSTTATAPNKICTAADPQKLYSNVAGPNIVLNTPDFPAFGRAIER # SVSTEGCLGYSLLMRKAGEFGGKKGTKVHGGGKDEKPDLTQTYLRITLGSHMVSVIFFRVFVLIFLSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g404 ### # start gene g405 4 AUGUSTUS gene 1588599 1589163 0.85 + . g405 4 AUGUSTUS transcript 1588599 1589163 0.85 + . g405.t1 4 AUGUSTUS start_codon 1588599 1588601 . + 0 transcript_id "g405.t1"; gene_id "g405"; 4 AUGUSTUS CDS 1588599 1588603 0.86 + 0 transcript_id "g405.t1"; gene_id "g405"; 4 AUGUSTUS CDS 1588695 1589163 0.85 + 1 transcript_id "g405.t1"; gene_id "g405"; 4 AUGUSTUS stop_codon 1589161 1589163 . + 0 transcript_id "g405.t1"; gene_id "g405"; # protein sequence = [MRGFFTSQTNPTPTAPTAPTNANATSEEISVGISEEKEATVVDSNPAEILWSHEIHPNYMYPPTPFDSTAAEETDNLV # NKMLEEHTQHVTARRSPDSPRFIGNPEFLSIKIISAVKVGRVMCPCHATLRVDHNKDSIFMDVSAIKVRCVLYFLFIMI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g405 ### # start gene g406 4 AUGUSTUS gene 1590606 1591551 0.29 + . g406 4 AUGUSTUS transcript 1590606 1591551 0.29 + . g406.t1 4 AUGUSTUS start_codon 1590606 1590608 . + 0 transcript_id "g406.t1"; gene_id "g406"; 4 AUGUSTUS CDS 1590606 1591259 0.33 + 0 transcript_id "g406.t1"; gene_id "g406"; 4 AUGUSTUS CDS 1591309 1591551 0.64 + 0 transcript_id "g406.t1"; gene_id "g406"; 4 AUGUSTUS stop_codon 1591549 1591551 . + 0 transcript_id "g406.t1"; gene_id "g406"; # protein sequence = [MEPLPQNPLPDPAPLPQTPKTKQANGPPVVESTPTSKKYASHAEDEVPQRASVVNKFLEDDIGDSVVLSLDDFATLIL # ELPVDWKVKEEIALQLDSDAVKDAFEAYLSVAIGVAEAEGKKRKGAAGHETQLYRPLANLLNVLKDSDEEGRFGSDIDEKIFYVQDPRPVLGSRIERK # PDLGGIYIQLLNLSEDQELSNYLEKKKKIVGVFWGLLLYFVEVYYQDHQCFHVIVSDLPFAEGTKTPRNGSSQSAVAKGSRRGSRQGSRTTAGPSLST # IPQAGPSQSQSVKRSRANEEDPTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g406 ### # start gene g407 4 AUGUSTUS gene 1592361 1593713 0.72 + . g407 4 AUGUSTUS transcript 1592361 1593713 0.72 + . g407.t1 4 AUGUSTUS start_codon 1592361 1592363 . + 0 transcript_id "g407.t1"; gene_id "g407"; 4 AUGUSTUS CDS 1592361 1593713 0.72 + 0 transcript_id "g407.t1"; gene_id "g407"; 4 AUGUSTUS stop_codon 1593711 1593713 . + 0 transcript_id "g407.t1"; gene_id "g407"; # protein sequence = [MVCQLNKLSTEKLGFIPNLDLNKFDHLRHPEQLTFHFEDDPSALVGATYTFTGSDGRRRRLKITKVLYRAEGIIGRCS # IVVEVVCLCEEADCVWHEEGNQKTRVMKISFPSKTRPCEDGLIGEARSKAESSGQRWALNHLPEVIDSITFPYHEHTTVQGRLKKHLKDDYEERVMRV # TFLEKLHPLSELTDPREYAQVFYDILQSTSLFDRLLYLSLPCFRPPPVHQWLYECAGILHRDLSSGNIMFRRIDGKIYGVLNDFDLSSRVRDMDKGPT # SNQRTGTRPFMSVDLLSPVWEGGHLYRHDLESLFYIMLCLACRYEAPGVPAPEPRAYSKWFNGSDADIFENKTTLLHDSFQSPPIQSYFAGFRRPLRK # IYRQLRAGYKQRPENPSTSEEESDESEDEDLEFLPNDNVLNFDWNTLNRHVSYARMRSVMSSFKGKSLQTRWVGNPDH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g407 ### # start gene g408 4 AUGUSTUS gene 1594165 1597066 0.11 + . g408 4 AUGUSTUS transcript 1594165 1597066 0.11 + . g408.t1 4 AUGUSTUS start_codon 1594165 1594167 . + 0 transcript_id "g408.t1"; gene_id "g408"; 4 AUGUSTUS CDS 1594165 1594626 0.47 + 0 transcript_id "g408.t1"; gene_id "g408"; 4 AUGUSTUS CDS 1594942 1595065 0.57 + 0 transcript_id "g408.t1"; gene_id "g408"; 4 AUGUSTUS CDS 1595274 1595536 0.3 + 2 transcript_id "g408.t1"; gene_id "g408"; 4 AUGUSTUS CDS 1595663 1597066 0.91 + 0 transcript_id "g408.t1"; gene_id "g408"; 4 AUGUSTUS stop_codon 1597064 1597066 . + 0 transcript_id "g408.t1"; gene_id "g408"; # protein sequence = [MEQPRENILKTQTQNQSRNLPVAKNTPASNKIPIEDEVPQYGSVLAEFLGNVVSNRVVLSLDDFSTLILNLSADWKVE # ENLNLGAKSKIVNDAFKASLKVEIIVAEGAETKGTDAAAYEKEYQPLTNLLNTLRDGEGHLGKDINEETLFVDPRPHVSTEASQTAFSRSQSPPLQTE # AIHYKVNKRVRLNDEFSPTKCPVSVGRVQSNKSPTTPHPVSPHSASTPTSASISLRYEDEDRHRINIWSEDTKKTVEIVMGQEYAQQSGMRSLEDYMK # FSSRGVENRFSFHVQSSKNDEWKKLFIVMVCQLKKLPRTTKNAEFIPTLYIDGIDHLQDPELFSNTFALDTQDLIDAIYSFVGNDGCSRRVVIQSILH # HAEDAVGLYAVVAEVECLCMEADCTWNREGKIVKISFMGTARQSEQVLTGEARSKAESTCELWALNYVPKAIHWVTLLPNKKKSFHRRLKTLLKDEYE # ERVMHITVFEKLHPLSELTDPRDFAQVFYDILQSTSLFDLLFYPSLPCSRTPLVHQWLYECAGILHRDLSSENIMFRRIDGNIYGVLNDFDHSSRVRD # MDKGPTPNQRTGTRPFMSVDLLSPVWEGGHLYRHDLESLFYIMLCLACRYEAPGAPAPEPRAYSLWFSGTDREIFNNKTTFLHDRFQSLPIQSYFAGF # KRPLCKIYRQLCAGYKQRPENPSTSEEESDESEDEDLEFLQNDNDSNFDWNTLNRHVSYDRMRSVMSSFKGKSLQTRWVGNPDH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g408 ### # start gene g409 4 AUGUSTUS gene 1603254 1605248 0.95 - . g409 4 AUGUSTUS transcript 1603254 1605248 0.95 - . g409.t1 4 AUGUSTUS stop_codon 1603254 1603256 . - 0 transcript_id "g409.t1"; gene_id "g409"; 4 AUGUSTUS CDS 1603254 1604436 0.95 - 1 transcript_id "g409.t1"; gene_id "g409"; 4 AUGUSTUS CDS 1604509 1605248 0.95 - 0 transcript_id "g409.t1"; gene_id "g409"; 4 AUGUSTUS start_codon 1605246 1605248 . - 0 transcript_id "g409.t1"; gene_id "g409"; # protein sequence = [MSEEHQPALPTIPILVELPAYGYSFTVHLPSEPTSTSAASSNTVLSIKHAISRTCPGNPQVDGQRVIWRGRVLGDAEK # VGELWPVVDGYGGQGLKRIVHLSVHPSAWTGKPPVISAAREVRESKEVRSEKGKGKEKEIVAEKDDVVNKLRAAAAVTFESLTTTPKLAPTVTTAPSP # PPALPAYLISTHRQALSALTDLEGFTPEVFTSSDNEKEIAVRFVNAHGYSWPAILDEGYPSTGADSEKGVSGRPYLRLLNPTETPTAAQKHALKVLSF # TFELLKLPTQPARHTSSPSIPNPAAQPNQPGVPVPETTPAVQVPAHLNAVLQQMGLPPITENLPPGVVNVIQQQQQQQLPQAQGGVQFDLNQFFNANN # PNNNDNNNNNHQIQQINIRPILLPLLMLSLRMFLLLYFVAPARKPFLMLLVLAWVGWEIWGWIAALGVRVEVEIERGRMEGGGAGERPPGGGGAPQPA # PPPAQQNVAAQAPPAVPAANNPPAPAPAPAAPPTLLDNLASFGIAQDQAALESTLPLETDSPEPGFARKALLFLVLFLISVHPAVWNRRRALLRAREG # QVRVEMGVLAEGVGEQESGAADDASALETTRRAQRRAEMYVKYMSRPAWVRRYMQRVMSAQAGEGAWVDEAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g409 ### # start gene g410 4 AUGUSTUS gene 1605769 1607682 0.41 - . g410 4 AUGUSTUS transcript 1605769 1607682 0.41 - . g410.t1 4 AUGUSTUS stop_codon 1605769 1605771 . - 0 transcript_id "g410.t1"; gene_id "g410"; 4 AUGUSTUS CDS 1605769 1607163 0.94 - 0 transcript_id "g410.t1"; gene_id "g410"; 4 AUGUSTUS CDS 1607323 1607682 0.41 - 0 transcript_id "g410.t1"; gene_id "g410"; 4 AUGUSTUS start_codon 1607680 1607682 . - 0 transcript_id "g410.t1"; gene_id "g410"; # protein sequence = [MPSIAYIVSQSVSSTPLTSTPASFEDEPLLEDTIQAIGGTKKTIEVVTSQEYARRAEAELRAEQKMTSTQGQRHTRIQ # CASYAKEMLSNGFIRNHAMGITADDSGFRFQYYDRSKVVESQPFHILNDESKTLLMAMVCQLNKLSTEKLGFIPNLDLNKFDHLRHPEQLTFHFEDDP # SALVGATYTFTGSDGRRRRLKITKVLYRAEGIIGRCSIVVEVVCLCEEADCVWHEEGNEERNQKTRVMKISFPSKTRPCEDGLIGEARSKAESSGQRW # ALNHLPDVIDSITFPYHEHTTVQGRLKKHLKDDYEERVMRVTFLEKLHPLSELIDPREYAQVFYDILQSTSLFDPFSHPSLPSSRTPLVHQWLYECVG # ILHRDLSSGNIMYRRIDGKVYGVLNDFDLSSRVRDMNHGPTSKQRTGTRPFMSVDLLDYRWAGGHLYRHDLESLFYIMLCLACRYEAPGVPAPEPRPY # SQWFSGTDREVVADKNMFLTSPFVLSEDLPIQPYFADFEPWLKSIHYFISEGYHARPRRPIVPMDDANNLDSTEDIPPQTSFNWQTLAGQVTYSRLSR # LMSSFSGVPLQTRWSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g410 ### # start gene g411 4 AUGUSTUS gene 1608122 1608871 0.27 - . g411 4 AUGUSTUS transcript 1608122 1608871 0.27 - . g411.t1 4 AUGUSTUS stop_codon 1608122 1608124 . - 0 transcript_id "g411.t1"; gene_id "g411"; 4 AUGUSTUS CDS 1608122 1608871 0.27 - 0 transcript_id "g411.t1"; gene_id "g411"; 4 AUGUSTUS start_codon 1608869 1608871 . - 0 transcript_id "g411.t1"; gene_id "g411"; # protein sequence = [MEPLPENPLPDPAPLPQTPKMKQANGPPVVEGTPMSQKCTSHAEDEVPQRASVVNKFLEDDIGDGVVFSLDDFATLIL # ELPVDWKVKEDIALQLDSQAVKDAFETYLSVAIGVAEAEGKKRKGAAGHETQLYRPLANLLNVLKDSDGEEGRLGRDIDEKIFYVQDPRPVLGSRIER # KPDLGGIYLQLLELSEDEGLSDYLEKKKKIVGVFWGLLLYFVEVKHRKGNFIGMSIRKAGIFSGPSMLPCNCF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g411 ### # start gene g412 4 AUGUSTUS gene 1609602 1610227 1 - . g412 4 AUGUSTUS transcript 1609602 1610227 1 - . g412.t1 4 AUGUSTUS stop_codon 1609602 1609604 . - 0 transcript_id "g412.t1"; gene_id "g412"; 4 AUGUSTUS CDS 1609602 1610050 1 - 2 transcript_id "g412.t1"; gene_id "g412"; 4 AUGUSTUS CDS 1610218 1610227 1 - 0 transcript_id "g412.t1"; gene_id "g412"; 4 AUGUSTUS start_codon 1610225 1610227 . - 0 transcript_id "g412.t1"; gene_id "g412"; # protein sequence = [MSKGDMLTTCACNPNINLSTPTQWGQRSDEGNGEFVKNGKPKFCDEDDDSEVDAVGSIDEEAKGPEWEIVQADRDVDV # DLDIAPPPPTPVPRPSSVALELPVPQFLQPRFRISLLEDTHEPEPESTWLRIGHLRGFPTWEREKGSTVELEND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g412 ### # start gene g413 4 AUGUSTUS gene 1611176 1611586 0.72 - . g413 4 AUGUSTUS transcript 1611176 1611586 0.72 - . g413.t1 4 AUGUSTUS stop_codon 1611176 1611178 . - 0 transcript_id "g413.t1"; gene_id "g413"; 4 AUGUSTUS CDS 1611176 1611586 0.72 - 0 transcript_id "g413.t1"; gene_id "g413"; 4 AUGUSTUS start_codon 1611584 1611586 . - 0 transcript_id "g413.t1"; gene_id "g413"; # protein sequence = [MDPLPENPLPDPAALAQTLKTKQAPLTTGIAELLAGQQSIFNTLVGMQKQLAQVDRRSACVNFTSLEKYTGALMDDCQ # TINQTRGSGAGKPYDEVRFPDNTLPSQPVRTLIQSAYFQSNVFEFWLGSRPCSTSNAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g413 ### # start gene g414 4 AUGUSTUS gene 1612259 1614230 0.24 - . g414 4 AUGUSTUS transcript 1612259 1614230 0.24 - . g414.t1 4 AUGUSTUS stop_codon 1612259 1612261 . - 0 transcript_id "g414.t1"; gene_id "g414"; 4 AUGUSTUS CDS 1612259 1613674 1 - 0 transcript_id "g414.t1"; gene_id "g414"; 4 AUGUSTUS CDS 1613832 1614230 0.24 - 0 transcript_id "g414.t1"; gene_id "g414"; 4 AUGUSTUS start_codon 1614228 1614230 . - 0 transcript_id "g414.t1"; gene_id "g414"; # protein sequence = [MRPGPSSRAQSDTLPSIAYVVSQSVSSTPLTSTSADFGDEPLLEDTIQAIGGTKKTIEVVTSQEYARRAEAELRAEQK # MTSTQGQHHTRIQCASYAKEMLSNGFIRNHAMGITADDSGFRFQYYDRSKVVESQPFHILNDESKTLLMAMVCQLNKLSTEKLGFIPNLDLNKFDHLR # HPEQLTFNFEDDSSALVGATYTFTGSDGRRRRLKITKVLYRAEGIIGRCSIVVEVVCLCEEADCVWHEEGNQKTRVMKISFPSKTRPCEDGLIGEARS # EAESSGQRWALNHLPEVIDSITFPYHEHTTVQGRLKKHLKDDYEERVMRVTFLEKLHPLSELTDPREYAQVFYDILQSTSLFDPFSHPSLPSSRTPLV # HQWLYECVGILHRDLSSGNIMYRRIDGKVYGVLNDFDLSSRVGDMNNGPTSKQRTGTRPFMSLDLLDPDWAGGHLYRHDLESLFYIILCLACRYEAPG # VPAPEPRPYSQWYSGSDEEICNNKYKFLTSPFGLINGLPIQSYFAGFQRWLRKIYDQLRGGYIRRPLCAKNLSTSNEESEESGDEDLEFSQSDNDLNF # DWNTLNRHVSYARMRSVMSSFKGKSLETRWAGKTEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g414 ### # start gene g415 4 AUGUSTUS gene 1614402 1615380 0.14 - . g415 4 AUGUSTUS transcript 1614402 1615380 0.14 - . g415.t1 4 AUGUSTUS stop_codon 1614402 1614404 . - 0 transcript_id "g415.t1"; gene_id "g415"; 4 AUGUSTUS CDS 1614402 1614674 0.22 - 0 transcript_id "g415.t1"; gene_id "g415"; 4 AUGUSTUS CDS 1614757 1615380 0.48 - 0 transcript_id "g415.t1"; gene_id "g415"; 4 AUGUSTUS start_codon 1615378 1615380 . - 0 transcript_id "g415.t1"; gene_id "g415"; # protein sequence = [MEPLPENPLPDPAPLPQTPKMKQAHGPPVVESTPMSQKCTSHAEDEVPQRASVVNKFLEDDIGDGVVFSLDDFATLIL # ELPVDWKVKEDIALQVDSQAVKDAFEAYLSVAIGVAEAEGKKRKGAAGHETQLYRPLANLLNVLKDSDGEEGHLGRDIDEKIFYVQDPRPVLGSRIER # KPDLGGIYLQLLELTEDEGLSDYLEKKKKIVGVYSQDHQYFHVIIFDSPFAEGTKTPRNGSSQSAVAKGSRRGSRQGSRTTAGPSLSTISQAGPSQSQ # SVKRSRANEEDPTGKCTSLLSWKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g415 ### # start gene g416 4 AUGUSTUS gene 1623127 1626834 1 - . g416 4 AUGUSTUS transcript 1623127 1626834 1 - . g416.t1 4 AUGUSTUS stop_codon 1623127 1623129 . - 0 transcript_id "g416.t1"; gene_id "g416"; 4 AUGUSTUS CDS 1623127 1626834 1 - 0 transcript_id "g416.t1"; gene_id "g416"; 4 AUGUSTUS start_codon 1626832 1626834 . - 0 transcript_id "g416.t1"; gene_id "g416"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPINVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYLMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGVRYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPAPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTTFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDHIRKASEREAQV # LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ # RHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLA # RLGIKSDLTSGYRPQSNGQTERANQEVEKYTRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE # ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNP # INGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g416 ### # start gene g417 4 AUGUSTUS gene 1626885 1628042 0.94 - . g417 4 AUGUSTUS transcript 1626885 1628042 0.94 - . g417.t1 4 AUGUSTUS stop_codon 1626885 1626887 . - 0 transcript_id "g417.t1"; gene_id "g417"; 4 AUGUSTUS CDS 1626885 1628042 0.94 - 0 transcript_id "g417.t1"; gene_id "g417"; 4 AUGUSTUS start_codon 1628040 1628042 . - 0 transcript_id "g417.t1"; gene_id "g417"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPRRQQISATAAPFTLFPNEPVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRAN # AMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g417 ### # start gene g418 4 AUGUSTUS gene 1629976 1630828 0.37 + . g418 4 AUGUSTUS transcript 1629976 1630828 0.37 + . g418.t1 4 AUGUSTUS start_codon 1629976 1629978 . + 0 transcript_id "g418.t1"; gene_id "g418"; 4 AUGUSTUS CDS 1629976 1630171 0.37 + 0 transcript_id "g418.t1"; gene_id "g418"; 4 AUGUSTUS CDS 1630482 1630828 0.95 + 2 transcript_id "g418.t1"; gene_id "g418"; 4 AUGUSTUS stop_codon 1630826 1630828 . + 0 transcript_id "g418.t1"; gene_id "g418"; # protein sequence = [MQLPASYPTRLPRGPDVASSDAEFDGEVLEGRERRRNAEGSDSDYRTDESSSESSDESDDSEGPSSAQTRRTHQSDLA # RVVTSRDGRIQAKEDDVRRQAKVQADEERARKKKDEERDDIIRRAAQEKEGTEFEGSLNSKNKTDLEDIAFSLGLDIDATAIVLKIRINAHFNTTPSL # KQDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g418 ### # start gene g419 4 AUGUSTUS gene 1633225 1633620 0.74 - . g419 4 AUGUSTUS transcript 1633225 1633620 0.74 - . g419.t1 4 AUGUSTUS stop_codon 1633225 1633227 . - 0 transcript_id "g419.t1"; gene_id "g419"; 4 AUGUSTUS CDS 1633225 1633620 0.74 - 0 transcript_id "g419.t1"; gene_id "g419"; 4 AUGUSTUS start_codon 1633618 1633620 . - 0 transcript_id "g419.t1"; gene_id "g419"; # protein sequence = [MLMIFQTSNNWLNVRGVPTHADIVMSFKVYSSGDIGIYDISFLLCNIYQSFLADDEPQFQICALSFNVGGDYSVGFAA # FAGVSAKWIERAETTPTFDIVPDLTETFVTTWPLCRDDLSAAKVVNLTLKESR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g419 ### # start gene g420 4 AUGUSTUS gene 1636264 1637285 0.58 - . g420 4 AUGUSTUS transcript 1636264 1637285 0.58 - . g420.t1 4 AUGUSTUS stop_codon 1636264 1636266 . - 0 transcript_id "g420.t1"; gene_id "g420"; 4 AUGUSTUS CDS 1636264 1636656 0.92 - 0 transcript_id "g420.t1"; gene_id "g420"; 4 AUGUSTUS CDS 1636703 1636967 0.7 - 1 transcript_id "g420.t1"; gene_id "g420"; 4 AUGUSTUS CDS 1637080 1637165 0.61 - 0 transcript_id "g420.t1"; gene_id "g420"; 4 AUGUSTUS CDS 1637283 1637285 0.65 - 0 transcript_id "g420.t1"; gene_id "g420"; 4 AUGUSTUS start_codon 1637283 1637285 . - 0 transcript_id "g420.t1"; gene_id "g420"; # protein sequence = [MVLKWNGIADNVTSLAPTSPTKRNLKKRNWCPSSYDYLAQQIYVGAEYDHRLMPDFGGPVFAMKKAKLIQPQWTNINN # DLIVPWEYYNYLRPGTVVVATICIEVFVMPVGSDNNTLRKIYHATITSLKVVADSDLVVLPPTPSIMRKNINHLLEPSSLAATALAAIDWSTSSTLPS # ASSSDQTLEDINDKIAGDEGGNSGYSSISKESSGITVPSTAAEDQTESGNEHNAIKGYIENTGESKKKRSRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g420 ### # start gene g421 4 AUGUSTUS gene 1637545 1637874 0.73 - . g421 4 AUGUSTUS transcript 1637545 1637874 0.73 - . g421.t1 4 AUGUSTUS stop_codon 1637545 1637547 . - 0 transcript_id "g421.t1"; gene_id "g421"; 4 AUGUSTUS CDS 1637545 1637874 0.73 - 0 transcript_id "g421.t1"; gene_id "g421"; 4 AUGUSTUS start_codon 1637872 1637874 . - 0 transcript_id "g421.t1"; gene_id "g421"; # protein sequence = [MSTSYAYLPGCIKTSSFENRGKPGGVYDKITAGFMKMGANAIANAELNRDFFRFNFAQAWSSNYSFRGIDSKQYTGNV # FGEIVGKAYGTHIGAQGNHFAGNDLNNVSTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g421 ### # start gene g422 4 AUGUSTUS gene 1641020 1643557 0.81 - . g422 4 AUGUSTUS transcript 1641020 1643557 0.81 - . g422.t1 4 AUGUSTUS stop_codon 1641020 1641022 . - 0 transcript_id "g422.t1"; gene_id "g422"; 4 AUGUSTUS CDS 1641020 1642119 0.98 - 2 transcript_id "g422.t1"; gene_id "g422"; 4 AUGUSTUS CDS 1642231 1643557 0.83 - 0 transcript_id "g422.t1"; gene_id "g422"; 4 AUGUSTUS start_codon 1643555 1643557 . - 0 transcript_id "g422.t1"; gene_id "g422"; # protein sequence = [MDIKFIGSGASAKAVLYYITNYITKSQLKAHVAYAALERAVRRLDEQCSTDSPFTIRAKRLLQKCAYSMISQQELSAQ # QVNTYLLDLDDHFTSHSYKNFYWTQFEHFVECQLPSHECRSSRKAYQNVEDTFGDKDVRDTCGDDTCQDDSDASHPPEFDDTPKAVNEYDIDDEVGIS # VGSEGFLIAKASQLDDYRYRPDAVEELSLWESIARCTKMRKAWSQQSYDASDEFDNENDLLAGDDNEALVDLPEDTCSDDGQRVPLSKLLDHRTRSHP # KFEFETGHPERLSHTFVLNSSRNRKVPVPIGPAIPRRDHENDWPRYCRLMLMFFKPWRNAVDLREQHESWADAFAVFNQTCDDEVKKMMDNMQILHEC # RDSRDDHFSSRASARRLRTSHGCGSSDQERSVEDDFLAEHDNELEILEHLLSIEGTNSRHVDLSKCEALSLDDCPEREQTWKDAYVTRKQLWQQKLVA # EPDNVNSNTNDYDCHIRNPDQPLDELDDAILRPPIHAFQPTGLVDIDDFVSKFTPPLNEEQERAFRLIASHTQQGKSDPLRMFIGGPGGTGKSHVISA # LKLFFEAQEESRRFRLASYTGVAAKNISGMTLHSALLLSTTTSAKVNSKSRQKLIAMWQGVNYLFIDEVSMLGCRFLLRISRALCQAKDNPAPFGGIN # IIFAGDFAQLGPVREQRLFSYIDTGRATTIHGQEIVFGKLLWLTVNTVVLLTKIMRQTGTENEAFVDLLSRLRTGSCTQSDYDILTTKVLSNVQPDWD # DPKWASTPTIVSSNRVKDLINERATETFAKRTGKPLHWYHSSDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g422 ### # start gene g423 4 AUGUSTUS gene 1643976 1646702 0.39 - . g423 4 AUGUSTUS transcript 1643976 1646702 0.39 - . g423.t1 4 AUGUSTUS stop_codon 1643976 1643978 . - 0 transcript_id "g423.t1"; gene_id "g423"; 4 AUGUSTUS CDS 1643976 1646702 0.39 - 0 transcript_id "g423.t1"; gene_id "g423"; 4 AUGUSTUS start_codon 1646700 1646702 . - 0 transcript_id "g423.t1"; gene_id "g423"; # protein sequence = [MDNLLAKSQAVSMSVDQLKLILEALNIRELIRPKQPRCQMLGLVHRYLSRICGAHIEAEKCANRMLPCSVLDVFKDFN # KLRFPVLLQYCLMHKLDVNVTTATAEDLRLQLTSHILSAECYTNVTVLSKSNSPGGCLSIATTFDPPVMNESTDIESASDFKRSLIHLLSTKLSLLTL # RNILQILEIPFNQNDTKHVLRHRLQVYNESVGVDLKCIEHEKKLRSLRTQWPSFVPQDFKHKLVERFRDCTSSQTLRKLVCASCSSEELATACHIVTS # DSIDLSLLKRPDMRSKKGFPSTVVDSNWLDSDCVAPHMDNIFEDSPGVVLDGKGVQTDEQNVATLCLCPVCHSALRNKKTPTLSLANHMYLGKVPDVL # KNLTVVEEAMISRCCAKSWIIQLKEADQIANRTTQRGLKGNIIVYPQKPTALAKILPPSLEELTAPICVIFVGSSQPSVEWLRNKAKPLTARPKVVRD # ALIWLKSHNKWYKDIVIDYDFLATLPDEFVLPVHVECVESGKCTDGLTAGYAPTHSSSSYPSVERETSDCHDEEVSFESVVIADVDANATMNELRAAA # MRHIKFKGGSYIEIPHDTEPMNEFFNPSLFPMIYPTLFPYGIGGFEDYSRSEPVSLKRHVKYLLNLSDRRFQEHYSFSFTAFNILQRRNMLLRTALKA # KKLSFPVLASQFASVTPSAIAAVSERFARGDMVSFRNSAEHTVLQLMQQVNLVTSSVPGSTSALVNMRNEIRALMIDQGLPSFYITINPADVYNPLVK # FLAGSDIDINCMLPKDVPEYWDQAVLVAKNPVVAAKFFNVYLNAFIHSLLGYDTSQQDLTGGVLGVVKGYYGCIEAQGRGTLHCHMMIWLEGGLNPNE # IRRRAIGCSERLLWLYRGSGPRNIALSYDDMVRRWVKSKRDSPTCY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g423 ### # start gene g424 4 AUGUSTUS gene 1648594 1650642 0.24 - . g424 4 AUGUSTUS transcript 1648594 1650642 0.24 - . g424.t1 4 AUGUSTUS stop_codon 1648594 1648596 . - 0 transcript_id "g424.t1"; gene_id "g424"; 4 AUGUSTUS CDS 1648594 1650642 0.24 - 0 transcript_id "g424.t1"; gene_id "g424"; 4 AUGUSTUS start_codon 1650640 1650642 . - 0 transcript_id "g424.t1"; gene_id "g424"; # protein sequence = [MHEQLSNLDGLPHEPLLDTPSKACRPPLFRAITPLSNSIALPFRSECQSTSLSVSDISLQNMDNLDEELDSKSQISVF # INLFAQKGPLDFYVFIEEDPGNDPGYADLESESDSDSDFGSEDDGDRSDIEDFCIPRSGACRGISRQGIPWDARKPPPESIALEALESLKWILEPRVG # KSKRRKVPEIDAWSKDHLEEIQRFLKLYTAKDSASKGQWTKSSEVIAVAKKGKFTRYGYSRGLRERARNFINERSPPQNPFGKHTKSRLQPDTKFAQD # ILAHLLTCGKYVKSQDIFDYLARPDVQLKHGLKHTISAATAKRWMRKLGYRFVKNHVGQYVDGHERDDVVKYRQTVFLPAWYSFENRMRSWDEQDLLE # YSLWSGRVIVIWYHDESIFYAHDRKKSQWVRNNESATPYAKGEGVSLMVADFVSADYSWLRSRDGKDSAQVVFRPGKNRDGYFDNDDILEQAQHAMDI # LTRDYPDEDHVLVFDNATTHLKRAPDTPSATKMTKFPSLFGIKVTAKGSDGKTLYSSSGKPQKKKIPMSGGQLPDGTPQSFYFPPGHAQEGMFKGMAI # ILEERGYGDWSMIRFECEKFKCDPTKQGNCCCRRKLYNEPDFVNGKSLLETACEARGFQCLFLPKFHCEINPIEQCWGRSKFWYRLLPMSKKEEDLKR # NMLNSLNNVTLKEIRW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g424 ### # start gene g425 4 AUGUSTUS gene 1652614 1652898 0.37 - . g425 4 AUGUSTUS transcript 1652614 1652898 0.37 - . g425.t1 4 AUGUSTUS stop_codon 1652614 1652616 . - 0 transcript_id "g425.t1"; gene_id "g425"; 4 AUGUSTUS CDS 1652614 1652898 0.37 - 0 transcript_id "g425.t1"; gene_id "g425"; 4 AUGUSTUS start_codon 1652896 1652898 . - 0 transcript_id "g425.t1"; gene_id "g425"; # protein sequence = [MPFGLHNNNNPTTTANNHTGRDTALGAGAGGFAGHEGHHGHTARDAALGGFAGHEAGHHGGGTATGTHGNRDGLIGAG # AGAAAGHGHGRESNFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g425 ### # start gene g426 4 AUGUSTUS gene 1654877 1656286 0.99 + . g426 4 AUGUSTUS transcript 1654877 1656286 0.99 + . g426.t1 4 AUGUSTUS start_codon 1654877 1654879 . + 0 transcript_id "g426.t1"; gene_id "g426"; 4 AUGUSTUS CDS 1654877 1655417 0.99 + 0 transcript_id "g426.t1"; gene_id "g426"; 4 AUGUSTUS CDS 1655496 1656286 1 + 2 transcript_id "g426.t1"; gene_id "g426"; 4 AUGUSTUS stop_codon 1656284 1656286 . + 0 transcript_id "g426.t1"; gene_id "g426"; # protein sequence = [MVRRDRSYSPDSSNKRVRHSHRSSPRSPSPTRRSSQRSSNRKYDDERDRDWDRDRERDRVRERDRDRDRDRDRDRERD # RDRDRYRDDRHKEDRRRDHRDDKRISPSRERDRDRRPASPRKDTPRDSPAPGATPAPATPEDDAIKAKRARLEAWKKQREAQKALGEAKAKAMALAGK # SAPPAPNNTNNNNVELPTKPALAAIKGLPAKPEFAAAGFKGLPVKPDFVSTKQLTMDDSVETKRKLEKLEDMPAVDMTMGGEGEPSVGDLEVDDDDEE # ANRMDLAIKKAAAASAAMDVVEEDEADPLDAFMSGVKEEVKKVNLEDMKKAVSSNGRLSRRMDQGDDEDDNVVEGPGPDELDTTELNPEDILALAAKK # AKKKDLAAVDHSRVKYESFRKEFYVPPPDIAAMTEEEADLLRLELDSIKIRGLDCPKPVVKWSHYGLPANW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g426 ### # start gene g427 4 AUGUSTUS gene 1656860 1658219 0.44 + . g427 4 AUGUSTUS transcript 1656860 1658219 0.44 + . g427.t1 4 AUGUSTUS start_codon 1656860 1656862 . + 0 transcript_id "g427.t1"; gene_id "g427"; 4 AUGUSTUS CDS 1656860 1657523 0.63 + 0 transcript_id "g427.t1"; gene_id "g427"; 4 AUGUSTUS CDS 1657609 1658219 0.67 + 2 transcript_id "g427.t1"; gene_id "g427"; 4 AUGUSTUS stop_codon 1658217 1658219 . + 0 transcript_id "g427.t1"; gene_id "g427"; # protein sequence = [MGFEPQVMKIINNVRPDRQTVLFSATFPKQMDSLARKILRKPLEITVGGRSVVAAEIEQIVEVRAEDTKFTRLLEILG # QMYNEDPECRTLVFVDRQEAADNLLRELMRKGYLCMSLHGGKDQVDRDSTIADFKAGVVPIVIATSVAARGLDVKQLKLVINYDAPNHMEDYVHRAGR # TGRAGNKGTCVTFITPEQDRYSVDIYRALKASNATVPKDLEELANAQAAGSGFGGKGLDRLDKERDAKEKAERKAYGEPEEEKPAVTEEAAPGGATAN # AAADDMTFGNFKVEIKRGPAPDSSKGLLGVAGAAAAARKLAHAKEEEKIQAQMRAAEEAAARAGKDSPAHKQALSVVAKLNAQLRASKLVLQSQLAFE # QQGGVVDKKNNPDSTDFHAIIPINDYPQKARWRVTNKETMVQVSCNWSILSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g427 ### # start gene g428 4 AUGUSTUS gene 1662232 1663539 0.89 - . g428 4 AUGUSTUS transcript 1662232 1663539 0.89 - . g428.t1 4 AUGUSTUS stop_codon 1662232 1662234 . - 0 transcript_id "g428.t1"; gene_id "g428"; 4 AUGUSTUS CDS 1662232 1662940 0.93 - 1 transcript_id "g428.t1"; gene_id "g428"; 4 AUGUSTUS CDS 1663009 1663177 0.96 - 2 transcript_id "g428.t1"; gene_id "g428"; 4 AUGUSTUS CDS 1663215 1663539 0.96 - 0 transcript_id "g428.t1"; gene_id "g428"; 4 AUGUSTUS start_codon 1663537 1663539 . - 0 transcript_id "g428.t1"; gene_id "g428"; # protein sequence = [MLLPSCLLALTFASIQVYAQLSLPSPPWLPANASAGAVATTGSNTSVPNEQWSTLLGDLLYFYEAQRSGKLPSNNRVS # WRNDSATSDGSDVGLDLTGGYYDAGGEDARNYIKVSFPLSFTLNSICWGGIDFGMGYDLSNQTSYLDSMLRWGLDWLIKMHPNTSTLHLTLPAGIDNA # YWGGDQNIPGPRPSFQINDTSPGTDAAAGVSAAFASCSYLYYGGTLSPTTIGKSSVNSTAPASLKNTTYADTLLTHAVELYGLAVNASGGMTLYQNSV # PEVQDSYASSGYGDELVMAGLWLSLAVNASQNANSTLNITTLSPQQYYSLAESYYSQFDLAGQNSVFNWDDKTAGTYILFAQMSSLGFEGAGNFSQWQ # TEAERYLDVVVDPSSSKGDASLTKGAFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g428 ### # start gene g429 4 AUGUSTUS gene 1664342 1667095 0.84 - . g429 4 AUGUSTUS transcript 1664342 1667095 0.84 - . g429.t1 4 AUGUSTUS stop_codon 1664342 1664344 . - 0 transcript_id "g429.t1"; gene_id "g429"; 4 AUGUSTUS CDS 1664342 1667095 0.84 - 0 transcript_id "g429.t1"; gene_id "g429"; 4 AUGUSTUS start_codon 1667093 1667095 . - 0 transcript_id "g429.t1"; gene_id "g429"; # protein sequence = [MAIDVPGQVSTSLASSVTLVSPASPKVGAVLEANFEELLEDPRVSASTVVEYISSRAKTTSSVYIYDLAEQVGFGTLT # KIWSKAQDGTAPVVDLQTRAGAGLSLVGRLSEGTSSDTANGAVLTAFTSPQGLSLMAPALSYLPPATASSRLVIQVPNITPAGETYALSPTLANFATV # LPILPENIVVLASATSQETVHFTQLSYQLSASHVIHIFDHFSSSREVGHATLPLPEKDYGNISVAEAIQRAGYSSFDYVGDAEAHTVVLALNGPLAVA # AKAIANKSRHGFAAVSVNVLRPWDEAALRSVLPVTVKTVHVLDDVPNATTKGPLYIDVFSTLLDSINPPTVHSHRITPSQTQVYISQKDSFKEFLATL # VPELEDPVPAIMKKLMFFTTPSTTLSNLPLLVEGALSTSRTLSSRLSIDHDVFSKRGGITASRILLAPRSALDSEDFPIPLVLPYDAQTSGEVDFLAI # MDQTILKTHSVLKYAKPRSTILIVTTWTAEELFSNLPVPVTRLIVERELRPFIINVTDVAEKLTSAIGQVQDVISNIVAYLAFMRMYLGAAATEENVL # TLAIGSYGETVEGVELTKLNSQTWDALEEVLFIEAPAEEKPVELKEFEFNAIAVETDEGDTVVNGARLGSWHDAAKHLLFPTIFAPPTESTDEEFPQH # PSLRPELPERTFLVTCTVNCRLTPKEYDRNVFHLEFNTSGTGLKYAIGEALGVHGWNDNQEVTDFCEWYGVDPNRLITIPVPGSEDKHHTRTVFQALQ # QQIDLFGRPPKSFYTDLAAYATSQADKYSLQFIGSAEGSSTFKKLSEKDTVTFADVLKLYSSARPGIEVLCELVGDIKPRHYSIASAQSVVGDRVDLL # VVTVDWVTPSGECGCPRIMISSHKASIYRLTEIRTVHAIPRRPSNWTESNCVHQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g429 ### # start gene g430 4 AUGUSTUS gene 1668727 1669281 0.66 - . g430 4 AUGUSTUS transcript 1668727 1669281 0.66 - . g430.t1 4 AUGUSTUS stop_codon 1668727 1668729 . - 0 transcript_id "g430.t1"; gene_id "g430"; 4 AUGUSTUS CDS 1668727 1669281 0.66 - 0 transcript_id "g430.t1"; gene_id "g430"; 4 AUGUSTUS start_codon 1669279 1669281 . - 0 transcript_id "g430.t1"; gene_id "g430"; # protein sequence = [MQYHNGFRQQVLSWPTNPADHYVETLSSYHVNTIVADLGCGDAAIARALIPKGISVLSFDLVSHSPYVVEADICGTLP # LPGSEGTEGSLSEGEAHIVDIVVFSLSLMSTNWPKSIREAWRILKPKYVTSSLIEDDSQFTILISGELKIAEVTSRFRNLENFVSLVSSIGFKLKSKV # SFHPFARN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g430 ### # start gene g431 4 AUGUSTUS gene 1669405 1669893 0.81 - . g431 4 AUGUSTUS transcript 1669405 1669893 0.81 - . g431.t1 4 AUGUSTUS stop_codon 1669405 1669407 . - 0 transcript_id "g431.t1"; gene_id "g431"; 4 AUGUSTUS CDS 1669405 1669893 0.81 - 0 transcript_id "g431.t1"; gene_id "g431"; 4 AUGUSTUS start_codon 1669891 1669893 . - 0 transcript_id "g431.t1"; gene_id "g431"; # protein sequence = [MPADPVPEAGSRKRKRPISDAGSETQSRIHSAEINLEKLVKKLTGKRDVGDARTNAASHSKPKPRRKTKESQPTAEVD # KKSISLPMPLMKASDRATKKTKRSHDSRPPDSEEQPERSSKDLDSSSGLTGMQKNMKQKLEGARFRLASKLTSDFALVVSYMPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g431 ### # start gene g432 4 AUGUSTUS gene 1674410 1676577 0.18 + . g432 4 AUGUSTUS transcript 1674410 1676577 0.18 + . g432.t1 4 AUGUSTUS start_codon 1674410 1674412 . + 0 transcript_id "g432.t1"; gene_id "g432"; 4 AUGUSTUS CDS 1674410 1674527 0.75 + 0 transcript_id "g432.t1"; gene_id "g432"; 4 AUGUSTUS CDS 1674607 1674903 0.47 + 2 transcript_id "g432.t1"; gene_id "g432"; 4 AUGUSTUS CDS 1675061 1675333 0.81 + 2 transcript_id "g432.t1"; gene_id "g432"; 4 AUGUSTUS CDS 1675468 1675596 0.68 + 2 transcript_id "g432.t1"; gene_id "g432"; 4 AUGUSTUS CDS 1675674 1675845 0.93 + 2 transcript_id "g432.t1"; gene_id "g432"; 4 AUGUSTUS CDS 1675957 1676145 0.84 + 1 transcript_id "g432.t1"; gene_id "g432"; 4 AUGUSTUS CDS 1676217 1676577 0.9 + 1 transcript_id "g432.t1"; gene_id "g432"; 4 AUGUSTUS stop_codon 1676575 1676577 . + 0 transcript_id "g432.t1"; gene_id "g432"; # protein sequence = [MSFFANNTGNSGQAGAGAAGGNIFGGGGNANAGGSTGTPTNKPAGSIFGGGNSTLNTGTGSGTNLFGGGGGSGTSTST # PLFGGASNTNTNTNTTNNASAANPTPALFGGSPFSLPKPTEQANAPKPATSSCTFFAVSHSPKPGENNASSTSAASAPGTGGTGLLGGGFFNKPATPA # TNTQAAPTPSTSSSPFSLGGNAVGSGTIPTAPSTPGPTTFGCRQQLRISDLLPRNLFGAPKPEEKKDGGAAGTGALSDQQLLAVKLMSCPAPSGGLTG # GLSGISTTTTSTAPAPPVAVQPPSMLRGKTIEEIVNKWSNELEAHVKEFNKFAAEVHVLAAEREQNEVDQSLDHIEQQQKDLAATLDAYEKVTEEIFG # GQGGSLRALDTGPADTERDKNYMLAADLQTHLDDLSGSLTQMIEAVNGLSISSGQSTSSDLSANGNDRSQEDPMAQISQILSSHLDSLQWIDGAVREI # EGKVTEVERRVGESGHGSSYGGGNSSGSGIGGVGVRSRSFRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/7 # CDS introns: 0/6 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g432 ### # start gene g433 4 AUGUSTUS gene 1680630 1681130 0.98 - . g433 4 AUGUSTUS transcript 1680630 1681130 0.98 - . g433.t1 4 AUGUSTUS stop_codon 1680630 1680632 . - 0 transcript_id "g433.t1"; gene_id "g433"; 4 AUGUSTUS CDS 1680630 1681130 0.98 - 0 transcript_id "g433.t1"; gene_id "g433"; 4 AUGUSTUS start_codon 1681128 1681130 . - 0 transcript_id "g433.t1"; gene_id "g433"; # protein sequence = [MHYPAGSALPYPFTAILRAQPLSVHSPQLRFNVLGQKGSYIKYGVDVQEEQLKSLTAVPVTATSTSTASLTPENLITS # PSLGYGLEPEILWGALEHATDPVGTTFVKSVWPSEEPGCYADLYRNLAAAIREGVETKVKWEEATAVIEMIELAKKSAKEGRTVDVPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g433 ### # start gene g434 4 AUGUSTUS gene 1682795 1685005 0.21 + . g434 4 AUGUSTUS transcript 1682795 1685005 0.21 + . g434.t1 4 AUGUSTUS start_codon 1682795 1682797 . + 0 transcript_id "g434.t1"; gene_id "g434"; 4 AUGUSTUS CDS 1682795 1683470 0.93 + 0 transcript_id "g434.t1"; gene_id "g434"; 4 AUGUSTUS CDS 1683543 1683808 0.35 + 2 transcript_id "g434.t1"; gene_id "g434"; 4 AUGUSTUS CDS 1683895 1684194 0.56 + 0 transcript_id "g434.t1"; gene_id "g434"; 4 AUGUSTUS CDS 1684268 1685005 0.95 + 0 transcript_id "g434.t1"; gene_id "g434"; 4 AUGUSTUS stop_codon 1685003 1685005 . + 0 transcript_id "g434.t1"; gene_id "g434"; # protein sequence = [MEQPRENVLATETPIPQQKQSQDLPVVAKTPASHEITTAEDAVPQRGSVLTEFLEDVRDRVVLSLDDFATLILNISAD # WKVEEEFSLRPESKIVQDAFEASLKVAIGAAEGAGKKGTDPIAHEKELHRPLRNLLNTLRDGEGHLGKDINEETLFVDPRPVLAFLLERKSDLSGIYI # QLQELLENRSLSDYLAERNITGIFWGLLISFVEVGCQKKDFVELNIRKEAANRSSQFMVSTPSQHGTTEGSQTAFSRSRSPPSSSQTEAIYHKLNKRV # RSNDEVGPASIGTLFIHLTETWYQYLFSHAASKEGEIPVHLGTEPKIEDCPASAGRIQSDALPATPHPVSPHSASTLASAPTHLLCEDEDRLHVNIWS # EDKKKTVEIATVQEYAQKDGMKSFGNHIEFSSRGVEDNGKQFFSFHVQSFKNDEWKKLFIVMVCQLKTLPRTTKNAGSIPTLYIDGIEYLQDPELFSH # TFALDTQDLIDAIYSFVGTDGCSRKVIIESILHHAEDAVGLYAVVAEVECLCMEADCTWNGERKIVKISFMGTDRQSEQGLIGEARSKAESTGELWAL # NHLPNAIHSLSLLPNKKKTFHRRLKTYLKDKYEERVMHITVFEKLHPLSELEDPRDFAQVFYDVLQSTPPFNSMYHHLTKPHMSSSSPMAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g434 ### # start gene g435 4 AUGUSTUS gene 1686155 1687480 1 + . g435 4 AUGUSTUS transcript 1686155 1687480 1 + . g435.t1 4 AUGUSTUS start_codon 1686155 1686157 . + 0 transcript_id "g435.t1"; gene_id "g435"; 4 AUGUSTUS CDS 1686155 1687480 1 + 0 transcript_id "g435.t1"; gene_id "g435"; 4 AUGUSTUS stop_codon 1687478 1687480 . + 0 transcript_id "g435.t1"; gene_id "g435"; # protein sequence = [MEAPPETKLATPTPLPQQKQPDAPPIVGSTFESNGTAYHTRNDAPQHTSALTKFLEDDANERVVFSLDEFVTFILDLP # TDWKVKEEFSLPPTSTAVTEALGAYLKVAIKIAEGKRKKWRNAATNEIELNQPLTKVLDTLKGREEQLSRELDEEVFRVENPHLVLGSLLKRNPGLGG # IYNQLLKLTENKKLSTYLAEKNIFGVFWWLLLLFAELKLKKSFAEPDIQTESTSHGTPVNESSQSSVIEGLRPGSTVAPQALPIPSNLSLSGRPSHPK # SNKRLRSNEELDSTSMCPLLTLARLGTDKCFQSSGRTRSLNLVQRPGQSHEPLEDLREVQREKVRHNLTFGIRIDVEIVKVKHPNPPPAVEIQSVAST # PFPSTPSTPTATSFEGRDGPRVTIQCKNKTKTVIATLQEARAEGMSRAEQNVIQAQGQHPTSRKCDDFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g435 ### # start gene g436 4 AUGUSTUS gene 1691932 1693914 0.61 - . g436 4 AUGUSTUS transcript 1691932 1693914 0.61 - . g436.t1 4 AUGUSTUS stop_codon 1691932 1691934 . - 0 transcript_id "g436.t1"; gene_id "g436"; 4 AUGUSTUS CDS 1691932 1693914 0.61 - 0 transcript_id "g436.t1"; gene_id "g436"; 4 AUGUSTUS start_codon 1693912 1693914 . - 0 transcript_id "g436.t1"; gene_id "g436"; # protein sequence = [MDEDSIKLTAITTPFGLYEWTVMPQGLKNSPAIHQHRVTLALRHLIGKICYVYVDDIIIWSNSVEEHVTNVEKVLLAL # RIARLYCNPNKCDLFMLNVHFLGHTISADGIAADDKKVDRIMDWPTPKMLKELQAFLGLVRYVAAFLPRLAELTEILTALTANVVDKNHLPWEACHQN # AFEAVKLLVSSRECLTVIDHDKLDTHKIFVTTDASNRCSGAVLSFGETWELARPVSYDSSTFKHAELNYPVHEKEMLAIIRALKKWRVDLLGVPFIIM # TDHRTLKNFHSQPDLSRRQARWMEFFSQFDCKIVYVKGERNTVADALSRRTDLLDPVKCHPYLDASADAIPTSRHPYAYCADSDDDLDLPILCVLPDS # CWSTARMLALRDPPDPPSPIAMTLEISSDPTLLDDIRNGYTTDAWCKDLPSMASSMPLIRHDKTSKLWYIGDRLIIPRVGHIREELFRLAHDNLGHFG # FDKSYAALRECYYWPHMRRDLSKAYIPACDECQRNKSTTQKKAGPLHPLPIPDRRFSSVAMDFIGPLPEDGGSNCILTITDRLGLTSAFSLAEPTSLL # QIAPNFSLTPGTARMVSPTILSVIVTIFLFPNFGKPSGVLPVFACACLPHTTPSPMVLVSEAIRRSSKCCVTTSNGTKRAGNEPCLVSASKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g436 ### # start gene g437 4 AUGUSTUS gene 1695058 1695828 0.88 + . g437 4 AUGUSTUS transcript 1695058 1695828 0.88 + . g437.t1 4 AUGUSTUS start_codon 1695058 1695060 . + 0 transcript_id "g437.t1"; gene_id "g437"; 4 AUGUSTUS CDS 1695058 1695828 0.88 + 0 transcript_id "g437.t1"; gene_id "g437"; 4 AUGUSTUS stop_codon 1695826 1695828 . + 0 transcript_id "g437.t1"; gene_id "g437"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQSDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPTLWTLMQPIPVMGILGKHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g437 ### # start gene g438 4 AUGUSTUS gene 1696274 1698532 0.89 + . g438 4 AUGUSTUS transcript 1696274 1698532 0.89 + . g438.t1 4 AUGUSTUS start_codon 1696274 1696276 . + 0 transcript_id "g438.t1"; gene_id "g438"; 4 AUGUSTUS CDS 1696274 1698532 0.89 + 0 transcript_id "g438.t1"; gene_id "g438"; 4 AUGUSTUS stop_codon 1698530 1698532 . + 0 transcript_id "g438.t1"; gene_id "g438"; # protein sequence = [MFTTSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g438 ### # start gene g439 4 AUGUSTUS gene 1702529 1703375 0.96 + . g439 4 AUGUSTUS transcript 1702529 1703375 0.96 + . g439.t1 4 AUGUSTUS start_codon 1702529 1702531 . + 0 transcript_id "g439.t1"; gene_id "g439"; 4 AUGUSTUS CDS 1702529 1703007 0.99 + 0 transcript_id "g439.t1"; gene_id "g439"; 4 AUGUSTUS CDS 1703117 1703375 0.97 + 1 transcript_id "g439.t1"; gene_id "g439"; 4 AUGUSTUS stop_codon 1703373 1703375 . + 0 transcript_id "g439.t1"; gene_id "g439"; # protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVLCQIDERKTLLRLTNRGHINLPFAADVPKTD # RNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGATL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g439 ### # start gene g440 4 AUGUSTUS gene 1716470 1717489 0.6 + . g440 4 AUGUSTUS transcript 1716470 1717489 0.6 + . g440.t1 4 AUGUSTUS start_codon 1716470 1716472 . + 0 transcript_id "g440.t1"; gene_id "g440"; 4 AUGUSTUS CDS 1716470 1717489 0.6 + 0 transcript_id "g440.t1"; gene_id "g440"; 4 AUGUSTUS stop_codon 1717487 1717489 . + 0 transcript_id "g440.t1"; gene_id "g440"; # protein sequence = [MLSWFAQTCMENKFTPFLAPAPSQPKALPIFTTERSSVSMVFLFTLNPTADPSFAAKLMRSLLARLGIKSDLTSGYRP # QSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKK # QQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYL # EDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAVNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g440 ### # start gene g441 4 AUGUSTUS gene 1718574 1719842 0.51 - . g441 4 AUGUSTUS transcript 1718574 1719842 0.51 - . g441.t1 4 AUGUSTUS stop_codon 1718574 1718576 . - 0 transcript_id "g441.t1"; gene_id "g441"; 4 AUGUSTUS CDS 1718574 1719842 0.51 - 0 transcript_id "g441.t1"; gene_id "g441"; 4 AUGUSTUS start_codon 1719840 1719842 . - 0 transcript_id "g441.t1"; gene_id "g441"; # protein sequence = [MPNVYSSMLDDTVTYAKWKPCGNGMPGTMSCGKITVETLEAAKRDLRIFLTNNRKLAASDYALRCLNVWEDPRVSNWI # DQNREKFSALSFDKLFIAVRDRVLEPDWQDSTFRQMRAVRMPDDLSTSASDLAVQLMVLNNLLQGTARFQSEESLKMMLIDAIDSGLREAFNKELEDH # AANPVHGIHSNDFHTFTRAIQVLDNGRHRQLLMARQMAEHMIRSRPTSRANTPLTSSSVANAQGRRGGGTGSTTNTGRLPPLTTNERHLLSENEGCFK # CRSFFVKCRTSSTEHEFPLPIGNGYKELTVADVTAARKLRGMNPDLNKKPRTAAIASIGVTDDGDDDDVVASIMPSAVLGDGTDSEEEVSCPFRVHHL # QWKCHVSGPITSLPRFCVKEKGRNLMGTPTNQSNTQYASSLLSNLFNSKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g441 ### # start gene g442 4 AUGUSTUS gene 1722018 1723258 0.57 - . g442 4 AUGUSTUS transcript 1722018 1723258 0.57 - . g442.t1 4 AUGUSTUS stop_codon 1722018 1722020 . - 0 transcript_id "g442.t1"; gene_id "g442"; 4 AUGUSTUS CDS 1722018 1722829 0.99 - 2 transcript_id "g442.t1"; gene_id "g442"; 4 AUGUSTUS CDS 1722931 1723258 0.57 - 0 transcript_id "g442.t1"; gene_id "g442"; 4 AUGUSTUS start_codon 1723256 1723258 . - 0 transcript_id "g442.t1"; gene_id "g442"; # protein sequence = [MANILDASALTSLIPTLLPPNQKSLQSPQDALAVLSHAILSSLAFRLIAVDDSNNNNEINSNSLPENWNSHGPGGYTF # RYKHEQSSLEFVVKLTKLGKRTVVNAIAVEVHDFTSPSSFPYILNTDTNSSSSSSPLVHCYISSSRITDFVSQFKLKIIQKLVPGLRKDGYTEEVDLD # DKSSTSTTNNTHSLNPVRPGPSRTIPRYNPDEEEFPMRFPPPRNPSSHIAPNNPLEIGRRDLDPIPGGSFQPPPLFPQSGSGDGMFVGPDHPIFGGRI # GQGQGSGGGFGPGIGGGGIGGIGGRGPRWGGDGFLPPMGAPPGARFDPVGPMFGPGPGGVGIGPFPGGGVSGIGSSGTGRRPHNLPGQGDPDNDEFMP # PGAVSNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g442 ### # start gene g443 4 AUGUSTUS gene 1723449 1725783 0.61 + . g443 4 AUGUSTUS transcript 1723449 1725783 0.61 + . g443.t1 4 AUGUSTUS start_codon 1723449 1723451 . + 0 transcript_id "g443.t1"; gene_id "g443"; 4 AUGUSTUS CDS 1723449 1723983 0.67 + 0 transcript_id "g443.t1"; gene_id "g443"; 4 AUGUSTUS CDS 1724075 1725783 0.87 + 2 transcript_id "g443.t1"; gene_id "g443"; 4 AUGUSTUS stop_codon 1725781 1725783 . + 0 transcript_id "g443.t1"; gene_id "g443"; # protein sequence = [MNNLRPYAHLGTIEESGLSDTQLNGHEEDAEEDRFVYDGESRSVSQSPSHREEEEEEEFVYPGLNAEDTTPLSPQESP # KPLTPPTISELSSRPRSDPLSESLPDLVLQAQPQEQAPQPLRTHPTPAQLESSYAASSSGDLSLLQKIFVTAHETGGISAFSLANDASTRTGLTALHA # AAKSCGAMSDLEDKEGETALHKAALNGHLHIVKYLLPSKHAANSSDALSRASVHAQDADGWTALHNACSKGYLDIVRYLCEEGGATESVDDDDSDQPP # ANGVNIRSKAGYTPLMNASSKGHLPVVRYLLSKQHADPLVRNNWGETAYDVAAAVFEVWICEVLERAEREWWYNRNSAHSNPNSPSKIPYNSLAIHTT # IPLVLYENQRLDARLKTLATSGGKPRFSASGLGRRGRRAPFELRILSVDDDNKRQNEGNEDSTVNNNIYQRNTTIPAWRSTVQLPLLDSPYSLPRPGS # YHSQSQGSTGPDRSQEEKSHFWLSDWTLDVTHPGVDADQGWQYARTFEDPEEDWTPEVTGALGRVLGGGLGGLSGVLRTPPGLGRSSSNSDSRSGSGS # NSTSATPTPTTYVRRRRWVRVMRRRLDIPSLPFLFPDGKMYLVREDGGLVRYIHHPNVSDEDASHPRSPAYWDPNASPDEVAYSYGEEGHQEGQELST # IPSRSSKAQDYVSRARYLVGSQTYGLDSDGIQNGDNAGGSLSAVDARRTIAKLERATMELRLGVSGKYFTINSSSLPCVVF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g443 ### # start gene g444 4 AUGUSTUS gene 1728197 1729533 0.29 - . g444 4 AUGUSTUS transcript 1728197 1729533 0.29 - . g444.t1 4 AUGUSTUS stop_codon 1728197 1728199 . - 0 transcript_id "g444.t1"; gene_id "g444"; 4 AUGUSTUS CDS 1728197 1728821 0.67 - 1 transcript_id "g444.t1"; gene_id "g444"; 4 AUGUSTUS CDS 1728911 1729533 0.3 - 0 transcript_id "g444.t1"; gene_id "g444"; 4 AUGUSTUS start_codon 1729531 1729533 . - 0 transcript_id "g444.t1"; gene_id "g444"; # protein sequence = [MICQLKKLPTEKLVFVPTLVLNGFDYLRDPEQFLQEFADDPQDLIDAVYSFKEIDGRTRKVIIKSILYHAKDFVGLHS # LIVDVECLCTKTGCKWHGNEKKVMKISFMGTARQSEQGLIGEARSKAESTGEVWALNHLPNAIHSLSLLPNRRKASHRRLKKALKEKYEEQAMHVTVL # EQLHPLSELEDPRDFAQVFYDVLQSTPIFHSISGNIMFRRKDGKIYGVLNDFDLSSRVEDMDNGDIRTGTRPFMSLDLLNSYWEGGHLYRHDLESLFY # IILCLACRYEAPGVPATEPRAYSKWFSGSDQDILGNKNTFLTSPFLLAQDLPIQPYFAHFVPWLKRIRYFISEGYHARPRPQLEPVDDTDILDLPEDM # QPQASFNWQTLGGQVTYSRFRRVMSSFKDEPLETRWSDGQAPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g444 ### # start gene g445 4 AUGUSTUS gene 1729958 1737081 1 + . g445 4 AUGUSTUS transcript 1729958 1737081 1 + . g445.t1 4 AUGUSTUS start_codon 1729958 1729960 . + 0 transcript_id "g445.t1"; gene_id "g445"; 4 AUGUSTUS CDS 1729958 1730107 1 + 0 transcript_id "g445.t1"; gene_id "g445"; 4 AUGUSTUS CDS 1730155 1737081 1 + 0 transcript_id "g445.t1"; gene_id "g445"; 4 AUGUSTUS stop_codon 1737079 1737081 . + 0 transcript_id "g445.t1"; gene_id "g445"; # protein sequence = [MIWKGLILSWVYKFGSLAKDLVAQIFFWPYPVFNPPSAFRYPFFHLGLRWARFRHLLFPLEAHSVSNCGFVSPVSHWL # SAFTSSTHVPTQAALTHGLPIAAPQLALRPSDNMKLAHAPSGSCTPTASSSTLTDQPCVRSLSKHDGIYSAESLTGSCATVASSSSLPDQLTASLSSM # QLLRASLLCNSITGIRCSAFVQDISCLTRYAALHGINLQGIVDPRACRLAVLHHILTGHCFAYNDNASTNPHACRSFAADFTSKSDYYRSIADLVRSS # KAADLPVDKLKIMLESVCIKDIYHTRDTRRQMLRSLQRYLSRVQNMNVDESKALPSRATDILIGLDKFPISVLLLYCRQHGVEVSIATATVARVRDLL # GRHLVTGTCYGKHDLVGCRSVVESFFPSGTTKNQGDEFRILLLDLLRKNMNLTSLRTILDILEVKRGKTDNKKELQRRLRLYVDEIASVSDSKRDIAR # SKLEQIKNMWPALVPITVKEQCVRNFIELTSTENLKMFTCASCSVEDLKANACEVDHGSIDMTLLNAPNVRSSSKFPSVVVDSNWLDEQCLPPDIPTP # LAEHPEAILDNNGIKILEDGRKMLLLCRSCHSALKNNKTPALSLANHLFVGEVPPELKELTVVEEAMISRCRAKSWIIQLKEENGFVTPTNQRGLKGN # IIIFPQKVSSVIKTLPPSLEELSQPICVIFVGSSRPSDEWLRKQARPLTVRPAKVRAALMWLKMHNKWYKDIEINNDLLHSLPHEFSLPVHVEHVVPD # DMNESLTAGYDRSSINPDELQGTGPSFESVVIADVNGNATVNELRAAAMRHIKKGGSYAEIPHEVNPVNEFFNPSMFPMIYPTLFPFGIGGFEDHHRA # CPLSMKRHVKHLLSCRDRRFQEHYSFPFTVFNILQRREMLLSTALKTKRSNFPFLAKQLATVSATAVSAVARRLALGEPVLFRNSEEQLVSKLMEQVN # LVTSNVPGSSSSLVNMRNQIRALMTDQGLPSFYVTINPADVYNPVVKLLAGNEIDIDNMLDSEVPRYWDQATLIAKNPVVAAKFFNIYLRSFLSALLG # YDPSQENLTGGILGVVKAHYGCIEAQGRGSLHCHMMIWLEGGLNPNEIKQRAIEDPESDFCARLIQFLDESISNSVPPLPNEPVHVPSDDKHPCSVRG # TIMEGFDRSTMTSETAKQKDVHNLVMKCQVHTHSGTCYKYCKGNTHPKQCRFGLDASNTEPITYFNPANGELTLRCLDRLVNNFNEFIIRTIRCNMDI # KFIGSGASAKAVLYYITNYITKSQLKAHVAFAALERAVTRLNEQDVDDDPLTVRAKKLLQKCAYMMISQQELSAQQVCTHLLGLEDHFTSHSYRNFYW # ISIERFLDSQVPSPECIVPKKPQELFESMLDDESERTTIPTTADALIERDVADCEIEDQSDDEDDEVTLTLDNNGGLVAKASPLDDYRFRPREVEGLC # LWEAVARCKKIRIPAKKIRADATSELQDLVDIEESEDNIEYAEHDTTNDEISNPLDEILDSDARIRPKFRFVAQHPEYESHLYVVEDSKTRKVPVPIG # PTIPRRDRENVRPRYCRLMLMFFKPWRNGIDLREDHQSWEDAFDVFMESCSIRIKAIMDNMQILHECRDSRDDHFANRANARRLRTSFAENEAQNPHG # EHEDDFQPDIDQETDIINHLLSIEMTHSDAAANANGEALDCVNHMDASGAFCRDELATSSSADHENVSLVVKITDENPAHEQAWKDAYESRKQDWKRK # ATADLSVPVLVEGTTYDGSIRHIEGVTSVNEDAVIQGGLYKQYEADKVDVDEFISQYTPRMNTEQERAFRIVASHSQEKKPAPLRMYLGGPGGTGKSH # VISALKNFFEQQEQTRRFRLASYTGVAAKNIAGMTLHAALSLVSNSNMKRNSKSHKDLIAMWHGVDYLFVDEVSMLGCRFMLKISRALSKAKQNDLPF # GGMNVIFAGDFAQLGPVRDPRLFSFVDTSRVGTVSGQEAVFGKLLWLAVTTVVILTVVMRQGGDANSSFVDLLQRLRTGSCTVDDYAILNNRLLSVVA # PDWNSKKWEHTPTIVSNNRIKDLLNERATEAYARRTGQKLHWYYSVDTHLGHPVENHVLQGYLNGLDSGKTNQRLGRLPLVIGMPVMITQNFDVESGV # VNGCQGILKSVRYRVDDQGFRHAISCMVEAKDTNARESLPFLSCNQHVAVIEDKISMSFTHEYTKKRCNFQRTQLPLAPAFAMTAHKAQGQTLETAVV # DFESCRGTEAPYVMASRVKSLDGLLILRPFQLKKIQCRQSEDSRKEHTRLNILALHTTMSHGSVGEQAEARVKVASYKWQPSSVPDEDLTSASRLAEI # QIGLKNCAEIGDGEDPGRKVCSFSFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g445 ### # start gene g446 4 AUGUSTUS gene 1738839 1739126 0.95 + . g446 4 AUGUSTUS transcript 1738839 1739126 0.95 + . g446.t1 4 AUGUSTUS start_codon 1738839 1738841 . + 0 transcript_id "g446.t1"; gene_id "g446"; 4 AUGUSTUS CDS 1738839 1739126 0.95 + 0 transcript_id "g446.t1"; gene_id "g446"; 4 AUGUSTUS stop_codon 1739124 1739126 . + 0 transcript_id "g446.t1"; gene_id "g446"; # protein sequence = [MPQVYQAIINSLKVVAKSDVPVATPVAALMGTEGSLSPRRTSAALKAFDAIGSSSKCSSTMNKPTNEANAFDFSPSDE # DMVDDNNTIAHKKSKTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g446 ### # start gene g447 4 AUGUSTUS gene 1741170 1741637 0.5 + . g447 4 AUGUSTUS transcript 1741170 1741637 0.5 + . g447.t1 4 AUGUSTUS start_codon 1741170 1741172 . + 0 transcript_id "g447.t1"; gene_id "g447"; 4 AUGUSTUS CDS 1741170 1741637 0.5 + 0 transcript_id "g447.t1"; gene_id "g447"; 4 AUGUSTUS stop_codon 1741635 1741637 . + 0 transcript_id "g447.t1"; gene_id "g447"; # protein sequence = [MNILTHRAAYCLFPQLTLEDKTTLLIDLVSPLTEIQTAAVRKYALRGFTIIHQAPTSMACNANSALTFLRPRRVGDKH # CFKINFEHLGKGAPKPDYIEANTWGLAYLRKFNTMDTSRIDIASPIPFLAFTQDLLNIERGIEKLNDSDRNFRSAFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g447 ### # start gene g448 4 AUGUSTUS gene 1743726 1744430 0.92 + . g448 4 AUGUSTUS transcript 1743726 1744430 0.92 + . g448.t1 4 AUGUSTUS start_codon 1743726 1743728 . + 0 transcript_id "g448.t1"; gene_id "g448"; 4 AUGUSTUS CDS 1743726 1744430 0.92 + 0 transcript_id "g448.t1"; gene_id "g448"; 4 AUGUSTUS stop_codon 1744428 1744430 . + 0 transcript_id "g448.t1"; gene_id "g448"; # protein sequence = [MADRFVHPYSPYSSINLSTSPAEEIFVGAEYDHRLMPDFGGPVFAFEKAKLIQPDWRDVNGDLIPPWLNHKLLRPGTL # VVANISIQVYVMISKSGDGMVRKVLPVFFVILLGFDRTFDFVQIYHAVLNSLRVVGGSDVLITPPVPLLHRSSLPKQNTSQTAAALALAALNFNVEQS # TGASSSLAFSDTPGSDSTVDSDNLDAACDHEVHRSAKDGGLEAANVEGRPSPKKKLRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g448 ### # start gene g449 4 AUGUSTUS gene 1751610 1752719 0.5 - . g449 4 AUGUSTUS transcript 1751610 1752719 0.5 - . g449.t1 4 AUGUSTUS stop_codon 1751610 1751612 . - 0 transcript_id "g449.t1"; gene_id "g449"; 4 AUGUSTUS CDS 1751610 1752719 0.5 - 0 transcript_id "g449.t1"; gene_id "g449"; 4 AUGUSTUS start_codon 1752717 1752719 . - 0 transcript_id "g449.t1"; gene_id "g449"; # protein sequence = [MPPYRFSLNQLNNETSRHSPHTSTQPQTHDQLSEAAKRAIQSAVSKKTIIRRYNYQGLYIDWCELNKIPPKHIVDPSE # TTLCNYAASFMGREAGGTVRAKLAAVKNLVTTKGNGWRGGSRLREVLNGVEREAPPSSFRQERDPVKEEWLNLLHDEMAEVGRNEFNSCVVACADTLF # YGQLRLGEVLPTSSLTSKYINSKLPFLSDLSITATPSDKSSAKLRLPCTKTQQSRGESAVIINHSARTNPVRALSRHIEVNRLTASDPLFSYRLANDS # LQVLTKKDFLHYCNRVWSRAGINRITGHSFRIGGTTHYLTKGIPPDVVKAMGRWKSDAFLKYWRNLDTLASIHVHRLHVRQDLHRRTLHRRSAPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g449 ### # start gene g450 4 AUGUSTUS gene 1752881 1754842 0.6 - . g450 4 AUGUSTUS transcript 1752881 1754842 0.6 - . g450.t1 4 AUGUSTUS stop_codon 1752881 1752883 . - 0 transcript_id "g450.t1"; gene_id "g450"; 4 AUGUSTUS CDS 1752881 1754842 0.6 - 0 transcript_id "g450.t1"; gene_id "g450"; 4 AUGUSTUS start_codon 1754840 1754842 . - 0 transcript_id "g450.t1"; gene_id "g450"; # protein sequence = [MSVTFAAAISTTGPDMNTLVMNSLPSPIPAIGSSKIPRKVFVLASMDSTAAPGTPKPATSNTGAVGVVRLPTVPKGTT # NAAFPISTRLRAEAWEAALIQAGLFDEFSDVPKGIREGFRIGIEDVFLSRTFIPDNHFKSDIEANIVRSKFIEEIQLGRLSPGFAPDHLESLIGPFRT # APMAVLEQKPGKFRIIINHSYPQSEFPNALEARSALPDTMIIDPSKISINSLIDSDDYPCDWGTFADCYLQVAVAPDGTQVAVFDVDAAFRNVPLHES # TRRFVALFIDNLVFLDLCLNFGKCSAPGIWGRIADVMVKILRSRGIEALLKWVDDFIFFRFPKSKAADGSFTYSYDESLIWSVAEELGWPWAPQKFVP # FSSSFLYIGFLWDLKNKTVQLPLNKKIKYADRVLPRTAPDAVMSLDKAEELIGTLNHVCLVLPTGRTRLVSLYKFRASFKSSRSPLATHRIGLLLRED # LVWWLNTLQANFVGMTIFTLPDYLDISLFVDASTSWGIGLVLNGRWLAWEFKPDWSSPERKIGWAEMVAVELAIRTLVSTGISNARVIVRSDNEGVVG # SLRKGCSRGSEQNFILRKIIELMQAHSIWVECNWVSTHENPADDPSRGIFPPRKQLHPHPPAVPRHLFQYINNSISPSDIRIRQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g450 ### # start gene g451 4 AUGUSTUS gene 1755895 1756515 0.66 - . g451 4 AUGUSTUS transcript 1755895 1756515 0.66 - . g451.t1 4 AUGUSTUS stop_codon 1755895 1755897 . - 0 transcript_id "g451.t1"; gene_id "g451"; 4 AUGUSTUS CDS 1755895 1756392 0.71 - 0 transcript_id "g451.t1"; gene_id "g451"; 4 AUGUSTUS CDS 1756495 1756515 0.66 - 0 transcript_id "g451.t1"; gene_id "g451"; 4 AUGUSTUS start_codon 1756513 1756515 . - 0 transcript_id "g451.t1"; gene_id "g451"; # protein sequence = [MKNWILQSHKPLRDLRDFQREKVRHSLTFGIRLDVQTVKVKHPDPLLNMHLDQLPAVEIQSDASTPLPSTPSTPAITS # LKQKDRPRVTIQSTNRTKTVEIATLREARAEGMSRAEQNVIQTQGQHPTRKCVTEMILTESMNHGFSFAQYRGSEVESEVSVSFHYSSNGRSWK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g451 ### # start gene g452 4 AUGUSTUS gene 1756631 1757335 0.89 - . g452 4 AUGUSTUS transcript 1756631 1757335 0.89 - . g452.t1 4 AUGUSTUS stop_codon 1756631 1756633 . - 0 transcript_id "g452.t1"; gene_id "g452"; 4 AUGUSTUS CDS 1756631 1757335 0.89 - 0 transcript_id "g452.t1"; gene_id "g452"; 4 AUGUSTUS start_codon 1757333 1757335 . - 0 transcript_id "g452.t1"; gene_id "g452"; # protein sequence = [MEAPPETKLATPTSLPQQKQPDAPPIVGSTPESNGAAHPTQDDAPQRTSALSKFLEDDVHERVVFSLDEFVTLILDLP # TDWKIKEEFSLPPTSTAVKEALGAYLKVAIKIAEGERKKWRNAATNEIELNQPLTKVLNTLRDGEGHFTKDNDEGIFCIEDPHLVLGSLLERNGIYSP # LLKLTENKKLSTYLADKNMFGVFWGLLLLFVEVNLRKKGFADPNIQRAGMLQGLFPFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g452 ### # start gene g453 4 AUGUSTUS gene 1757958 1759292 0.97 - . g453 4 AUGUSTUS transcript 1757958 1759292 0.97 - . g453.t1 4 AUGUSTUS stop_codon 1757958 1757960 . - 0 transcript_id "g453.t1"; gene_id "g453"; 4 AUGUSTUS CDS 1757958 1759292 0.97 - 0 transcript_id "g453.t1"; gene_id "g453"; 4 AUGUSTUS start_codon 1759290 1759292 . - 0 transcript_id "g453.t1"; gene_id "g453"; # protein sequence = [MICQLKNLPTEKLVFVPTLVLNGFDYLRDPEQFLQEFADDPQGLIDTVYSFKEVDGRTRQVIIKSILYHATDSVGLRS # IIVDVECLCTKPGCEWHGNGRKIVKISYMSTTRTSEPRLIKEVRLKAESTSELWALNHLPNPIHSLTLLPNRRKASHRRLKKNLKEKYKEQAMHVTVH # EQLYPLSELEDPRDFAQVFYDILQSTPPIFDLMYPHHLTGPCALTYIAHQWLYECGGILHRDLSSGNIMFRRKDGKIYGVLNDFDLSSRVEDVDNGDI # RTGTRPFMSLDLLNSYWEGGHLYRHDLESLFYIILCLACRYEAPGVPATEPRAYSKWFSGSDQDISGYKNTFLTSPFVLAQGLPIQPYFADFEPWLNL # MHQFVSEGYHARPRPGIDVSAYPGLKKPLPSKTLFDWQTLDGNVTYSVLRQFMSSFQKEPLDTRWTGFNPDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g453 ### # start gene g454 4 AUGUSTUS gene 1759365 1760933 0.85 - . g454 4 AUGUSTUS transcript 1759365 1760933 0.85 - . g454.t1 4 AUGUSTUS stop_codon 1759365 1759367 . - 0 transcript_id "g454.t1"; gene_id "g454"; 4 AUGUSTUS CDS 1759365 1760185 0.88 - 2 transcript_id "g454.t1"; gene_id "g454"; 4 AUGUSTUS CDS 1760246 1760933 0.93 - 0 transcript_id "g454.t1"; gene_id "g454"; 4 AUGUSTUS start_codon 1760931 1760933 . - 0 transcript_id "g454.t1"; gene_id "g454"; # protein sequence = [MEASSDTKPATPTSLPQQKQPDAPPIVGSTPESNGAAHPTQDDAPQRTSALTKFLEDDANESVVLSLDEFVTLILDLP # AEWKIKEDFSLLPETKAVTEAFEAYLKVAIKIAEGTRKKWKNAATNEIELNQPLTKVLDTLKGGEGLGQLSREIDEEVFHVEEPHLVLDSLLKRKPGL # GGIYSQVLELTENKKLSTYLAEKNIFGVFWWLFLLFAEVKLRKGCAEPDIQREKFGIAMDESSQSLVIEALRPISTVPSPSNFSLLEKRPSHPKSKKR # LRSNEELDSTSMCSKLILERLGTDKCLKSSNQIRSLNLTQRPGYSQEPWRDLRNYRREKVRYNLTFGIYLDVETVKVKHPDPSLSMHLDQLPAIDFQS # DDSAPLPSTPSTPTATSFECKDRPRVTIHCKNKTKTVEIATLQEARAEGMTRAEQNVIQTQGQHPTKCATEMIPTESMDHDFTFAHYRGSEVESEVSV # SFHYSSSGRSWKQRASGPIQFPRVFLLTSTMI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g454 ### # start gene g455 4 AUGUSTUS gene 1763915 1764655 0.99 - . g455 4 AUGUSTUS transcript 1763915 1764655 0.99 - . g455.t1 4 AUGUSTUS stop_codon 1763915 1763917 . - 0 transcript_id "g455.t1"; gene_id "g455"; 4 AUGUSTUS CDS 1763915 1764655 0.99 - 0 transcript_id "g455.t1"; gene_id "g455"; 4 AUGUSTUS start_codon 1764653 1764655 . - 0 transcript_id "g455.t1"; gene_id "g455"; # protein sequence = [MEPVLENEIAAHPPLPHTPKPKQHQAYAPPVVQSTPSSQRFTSHAEDEVPQRAEIVNKFLEDDISDRLEISLNDFATL # ILDLPTDWHVRKEFTLLPESEVVKDAFAAYVKVAIGEVDGEGKKKIGIAGNESGLYQPLANLLNSLRDGEGRLGKDIDEKIFYVQDPRPVLGSLVARK # PDLGGIYTELLGLTENAKLSDYLAENNIVGVFWGLLLYFIEVKHERGRFVGLNVNKQEGIFTGLNSLPYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g455 ### # start gene g456 4 AUGUSTUS gene 1765534 1766011 0.57 - . g456 4 AUGUSTUS transcript 1765534 1766011 0.57 - . g456.t1 4 AUGUSTUS stop_codon 1765534 1765536 . - 0 transcript_id "g456.t1"; gene_id "g456"; 4 AUGUSTUS CDS 1765534 1765759 1 - 1 transcript_id "g456.t1"; gene_id "g456"; 4 AUGUSTUS CDS 1765860 1766011 0.57 - 0 transcript_id "g456.t1"; gene_id "g456"; 4 AUGUSTUS start_codon 1766009 1766011 . - 0 transcript_id "g456.t1"; gene_id "g456"; # protein sequence = [MDEAIEIEQRAHVHDLQRKQRIEEKRMHHGYPMQNEVMSREEREARIWAFMNYKPSESDLEDVEDDDEDDDPAGWFED # DQDDGRKGQNIVEPDEEDPESLHNIIRVMDPNQMHYNTFYEPRDDGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g456 ### # start gene g457 4 AUGUSTUS gene 1767405 1767965 1 - . g457 4 AUGUSTUS transcript 1767405 1767965 1 - . g457.t1 4 AUGUSTUS stop_codon 1767405 1767407 . - 0 transcript_id "g457.t1"; gene_id "g457"; 4 AUGUSTUS CDS 1767405 1767965 1 - 0 transcript_id "g457.t1"; gene_id "g457"; 4 AUGUSTUS start_codon 1767963 1767965 . - 0 transcript_id "g457.t1"; gene_id "g457"; # protein sequence = [MDLNAQPPADWKTRGPPYEVAEYALKEDVDVVVMLNAWLDSRVKHYESKLSDDGEVMKKMKADWGKEEENEKDFGDIF # DWTTVEFWATRLKPLWVQGGASSSLRQHDTIQARLSGSNSSAKEQKESKDEEEVQGGVCASDRRTIVVICNRTGEEKGICYILTSFMKFLMMIIISYL # ILPFNVPHSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g457 ### # start gene g458 4 AUGUSTUS gene 1777338 1778618 0.97 - . g458 4 AUGUSTUS transcript 1777338 1778618 0.97 - . g458.t1 4 AUGUSTUS stop_codon 1777338 1777340 . - 0 transcript_id "g458.t1"; gene_id "g458"; 4 AUGUSTUS CDS 1777338 1778618 0.97 - 0 transcript_id "g458.t1"; gene_id "g458"; 4 AUGUSTUS start_codon 1778616 1778618 . - 0 transcript_id "g458.t1"; gene_id "g458"; # protein sequence = [MTALQATNSWVLVVAPRRSSAAEIISELRLVSRRSNAALELANSEKDLLQRPNVRTIRVVSAYHLFQAISLWDSRVPL # LGLDLVVCENLDQMDGVYELGISLLRHATQMTPTRYLGISNSLNDAADLAAWLNADESAFHSFRPTDRSQSLITSTQSFTIPHSGSLFKAMAKPAHSV # IRKVILEDSAIVFVSSRTQCKATALDLLTQCALEDQSDRGYLPPGVHEYIREDYLTRLEDSSLTDFLSKGVGFFHDGIRRSDRSLMLQLYAEGIVRVL # IVPREACWSLPVRAAAVVVMGTQYVHFASQVDERQVREYDLTELVRMQSRAVRHSGSGQFHLFCQAELKDTYVRFLTEGLPLESKLLENVLEEWLQSA # RTRGYLESKQHLMDLLSFTFLARRVVTNPSYYDCHSRSRDENLSRFVDQLWSSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g458 ### # start gene g459 4 AUGUSTUS gene 1778665 1779896 0.4 - . g459 4 AUGUSTUS transcript 1778665 1779896 0.4 - . g459.t1 4 AUGUSTUS stop_codon 1778665 1778667 . - 0 transcript_id "g459.t1"; gene_id "g459"; 4 AUGUSTUS CDS 1778665 1779621 1 - 0 transcript_id "g459.t1"; gene_id "g459"; 4 AUGUSTUS CDS 1779675 1779704 0.92 - 0 transcript_id "g459.t1"; gene_id "g459"; 4 AUGUSTUS CDS 1779834 1779896 0.4 - 0 transcript_id "g459.t1"; gene_id "g459"; 4 AUGUSTUS start_codon 1779894 1779896 . - 0 transcript_id "g459.t1"; gene_id "g459"; # protein sequence = [MRDNEERELKDLLNIVPCEVKNTGNNEGAGDVGVVITSEGKVNILLQAYISRRTLEDFALVSDSAYVAQNGGRIVRAL # LEIAISRKWANVSAVLMGMSKAIEKRLWPFDQPLKQFDLKGDLIYHLENWGDDYSPADLAAMSAEELGELTHLNSIQGKALLNAAKQFPTVQIQSVLR # PLGSEVLKVVVRLTKQFTWVNKLHGTSEPFWVWIEDHNGINILQMSHLIVRPNTETIHLDFIIPIAYEHTPPFITIRCVSDRWLGAENEIEVSLDGLI # MPRPIRSMTALLDLPLLPLTALRRPEVEIMYSRRLHNFNSLQTQVLWSLTNTKSHSLFCAPAGSGKSLMADIVAW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g459 ### # start gene g460 4 AUGUSTUS gene 1780845 1781457 0.71 - . g460 4 AUGUSTUS transcript 1780845 1781457 0.71 - . g460.t1 4 AUGUSTUS stop_codon 1780845 1780847 . - 0 transcript_id "g460.t1"; gene_id "g460"; 4 AUGUSTUS CDS 1780845 1781304 0.81 - 1 transcript_id "g460.t1"; gene_id "g460"; 4 AUGUSTUS CDS 1781441 1781457 0.71 - 0 transcript_id "g460.t1"; gene_id "g460"; 4 AUGUSTUS start_codon 1781455 1781457 . - 0 transcript_id "g460.t1"; gene_id "g460"; # protein sequence = [MKHFSSVSRQKGLFYFDSSFRPVPLEQHFLGIKGKPGSSQAKKNLDHVTFEKVSELVAQGHQVMVFVHARKETVKSAL # AIQEAALAEGSSDDFSCEDQTQWSLFRREIAQSRNKEMKQLFDHGFGIHHAGMLRSDRNIMERMFEARAIKVDSFPSITP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g460 ### # start gene g461 4 AUGUSTUS gene 1789916 1790290 0.41 - . g461 4 AUGUSTUS transcript 1789916 1790290 0.41 - . g461.t1 4 AUGUSTUS stop_codon 1789916 1789918 . - 0 transcript_id "g461.t1"; gene_id "g461"; 4 AUGUSTUS CDS 1789916 1790290 0.41 - 0 transcript_id "g461.t1"; gene_id "g461"; 4 AUGUSTUS start_codon 1790288 1790290 . - 0 transcript_id "g461.t1"; gene_id "g461"; # protein sequence = [MRVVARTCNLIFIVLDVLKPLGDKKIIETELEGFGIRLNKRPPAVLVRKKERGGIAITNTVPLTKIDHDEIKAVLSEY # KINNADVAIREPNATADDLVDVIEGNRVYIPALYVSVPVSVIHQRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g461 ### # start gene g462 4 AUGUSTUS gene 1792580 1793335 0.92 + . g462 4 AUGUSTUS transcript 1792580 1793335 0.92 + . g462.t1 4 AUGUSTUS start_codon 1792580 1792582 . + 0 transcript_id "g462.t1"; gene_id "g462"; 4 AUGUSTUS CDS 1792580 1793335 0.92 + 0 transcript_id "g462.t1"; gene_id "g462"; 4 AUGUSTUS stop_codon 1793333 1793335 . + 0 transcript_id "g462.t1"; gene_id "g462"; # protein sequence = [MKQRLVDAAKLAKKEAMGDYSHLKDKKGKMVGKPLPQPTLPNLSVDDDDDRSSIRTRGPPPSTYTQDSNYYYYDKGGA # YPPPMPAYNPYSANQSPGSYPYLNPSQPALSREDYQSGYEEDDTTGLAVAAAPFAQQSQTHLNAHSSSLTNPYSPGPTGGTGFNAHDVYQGRDPDHDG # LAYYSNSHSETSEGLAYDQDSQPQQGAYHQDYVPHYDKQYSGGTYQDYSTSQPVYGAYALSQNKDNGGGAHGYAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g462 ### # start gene g463 4 AUGUSTUS gene 1793779 1794243 0.65 - . g463 4 AUGUSTUS transcript 1793779 1794243 0.65 - . g463.t1 4 AUGUSTUS stop_codon 1793779 1793781 . - 0 transcript_id "g463.t1"; gene_id "g463"; 4 AUGUSTUS CDS 1793779 1794243 0.65 - 0 transcript_id "g463.t1"; gene_id "g463"; 4 AUGUSTUS start_codon 1794241 1794243 . - 0 transcript_id "g463.t1"; gene_id "g463"; # protein sequence = [MELDEADEMVSSIKLSRVHSRKPFLSCLQVSQMDIEIQGIPQSIRPQYQNRLKSAKADLSRFKKTFKDLSAQLARSSL # LASSTPRPGYSSDDPYGSSSDRSRLLAGTALLEDGTKRLQDSQRLALETEDLGADILSNLRVQREQIENSRSTVGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g463 ### # start gene g464 4 AUGUSTUS gene 1795347 1795685 0.71 + . g464 4 AUGUSTUS transcript 1795347 1795685 0.71 + . g464.t1 4 AUGUSTUS start_codon 1795347 1795349 . + 0 transcript_id "g464.t1"; gene_id "g464"; 4 AUGUSTUS CDS 1795347 1795685 0.71 + 0 transcript_id "g464.t1"; gene_id "g464"; 4 AUGUSTUS stop_codon 1795683 1795685 . + 0 transcript_id "g464.t1"; gene_id "g464"; # protein sequence = [MDVRWVSSLSWYFLNFFGLNGLYRLILGNDNCMSSLELIGGFLILNSSLAAADTSQTMMASPFAAGANQPGQPQDYVK # LFKAEKDNLAFAEGLYSWMGDDVETRLLRKHGKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g464 ### # start gene g465 4 AUGUSTUS gene 1797428 1798723 0.49 + . g465 4 AUGUSTUS transcript 1797428 1798723 0.49 + . g465.t1 4 AUGUSTUS start_codon 1797428 1797430 . + 0 transcript_id "g465.t1"; gene_id "g465"; 4 AUGUSTUS CDS 1797428 1798723 0.49 + 0 transcript_id "g465.t1"; gene_id "g465"; 4 AUGUSTUS stop_codon 1798721 1798723 . + 0 transcript_id "g465.t1"; gene_id "g465"; # protein sequence = [MTLQWARLNPSQKPGFPNPGWPGCCRAPAPSEYRMIQAADWRSISIVHHIPIPPEIKVILDGLTTGGRSSSKPFMPPL # DRRNSNSGTGTGTGGGSPPTKLGNTAVKPVSSANKVRTSASPKTPAATLSKATANAVEGIRNSPEKEKASYNNSAHSSPGRKQIELDTNTTPRRNSGS # RAPPAIPSFNKGSPDLRSSTLPSGKSSLESRSSAIPSNKGSPDLRPSVIPSGKSSPESRSSAIPSNKGSPDLRPSVIPSGKGSPESRSPATTLNKGSP # ESRSSVVPLSKGSPEMRPSLDRRRSSNIHPPTPSSKSSIPSRNTASSFTLASRKASKNDDASSVASGGSGGSDSLSDSTVTSDGGFTDYLSDESEAEL # QRQAEAKAALLAQNQAEELEFKAARQQLAHVDLRPPKSWNPTNITNNNTALRLTTTTKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g465 ### # start gene g466 4 AUGUSTUS gene 1804137 1805336 0.98 + . g466 4 AUGUSTUS transcript 1804137 1805336 0.98 + . g466.t1 4 AUGUSTUS start_codon 1804137 1804139 . + 0 transcript_id "g466.t1"; gene_id "g466"; 4 AUGUSTUS CDS 1804137 1805336 0.98 + 0 transcript_id "g466.t1"; gene_id "g466"; 4 AUGUSTUS stop_codon 1805334 1805336 . + 0 transcript_id "g466.t1"; gene_id "g466"; # protein sequence = [MKNLLFSPSIWRIKFPKSSGVDELAASERSETSPSTFIGRLKPGHKETGERATSSMKQTPCRPPRPPSPNLFGTPRPV # EDTSEVPTLRRELSQRKHIRVQRPNRTADSLKAKRSLPELDGVWKGFLNEVNEDHDSLYQHPIPDLPTLQRQSPTVRPELKDEEVSGSRSHFPRRRPF # GGSQPRVTLHTSRSTTCVAIPEERSLSPRSSVSSADYETDMDSLALFPAPPPLRIRKKIPKPLILVPTATIVPLPPSPCTGSLNPTPVASPTSPKLPQ # SPRRATSPPSILKKSQSAASLYSMPTSPSYNTYPSTLTLAHPPRIAHSISSPSRPSPSISPTSHKSSSSDTMALSNSGSSRRYTNRTSTFTSSSWNDK # PLPPLMVSKFHSRRTGRCISKRILIAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g466 ### # start gene g467 4 AUGUSTUS gene 1813733 1815752 0.3 + . g467 4 AUGUSTUS transcript 1813733 1815752 0.3 + . g467.t1 4 AUGUSTUS start_codon 1813733 1813735 . + 0 transcript_id "g467.t1"; gene_id "g467"; 4 AUGUSTUS CDS 1813733 1814209 0.3 + 0 transcript_id "g467.t1"; gene_id "g467"; 4 AUGUSTUS CDS 1814364 1815752 0.92 + 0 transcript_id "g467.t1"; gene_id "g467"; 4 AUGUSTUS stop_codon 1815750 1815752 . + 0 transcript_id "g467.t1"; gene_id "g467"; # protein sequence = [MLPWPQRLSQISSLLLFIFFFPKVVIETNEITVALTGSELTDFCRLRSPYLIPDSPGSVMAPYLCAPACVSGPWPSKR # SATLHRNSCMLWQEHIGTQASKRRHSPSSNGSASGSDNDVATIRAIARRKKKARLAKKPNVTFGVSGINFNDNYSSPFKMCTLITSGTTSQPSEDVVP # TEQLASAANTRLETTQTLVGEPVQASLSSSRPQRNRRLPARYQDVLPEGTAVIVNAEPLVEEQVPLRRRVILHVREQLKTQLNSFGLWREYLEKPSHD # PDGEVGIQDMANIPSAQDPDDDGHTSDDSHCDATLNPTQTLLTGWQNNGNSTKSNGEMDKLANLIRRPEFQVSELQGYSAHTANAKITQADENWDYNK # LKDSFLETSVDIEVPSGDKNIPSKVFSIPGLLYRSPLSVIRAAFASRLANQFHYTPFRLFQTSESPDGSDNDVQRVHTDIYNSDAFIQEHYRVLRAPT # DDPDCKREKVVAALMCWSDATQLANFGTAKLWPIYMLFGNLSKYIRASPNSGAVNHLAYIPSIPDSIKHEISMFHTKWKTQSKEIITHCSRELYHAIW # RYLLDDEFIHAYRYGIVIKCFDGVERRIYPRFFTYSADYPEKYVFICMCNQTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g467 ### # start gene g468 4 AUGUSTUS gene 1817909 1818217 0.86 + . g468 4 AUGUSTUS transcript 1817909 1818217 0.86 + . g468.t1 4 AUGUSTUS start_codon 1817909 1817911 . + 0 transcript_id "g468.t1"; gene_id "g468"; 4 AUGUSTUS CDS 1817909 1818217 0.86 + 0 transcript_id "g468.t1"; gene_id "g468"; 4 AUGUSTUS stop_codon 1818215 1818217 . + 0 transcript_id "g468.t1"; gene_id "g468"; # protein sequence = [MYMRYFPGGGVGHTANRKFFKDVAEDAEELDGEPTGNQSPDEDDELYFPLDSELPLSDKEEMLGSSSDEENEDESDEE # DQVEDGSDGTDIDDWQWDDGYGSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g468 ### # start gene g469 4 AUGUSTUS gene 1826867 1827367 0.97 + . g469 4 AUGUSTUS transcript 1826867 1827367 0.97 + . g469.t1 4 AUGUSTUS start_codon 1826867 1826869 . + 0 transcript_id "g469.t1"; gene_id "g469"; 4 AUGUSTUS CDS 1826867 1827367 0.97 + 0 transcript_id "g469.t1"; gene_id "g469"; 4 AUGUSTUS stop_codon 1827365 1827367 . + 0 transcript_id "g469.t1"; gene_id "g469"; # protein sequence = [MLICILQLFLEEEREKELEALYENGTVEALNRADLAIGSGVGDGFPESSISAEATGVSKQTGETLMAGERIMDALDLA # DGERRIFREYEETMSRTTEDDAVKLQPPPRNPVLAAYDLEPEAYVLKVVEKVHSTALHDALLALPFSKVISLMEYLNIWAQKVSKSHG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g469 ### # start gene g470 4 AUGUSTUS gene 1829861 1830265 0.5 + . g470 4 AUGUSTUS transcript 1829861 1830265 0.5 + . g470.t1 4 AUGUSTUS start_codon 1829861 1829863 . + 0 transcript_id "g470.t1"; gene_id "g470"; 4 AUGUSTUS CDS 1829861 1830265 0.5 + 0 transcript_id "g470.t1"; gene_id "g470"; 4 AUGUSTUS stop_codon 1830263 1830265 . + 0 transcript_id "g470.t1"; gene_id "g470"; # protein sequence = [MAKWRLAKALGVDLRLNTLNLLLAQSFRSSFVLADTSQLHTKITEMGQRIRQLEDALAISHSGISNEPHPLLRDELLS # IKFGPENGTTSRAPPSRDPSVESIDAFGTLTIFDRDLSKYFGRSAGSEVSVIFSEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g470 ### # start gene g471 4 AUGUSTUS gene 1831894 1832984 0.4 + . g471 4 AUGUSTUS transcript 1831894 1832984 0.4 + . g471.t1 4 AUGUSTUS start_codon 1831894 1831896 . + 0 transcript_id "g471.t1"; gene_id "g471"; 4 AUGUSTUS CDS 1831894 1831912 0.44 + 0 transcript_id "g471.t1"; gene_id "g471"; 4 AUGUSTUS CDS 1832242 1832248 0.45 + 2 transcript_id "g471.t1"; gene_id "g471"; 4 AUGUSTUS CDS 1832357 1832984 0.44 + 1 transcript_id "g471.t1"; gene_id "g471"; 4 AUGUSTUS stop_codon 1832982 1832984 . + 0 transcript_id "g471.t1"; gene_id "g471"; # protein sequence = [MTDFRTLVYGTSPIPSSLSVGRDYGDDELALFGGQTRVLFSKLLLLQRSKQKNQTESFVNTPISTSDSDSPAPSDATD # SKDNSPETLPDVHPSLVEYISLLPPSQHPRSPPPESAMEQFYTNPFAQTSFPNSQMQNLLISLPDVPSQVSNEQSFPRFFSDLGDFSMGTFTAEPTVM # NGTASAGDLMNLDLMMTDSGIDQQWRSFMRDSGLLDQGPSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g471 ### # start gene g472 4 AUGUSTUS gene 1835323 1835727 0.32 - . g472 4 AUGUSTUS transcript 1835323 1835727 0.32 - . g472.t1 4 AUGUSTUS stop_codon 1835323 1835325 . - 0 transcript_id "g472.t1"; gene_id "g472"; 4 AUGUSTUS CDS 1835323 1835727 0.32 - 0 transcript_id "g472.t1"; gene_id "g472"; 4 AUGUSTUS start_codon 1835725 1835727 . - 0 transcript_id "g472.t1"; gene_id "g472"; # protein sequence = [MMCSSCVSGVSKVTCTYLIIASERKENRYDPPTGHSPTVTYSIPSSSSFNPLSHVFTLASSLTIPALTIRLLTQSESP # SSPTFLVNEIVGVSARDDLLTEASAVLISQLGKFKRMTMGWEDKVRFLEFYGSKST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g472 ### # start gene g473 4 AUGUSTUS gene 1838294 1839070 0.53 - . g473 4 AUGUSTUS transcript 1838294 1839070 0.53 - . g473.t1 4 AUGUSTUS stop_codon 1838294 1838296 . - 0 transcript_id "g473.t1"; gene_id "g473"; 4 AUGUSTUS CDS 1838294 1839070 0.53 - 0 transcript_id "g473.t1"; gene_id "g473"; 4 AUGUSTUS start_codon 1839068 1839070 . - 0 transcript_id "g473.t1"; gene_id "g473"; # protein sequence = [MAERAEHVSNQVNRLTRLLPARLRQDASSISSDFLAAHHSSITWYLSRRLAEVSQKQKEMQEERVKRELERSRTLGSG # AGLEVLNMTTNDAFRTHNASEPRVSASSSWLGDTSSLIAATIGAPTIDETHRPGPSFPLPDTAPPSDDEDDFELSSSQILQFETENANILRSVQETLD # SVHQAESRLMEISTLQMELVEHLTKQTVLTDQLYEDAIASTSMVEKGNAQLREARRRSKDSRFFILVFFIISSLSLLFLHYY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g473 ### # start gene g474 4 AUGUSTUS gene 1840086 1841081 0.7 - . g474 4 AUGUSTUS transcript 1840086 1841081 0.7 - . g474.t1 4 AUGUSTUS stop_codon 1840086 1840088 . - 0 transcript_id "g474.t1"; gene_id "g474"; 4 AUGUSTUS CDS 1840086 1840945 0.89 - 2 transcript_id "g474.t1"; gene_id "g474"; 4 AUGUSTUS CDS 1841054 1841081 0.7 - 0 transcript_id "g474.t1"; gene_id "g474"; 4 AUGUSTUS start_codon 1841079 1841081 . - 0 transcript_id "g474.t1"; gene_id "g474"; # protein sequence = [MSLLSSHRSPEEFGTIGGVVEEDAGLSLGTVFNDSPYLRSYIINRNVLVGSDIPPNITNLSINLDGVITVSLSITTVL # HIIAGLSTLEEFSISLARAQDTSFLPNRDAQHLTTLPTLKALTLIGQPDLFALLQNIHTPSLQCLRLMSSSEPIPVSHQWSGLMLLQWLALGNTSLEL # LELRDVDVAQDVFISCLRSLTKLRTLKLHDSEISDAVFGSLHGDQGYCPHLSKVDLRWCSVVTGHALVNFVRDRSQMSARPIESITVINCSFVEDQDI # LDLAQFTVCRLVIDSNDYCRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g474 ### # start gene g475 4 AUGUSTUS gene 1848259 1848816 0.6 - . g475 4 AUGUSTUS transcript 1848259 1848816 0.6 - . g475.t1 4 AUGUSTUS stop_codon 1848259 1848261 . - 0 transcript_id "g475.t1"; gene_id "g475"; 4 AUGUSTUS CDS 1848259 1848616 0.6 - 1 transcript_id "g475.t1"; gene_id "g475"; 4 AUGUSTUS CDS 1848701 1848816 0.96 - 0 transcript_id "g475.t1"; gene_id "g475"; 4 AUGUSTUS start_codon 1848814 1848816 . - 0 transcript_id "g475.t1"; gene_id "g475"; # protein sequence = [MANTVKIPVPALNKEISVSTGLFINNEFVPSVDSSEVIQRNHCERCGRCVQKSFSTSWIHQNIIIIGSSKDIDVAVAA # ARKAFKTSWGKNVTGWERSRLINKLADLIERDAQELAELETLNNGKPVAIARLVLVCGVCETQLTSLIETSISEIASSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g475 ### # start gene g476 4 AUGUSTUS gene 1850810 1851633 0.61 + . g476 4 AUGUSTUS transcript 1850810 1851633 0.61 + . g476.t1 4 AUGUSTUS start_codon 1850810 1850812 . + 0 transcript_id "g476.t1"; gene_id "g476"; 4 AUGUSTUS CDS 1850810 1850836 0.61 + 0 transcript_id "g476.t1"; gene_id "g476"; 4 AUGUSTUS CDS 1850932 1851633 0.61 + 0 transcript_id "g476.t1"; gene_id "g476"; 4 AUGUSTUS stop_codon 1851631 1851633 . + 0 transcript_id "g476.t1"; gene_id "g476"; # protein sequence = [MAKEKAASTISSLTATIQMLVVGLPTLPQLPSEVLEKLTQITTSTGSFEHATIAGEFIALNCYLSHLIICILWTATSR # GSILSNPQVSFTSPAPIPFRSLPFNSSINSNTSSVDGSANGNDMANATLPVMPTTNAVTTANGAGDERVHSLTVGHGQVLTYKYSHIREPRQISFATN # IARLDRVWDDERPNWDPVDCAKNLLEINGMGIALRYWQEVFSGKKNKVWSWLKKLWIEWKVSCIFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g476 ### # start gene g477 4 AUGUSTUS gene 1858256 1859300 0.34 + . g477 4 AUGUSTUS transcript 1858256 1859300 0.34 + . g477.t1 4 AUGUSTUS start_codon 1858256 1858258 . + 0 transcript_id "g477.t1"; gene_id "g477"; 4 AUGUSTUS CDS 1858256 1858891 0.37 + 0 transcript_id "g477.t1"; gene_id "g477"; 4 AUGUSTUS CDS 1859004 1859300 0.43 + 0 transcript_id "g477.t1"; gene_id "g477"; 4 AUGUSTUS stop_codon 1859298 1859300 . + 0 transcript_id "g477.t1"; gene_id "g477"; # protein sequence = [MYNSICQSVHINSSEHKPRNFKDFETVLMYNAETIESHLELSHAGLILISLLLKNDYSDGVNGIGSETAAGLAKCGYG # DDLLKAYSSFSTMPQQLAEAFDQLNNDMVEELEFNTHHKLRYRSPYKANVLRVSQFPSLKDLSTLTAFLEPVTSWSRSMDSSGAPNASKWPPRTPDII # EITKFCCNTFGWPDKHALKRFHAELWPAVIMRMLSSSTFAIDVNGKSYPSMLSTVVRNKNSLRLQGMRANDAISTTFTTEFFLQLTGLASSVSETSRR # VDVPAAMIAVALQQSDQIRGLNKRLGELFMLSDVLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g477 ### # start gene g478 4 AUGUSTUS gene 1862819 1863976 0.77 - . g478 4 AUGUSTUS transcript 1862819 1863976 0.77 - . g478.t1 4 AUGUSTUS stop_codon 1862819 1862821 . - 0 transcript_id "g478.t1"; gene_id "g478"; 4 AUGUSTUS CDS 1862819 1863976 0.77 - 0 transcript_id "g478.t1"; gene_id "g478"; 4 AUGUSTUS start_codon 1863974 1863976 . - 0 transcript_id "g478.t1"; gene_id "g478"; # protein sequence = [MVERGNPVHSAIISHLSNSNTRVRAWMNVLCRTPQSSIAREIPYTNGDPYLSDSEQESEHSFIKDPTTGSRLYPQDAM # NAMHILAVDDGKSGDEESLYNPMFDFDIQDDGRFVCRVKAAGQFQDVQQSWSTPSSTKAGARRLASYDACAHLYERGLLDSRVFPKNWTIPPDSDILP # AFDPIVVGTRVYGKKLPTFWSNSALFSLGSLNRLYPVIISIESGANTIPPHAPLLLLTRQPLPDVPMFNVFFAGLPTRISLTRAEPFMVNEHQLQDIH # SYNNQLWRGVLNKPYSAALNETLALYAPLHSSWRSGILDVSSHISWDLISATVENWIVPLNYDSLEALMIDTEDALIQDRWTQYTRRYDAVKIRLDLN # PLSKPRDPEVNAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g478 ### # start gene g479 4 AUGUSTUS gene 1866685 1867059 0.88 + . g479 4 AUGUSTUS transcript 1866685 1867059 0.88 + . g479.t1 4 AUGUSTUS start_codon 1866685 1866687 . + 0 transcript_id "g479.t1"; gene_id "g479"; 4 AUGUSTUS CDS 1866685 1867059 0.88 + 0 transcript_id "g479.t1"; gene_id "g479"; 4 AUGUSTUS stop_codon 1867057 1867059 . + 0 transcript_id "g479.t1"; gene_id "g479"; # protein sequence = [MRIGKSHRDVAIILLGSFSRYINHLDDSELQKPRTKTILKALRANLKLAIDVGLAKSQSDLTASFMQTLIMSEGDKWI # HAQTSNVVIALRAGTAGEPVKTADAAVRKFATKELGKAELIASLED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g479 ### # start gene g480 4 AUGUSTUS gene 1873940 1875172 0.3 + . g480 4 AUGUSTUS transcript 1873940 1875172 0.3 + . g480.t1 4 AUGUSTUS start_codon 1873940 1873942 . + 0 transcript_id "g480.t1"; gene_id "g480"; 4 AUGUSTUS CDS 1873940 1874396 0.36 + 0 transcript_id "g480.t1"; gene_id "g480"; 4 AUGUSTUS CDS 1874448 1875172 0.83 + 2 transcript_id "g480.t1"; gene_id "g480"; 4 AUGUSTUS stop_codon 1875170 1875172 . + 0 transcript_id "g480.t1"; gene_id "g480"; # protein sequence = [MSPSRRKLRKIEDHQCPAYQPFRSARGRRVNDSGLVVGIQGRADADYSRELVALDANEADSTHWSRSGWCERPKVELF # VRESIYLYLQLQTVSTPQSYDFILSPNGKVSPEDLSPSKVKLEPVPDGYVIQNVTGIRTHIVQRFDGRGYDVRKLGHYTVRPGQLVYINDSSLLLSAA # SPSTAAIEHFGAIQLRFYVDAVDTMFSMLNMMETVNDMDLSVTGHVGFFGGDLLDSEELPSKFQGLVPVYRDDDNEFGCTQYHKSFQDGILLVRRGEC # TFIQKLVEARDAGAAGVLVLSDENTAINPTANSEDLEAAGDISQVAIIVLPRTAGQSVEHLLDTTQGIGQVMLSLEHEHQPGVDAEADEGPEPGEGSK # KDPNRILYLNGHPLLNTRLLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g480 ### # start gene g481 4 AUGUSTUS gene 1877717 1879585 0.32 + . g481 4 AUGUSTUS transcript 1877717 1879585 0.32 + . g481.t1 4 AUGUSTUS start_codon 1877717 1877719 . + 0 transcript_id "g481.t1"; gene_id "g481"; 4 AUGUSTUS CDS 1877717 1877864 0.73 + 0 transcript_id "g481.t1"; gene_id "g481"; 4 AUGUSTUS CDS 1878111 1878208 0.33 + 2 transcript_id "g481.t1"; gene_id "g481"; 4 AUGUSTUS CDS 1878417 1878452 1 + 0 transcript_id "g481.t1"; gene_id "g481"; 4 AUGUSTUS CDS 1878572 1879585 0.99 + 0 transcript_id "g481.t1"; gene_id "g481"; 4 AUGUSTUS stop_codon 1879583 1879585 . + 0 transcript_id "g481.t1"; gene_id "g481"; # protein sequence = [MDVNSDEIYAEIDEAAATCIDSETLTSQQYVVYSATFQVPCFYFAMYRSIEELLKEVENDIDEEDMRLLMWLKLWFTV # LGGVGRLQNNKYLKASATEAVIVAASRTPTGSINGALKSFTAPQLGSLALKHAFASKNIDPTIVEEIYFGNVVQAGVGQSPARQVALSAGMSSRSDAT # TINKVCASGMKSIMLASQSIQLGQASVVAAGGMESMSNAPYVFICSFGVPRLIDLLLSFLLPRQNPVFGKFTATDSLEYDGLWDTYNNQAMGCCGESA # AEKHSISREAQDAHAIESYKRAEQAWKNGAFDAEIVPITVKGKKGDTIVREDEEYKRIIYEKVPSLRSAFKQGGSITAANSSPLNDGASALILMSVEK # AKELGLTPLAKVICTFVFLIFGIALFDWYSQPMRTPVWILSISPLHRQSHCPRPWNVQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g481 ### # start gene g482 4 AUGUSTUS gene 1885425 1885877 0.79 + . g482 4 AUGUSTUS transcript 1885425 1885877 0.79 + . g482.t1 4 AUGUSTUS start_codon 1885425 1885427 . + 0 transcript_id "g482.t1"; gene_id "g482"; 4 AUGUSTUS CDS 1885425 1885877 0.79 + 0 transcript_id "g482.t1"; gene_id "g482"; 4 AUGUSTUS stop_codon 1885875 1885877 . + 0 transcript_id "g482.t1"; gene_id "g482"; # protein sequence = [MPVPVEFAAQVSSTLQLGSIPKLDKTRFISSFVDTQRLHTKYYAEEGRTLWNNLVDTARDPSPKSPPQENTVFGLSTP # VLVPRIPQVIIAKEPGSKTSTPKENPPKKTKSKAKSTFHAKSGQRPNEHPQNAPHTKKRAGKLSDDDETAAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g482 ### # start gene g483 4 AUGUSTUS gene 1886252 1887808 1 + . g483 4 AUGUSTUS transcript 1886252 1887808 1 + . g483.t1 4 AUGUSTUS start_codon 1886252 1886254 . + 0 transcript_id "g483.t1"; gene_id "g483"; 4 AUGUSTUS CDS 1886252 1887808 1 + 0 transcript_id "g483.t1"; gene_id "g483"; 4 AUGUSTUS stop_codon 1887806 1887808 . + 0 transcript_id "g483.t1"; gene_id "g483"; # protein sequence = [MPGILTNSRTSNTKNLKFSFSHEAIRPPAFLETVFLKGTSHCAKSVPNEPLSDNSTSSQNDSTPSTPPKLKLRKVPNP # SVKNHSRSSTVSSSSFDNEVTETPIAQAESEVWDIEREGYNLPSTMSSTSPERNQSVVLNTCSLPWVLETATSGEIHEKHKRKALAHERDRTSQLSSS # LAPSQSASQHGLNGRCRTTTPVPLLASKYFMPQRPHSVADALAKDETAIPFSSPSAPALQAPPIQTHESSLSDYFLHLPVAPNVQANTSYHPPHRADD # IIYEPYIAPIYAGENPWDPLAFSDPVNFSDTDAPQPPPEIVAPNLTLGISYPYDFYIPPRVDAPPLQYDSGYDVEDANSMFYLDDDGCGHTGWGLQEI # VCDNHEEEYLEHGQMYDEHEHLSCQTQQFGAEHENTTDQNWQRDFCSIEDDALFGMGIDSEEADMLQCPSEEWMEPIGQDRVLSEANSDDSVVREMPR # FLQGRELLLGFGATSRQEDIVRDWSGYASVAEADVARNLKGHWLPQRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g483 ### # start gene g484 4 AUGUSTUS gene 1890750 1891130 0.53 + . g484 4 AUGUSTUS transcript 1890750 1891130 0.53 + . g484.t1 4 AUGUSTUS start_codon 1890750 1890752 . + 0 transcript_id "g484.t1"; gene_id "g484"; 4 AUGUSTUS CDS 1890750 1891130 0.53 + 0 transcript_id "g484.t1"; gene_id "g484"; 4 AUGUSTUS stop_codon 1891128 1891130 . + 0 transcript_id "g484.t1"; gene_id "g484"; # protein sequence = [MEEDASDDSDSEIDSDTDKESDSDASDDKGSESDRSEHSCDEDGNSDIEVEELVEEATVESVKAKLEHTKADITASRA # RLSESRKDKKTVLDRLANLKKSLGKVQKTKNGWCSLKRSEVKLYLSVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g484 ### # start gene g485 4 AUGUSTUS gene 1891819 1892796 0.61 + . g485 4 AUGUSTUS transcript 1891819 1892796 0.61 + . g485.t1 4 AUGUSTUS start_codon 1891819 1891821 . + 0 transcript_id "g485.t1"; gene_id "g485"; 4 AUGUSTUS CDS 1891819 1892086 0.61 + 0 transcript_id "g485.t1"; gene_id "g485"; 4 AUGUSTUS CDS 1892399 1892796 0.94 + 2 transcript_id "g485.t1"; gene_id "g485"; 4 AUGUSTUS stop_codon 1892794 1892796 . + 0 transcript_id "g485.t1"; gene_id "g485"; # protein sequence = [MDDENEYEYPYTSDSEVDDDPFTAFLNSRAEYQGLIAMQRDKKPSTGITPRLTDVKFYFVDKIAWVLIFLSGVWQTHP # GLRRSASRTVQELLSPFTKNIATSWGKLFETDLLSHFEETVQAAICRLLDDMVESAAAGLRERVGMQGDLCKAEADVVLKQVVAVVRDTITTQQKDVS # RCLAPHVQNNLIDGYDLAMEETGKGSVARQKVGSGLQCASLENNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g485 ### # start gene g486 4 AUGUSTUS gene 1896026 1896572 0.69 + . g486 4 AUGUSTUS transcript 1896026 1896572 0.69 + . g486.t1 4 AUGUSTUS start_codon 1896026 1896028 . + 0 transcript_id "g486.t1"; gene_id "g486"; 4 AUGUSTUS CDS 1896026 1896126 0.74 + 0 transcript_id "g486.t1"; gene_id "g486"; 4 AUGUSTUS CDS 1896251 1896572 0.91 + 1 transcript_id "g486.t1"; gene_id "g486"; 4 AUGUSTUS stop_codon 1896570 1896572 . + 0 transcript_id "g486.t1"; gene_id "g486"; # protein sequence = [MSKSSLPPIDPTKTASGIALDPQTLERVIPESRRGTKQTQADSNALPKGHIIGWIPPSSKEADSSKPLSKSAKKNAKR # REKKVSDKKADEPVKDNWEDDDDDETIAAAPQKNEEPTKTNGAQSTDAAESLSSKMEKLDVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g486 ### # start gene g487 4 AUGUSTUS gene 1898325 1898900 0.66 - . g487 4 AUGUSTUS transcript 1898325 1898900 0.66 - . g487.t1 4 AUGUSTUS stop_codon 1898325 1898327 . - 0 transcript_id "g487.t1"; gene_id "g487"; 4 AUGUSTUS CDS 1898325 1898900 0.66 - 0 transcript_id "g487.t1"; gene_id "g487"; 4 AUGUSTUS start_codon 1898898 1898900 . - 0 transcript_id "g487.t1"; gene_id "g487"; # protein sequence = [MPANYDYTLSSSNGATMLDIPGGHALDMFTHILGPISSLSAIIKNQFPLTTLTDSDGNPTSRTVPNDSPNQVCVTGTL # ANGALFTVHFQSPVKEADFNWIINGENGVLRIVDESDRTTKRGFFDATPDVYLNGEKVAVDADNITRRTGLNWQAFANRDVSQYADLEQALKVKEILQ # AVVKSSEDGRRVEMQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g487 ### # start gene g488 4 AUGUSTUS gene 1899092 1899571 0.97 - . g488 4 AUGUSTUS transcript 1899092 1899571 0.97 - . g488.t1 4 AUGUSTUS stop_codon 1899092 1899094 . - 0 transcript_id "g488.t1"; gene_id "g488"; 4 AUGUSTUS CDS 1899092 1899571 0.97 - 0 transcript_id "g488.t1"; gene_id "g488"; 4 AUGUSTUS start_codon 1899569 1899571 . - 0 transcript_id "g488.t1"; gene_id "g488"; # protein sequence = [MAQESKTPIQLGFIGLSATGWAAIALAPPLFEEPLSSKYSLVAVSTSKPESAAASAAKYSELASNSTGTSVTVKPYHG # SAKHIASNIDVGMVAVSVKVLDHKEVASEVIKAGKDLFIEWPAGVRLAETKELYEAAKAKGIRTMIGFQSRFTAYALKVSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g488 ### # start gene g489 4 AUGUSTUS gene 1908835 1909563 1 + . g489 4 AUGUSTUS transcript 1908835 1909563 1 + . g489.t1 4 AUGUSTUS start_codon 1908835 1908837 . + 0 transcript_id "g489.t1"; gene_id "g489"; 4 AUGUSTUS CDS 1908835 1909563 1 + 0 transcript_id "g489.t1"; gene_id "g489"; 4 AUGUSTUS stop_codon 1909561 1909563 . + 0 transcript_id "g489.t1"; gene_id "g489"; # protein sequence = [MDPFSGRIVINLFSFIFSVTFDALLVGHEAGVTSISWRPSNSTQSTLTLLSTSTDSSLILWSPATILTDPENRTSSST # IWINRQRYGDIGGQRLGGFVGGVWRLDGDEVLAWGWSGGWRRWRRKPSATDDDEVWEEGGAIGGHRGPVKSVDWSSTGTFLISSGCGMHICHFKMTTH # ITLELTKQLEYMVQSHKSTDLLLGMNLADLKFMDMTYLEVFSSKNSNLPVSQTRKYFESSKLLADL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g489 ### # start gene g490 4 AUGUSTUS gene 1911633 1914187 0.75 - . g490 4 AUGUSTUS transcript 1911633 1914187 0.75 - . g490.t1 4 AUGUSTUS stop_codon 1911633 1911635 . - 0 transcript_id "g490.t1"; gene_id "g490"; 4 AUGUSTUS CDS 1911633 1912731 1 - 1 transcript_id "g490.t1"; gene_id "g490"; 4 AUGUSTUS CDS 1912895 1912921 1 - 1 transcript_id "g490.t1"; gene_id "g490"; 4 AUGUSTUS CDS 1913007 1914187 0.75 - 0 transcript_id "g490.t1"; gene_id "g490"; 4 AUGUSTUS start_codon 1914185 1914187 . - 0 transcript_id "g490.t1"; gene_id "g490"; # protein sequence = [MARSAALNPASMPFFPGNRSTDDDGLPGLGLPYRHSFQRHDQDPSSTSSVSVSPTEFRSVKSSPSPPSKEEVTNTSVG # RPSPPLANDGSRSSPSVRQIDPNRPYPGLENRIQREPSMMGGLEALPEAEDIQTTPGPALELSSRGLTGLSFFNLQQSKESLPTPTLPVAINNGNHTS # YSSVGGGFTSSSPASSLDSSSHFAASVDLQTQSFEAQLKASPMIHDLLDRLVRCEFSTREIQRDLGDMHRKVNLLVERSLGANSQPEFKDPFASSNTP # TFSPRPSIVNIAPNQSAPADDISTISQRLNTLTSSVGQLLALQTQQIQTASSIPGLPLMNTGAGLEVNSTPTMLGHGLPNRSDIRPSPRLPNPPLRTW # STGTLDLPVRGADMNGSRPDAHLILNNLCRCVGPPNKIQQRALPFLLRGADIIAQAPPTQERIAAYVIPAIQIAINGIANQPVNRGPIVIMISTTVDQ # ATQAQRMIRDLGGPIGVKSALGVGTTNTDLTQELRLLHQNVPHIICGTPQKLHALFTSSGGLPGSEVRFLVLDEVDQLIARNLHEFVFNIVKLLPSPR # SRPLSSSAPGGNIVPGSGAFGSNFDPSATPFQNNNSRRFSAVAPSPDPSGQNTPQSVERQTALFSNTVPQDVLNLATAIQLREPVRVLVRRDGNVTQA # EASQGGSRGLRQYYLYLAFTAGSRADPAAANSGGGLGIIGSGRGSTNAESVQAREWKLDALADLFDDVDVQQAIVHVGGMTALDSVVYKLASRGLEAV # PLVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g490 ### # start gene g491 4 AUGUSTUS gene 1916331 1917530 0.95 + . g491 4 AUGUSTUS transcript 1916331 1917530 0.95 + . g491.t1 4 AUGUSTUS start_codon 1916331 1916333 . + 0 transcript_id "g491.t1"; gene_id "g491"; 4 AUGUSTUS CDS 1916331 1917530 0.95 + 0 transcript_id "g491.t1"; gene_id "g491"; 4 AUGUSTUS stop_codon 1917528 1917530 . + 0 transcript_id "g491.t1"; gene_id "g491"; # protein sequence = [MLSTQVLRCDPTSISFDSTGKPKVTSQDTLNSLSIAAKNLVDLQPVAFPTETVYGLGALALDSSAASCIFSVKGRPPD # NPLIVHVSSPDMLRTLLPSSFKMPQSYELLMRRFWPGALTLLFPSDPNTIPSIITANQPTVAIRMPSHPVARALIALVNAPVAAPSANSSGKPSPTTA # EHVRRDLSGKLNVILDGGACDVGLESTVVDGLQEDGKIRVLRPGGISVEDIQETLQEGFQDHALVPQVLVHRRDYRDKELEAAPTTPGMKYRHYSPAA # PVTLLMTTSAPPEKVVPSKAESFLISLKNEMEPSAFVKVGVLVLTNSILGTLTLPVVDGIEWRRYELGPVDDPSVTARRLFDGLLTLDQQGVDMILIE # EVTETKEGLAIMNRVRKAASEVRWITF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g491 ### # start gene g492 4 AUGUSTUS gene 1918237 1919166 0.49 + . g492 4 AUGUSTUS transcript 1918237 1919166 0.49 + . g492.t1 4 AUGUSTUS start_codon 1918237 1918239 . + 0 transcript_id "g492.t1"; gene_id "g492"; 4 AUGUSTUS CDS 1918237 1919166 0.49 + 0 transcript_id "g492.t1"; gene_id "g492"; 4 AUGUSTUS stop_codon 1919164 1919166 . + 0 transcript_id "g492.t1"; gene_id "g492"; # protein sequence = [MTSKEEPSADPYNCTQRTESSSASAVPVSLIHAPLPSVPRIRFPVDCDLAHYYQDVPHLSTAPSPSLCPIPTPPLSSP # SPPPFNSQMEHIPRPPNAFMLFRSDFSKRDVIPPSVEKRQQTLSQVAGEVWNLMPVEEKRKWHAKSAEALKLHTEKYPNYKFSPVRRGSGRKTKVKAA # EDDDMESKDRIREIRETYLHMRGPAIAPLRRRRGRQQASTSEDEKTGMSSKSFIDQLPIGRSEMQESNLSDPREPALPPVFPRPTNPHLANHIYSGDD # VKGDYEHYPKKAQYYASTVENQSRCNPASSSVCRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g492 ### # start gene g493 4 AUGUSTUS gene 1924443 1925627 0.39 + . g493 4 AUGUSTUS transcript 1924443 1925627 0.39 + . g493.t1 4 AUGUSTUS start_codon 1924443 1924445 . + 0 transcript_id "g493.t1"; gene_id "g493"; 4 AUGUSTUS CDS 1924443 1925627 0.39 + 0 transcript_id "g493.t1"; gene_id "g493"; 4 AUGUSTUS stop_codon 1925625 1925627 . + 0 transcript_id "g493.t1"; gene_id "g493"; # protein sequence = [MDITNWDSVLQFSSGANMEFGLQNDDFPEQSTSSTPNLQVPTPPVCSELLLLILRLILPFHLQHSTDGGSPICDDPSD # NNVLVSISTTFYPGANLHSLPPDLALLSTDSVFFYVHSHIILAASDNNFLSLLPTSSSKEQSSNMVIHVPELSPVLNIILHIIYNISCSHYSPSFETL # SDAVHRLPSYGIDPKSCITPSTPIHALLLSHAPLCPLDVYTLAAKYDLYDLAVPTSSHLLSFQLSTLTDDTAEAIGPKYLRRMFFLHIGRSDALKRVR # SKKIQNLSQLTSGQILLQPPHPHAPTPWCDFADQKNLTRAWALASAYLAWDARPGEYPLQSLKPTSDIPCLRCVNRFSGSCSYSSGGAFILRSVQTRS # ERPHQKSHRAVVCREGKSYLRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g493 ### # start gene g494 4 AUGUSTUS gene 1932271 1937364 1 - . g494 4 AUGUSTUS transcript 1932271 1937364 1 - . g494.t1 4 AUGUSTUS stop_codon 1932271 1932273 . - 0 transcript_id "g494.t1"; gene_id "g494"; 4 AUGUSTUS CDS 1932271 1937364 1 - 0 transcript_id "g494.t1"; gene_id "g494"; 4 AUGUSTUS start_codon 1937362 1937364 . - 0 transcript_id "g494.t1"; gene_id "g494"; # protein sequence = [MSLQFTVASNNTPQILTRYRSALLADATRTLSELPFFDSDLSLSRELDINHGFYQVPIPAYQPLSPVSSDSDSDSDSE # YYLSLATTHIAMPAVFSSALDETVTYAKWNKSGNGMPGNMSCGKITVETLEAAKRDLRIFLTNNRKLAPSDYTLRCLNVWEDPRVSNWIDQNREDFTK # LSFDEFFVVVRNRVLDPDWQDSTFRKMRAVRMPDDLQTSISDLAVQLMVLNNLLQGTPRFQSEENLQMMLIDAADTGLREAYNKEVDDHAGNPLHGIH # SKDFHTFTRAFQVLDHGRHRQLVIARQMAEHMIRSRPNSRATTPLAPSAAANTQNRRTTNGNTGQNGRLPPLTTNERRLLSENDGCFKCRSFFVKCRT # SSSEHEFPLPNGNGYKELNASDVDTARKLRGTVETNKKARTGPIAAIGVADDGDDGVVASIMPSAVLGDGTDSEEEVSGPFRVSHLRWKCHVAGPKSP # FPIIVNSLIDNGAHLALIHPDLVCRLGLSRRILKKPETVCAAFQSGSNQSIAPLTEYVQLKVSSVDGSFTSRNVPFIIAPNLCTQLLLGLPWLTHNNI # VIDYASRSCTHKPSGFDLLNNTPVSHKFAFKTKSVEKIRDSLVKLGNRSKEHRRKLLVELKEKCASIRPRCPPSSVSSTPTSSEVIASIRSRIEHLAT # LETLKGHESRLREKYHAIFEPIPHVDDLPASVTAKIQLVDASKSISSRSYRCPRKFRAAWQTLIQKHLDSGKIRPSDSPYASPSFVIPKSDPNALPRW # VADYRQLNDNTVTDAHPLPRIDDILADCAKGQIWGKIDMTDSFFQTRMDEDSIKLTAITTPFGLYEWTVMPQGLKNSPAIHQRRVTSALRHLIGKICY # VYVDDIIIWSKSVEEHIINVEKVLLALRSARLYCNPNKCDLFTFNVHFLGHSISKDGISPDDKKVDRIMDWPTPRTVKELRAFLGLVRYVAAFLPRLA # ELTEILTRLTANDIDKDNLPWEARHDRAFEAIKVLVASCECLTVIDLDLLDTHKIFVTTDASDKCSGAVLSFGTSWESARPVSFDSSTFKGAELNYPV # HEKEMLAIIRALKKWRVDLLGVPFVIMTDHRTLENFHTQPDLSRRQARWMEFFSQFDCKIVYVSGDQNSVADALSRRTDLYSAPVSSADAILASQHPY # AYCADSDDDLDLPILCVLEDSPWSGARALANSPHFEPALPLIAATLEITSDATLLQEIRDGYSTDPWCKDLPSMAASMPLVRKELGSKLWYIGERLII # PRTGHIREELFRLAHDNLGHFGFDKSYAALRESYYWPHMRRDLEKAYVPACDECQRNKSTTQKKVGPLHPLPVPEHRFSSVAMDFVGPLPEDSGSNCI # LTITDRLGADLRIIPCRTDLSAADCAQLFFDHWYCENGLPEDIVCDRDHLFVSKFWEALRSLSGVRLRMSTSYHPESDGASERSNKTVVQMLRYHVER # NQKGWKRALPRIRFQIMNTVNSSIGMSGFQLRSGFSPRLIPPLIPRLPNSSTEFEFDAHNFLKDIQVDVLEAQDCLLSSKLDQVRSHNRHRRADPGFK # IGDRVLLKTKHRKNEYKRKGDKRAAKFFPRYDGPYTITDIHPQFSAYTLDLPAHLNIFPTFHADELKAYYDNDPSLFPNREFPRPGPIVTADGLVELH # VDKILDERKVGRGRRYLVRWQGYGPEFDSWEPGKSLQECEALDIWEGLAEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g494 ### # start gene g495 4 AUGUSTUS gene 1938077 1938792 0.64 + . g495 4 AUGUSTUS transcript 1938077 1938792 0.64 + . g495.t1 4 AUGUSTUS start_codon 1938077 1938079 . + 0 transcript_id "g495.t1"; gene_id "g495"; 4 AUGUSTUS CDS 1938077 1938132 0.79 + 0 transcript_id "g495.t1"; gene_id "g495"; 4 AUGUSTUS CDS 1938252 1938792 0.65 + 1 transcript_id "g495.t1"; gene_id "g495"; 4 AUGUSTUS stop_codon 1938790 1938792 . + 0 transcript_id "g495.t1"; gene_id "g495"; # protein sequence = [MSPVVSKNEFIYYLAYWDGQADLRGSLNAIATTTLDIQKAKAKELQSKKKQTATPSKSKPSKSKSKTVDSSETTEEEV # YHFIGYVPAFGKVWELDGLKPGPLEVGELASEGNTTDWMDVARPAIRMKMAKYGGGADAGNIRFSLLAFVDGSYEKANDEWEYWRRERRSIERRLDET # DSGWKSKASSTTVYSFPQSIVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g495 ### # start gene g496 4 AUGUSTUS gene 1940033 1940341 0.8 - . g496 4 AUGUSTUS transcript 1940033 1940341 0.8 - . g496.t1 4 AUGUSTUS stop_codon 1940033 1940035 . - 0 transcript_id "g496.t1"; gene_id "g496"; 4 AUGUSTUS CDS 1940033 1940341 0.8 - 0 transcript_id "g496.t1"; gene_id "g496"; 4 AUGUSTUS start_codon 1940339 1940341 . - 0 transcript_id "g496.t1"; gene_id "g496"; # protein sequence = [MVIDIPQDPLSSYEADRVLPSVFTDPHFLAAAHTFQDHLYSGWLKDDFKAKVAKYEEGIRNGTLAAPWKDQEWEKEHA # MLENDALTSSKPRSTGPGGAIKAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g496 ### # start gene g497 4 AUGUSTUS gene 1951967 1952415 0.82 + . g497 4 AUGUSTUS transcript 1951967 1952415 0.82 + . g497.t1 4 AUGUSTUS start_codon 1951967 1951969 . + 0 transcript_id "g497.t1"; gene_id "g497"; 4 AUGUSTUS CDS 1951967 1952021 0.83 + 0 transcript_id "g497.t1"; gene_id "g497"; 4 AUGUSTUS CDS 1952093 1952415 0.97 + 2 transcript_id "g497.t1"; gene_id "g497"; 4 AUGUSTUS stop_codon 1952413 1952415 . + 0 transcript_id "g497.t1"; gene_id "g497"; # protein sequence = [MVHNAFCLPFVPDTRIDPYSDGESSDGGEYLPTEEDEEEEDLYLLDTDDMVEADESDFEMEEVDLDIYQNWEPTDVED # NIEDVSSEWGLTDGDSLSNSDGDISFESDSAPTHSGKSFFVLWRILA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g497 ### # start gene g498 4 AUGUSTUS gene 1952613 1953224 0.99 - . g498 4 AUGUSTUS transcript 1952613 1953224 0.99 - . g498.t1 4 AUGUSTUS stop_codon 1952613 1952615 . - 0 transcript_id "g498.t1"; gene_id "g498"; 4 AUGUSTUS CDS 1952613 1953224 0.99 - 0 transcript_id "g498.t1"; gene_id "g498"; 4 AUGUSTUS start_codon 1953222 1953224 . - 0 transcript_id "g498.t1"; gene_id "g498"; # protein sequence = [MSRSNTTSARLYFLSGPRLINYLTSAHDLLTSTASILSCGAPLVPERVSQVVDERKKSEKHITDLELELAKRISAELS # SEATVGSGNDGYIFRKHLHRTDDGGNVLGFLSAISVAFSEQMAHSQIPYLLVFTSTPSAQITSSTTVVMVVGSDDKEVKTIGEYLKSQLGVKGGGKGL # KWSGKYTGVWKEKNEGERVNHILKNVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g498 ### # start gene g499 4 AUGUSTUS gene 1953345 1954293 0.68 - . g499 4 AUGUSTUS transcript 1953345 1954293 0.68 - . g499.t1 4 AUGUSTUS stop_codon 1953345 1953347 . - 0 transcript_id "g499.t1"; gene_id "g499"; 4 AUGUSTUS CDS 1953345 1954084 0.96 - 2 transcript_id "g499.t1"; gene_id "g499"; 4 AUGUSTUS CDS 1954167 1954293 0.69 - 0 transcript_id "g499.t1"; gene_id "g499"; 4 AUGUSTUS start_codon 1954291 1954293 . - 0 transcript_id "g499.t1"; gene_id "g499"; # protein sequence = [MGTIVLSPPSTPAEYFRIVSPTLQIPSPGTGISVPVGILACQLVIACTVSQPPSTPAGKKTKKAVSAPTLPNEPILEV # ILHDTVIFPEGGGQPTDTGVITTSDGKTWSVLQAKRNGGHAVHYVKVKEGDLESALLVFTPGSTVTAALGQDDYDRRYDHVRLLRPADLLRVYSDTLQ # MSMHTSQHLLSALLETRLNLPTLSWSLTNAPSPCYIEVPRGMTVEEIRFIQSEANRLVFEGRQVHTEVEELDRDKKAAPVVIGGRSVGKGLPSDYTGG # VNRVVVIDGVDRNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g499 ### # start gene g500 4 AUGUSTUS gene 1967447 1968504 0.39 - . g500 4 AUGUSTUS transcript 1967447 1968504 0.39 - . g500.t1 4 AUGUSTUS stop_codon 1967447 1967449 . - 0 transcript_id "g500.t1"; gene_id "g500"; 4 AUGUSTUS CDS 1967447 1967909 0.83 - 1 transcript_id "g500.t1"; gene_id "g500"; 4 AUGUSTUS CDS 1968242 1968504 0.84 - 0 transcript_id "g500.t1"; gene_id "g500"; 4 AUGUSTUS start_codon 1968502 1968504 . - 0 transcript_id "g500.t1"; gene_id "g500"; # protein sequence = [MANRPPLDSVSSHGSDSTAYGDPFADRPRQAQFVEPERPYRNNNPQAFESSASIPQEFGGRDYNDEEDYMEKQPLTAG # QTYPGGFYPPHMRYTAATCDPDEFSEANGYSLRTKIYGRETELLIAVTSYNEDKTLYARTLHGVMLNIRDICKTKQSKYWRRQAEEGMPGWQKITVAL # IVDGLDAMDKSVLDLLATVGVYQDGVMKKQLDGKDTVAHIFEVRSNHHLLNLIQQFHLVHYSTFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g500 ### # start gene g501 4 AUGUSTUS gene 1979745 1981699 0.19 + . g501 4 AUGUSTUS transcript 1979745 1981699 0.19 + . g501.t1 4 AUGUSTUS start_codon 1979745 1979747 . + 0 transcript_id "g501.t1"; gene_id "g501"; 4 AUGUSTUS CDS 1979745 1980840 0.19 + 0 transcript_id "g501.t1"; gene_id "g501"; 4 AUGUSTUS CDS 1980906 1981699 0.98 + 2 transcript_id "g501.t1"; gene_id "g501"; 4 AUGUSTUS stop_codon 1981697 1981699 . + 0 transcript_id "g501.t1"; gene_id "g501"; # protein sequence = [MSNNSNLLSGLLRSISRRSQRRDADTEESEQPLRADVDMESESQQSRTADPQTAITAVANNAVNANDGNQSDSSMPAL # QDVSDSEDSEVDSEDEDEARRDQFMNTSQVSHSGGIVNANSEFSQHTFGRSGLHTDDDEDMPSLESTHPTRSSNTRPQGTRRARVEDDVDGDSERDRR # HPSQRASNNQSEASSPLPIHPVHPGQANNHVHRHIVFSNMPGVGADAAGPLPPFPDFPGHQHHPLPLNMMAQMGFDIRTNATQGGNADVSDNGGPGNN # TDSGTPEGNNNSQPRGAIPNTPNGFAAILQSFLQAAGGHPGATFTTAFNGVPVGDNLPNANAGAENGGGNSGFLGNLFTVMSGMEGGTIAANLPGGIP # FFGFRPAQERENPERAKVLVDGLEEVPVGLIRRLERVSPESSGCAICWEKLLEQDAEYLRREEQEQKKVEDASKAGGNMAPDASSTITQNDLQTTNPS # LSIPSSTPSPSSSASKGTSINNKVPTYPRIVSLPCSHVFHSECLLPWFTRPRQTTCPTCRFNIDPDDLTRGVGIRRRAAASTAAGGRGGTETVAGEDA # MPSASTTTDGFGAVDPATGLPAPLSVNAQRMPFIGSVNGRSNGMQVQPPFPGMTGSGARAW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g501 ### # start gene g502 4 AUGUSTUS gene 1982497 1983768 0.74 + . g502 4 AUGUSTUS transcript 1982497 1983768 0.74 + . g502.t1 4 AUGUSTUS start_codon 1982497 1982499 . + 0 transcript_id "g502.t1"; gene_id "g502"; 4 AUGUSTUS CDS 1982497 1983768 0.74 + 0 transcript_id "g502.t1"; gene_id "g502"; 4 AUGUSTUS stop_codon 1983766 1983768 . + 0 transcript_id "g502.t1"; gene_id "g502"; # protein sequence = [MHPQGNIQHHHHAGDSYVTIGFDFVLSPNAPLSGPIPPQAGATGNTPQNAPLNHSDNHGTNNRDADNSYAAQDGVPHQ # TDSRGQTSGNSEAELPNEVEFHTIGVDIGIDHLGSMDPSSFDEGTCLRYVFRGVLVFIVTAAEEDFMSFPDILNAHPQRPEGPVMSSGARTPGDVSNS # TVPVAAPPLQTSDPRTAHNNFAANQRRAASSDATGNNAQPNPNTSPRIPDITGYLDSMFGSAVPSTAGPRRPQYATRGSRPRSAARGGYRTQERRPWA # PPPPPGLTLRQTIEKREREAGLRCWDVSCGLAPDDDCPLREIPEGQKRQVRIRQGSAASTSSPQEGGEDPKGKGKEKADHDPEPKYVCEHTFHTPCLV # SAQRVALNGAEEVIVEEGKSVEVSCPICRTIGVVPRDDWEDGVRALESDLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g502 ### # start gene g503 4 AUGUSTUS gene 1984569 1986107 0.71 + . g503 4 AUGUSTUS transcript 1984569 1986107 0.71 + . g503.t1 4 AUGUSTUS start_codon 1984569 1984571 . + 0 transcript_id "g503.t1"; gene_id "g503"; 4 AUGUSTUS CDS 1984569 1986107 0.71 + 0 transcript_id "g503.t1"; gene_id "g503"; 4 AUGUSTUS stop_codon 1986105 1986107 . + 0 transcript_id "g503.t1"; gene_id "g503"; # protein sequence = [MDDQHSAAEIPLPSSPPHTPAQNGYANPSISVAHKSDADASHRSGPSPQPDLKPQKIEDSLKYEPSAAENVEGHIDVV # DELSVGVPIPQIHAPILGVQEQELSVLNSTAPMTEEQMDGNASAVDEAVIAVSDSRITAPNSDAQERELPVPEPESSLELTPTLKSAEPSSSTVREIP # PVPSSPVFNPNTFKESHHPKTPGSPLSSNSVTHRRSLTISRGNNSVSAVLISSALEIIASSKDAKRSAPLKESTQKALDLIRSNQGGDHPKEIFEPLR # LACETRNEKLMIASLDCISKLISYSFFAESPLSANSDYNSPPNSPGPSLEDNLPSLVDLVAHTITACHTENTPDAVSLQIVKALLSLVLSPTVLVHHS # SLLKAVRTVYNVFLLSTDPVNQMVAQGGLTQMVHHVFTRCRIGDYPPSIDSATLSRSPSQTSFASPKHLPFTIPSPRTPTAINGRNTPDSYTKDNASA # STASLPQETASPLPVTTESESVNGSHPEEDDESGPRTPKAFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g503 ### # start gene g504 4 AUGUSTUS gene 1986772 1988452 0.1 + . g504 4 AUGUSTUS transcript 1986772 1988452 0.1 + . g504.t1 4 AUGUSTUS start_codon 1986772 1986774 . + 0 transcript_id "g504.t1"; gene_id "g504"; 4 AUGUSTUS CDS 1986772 1986846 0.3 + 0 transcript_id "g504.t1"; gene_id "g504"; 4 AUGUSTUS CDS 1986908 1987450 0.54 + 0 transcript_id "g504.t1"; gene_id "g504"; 4 AUGUSTUS CDS 1987504 1987873 0.85 + 0 transcript_id "g504.t1"; gene_id "g504"; 4 AUGUSTUS CDS 1987923 1988452 0.47 + 2 transcript_id "g504.t1"; gene_id "g504"; 4 AUGUSTUS stop_codon 1988450 1988452 . + 0 transcript_id "g504.t1"; gene_id "g504"; # protein sequence = [MFSRLCQDPQALVDIYLNYDCDSEAASISSLINVISKIATSPSTNQHNKTNEPPSPAVTPNSSKQSGKNSTIPPSLST # TAMSVSGSMDTSSMGLSEAQLRRQGLECLVAILRSLVAWGTAAGKSTEDGNTLVGSESGTVSQNGEEAPRDSMIADSSLDRLATEPSSEQLRQPTPEL # ADDPSRFESAKQKKTTLLEGIRRFNFKPKRGISFLIEHGFILSKTPQAIANFLLHTDGLSKSMIGEYLGEGLVLCNTFLDVAIQLFSRGEENIAIMHA # FVDQLDFNNLAFVDALRLFLQSFRLPGEAQKIDRFMLKFAERYVAGNTQTAFANADTAYVLAYSVVLLNTDAHNPQVKKRMTKQDFIKNNRGINDGAD # LPEDLLGPIFDEITSNEIKMKDEVEAITVSATGPGIASALANVGRDLQREAYVMQSSGMLNKTEVCHVGDRVILQSDSLIIVGHVQDIDAHATKGFER # WKPILQRVPFRACATHVRGGLDSVSSRPFWATARD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g504 ### # start gene g505 4 AUGUSTUS gene 1991789 1993396 0.65 - . g505 4 AUGUSTUS transcript 1991789 1993396 0.65 - . g505.t1 4 AUGUSTUS stop_codon 1991789 1991791 . - 0 transcript_id "g505.t1"; gene_id "g505"; 4 AUGUSTUS CDS 1991789 1993396 0.65 - 0 transcript_id "g505.t1"; gene_id "g505"; 4 AUGUSTUS start_codon 1993394 1993396 . - 0 transcript_id "g505.t1"; gene_id "g505"; # protein sequence = [MSVEDMRYVDKLLSKKSHPPTNDNLSDDDTPLALHRSKSSGGKVAPPRVSPQPKKGPTIDWFDFFLTAGCDLDDCTRY # AASFERDKIDESILPDITESTMRSLGLREGDIIRVTKAIEKRRPKSADKSNDHSARDEALAKQLQAQESSDSPKVTAPPNLFANGPNGVLKPGRRGRP # QPTKSLSSAVDLNTISEVSDKIQRTESPSLLSPVSAGTPVQPPARSSSAALVASGFDDDAWTNRPISTEPLAPASRAPPVTVPRAPSAPPTSAPAQAV # PVPTPPNPPVAASARGPPSLANTTEDDVFQQLARLSELRKSTAPAPAPSPSPITNVVQMGTPSPIPQAPTPPTAPNGYQSGMGMSNSPIPMGQHLQAQ # QTGVYGPGPRGPYAPVPSNQNLLQPLIPTQTGFNGFVPTRANNVNLSQPSFLQSQPTGFPTTQPMISYPNGFPITTQSTGMPFGGMNGGMTGLNSGMN # AVNPFGAGGVMTSMSSVSFCYHSSHFYLSRSNRFQSCNGPELQRWHVFASACSSAPIGYFKSQQH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g505 ### # start gene g506 4 AUGUSTUS gene 1993670 1994646 0.22 - . g506 4 AUGUSTUS transcript 1993670 1994646 0.22 - . g506.t1 4 AUGUSTUS stop_codon 1993670 1993672 . - 0 transcript_id "g506.t1"; gene_id "g506"; 4 AUGUSTUS CDS 1993670 1994536 0.66 - 0 transcript_id "g506.t1"; gene_id "g506"; 4 AUGUSTUS CDS 1994614 1994646 0.28 - 0 transcript_id "g506.t1"; gene_id "g506"; 4 AUGUSTUS start_codon 1994644 1994646 . - 0 transcript_id "g506.t1"; gene_id "g506"; # protein sequence = [MKGTLGIGSGAAAVQKWPTSSISNINVEKAKHVHFDVEGGVSLHFNVGSKDNCEAIVAKLESSKALALQPSEETPAPT # PSRAPPPPSLGSLPARAVKASVHFAPESPAIIPSPPEAEEPEEEEEPEEEGEMAVALYPFTADGDDELSVIEGEQLLVLEKDGDEWWKCRNAEGAEGV # VPASYIELAPSNRQTAPRSTPLEEEPEEEEEKEDLVAKEAQARERAEAEAAAAAAAERARKEEEGRREKDKEKERKKKEAQARAKAAEAERAKRTQAA # AVSHPSPPPSSANNRLVICTLIAKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g506 ### # start gene g507 4 AUGUSTUS gene 1995589 1996779 0.5 + . g507 4 AUGUSTUS transcript 1995589 1996779 0.5 + . g507.t1 4 AUGUSTUS start_codon 1995589 1995591 . + 0 transcript_id "g507.t1"; gene_id "g507"; 4 AUGUSTUS CDS 1995589 1996087 0.95 + 0 transcript_id "g507.t1"; gene_id "g507"; 4 AUGUSTUS CDS 1996142 1996779 0.51 + 2 transcript_id "g507.t1"; gene_id "g507"; 4 AUGUSTUS stop_codon 1996777 1996779 . + 0 transcript_id "g507.t1"; gene_id "g507"; # protein sequence = [MKITLITISIPCFLLPLAMSKLNAGAFEFVPGKSFALPPQSFQQSQAPLPPPIERPEQTEAPRPPPTISLSIGGSKPS # APTPVVQPDPAAAITPSNAPTSTPTSSQAKSTPIPAKTSVKVKSDSPAPPTAPSKTFSLEKSKTDTNAIAKEVQAAADKAVLDDLFGNAKEHLNIVFI # GHVDAGKSTLGGNLLFITGAVDKRTMEKYEKEAKEAGRETWYLSWALDSTPQERLKGKTVEVGRAYFETTIRRYTILDAPGHKTFVPSMISGAAQADI # AILVISARKGEFETGFERGGQTREHIMLVKTAGVSKVVIVINKMDDPTVLWDKGRYDEIKDKLTPFVRAAGFNPKTDVTFIPVSAYTGLNLKDRVPKT # TCPWWE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g507 ### # start gene g508 4 AUGUSTUS gene 1996900 1997340 0.24 + . g508 4 AUGUSTUS transcript 1996900 1997340 0.24 + . g508.t1 4 AUGUSTUS start_codon 1996900 1996902 . + 0 transcript_id "g508.t1"; gene_id "g508"; 4 AUGUSTUS CDS 1996900 1997340 0.24 + 0 transcript_id "g508.t1"; gene_id "g508"; 4 AUGUSTUS stop_codon 1997338 1997340 . + 0 transcript_id "g508.t1"; gene_id "g508"; # protein sequence = [MPVSEKYKDMGTIIVGKIESGHMRKDDKLVLMPNKDQVEIAAIYNEIEDEVPDAFCGDNVRIRIRGVDDEDINPGFVL # TSPSKPIHAVRQFEAQLAILEHKSIICAGYSAVMHVHTLAEEVTLVVSIVYVEWERFADRPSVLVTLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g508 ### # start gene g509 4 AUGUSTUS gene 2000246 2000896 0.49 + . g509 4 AUGUSTUS transcript 2000246 2000896 0.49 + . g509.t1 4 AUGUSTUS start_codon 2000246 2000248 . + 0 transcript_id "g509.t1"; gene_id "g509"; 4 AUGUSTUS CDS 2000246 2000896 0.49 + 0 transcript_id "g509.t1"; gene_id "g509"; 4 AUGUSTUS stop_codon 2000894 2000896 . + 0 transcript_id "g509.t1"; gene_id "g509"; # protein sequence = [MSSELASTLHAGSCLIDTLSTPQTQLKSALLQRLQNYYSCLGSSSTLNDSATLENVQIRTADEALVVVEKVQRLLRTN # APDTGAPLLGTRDLNQLRVLLSITFRWGVDPLLSHVISSWPSTSSSTVPGAKIIDLTSTPEDYHHLANLVARQLTLVFPLGIHGNTSNTLITEVILQR # HLPDILKPAISLGWLPKSLAVDTMTPLDDIRPLIMRLMAM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g509 ### # start gene g510 4 AUGUSTUS gene 2002104 2002544 0.15 + . g510 4 AUGUSTUS transcript 2002104 2002544 0.15 + . g510.t1 4 AUGUSTUS start_codon 2002104 2002106 . + 0 transcript_id "g510.t1"; gene_id "g510"; 4 AUGUSTUS CDS 2002104 2002544 0.15 + 0 transcript_id "g510.t1"; gene_id "g510"; 4 AUGUSTUS stop_codon 2002542 2002544 . + 0 transcript_id "g510.t1"; gene_id "g510"; # protein sequence = [MQLQIAVSDSSKSAGLFSKPSQILTFIKQALEAAASARPEPNYQKKKVSLAGKFQISDLRLSPQDEEDPEVSDGDSDD # DLSDSEAFTADNEMEETSITLLLSVLEGKISLLPITVTSFIGQIQPTKTCQPVQSLYSTTYLSFLNLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g510 ### # start gene g511 4 AUGUSTUS gene 2002595 2003627 0.13 + . g511 4 AUGUSTUS transcript 2002595 2003627 0.13 + . g511.t1 4 AUGUSTUS start_codon 2002595 2002597 . + 0 transcript_id "g511.t1"; gene_id "g511"; 4 AUGUSTUS CDS 2002595 2003036 0.23 + 0 transcript_id "g511.t1"; gene_id "g511"; 4 AUGUSTUS CDS 2003116 2003627 0.53 + 2 transcript_id "g511.t1"; gene_id "g511"; 4 AUGUSTUS stop_codon 2003625 2003627 . + 0 transcript_id "g511.t1"; gene_id "g511"; # protein sequence = [MTARLALGDDDVSRNNAVDTQAESPREIYQKALKFLQDPILPVRAHGLLLLRQLASASTDSAKMDSALVPAVLEIFVQ # SIQDDDSYIFLNAVQGLAALVDNYDRSILKRLVYDYTKHLDGLEAGNMNQQDVDTRIRLGEALSMVIRRWNVIIPPLLRVVRSPTAPTTLRTSSLSLL # ADCQNTYALAVLPYLLDLAEGMIDLLQVETTSTTDNTTTIKSEEGRKSTMDDHPTSTNTKFPPLRRAALHFLTLLIRGTTKEIYESYASAGDNARLSV # GLTKRMRITLGYISNTDDDMLVRIMAREALEDLAHLELAKLTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g511 ### # start gene g512 4 AUGUSTUS gene 2006710 2007024 0.97 - . g512 4 AUGUSTUS transcript 2006710 2007024 0.97 - . g512.t1 4 AUGUSTUS stop_codon 2006710 2006712 . - 0 transcript_id "g512.t1"; gene_id "g512"; 4 AUGUSTUS CDS 2006710 2007024 0.97 - 0 transcript_id "g512.t1"; gene_id "g512"; 4 AUGUSTUS start_codon 2007022 2007024 . - 0 transcript_id "g512.t1"; gene_id "g512"; # protein sequence = [MVVKTAVSEALALQIVQVLTGDEFQMLDALQNPPEPFEDVIRTHFRLKARSLKKQLDSWLKEDDHRALASDGAEYSGA # GRNSSTSSSNDFKADINSLKSLLNDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g512 ### # start gene g513 4 AUGUSTUS gene 2009161 2010078 0.32 - . g513 4 AUGUSTUS transcript 2009161 2010078 0.32 - . g513.t1 4 AUGUSTUS stop_codon 2009161 2009163 . - 0 transcript_id "g513.t1"; gene_id "g513"; 4 AUGUSTUS CDS 2009161 2009438 0.53 - 2 transcript_id "g513.t1"; gene_id "g513"; 4 AUGUSTUS CDS 2009527 2009841 0.48 - 2 transcript_id "g513.t1"; gene_id "g513"; 4 AUGUSTUS CDS 2009893 2009964 0.76 - 2 transcript_id "g513.t1"; gene_id "g513"; 4 AUGUSTUS CDS 2010018 2010078 0.76 - 0 transcript_id "g513.t1"; gene_id "g513"; 4 AUGUSTUS start_codon 2010076 2010078 . - 0 transcript_id "g513.t1"; gene_id "g513"; # protein sequence = [MDKEDDDGELEDDEGVLTRYYYDSDDDGGMPGDSGASKVNDPYAGIFFSKDRREEVIEIEEESVFVSVPEINEKVEVM # TQGRWMAGCAEGGEQSFLFSLYSQLGESQLSDLDGVCPCPSGCGQTVKRQQSDFFAIYVSFVLDQQISDSDNFCFACGEKISQDASDPLWHCSNLQGV # ILGVGLFMIERLFEQQKEESEIKETTERETKRRKTRDIDDDELDTGSGKTKGGVGYAGDLKEDVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g513 ### # start gene g514 4 AUGUSTUS gene 2015894 2016286 0.55 - . g514 4 AUGUSTUS transcript 2015894 2016286 0.55 - . g514.t1 4 AUGUSTUS stop_codon 2015894 2015896 . - 0 transcript_id "g514.t1"; gene_id "g514"; 4 AUGUSTUS CDS 2015894 2016286 0.55 - 0 transcript_id "g514.t1"; gene_id "g514"; 4 AUGUSTUS start_codon 2016284 2016286 . - 0 transcript_id "g514.t1"; gene_id "g514"; # protein sequence = [MSTGTLFQSPRDAMQDARGHQLNSLITPRKRHRSASPIDNGAVDETYNEEESMSIDVGRQPERPVKPLKKTARSMLQS # KSLPAGALFPGQSQTILQGDLRETDEEENDWSSDLTFQASASSITFEPTLMP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g514 ### # start gene g515 4 AUGUSTUS gene 2018211 2018720 0.44 + . g515 4 AUGUSTUS transcript 2018211 2018720 0.44 + . g515.t1 4 AUGUSTUS start_codon 2018211 2018213 . + 0 transcript_id "g515.t1"; gene_id "g515"; 4 AUGUSTUS CDS 2018211 2018720 0.44 + 0 transcript_id "g515.t1"; gene_id "g515"; 4 AUGUSTUS stop_codon 2018718 2018720 . + 0 transcript_id "g515.t1"; gene_id "g515"; # protein sequence = [MSPCVGPNNSFYYTGGFDGSSLEPLSNVWRLNISGVLSSNNPTSVSGSWQEMTINNFNSLSTQNLSGTMVMDSVAVYG # GCATTSTTNNSCATQNAYSLDIDTRTSTDPNNCPAPRFGAVMTPNLNSVSATSTQVMLLLGTFNSSLWSDDSGLDNGEVVRNSIFFKYLAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g515 ### # start gene g516 4 AUGUSTUS gene 2019366 2020653 0.8 + . g516 4 AUGUSTUS transcript 2019366 2020653 0.8 + . g516.t1 4 AUGUSTUS start_codon 2019366 2019368 . + 0 transcript_id "g516.t1"; gene_id "g516"; 4 AUGUSTUS CDS 2019366 2019887 0.8 + 0 transcript_id "g516.t1"; gene_id "g516"; 4 AUGUSTUS CDS 2020030 2020653 1 + 0 transcript_id "g516.t1"; gene_id "g516"; 4 AUGUSTUS stop_codon 2020651 2020653 . + 0 transcript_id "g516.t1"; gene_id "g516"; # protein sequence = [MASHSLILLVCLGLGIAGLVSAFTSISLTTPTSNLSKRTSSTNFHLHTGHGIASLAFFIVLYGVLPLLWLLSGRFNRP # SKATDHIEGLNSDKQHITSADTVEKTTKSRSRTPSRPSSPRRRTHSWGPSILWRPSTDRGDSDSNNSADAQAALTQTDPVPAEPPRTFEVVNRPPRDA # LDYALTENQRSRERALLSTSAVPNTPNHLSPTPEIPDANGIVLHILLQSSILGLAIISLIKLWSSSLVGFIVFLIWTVAFYITLVVLAWNGKPKLSIL # AVILTRLRAKPAATAQEVNQYLASQSPPLSAPDHYAFPQGSGPYYHEPPFQAVSTDLSHGDLLSVETDEDDDEDEDARQQRIESEMARREIVTVTVPR # RKLLIANPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g516 ### # start gene g517 4 AUGUSTUS gene 2020928 2022154 0.37 - . g517 4 AUGUSTUS transcript 2020928 2022154 0.37 - . g517.t1 4 AUGUSTUS stop_codon 2020928 2020930 . - 0 transcript_id "g517.t1"; gene_id "g517"; 4 AUGUSTUS CDS 2020928 2022154 0.37 - 0 transcript_id "g517.t1"; gene_id "g517"; 4 AUGUSTUS start_codon 2022152 2022154 . - 0 transcript_id "g517.t1"; gene_id "g517"; # protein sequence = [MARTPLARSSTLIDPATLQDHPVNIRASSFEPTSGMARRNSRHVGPLLNFDDDGKVPTVAVNKGPPNRSVFGVDTLWE # REMAKLREIEAQEAFERERQQAIEETEALKNGGKKKKKKGKKGQGSEFASPVPDLSPSVAGRSVLEDTPAESVVSSGPPVLPTIPAIRGPPPVIDDEV # SDSEESVGGRVVQSSQAEGWYADSDEDKDGPRRITGIGLRYPQKQTPPPQIHATDDDSEEDLPLAATIGRAIERTSRLAPPESDSDEEKPLSTLIAKP # SLPSINFDNLSPLSAEPDTRDDDDEPLGIRASRIMPNPNADGEDDDRPLAFHPEQQRRTQYQMMAQHQMMMNNMQMQNSMFFNPSMSGFFPPPMVMPP # PMVSAPIPIPSPPPVHDAAKFGRVDRWRHDVATEGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g517 ### # start gene g518 4 AUGUSTUS gene 2022186 2024574 0.11 - . g518 4 AUGUSTUS transcript 2022186 2024574 0.11 - . g518.t1 4 AUGUSTUS stop_codon 2022186 2022188 . - 0 transcript_id "g518.t1"; gene_id "g518"; 4 AUGUSTUS CDS 2022186 2023739 0.65 - 0 transcript_id "g518.t1"; gene_id "g518"; 4 AUGUSTUS CDS 2024148 2024269 0.37 - 2 transcript_id "g518.t1"; gene_id "g518"; 4 AUGUSTUS CDS 2024415 2024574 0.23 - 0 transcript_id "g518.t1"; gene_id "g518"; 4 AUGUSTUS start_codon 2024572 2024574 . - 0 transcript_id "g518.t1"; gene_id "g518"; # protein sequence = [MKARVLEINPRSPLIEGLLKKVEALPTEEEGRDVEAEEELEEVASILLDGALIHDTVKPAPPVDPELPAFEELYQMPP # EDGKAGVYVPPHMQDDYTCSISWPEYDNDPSDPSAPYRSAHESAIFAHLRRNPARPQVSQRKSDYLGVPLPSETDSVLDGKRKSRGSTIGPLRNPFGA # DDHFEEEAEEQEVQEEAGEMDLDLTSWGLDAFMSKDKSGKGKGKAKSLPSAQPLSAVQAHFPKTNDVLGEVHRRPRTTRSMSVGNYDFLSPAEEVRRK # SIGSPLDLSAMEIPASFQRPVASTSQSLGYDSLAYDGLAFEESHPAMGSIPFPTTSVRSPSPMTLDHRRTYSTASFESKMAMSAPRLRTTSNGTMEPT # DDNPFTIAPPSRASRFDPKAAAHARTVSNASLGSRMLLENDGASVMTGRPPLESRYSTTMELLRPKVLVMPSPLQSANAPPPPPKGRDGFTLADAPPM # PPGARTPMRIPNIGSSTVPVPSNSFTPNPRLNLSLSQLTFRNNLTVGGQRDIAYNDIDGDLPRALEDGEQAKLSTTPTMEMEMNLPIPSEHATSPHRP # AGKLYGKSLIDDLENRKAGMKSKQRYIQFYLFIAHLQTKIDII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g518 ### # start gene g519 4 AUGUSTUS gene 2024912 2025526 0.83 - . g519 4 AUGUSTUS transcript 2024912 2025526 0.83 - . g519.t1 4 AUGUSTUS stop_codon 2024912 2024914 . - 0 transcript_id "g519.t1"; gene_id "g519"; 4 AUGUSTUS CDS 2024912 2025029 0.98 - 1 transcript_id "g519.t1"; gene_id "g519"; 4 AUGUSTUS CDS 2025081 2025226 1 - 0 transcript_id "g519.t1"; gene_id "g519"; 4 AUGUSTUS CDS 2025362 2025526 0.85 - 0 transcript_id "g519.t1"; gene_id "g519"; 4 AUGUSTUS start_codon 2025524 2025526 . - 0 transcript_id "g519.t1"; gene_id "g519"; # protein sequence = [MADLETEDSEKFEKFYEIFGGILKLGAVEDQKNREKLAAITRFTTNHRNFTTLDQIFYLAEMGENPQELAKSVFVEKL # HARGYEVLLFTEPLDEIFVQNIRRWKNIPFQDIAKVGLKFGDEGEVITSRYELFIEFPLWIRHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g519 ### # start gene g520 4 AUGUSTUS gene 2026129 2026512 0.44 - . g520 4 AUGUSTUS transcript 2026129 2026512 0.44 - . g520.t1 4 AUGUSTUS stop_codon 2026129 2026131 . - 0 transcript_id "g520.t1"; gene_id "g520"; 4 AUGUSTUS CDS 2026129 2026411 0.52 - 1 transcript_id "g520.t1"; gene_id "g520"; 4 AUGUSTUS CDS 2026469 2026512 0.48 - 0 transcript_id "g520.t1"; gene_id "g520"; 4 AUGUSTUS start_codon 2026510 2026512 . - 0 transcript_id "g520.t1"; gene_id "g520"; # protein sequence = [MILQSILRTRKLLRWSKHSSFSTSFPIYLFTQRTDEIPDEDVILEETSSAESVPKPTSDTDDADADDTDEAVIEDVSE # EEQTPAPPKMKSITVDEWVRLNGQPPIWTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g520 ### # start gene g521 4 AUGUSTUS gene 2028093 2028410 0.2 - . g521 4 AUGUSTUS transcript 2028093 2028410 0.2 - . g521.t1 4 AUGUSTUS stop_codon 2028093 2028095 . - 0 transcript_id "g521.t1"; gene_id "g521"; 4 AUGUSTUS CDS 2028093 2028410 0.2 - 0 transcript_id "g521.t1"; gene_id "g521"; 4 AUGUSTUS start_codon 2028408 2028410 . - 0 transcript_id "g521.t1"; gene_id "g521"; # protein sequence = [MSSTPTSKLGMSERALQQEFEKWQRERTHASRKAFDQMLSENSFVEFWGRLGKIGGEGVDGGVKADEDDAESEGLGTK # VDMKVLAKNVDVEEMEKVLRVSLVNLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g521 ### # start gene g522 4 AUGUSTUS gene 2029077 2030308 0.2 - . g522 4 AUGUSTUS transcript 2029077 2030308 0.2 - . g522.t1 4 AUGUSTUS stop_codon 2029077 2029079 . - 0 transcript_id "g522.t1"; gene_id "g522"; 4 AUGUSTUS CDS 2029077 2029601 0.43 - 0 transcript_id "g522.t1"; gene_id "g522"; 4 AUGUSTUS CDS 2029649 2030308 0.47 - 0 transcript_id "g522.t1"; gene_id "g522"; 4 AUGUSTUS start_codon 2030306 2030308 . - 0 transcript_id "g522.t1"; gene_id "g522"; # protein sequence = [MLGPGGQLYYYNVQTKESTYIRPLPSFQNIPPVQPPKKKERPLTKTQIPDTDWIRVKTTEGNVFYSHKVKKQSIWSVP # DEIKDAVAQLELNEKKAGEGEHLMQAEEMLEVERVKAEIKDTAKRKAGETEDTHLDEVVITKKIRIEEAPEDEDEEDESEEEEEWQREAAAQLAAEAE # VEKKRAEEEARQEAEAELKRAKEAQIVMPEKVDLSIEEAKALFKTLLREKDINPLYPWDTSLPKFVSDPRYVLLPSVSARREAFDEYCRDRARELRRN # AVNKESRTPKEEFDSLLNAEVKSTRTSWTDFRRTWKKDRRFYGWGRDDREREKAFRDFIRDLGESTYVSCCTDFYAYAHPYKLEKKAAAQKAEADFLA # LLREHADIKEGCVWKEVCSSNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g522 ### # start gene g523 4 AUGUSTUS gene 2034691 2037495 0.07 - . g523 4 AUGUSTUS transcript 2034691 2037495 0.07 - . g523.t1 4 AUGUSTUS stop_codon 2034691 2034693 . - 0 transcript_id "g523.t1"; gene_id "g523"; 4 AUGUSTUS CDS 2034691 2035191 0.92 - 0 transcript_id "g523.t1"; gene_id "g523"; 4 AUGUSTUS CDS 2035896 2035930 0.44 - 2 transcript_id "g523.t1"; gene_id "g523"; 4 AUGUSTUS CDS 2035981 2036101 0.51 - 0 transcript_id "g523.t1"; gene_id "g523"; 4 AUGUSTUS CDS 2036407 2037495 0.45 - 0 transcript_id "g523.t1"; gene_id "g523"; 4 AUGUSTUS start_codon 2037493 2037495 . - 0 transcript_id "g523.t1"; gene_id "g523"; # protein sequence = [MRKQMAKLEDVSQTVVRIQAAVRTYLARKRLLVLIRGLRKATPLVVGFQARARAGLARQKHENLGKALSEVKTIKAVH # GMQSLARAALARNRHREITRKLDFIAPDVVGLQAAVRGALSRDLYYRWRDHLHNNEHVATVLQAMLRGLAQRKKFRAKMDYYRANLSKVVKIQSLFRA # KETREQYRQLTMGKNVTVGTIKNFVHLLDDSETDFQEELKVERLRKKVVENIRENQALESDVTDLDVKIALVVQNVKSFEDVLKARRGLGADSAAAHA # ARSHLLAAHGDPFAGPNTLDQTARRKLELYQQLFYHLQTHSEYLSRLFVRLSRDDTPEKDRRFTEAAVLTLYGFGQDRREDFLLLKLFQVHRARIELE # EMRAGRPSSQPKDVSFRQALDDPATRPIFIRHLQALQLWTDRFAPAPDDAIRAILTELNGVPNFGNEELKDARDRTITLELTNRFANVEGTGKIIESI # SSSSLRILDPLAEEKTLWVQAKRGVLAILRVQPTQDLLGALLRPVTEEDESVWEDILDAEIANEARQIPRRQASAIGADAAYRLEDIRLWAILHSLRT # CSSNLWPDLISLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g523 ### # start gene g524 4 AUGUSTUS gene 2038668 2040188 1 - . g524 4 AUGUSTUS transcript 2038668 2040188 1 - . g524.t1 4 AUGUSTUS stop_codon 2038668 2038670 . - 0 transcript_id "g524.t1"; gene_id "g524"; 4 AUGUSTUS CDS 2038668 2040188 1 - 0 transcript_id "g524.t1"; gene_id "g524"; 4 AUGUSTUS start_codon 2040186 2040188 . - 0 transcript_id "g524.t1"; gene_id "g524"; # protein sequence = [MQRSDSLSSSSSNPSSSRPNSSSSGPFAYQTRLLERTSSSSKGSLSRTNSQSSNNILTNTTGSSTSSATRRWTPGHRV # ANSLDAVRGKWEERVRENAIDEGPSIPQTPTRLTTFAKLQNAVDSSPVHSTSSPLERTPTYLKRYTTSSVPSPIIATPLSPNSTGVTVEADSPSPTMS # SQRIHLPSYDHVSRSAGAIGRPTSPTLPQPSPARRNTVDFSSLKRINPPRNDAQPPSTPSSPSMFDQSSSVISTPTSVQRRPTSLYSRPSVSSDRDRI # QHQSTGSTSFNPLSPTSANSITAPTPSSPSSNVMFPSTYKSSYMQNKSRYGNTLSAGGRRFGKHLPRIASGDTEDHVEEKKEKEVEREVEKEPPPSRV # ERRAMRRDGNFDTTPRRATTLEAPVADSDAVIGIPGRMRLSRNKAFNAPAPLPSARLARGLWADTQRHLIQAYEYLCHVGEAQQWVEGCLDQELGFGV # VEMEEGLRNGVVLAKLVRVFQGEGVVRRIYEVCPTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g524 ### # start gene g525 4 AUGUSTUS gene 2043601 2044934 0.57 - . g525 4 AUGUSTUS transcript 2043601 2044934 0.57 - . g525.t1 4 AUGUSTUS stop_codon 2043601 2043603 . - 0 transcript_id "g525.t1"; gene_id "g525"; 4 AUGUSTUS CDS 2043601 2043934 0.58 - 1 transcript_id "g525.t1"; gene_id "g525"; 4 AUGUSTUS CDS 2044258 2044934 0.89 - 0 transcript_id "g525.t1"; gene_id "g525"; 4 AUGUSTUS start_codon 2044932 2044934 . - 0 transcript_id "g525.t1"; gene_id "g525"; # protein sequence = [MKSKLGIVLGGYKVTPEVALREDGDAIIIDGNVLEKPFVEKPVSGEDHNVYIYFRGGGGRRLFRKVRAVVFSEFDIDR # ILQVGNKSSELDPSLNHPRTDGSYIYEQFIDVDNSEDIKVYTVGKDYTHAETRKSPVVDGVVRRNTEGKEIRYVRLHVPIPSVKLQRLDRFITRLTDE # ERAWASRICEGFGQRVCGYDMLRCDNGHKSQVIDVNGWSFVKGNESYYGANFPIGEAWTQPFVKLLNGETEEIILREKEQLTKIASAVEESKSLGASG # EELAKLTQLNSALFSKIDLPGTKAQLKPVYSKKQAGHARSLTKLTLVFKWGGEVLSLCFHHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g525 ### # start gene g526 4 AUGUSTUS gene 2046431 2047970 0.18 + . g526 4 AUGUSTUS transcript 2046431 2047970 0.18 + . g526.t1 4 AUGUSTUS start_codon 2046431 2046433 . + 0 transcript_id "g526.t1"; gene_id "g526"; 4 AUGUSTUS CDS 2046431 2046693 0.42 + 0 transcript_id "g526.t1"; gene_id "g526"; 4 AUGUSTUS CDS 2046742 2046858 0.53 + 1 transcript_id "g526.t1"; gene_id "g526"; 4 AUGUSTUS CDS 2047511 2047970 0.98 + 1 transcript_id "g526.t1"; gene_id "g526"; 4 AUGUSTUS stop_codon 2047968 2047970 . + 0 transcript_id "g526.t1"; gene_id "g526"; # protein sequence = [MTCASCSNTITNTAKDLPGVIDLVVSLLDNSASAVVESEDVARELTSVIDDCGFEATVMNIQSIKKSVTSSIESNRTV # SLKVDGMHCQHCPPKIAAAIERMGSITIVKPNQSHNDPILTISYRPTPPKARTADAISSLALLKPAEAYLLTASDEWSGSSVSSSEGLTAVPMTAKGA # VAFKIENIPADMLELGDIVRVPHGSSPPADGMMVSGTSGVFDESSLTGESEPVRKEAGDKVYVGTINRGDVVHVSVVDISGTTMCVIQFCFAISTNVS # VGWII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g526 ### # start gene g527 4 AUGUSTUS gene 2048201 2049073 0.9 + . g527 4 AUGUSTUS transcript 2048201 2049073 0.9 + . g527.t1 4 AUGUSTUS start_codon 2048201 2048203 . + 0 transcript_id "g527.t1"; gene_id "g527"; 4 AUGUSTUS CDS 2048201 2049073 0.9 + 0 transcript_id "g527.t1"; gene_id "g527"; 4 AUGUSTUS stop_codon 2049071 2049073 . + 0 transcript_id "g527.t1"; gene_id "g527"; # protein sequence = [MNIAVWSLEFAIAVFVVACPCGIGLAAPTALLVGSGLAAKYGLLARGGGEAFQEASRLDIVVFDKTGTITTGKLQVSD # VKYVTNSWNEETILGIIDEMESTSSHPLAIAIREFCAAKTTHPQNGASFRETAGRGLFASFQSLSCSVVIGNEYWMQENSVQISLELRDLADSWKNEA # KSVVFVAAQRDAQWEVLAIFGVADLIRPEASNVISLLIKAGIETWMISGDNEKTALAVAAAVGIPSSNVIAGVLPQEKVSSLFYQIHLNTDCCDSGSK # DTMVTKRTSCLTLHRH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g527 ### # start gene g528 4 AUGUSTUS gene 2050163 2051740 0.65 - . g528 4 AUGUSTUS transcript 2050163 2051740 0.65 - . g528.t1 4 AUGUSTUS stop_codon 2050163 2050165 . - 0 transcript_id "g528.t1"; gene_id "g528"; 4 AUGUSTUS CDS 2050163 2051740 0.65 - 0 transcript_id "g528.t1"; gene_id "g528"; 4 AUGUSTUS start_codon 2051738 2051740 . - 0 transcript_id "g528.t1"; gene_id "g528"; # protein sequence = [MEKHHSSTSAPATELNTVRVYSTSSNTTIDLDPESQSSSNHTTGTNTQRTSMRSNPFEDNHSIQTTGTEGTNVIPIAL # VTPDSLHHSAVSSETETSRSPSPMRPARTPEIDLNLDHINVSHDSLKQIGNYPTSTRSDVSAMSRNSYMSSASYSSDFLNEAPMIMTPNKGAVRQVLG # VVKAEMVNAPGHSPTSAEGLKPSASTSKPAVRSPLAASSFGPADLNFDAVSVSTSEEGGNPFSDRHSTRTTLASSPAASHTTFGEPSPAFNTGTDWAE # TGPRLPWSTGDDGSRPSSVSTQAGSVIDIANATRVNLGLSQLSRESGVLTPRTRTTMGKLVNPSTATTELDTFEEQQQRALAHAQAQAQAQGGVQSRR # ISASSAMSATADSILESFPFVPPSPISNRPARSPPLSPLAQQAFNVSPPSPMSSQNFQATPFDSKLDSNAVVPTPNRKTLGLSTGSQLSTVSTGLGSF # PFQIDTGNSRDSTAPSAFSGRQRASLDTLAITSDLSSFPLGFDRDSVTVPVPRRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g528 ### # start gene g529 4 AUGUSTUS gene 2052392 2052838 0.87 + . g529 4 AUGUSTUS transcript 2052392 2052838 0.87 + . g529.t1 4 AUGUSTUS start_codon 2052392 2052394 . + 0 transcript_id "g529.t1"; gene_id "g529"; 4 AUGUSTUS CDS 2052392 2052838 0.87 + 0 transcript_id "g529.t1"; gene_id "g529"; 4 AUGUSTUS stop_codon 2052836 2052838 . + 0 transcript_id "g529.t1"; gene_id "g529"; # protein sequence = [MAQPEIIDLTLPSSQSPHASFADEDVQIIPQPKKRKSSRSKDNKKSTKKLRSETPIDNSKLFIVDLDPSEALRPTIST # IPQEHESNEGKLLLPAHVSVLGSVPVEIIAPASEDQDYVEYLDYGGPDVHKSYVLITCFVVDLRKHSSWV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g529 ### # start gene g530 4 AUGUSTUS gene 2053527 2054165 0.63 + . g530 4 AUGUSTUS transcript 2053527 2054165 0.63 + . g530.t1 4 AUGUSTUS start_codon 2053527 2053529 . + 0 transcript_id "g530.t1"; gene_id "g530"; 4 AUGUSTUS CDS 2053527 2054165 0.63 + 0 transcript_id "g530.t1"; gene_id "g530"; 4 AUGUSTUS stop_codon 2054163 2054165 . + 0 transcript_id "g530.t1"; gene_id "g530"; # protein sequence = [MRHVHDIPDENSAFGITNLLTGPFSEIETGNTDRAPREWELDSAEWNDWGGRVPINVGRQAKKKEIARMRAHLLDDED # EDDPFSRLAKPMRDGAKKNPGNGQKPPSQPKKMRFELKVKGASNQASGPQDLLRRISSDVGSKGSGRPKDNDTYHRQHGSGRSDKDRERKRNQYRDRD # SPREDRNLKREQDRGREKGREQGPRYKGGYSNGYYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g530 ### # start gene g531 4 AUGUSTUS gene 2059193 2060626 0.8 + . g531 4 AUGUSTUS transcript 2059193 2060626 0.8 + . g531.t1 4 AUGUSTUS start_codon 2059193 2059195 . + 0 transcript_id "g531.t1"; gene_id "g531"; 4 AUGUSTUS CDS 2059193 2060626 0.8 + 0 transcript_id "g531.t1"; gene_id "g531"; 4 AUGUSTUS stop_codon 2060624 2060626 . + 0 transcript_id "g531.t1"; gene_id "g531"; # protein sequence = [MNGLARIEDWESHPKQLANAHSVHQAFMRHVDAVKKHDPSSAELSLAPTAAYVKILGATGLHQEIFDVFYSLDAEGRL # APDHLLFTAMFQALAMKPTAETGDFVQNAASAKLLWNLMTKALRRTKFQIDGQLVSSAMVALSRGRTIDQDFAFSLANEYFGLVGLDGVADSAPSEGK # GILPLQPQSFAAILTLCRNSSRPLHAINFFGAVLQRPESQGGPSIIDRAHVEQVLHSLIAANISSCSEKAIELIEWMLTQEIKLPSTAATKIRPTYPT # FNLLISHICRPENNWRVAVKAFDLMTGYHCHDFMDGVEAKEPRIDHRSTGRNIPPTAEILSSMMRIAVGSENRANIRQALRLVHHFGIQSLARPSHTL # ESKKALKDKLFYACKLARSAMEGIDILSSRSTAQDRPRDDDLVRWQSLKVEAKKLLGSESDNDFIPNIRRKQVHAKPREIREGASTIQSNRLSKTGGR # ILNFKSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g531 ### # start gene g532 4 AUGUSTUS gene 2060926 2062017 0.97 - . g532 4 AUGUSTUS transcript 2060926 2062017 0.97 - . g532.t1 4 AUGUSTUS stop_codon 2060926 2060928 . - 0 transcript_id "g532.t1"; gene_id "g532"; 4 AUGUSTUS CDS 2060926 2062017 0.97 - 0 transcript_id "g532.t1"; gene_id "g532"; 4 AUGUSTUS start_codon 2062015 2062017 . - 0 transcript_id "g532.t1"; gene_id "g532"; # protein sequence = [MYSVYDFGDFNSNGEMIDPFLKLLSLVDPNEASGDFVKARGGTAKTGITYNESNATASTASVTSVDLSTEVAETLAKI # GTYFPVILAIVALNALVLLALTIVGIIILCKRSKKNKRQRIMDVRTRAPMGRMSPMPLNNRDSAATTEPHTYEPISMALTEDTMFVPPSPHFKKYNGS # IRSGKGADRPSSLATLPSQRSFHQDGTPEDALFGPPSPGFRDFSDDRPRSMGMPSNNPYQPFVAGAPASQAHGPEDPLFVPPRSPMRSSHFDRQPSTS # STIAGPSGLGSPQSTQMLDEPFTPPRARFQYDAKTIDRPISMGNTPPPMPTPQHEAHPLEEDITMTPNPAFMRAHAGEGSSGDRPMSVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g532 ### # start gene g533 4 AUGUSTUS gene 2067245 2067529 0.91 - . g533 4 AUGUSTUS transcript 2067245 2067529 0.91 - . g533.t1 4 AUGUSTUS stop_codon 2067245 2067247 . - 0 transcript_id "g533.t1"; gene_id "g533"; 4 AUGUSTUS CDS 2067245 2067529 0.91 - 0 transcript_id "g533.t1"; gene_id "g533"; 4 AUGUSTUS start_codon 2067527 2067529 . - 0 transcript_id "g533.t1"; gene_id "g533"; # protein sequence = [MGKDRSRSPRPELECVETIESFVGPRIQESYSMLMVSVGKMNRLRKSDSKAQALDMKYDGGFEYGGSDIRYDDDDDDV # RKNGYDDGEKVRSKER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g533 ### # start gene g534 4 AUGUSTUS gene 2072117 2072410 0.88 + . g534 4 AUGUSTUS transcript 2072117 2072410 0.88 + . g534.t1 4 AUGUSTUS start_codon 2072117 2072119 . + 0 transcript_id "g534.t1"; gene_id "g534"; 4 AUGUSTUS CDS 2072117 2072410 0.88 + 0 transcript_id "g534.t1"; gene_id "g534"; 4 AUGUSTUS stop_codon 2072408 2072410 . + 0 transcript_id "g534.t1"; gene_id "g534"; # protein sequence = [MGYDGSGVAGTLRWKDLALDQLLPVDEEKETALKAAEARKMASGTGNQNPQTQQQPAALAPGDETIDEEDDEDEDDES # EDDENDDEADEDEDSEEDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g534 ### # start gene g535 4 AUGUSTUS gene 2080544 2081095 0.56 + . g535 4 AUGUSTUS transcript 2080544 2081095 0.56 + . g535.t1 4 AUGUSTUS start_codon 2080544 2080546 . + 0 transcript_id "g535.t1"; gene_id "g535"; 4 AUGUSTUS CDS 2080544 2081095 0.56 + 0 transcript_id "g535.t1"; gene_id "g535"; 4 AUGUSTUS stop_codon 2081093 2081095 . + 0 transcript_id "g535.t1"; gene_id "g535"; # protein sequence = [MLIRLIPSASQPTVLFKLVFENLPETLQTPAAWVNHLATLDSDDLEIPELMHALDKAVGVQGILEQVTFDLVEQKIKC # VFFDGETEEWHIGSCYQGLLGEAAHRRKADLVRRLDSVIDDVNESAAEVERERRREEERKEQKRMREEDERLDAAKQDEITASIHGRRNRPGHKKQRS # LLMNLVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g535 ### # start gene g536 4 AUGUSTUS gene 2081313 2083034 0.69 + . g536 4 AUGUSTUS transcript 2081313 2083034 0.69 + . g536.t1 4 AUGUSTUS start_codon 2081313 2081315 . + 0 transcript_id "g536.t1"; gene_id "g536"; 4 AUGUSTUS CDS 2081313 2083034 0.69 + 0 transcript_id "g536.t1"; gene_id "g536"; 4 AUGUSTUS stop_codon 2083032 2083034 . + 0 transcript_id "g536.t1"; gene_id "g536"; # protein sequence = [MPSPGIRNHRPLSTSSSSSPLAPTESSFPVVIVAPPLPPPLSPRALRRRARSSLVDAFRLYVLPELNRRIRFSHLAGS # HMTSSIPSYGSDTPASYYTWIVGSTLKRVDKRLSEIGKDLKDELDAIGIEPSSLPLGLFAGLGKLFISLVYILSLNLLQGIGSSADPPTAQSLPCSLP # SLAGDSSDGDAGSRSEVDGELAERNDSDNVSEVTLFEPNASSTGNPITVHYHLPKPPANGSSTSSVIAFPPSLYLRSSLSSSDILTPASIVHPEVPLP # ESLNELLIQHNDFSSLHLRLAHLLLTSHTRAAAAAADIAQREAILQVRGRRRSWLNGALKAHGSSNSDTKGYPVNWSGAMATPFRQSGLGKYFYSSDE # WECDPYHYLKMSRLSSLSTLVTDVYPNLFDYAGDNGFSTYFHGHRRKGSVNEKNLSLFPVSEEEFVDDGPSVHRNNFGHRGYLEVEIDEDDEDEDGED # TDVDPLVDVEFDGLDDDDDDMLTRPLRPFLQLDTHSSTGIPKSSTPFSPTAVSMHLEARIPKGASDDRVDDFAPLALANISKRIQNETKAEFLSDNIS # DVAPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g536 ### # start gene g537 4 AUGUSTUS gene 2088542 2089460 0.58 + . g537 4 AUGUSTUS transcript 2088542 2089460 0.58 + . g537.t1 4 AUGUSTUS start_codon 2088542 2088544 . + 0 transcript_id "g537.t1"; gene_id "g537"; 4 AUGUSTUS CDS 2088542 2088758 0.71 + 0 transcript_id "g537.t1"; gene_id "g537"; 4 AUGUSTUS CDS 2088820 2089460 0.82 + 2 transcript_id "g537.t1"; gene_id "g537"; 4 AUGUSTUS stop_codon 2089458 2089460 . + 0 transcript_id "g537.t1"; gene_id "g537"; # protein sequence = [MVSKPQPRVLTRSPPSSPQAEHRNGPRDPYPIPSSNPASQYTLLEKLGTGSFGIVYKAMHNETKQIVAIKQIDLEDTD # DDISEIQQEIASLAQCDSEYVTRYYGSFVVAYKLWIVMEYLAGGSCLDLLKPGPFSEAHIAVICRELLLGLDYLHTEGTIHRDIKAANVLLSSSGKVK # LADFGVAAQLTNTLRHTFVGTPFWMAPEVIRQAGYDAKADMWSLGITAIEMALGEPPLAEYHPMRVLFLIPKAKPPVLEGPFSAAFKDFVSLCLTKDT # NAVRPYHSIQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g537 ### # start gene g538 4 AUGUSTUS gene 2089646 2090320 0.54 + . g538 4 AUGUSTUS transcript 2089646 2090320 0.54 + . g538.t1 4 AUGUSTUS start_codon 2089646 2089648 . + 0 transcript_id "g538.t1"; gene_id "g538"; 4 AUGUSTUS CDS 2089646 2090320 0.54 + 0 transcript_id "g538.t1"; gene_id "g538"; 4 AUGUSTUS stop_codon 2090318 2090320 . + 0 transcript_id "g538.t1"; gene_id "g538"; # protein sequence = [MGWDANSSIRSDWNFDTIKTSSIMGTYRNMAKDLSSMSEAYEDEFIDSGLPSTIDTAAATKGSDPIANGRIGSNFDAA # HSTVVIKSPVIEKDMETLLEATESPVSSEPLSDSVTPPPAYSGSIRSNRRSSYAERHSIDGAGTVMREADLGTGVDTIRPVKKVDTVGSLKISAEHVG # SLRKNSGSSSGPSSPTLHRRAASEIGRAGTSIVDEVVLPVLSQVRRAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g538 ### # start gene g539 4 AUGUSTUS gene 2092953 2093255 0.45 - . g539 4 AUGUSTUS transcript 2092953 2093255 0.45 - . g539.t1 4 AUGUSTUS stop_codon 2092953 2092955 . - 0 transcript_id "g539.t1"; gene_id "g539"; 4 AUGUSTUS CDS 2092953 2093255 0.45 - 0 transcript_id "g539.t1"; gene_id "g539"; 4 AUGUSTUS start_codon 2093253 2093255 . - 0 transcript_id "g539.t1"; gene_id "g539"; # protein sequence = [MVIYRHVPSAWAAAYPSSTPDTSQLPAAWTAALNTAVGAGKIPNVPVSSQPVPDTNPVYPDGYDPTGPDVCSGTYKCR # IPGNVWDAPDGFIGTGNSSVFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g539 ### # start gene g540 4 AUGUSTUS gene 2094150 2096438 0.41 - . g540 4 AUGUSTUS transcript 2094150 2096438 0.41 - . g540.t1 4 AUGUSTUS stop_codon 2094150 2094152 . - 0 transcript_id "g540.t1"; gene_id "g540"; 4 AUGUSTUS CDS 2094150 2094908 0.46 - 0 transcript_id "g540.t1"; gene_id "g540"; 4 AUGUSTUS CDS 2094964 2095152 0.93 - 0 transcript_id "g540.t1"; gene_id "g540"; 4 AUGUSTUS CDS 2095205 2095570 0.93 - 0 transcript_id "g540.t1"; gene_id "g540"; 4 AUGUSTUS CDS 2095629 2096438 0.95 - 0 transcript_id "g540.t1"; gene_id "g540"; 4 AUGUSTUS start_codon 2096436 2096438 . - 0 transcript_id "g540.t1"; gene_id "g540"; # protein sequence = [MAPKAKADISLLFHPKKNKKSTSISSPRPPPPNSALNGSRPSSPVKAKPSPKPSPPKPNADDDEADLQLPDGPYQEFR # IMSSALNGWKYDVMKFDSRKSVDILRWQGPIKLNRKDLRREDPSMSGAGQAVRPMLGLDGQPVIGSDGKTVMVDSEGRPVTENGASGSGAGKGKGLTN # GKKKFQKKTRQVFIVPDEVRNLRKEERYPWVIEDAPGSEVWTAQLDDLGKAETHAFFMPAANDVFKFVPSHRYYKFQKKLKHDMPTDTTSVESAYQKS # LKRDPSTWLHQRNGKGPSAATAAMFKAEADGQPQANGSLVHQAQQSLGPGGRRLKAVDSGADDLFGEDDEDNGAAKRRAKEFGGEGDMDEMVYEEDFA # DDEEKMDVEDTNDQEAKELEERLKKEYKNANKTREGYIDESDEEEEKPGMTKQAKRMQKMLRAREGNDVYESEEEEDNPYASSEEEEDEEEEIVPQTG # PAVQPQSKSPTPSQTSSSNLELMKATTQINGAVHTTASRATSPVPGLGGHSVVAKRATSPKVPKIKPNLTNTGRSGSPLASRASSPVSPVGAGGMTTA # TSPTPGSRAGSPAAVNGVQNGQSQNKKRKAEEAGSLSPTLLSSNGPPKPKKRKAHPTTAVAIPAGPLEERLLIEWLKNTPTANASTRECIQYFTPYLT # DEEKKAQFTGLVKEIAQLKNGVLVLRPAYRDSPAATPTASG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g540 ### # start gene g541 4 AUGUSTUS gene 2096804 2097996 0.71 - . g541 4 AUGUSTUS transcript 2096804 2097996 0.71 - . g541.t1 4 AUGUSTUS stop_codon 2096804 2096806 . - 0 transcript_id "g541.t1"; gene_id "g541"; 4 AUGUSTUS CDS 2096804 2097159 0.97 - 2 transcript_id "g541.t1"; gene_id "g541"; 4 AUGUSTUS CDS 2097237 2097996 0.71 - 0 transcript_id "g541.t1"; gene_id "g541"; 4 AUGUSTUS start_codon 2097994 2097996 . - 0 transcript_id "g541.t1"; gene_id "g541"; # protein sequence = [MSVDKGVPGELLAGPGVSGIEVEMEAPPPKRRGSAIDTSRIASLSLNEQRRNSVDSRGSHWAWTNDRRDSTSSIFSAA # SGYSQAFPGTESPQGRPATGITTFAWPVSASPHPSESINMQHEGDPNVTASAPLHMMPPINFSQDRRMSVPNVLSASPPTSTGPTRVLRSRSRPPSRQ # TRAEDAQSASPEDPLADPLASSSSSVKAAKDSGATPYSRSPELRVSHKLAERKRRKEMKDLFDELRDQLPADRGMKATIDFVNQLKQSHQDMAREIDM # LRHELDAVRQNAGLPPFTGPPPPHLIYAQGPIPAPYPLPPGVLPHPPPISHPTAQQQHPQHPLSRPASSQNMLPLGEQNPPPPQNGDLPRPEVHPTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g541 ### # start gene g542 4 AUGUSTUS gene 2099529 2101631 0.2 - . g542 4 AUGUSTUS transcript 2099529 2101631 0.2 - . g542.t1 4 AUGUSTUS stop_codon 2099529 2099531 . - 0 transcript_id "g542.t1"; gene_id "g542"; 4 AUGUSTUS CDS 2099529 2101451 0.58 - 0 transcript_id "g542.t1"; gene_id "g542"; 4 AUGUSTUS CDS 2101548 2101631 0.22 - 0 transcript_id "g542.t1"; gene_id "g542"; 4 AUGUSTUS start_codon 2101629 2101631 . - 0 transcript_id "g542.t1"; gene_id "g542"; # protein sequence = [MADEKRSDNVPKSSTIPSRKSKLVCLMPKTAASITVDLDDSPAGLQELRQESFDSHLNLDYDPPKLTGASHLWLQVIL # TDLFQGESVDIPLISEQITSRPEQMVSASSLETLASNSMRFLTPDIQVVERATGLREDDPIVVDSSPVKLYSQPTRAVPQTLYSIFAPRTRVEPSVTP # VNPAKIPISHLEAPFPDASSQHVRGPQTTYNAPSISFPPRYQDTTASNTSLHVSDVIGIPSLVETKDEHAHKLRLDASTSHTVRAVHLTSIPTEHLQS # HPVIAHLVETATFEPDSFSGDSHRLWTDKWRPSRADHVLGNEEQATFLRQWLCALEVNFITASAPPDVNAFAASRAPGRLGKGKTKSTANEKRGTKRR # VIRAVEKRKRQRIDSDDDDDSWIIYSDNVSETESPPIDNFEDTEECVENASPRLYRQSRRNDSSSTIHYPTHLTFQERLTNTILLSGPNSTGKTAAVY # ACAAELGWEIFEVYPGVGKRSGANLDNLIGEVGKNHLVRKTQLQNENSGTNPKVDGSLKSAFARGKEKNNGKIWIPNDHRERSTSMNGFGFVEELNGT # QHEEHEAAARQSLILLEEVDVLFKEDVNFWGSIISLIKDCKRPVILTCNGTILFCLFIILLNDIRCLSGACGRASFARCAEFSALFHKCCYFVLTGIV # LR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g542 ### # start gene g543 4 AUGUSTUS gene 2101889 2102551 0.45 + . g543 4 AUGUSTUS transcript 2101889 2102551 0.45 + . g543.t1 4 AUGUSTUS start_codon 2101889 2101891 . + 0 transcript_id "g543.t1"; gene_id "g543"; 4 AUGUSTUS CDS 2101889 2102551 0.45 + 0 transcript_id "g543.t1"; gene_id "g543"; 4 AUGUSTUS stop_codon 2102549 2102551 . + 0 transcript_id "g543.t1"; gene_id "g543"; # protein sequence = [MRMNKIIIDLNGDHIDILEGTPTALEFARIVQISRPVLIKSHLKTHSPSLETDMAICPRIPGIQLQMVERLSDQQDGL # PPNICGCHSQWVRVSTFSSCTNPTNTRKRRADAITLGPNGKLYFAEPAVEKMTMKSLLDNLSDDKASDGDGAVCARLPLRTFPAHSTRQAAEKYYLQS # QNGNVYSSRFFNGQDDSSEFETLRQDIPSDVKWCTEALGWSNLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g543 ### # start gene g544 4 AUGUSTUS gene 2106041 2107946 0.86 - . g544 4 AUGUSTUS transcript 2106041 2107946 0.86 - . g544.t1 4 AUGUSTUS stop_codon 2106041 2106043 . - 0 transcript_id "g544.t1"; gene_id "g544"; 4 AUGUSTUS CDS 2106041 2106746 0.92 - 1 transcript_id "g544.t1"; gene_id "g544"; 4 AUGUSTUS CDS 2106808 2107946 0.86 - 0 transcript_id "g544.t1"; gene_id "g544"; 4 AUGUSTUS start_codon 2107944 2107946 . - 0 transcript_id "g544.t1"; gene_id "g544"; # protein sequence = [MPHAESNVVSLSPTPSPPGSPSIPHFITREPPSPTQPFHVPSVPSSAAAKISSGGKLSIPSFGSLQIHLHSRSHSPVY # GDDDDDLLSSGQVSPIGYGSGYGLGFESGTDDPRTPRGWPADYLNNRLVRLGSSFPNVPSKRGSEASAQTQSSTSSKFQDMSPKKEQDIAYRSLGKGH # PTQRTWAGNRVPHASRVSSWSDPISARDVMQGIGDRTRQSSEIDEGLESEDRLSKDEELERGKTIFVDYNQRHRRSSTVRPTQNAFTNEAGTWTNEGA # SDIMAYSHHIRSQSITGRRSVRLRDSGSRNEGKTYHLEDDTAEEGATTRKMLGIVPRRRRSFHSLSIYRHDFSPIDVEMTDEDVKQRIPIKVLPIDRM # RIDVDLCGLVSCLAIMFSPISPRLLQILTSRLSDTNARMRSYYEAHLPDIVELETHTKAIAEVDLENANVMKISQATKTLWYEAEQFRVPDLWHIASP # PRQKVLVMRQKLFGTGGRRFPQGVHGAHGRFNRVQKTLDGRERLVDSEGKTESEVEEERKIDEDGVFISPPKEDVEDVVEHPSIKPMWLLRFFTSWVN # WRPSASVATQRIENPSSPASPTVTQEMTGEVSTPSQPIRLEKAVSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g544 ### # start gene g545 4 AUGUSTUS gene 2108059 2110464 0.39 - . g545 4 AUGUSTUS transcript 2108059 2110464 0.39 - . g545.t1 4 AUGUSTUS stop_codon 2108059 2108061 . - 0 transcript_id "g545.t1"; gene_id "g545"; 4 AUGUSTUS CDS 2108059 2109897 0.93 - 0 transcript_id "g545.t1"; gene_id "g545"; 4 AUGUSTUS CDS 2109976 2110464 0.42 - 0 transcript_id "g545.t1"; gene_id "g545"; 4 AUGUSTUS start_codon 2110462 2110464 . - 0 transcript_id "g545.t1"; gene_id "g545"; # protein sequence = [MYGTLPVTSLAQFRSDFTIVQIPDGNLESAKPQLYTNINLLRMGCSGRSGLTLEEPSDTTKDRFISTYFLPYNHLLGA # GKAPSLFNDTVLELVKLVQVSLHIFGYYETSSFDGLLCDSTVEGLQRWVKEIGELVEGLDSMERIADPSTVASLLSLVLAVRNRLIIPKDPFLHPGLF # IRALATYVTNSNANSHYFHSTIPPQIVSLASSKGSNASYSPRQSISQSSGGSPPIPTSAIPAFLKDQFVNLGHGSSFSDEATHSSYGRSIPSATTNHS # HASSPLNSAVPSTQLASAPNTSRLPGATFNIDTKGGMSTPTLALTLPSPKTGFHSSAISLANSASNELHIVDQAGGLTPAFSAADSPSTNKLHADGVF # LSRSLIEFVFNAYDAKLLKSSPEVRRAVRKEQKANRYRKKDSVSYAREDDGTGKDGLSSIAGLPSVASHSHLLSGSSLPLASGFKTGLASGLTGTLAS # TLTGGSMNSGAASVLMPMSDLEEFIEVILGEISYRRNREEKREKRERKERIKIRIKEEKEEQKERERERERDKKGADNLSSSSSSDGLVDFSRAAKKV # KAKVKGRSVDKGDERDSEEAKDVVKEHKRRKDKDNVGGVGGLVLGLWTGRVNLVIKLREKTEERERERERSIQFSDARQVAERDGVLSDGVTSWQNNP # KNTSKDFHNRPSLWSDGDADTHAYSYDDRKRISLPARDGTSPTFARRSSVSGTGSRGSYGSVQNVLTPEKSDGRSTEEEGPGLLGSETLGALWAKSGS # KVKDKLESWAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g545 ### # start gene g546 4 AUGUSTUS gene 2112267 2113037 0.47 + . g546 4 AUGUSTUS transcript 2112267 2113037 0.47 + . g546.t1 4 AUGUSTUS start_codon 2112267 2112269 . + 0 transcript_id "g546.t1"; gene_id "g546"; 4 AUGUSTUS CDS 2112267 2113037 0.47 + 0 transcript_id "g546.t1"; gene_id "g546"; 4 AUGUSTUS stop_codon 2113035 2113037 . + 0 transcript_id "g546.t1"; gene_id "g546"; # protein sequence = [MSSSASSSSASSSNLNASDQIEYGTMLEIRSVQMLPDGRSMVETWGVWRFRILERGLMDGYVNARIERIDDIPDEEEN # EESESPVAPVEVHRPSTLQRLTSRLSSVTSTADSPSSSQFLASGSTYSGIASTSSLSESSSESSSVVFPPPPPPLPLSTRLLIEHCTSFLSQLHTSTT # PWVVQRLSYTHGPPPPSDPSDPAFDAGTFSFYVGMVLPIDDWEKAKLLPVRSVRMRLKMCVWWIEGLRQHWWFERGCIVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g546 ### # start gene g547 4 AUGUSTUS gene 2116287 2116880 0.84 - . g547 4 AUGUSTUS transcript 2116287 2116880 0.84 - . g547.t1 4 AUGUSTUS stop_codon 2116287 2116289 . - 0 transcript_id "g547.t1"; gene_id "g547"; 4 AUGUSTUS CDS 2116287 2116880 0.84 - 0 transcript_id "g547.t1"; gene_id "g547"; 4 AUGUSTUS start_codon 2116878 2116880 . - 0 transcript_id "g547.t1"; gene_id "g547"; # protein sequence = [MDHAEFLKRGTSYLKNPNDDPELSKSIDDFKSVLSYVAGDYEDGSAFDNLNQHLEEIESHYQSKECNRIFYLALPPSV # FIPVAKNLKEHCYVTKGGINRIIVEKPFGKDTESARELLGSLKKYWTEDETFRIDHYLGKEMVKNLLVLRFANVAMNAAWDKNSISNVQITFKEPFGT # EGRGGYFDEFGIIRDILQNRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g547 ### # start gene g548 4 AUGUSTUS gene 2131226 2132481 0.35 + . g548 4 AUGUSTUS transcript 2131226 2132481 0.35 + . g548.t1 4 AUGUSTUS start_codon 2131226 2131228 . + 0 transcript_id "g548.t1"; gene_id "g548"; 4 AUGUSTUS CDS 2131226 2131407 0.46 + 0 transcript_id "g548.t1"; gene_id "g548"; 4 AUGUSTUS CDS 2131461 2131497 0.89 + 1 transcript_id "g548.t1"; gene_id "g548"; 4 AUGUSTUS CDS 2131801 2132481 0.86 + 0 transcript_id "g548.t1"; gene_id "g548"; 4 AUGUSTUS stop_codon 2132479 2132481 . + 0 transcript_id "g548.t1"; gene_id "g548"; # protein sequence = [MYGGAPPQTMAPSPEANHAAGAFGRMTLSNDQTLEKLAANVRAATTTSASDRAKQIFVQAWLTANYAPYPDGNPSINA # ARQAQDQSETSHRSEERSDEDEDDADSEGLPSAGVSKRNSLTLSGEAKQPVFSQDSSDKTPTAATLLSQAQSAHRPPGSFPPQAPIRRHPQADSSLTV # SQSSPSSSVPYLASSQPVSVRQFPHFPSIEEAVGSNSTSQHSIAAREVWGWFQDHLDLLLENVRLFRFDQFEINLRTFWSSLGGNHREIVHAPAIAGL # MAKADAIVYDVCRRKALAPGIICSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g548 ### # start gene g549 4 AUGUSTUS gene 2133395 2133736 0.45 + . g549 4 AUGUSTUS transcript 2133395 2133736 0.45 + . g549.t1 4 AUGUSTUS start_codon 2133395 2133397 . + 0 transcript_id "g549.t1"; gene_id "g549"; 4 AUGUSTUS CDS 2133395 2133736 0.45 + 0 transcript_id "g549.t1"; gene_id "g549"; 4 AUGUSTUS stop_codon 2133734 2133736 . + 0 transcript_id "g549.t1"; gene_id "g549"; # protein sequence = [MDVRPQHLMANTPTTSSMLAALQNDPFPAGSLDPSASSFNSDAYGSLSYMDTSSSQDNPIPNVQSDLSFPDFSNSGNA # FDVPSAFSQDMGLAASVTPGSEPDHTSDSEGVKSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g549 ### # start gene g550 4 AUGUSTUS gene 2135159 2136664 0.53 + . g550 4 AUGUSTUS transcript 2135159 2136664 0.53 + . g550.t1 4 AUGUSTUS start_codon 2135159 2135161 . + 0 transcript_id "g550.t1"; gene_id "g550"; 4 AUGUSTUS CDS 2135159 2136664 0.53 + 0 transcript_id "g550.t1"; gene_id "g550"; 4 AUGUSTUS stop_codon 2136662 2136664 . + 0 transcript_id "g550.t1"; gene_id "g550"; # protein sequence = [MRHRKASLDLPDLAAMYDTVQTRSSPWSIPVKAQERKETIYVQPKVHIENNLGRRVQDQPQTPIPSVESFPRTVSFHP # AAPPPSRTTTSETLVIRSSLPMALDFDAIPEAVEPSISLVDRKINWHGKAASVFVVHMADNVSVRTMMDQLSVSPCLLFRILISFVCYTSSPTSFSTS # VAFPPGTHHIRFLVDDQWRVTDDLPKAVDDAGNLANYIHVDPPHDPNNPQPTRITPPRSPLGTHVIVTSLPPLEGNLANLGRLSLGRSFWSSSTENSD # HDHDSGSADERAALSRYMPRWTTDIPLELLQAAKEEEVYLEYASKTPSRRPGESQVQQGFVPLPNIPPAPGLPRYLEKLILNQGFTHTVGHDRRHKDK # RSSRENIERLNEDLIHRSGVILPLPVTTASGTDIATGVSVRAPELAGTERMLPVMEAIEGGELDPTSPHAAAALATLATISDDSSVLPVPSHVVLHHV # CTSTIKEGVLAVASTVRYRKKYLTTVFYKPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g550 ### # start gene g551 4 AUGUSTUS gene 2140102 2141871 0.34 - . g551 4 AUGUSTUS transcript 2140102 2141871 0.34 - . g551.t1 4 AUGUSTUS stop_codon 2140102 2140104 . - 0 transcript_id "g551.t1"; gene_id "g551"; 4 AUGUSTUS CDS 2140102 2141214 0.43 - 0 transcript_id "g551.t1"; gene_id "g551"; 4 AUGUSTUS CDS 2141593 2141871 0.41 - 0 transcript_id "g551.t1"; gene_id "g551"; 4 AUGUSTUS start_codon 2141869 2141871 . - 0 transcript_id "g551.t1"; gene_id "g551"; # protein sequence = [MAPASKSKPANGSTAKGKASTPTTNGTTTPVSVASEKKDTSEVPSVSGGKPDKKAYDVEQERLKGEIDALQVKLVCIF # HHSVAFPVAHVPDAIVDSGTLKLADEKRALAEISSCKRSRRTLDAFQSDQESIDADRAAVAELRKQLDDPDFKAVSERYDKAKQELDELKKEEDVLYA # NRSKLFEERDSIQAQLNTLYNEKRESLQNFREANDRYYTKLNEDRARRAERLRAQRAAEELQTKQEVAQQLREEAEVPAYQAQIEDCQTLIDSLSGKT # SGDVTLKSAPLVKKQELVGVSKLEIRKVEDVPEGVVVRKKKGEDDDSYFVGGKGKGKGKKTGSKANGSTENPSHLNIPLSTLSALLNFSIPPPTSSAD # IPRVVENLKTKKEWFEANQARQTAANIAKAEAEIQRLTGSSKDIQSPETADVTPPNGEGEIPDDPAPTPGVSGLSSLAVPDDEVNETEAAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g551 ### # start gene g552 4 AUGUSTUS gene 2142916 2143671 0.82 + . g552 4 AUGUSTUS transcript 2142916 2143671 0.82 + . g552.t1 4 AUGUSTUS start_codon 2142916 2142918 . + 0 transcript_id "g552.t1"; gene_id "g552"; 4 AUGUSTUS CDS 2142916 2143671 0.82 + 0 transcript_id "g552.t1"; gene_id "g552"; 4 AUGUSTUS stop_codon 2143669 2143671 . + 0 transcript_id "g552.t1"; gene_id "g552"; # protein sequence = [MSSVSMTDVAPPPPTRPRRPTRSAPPPPELPDVDIPRASSPEIQPEQQSSKPQPSNEILTPLRAHYLKKSLIQLEFER # EIDDITTSAPNNVSTFSYLGPPFNPPPKEAPPIDLPFLRFMFRQFVLTFPFMASAPSNFYSEKLQPFLGALFSRNLTATSVFDDNHEGDSSTTSMNAV # ARLERNFSLFFGAATKVIEPEEVVRLNQSDLDHLEALAKKREARNLKHRDIFEVNIVSVRTVIDKGRVRSRAHEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g552 ### # start gene g553 4 AUGUSTUS gene 2144822 2146640 0.27 + . g553 4 AUGUSTUS transcript 2144822 2146640 0.27 + . g553.t1 4 AUGUSTUS start_codon 2144822 2144824 . + 0 transcript_id "g553.t1"; gene_id "g553"; 4 AUGUSTUS CDS 2144822 2144979 0.95 + 0 transcript_id "g553.t1"; gene_id "g553"; 4 AUGUSTUS CDS 2145056 2145290 0.93 + 1 transcript_id "g553.t1"; gene_id "g553"; 4 AUGUSTUS CDS 2145534 2146640 0.28 + 0 transcript_id "g553.t1"; gene_id "g553"; 4 AUGUSTUS stop_codon 2146638 2146640 . + 0 transcript_id "g553.t1"; gene_id "g553"; # protein sequence = [MFTGSLFEEVKELEDEIQAVKTKVDDPVMCEKIKNFVNAPKEIQDALKADAGNIVLRSGEEPVLSRAQLHRVAKASQA # HAIYLKHRETLADSDDDDGPQDDDSWLYEDLKVLGQLYSRLKDREQLIDLVFESFTVTQEDPNRTVQSFVDLIQRHEQSFYSFVHKVHSKGEGLFDSL # MRWIELFLTFMREGLGPPISLEFLLPHMGLERTEILAEVDKVALYHYKLKLLYENKVRRRFGRTQAQGDADAEDQVTKALVDGVVGEISFGDLVQGAA # DDMAAEDAEEDSEDEDEDESSTEYETDSESGSDVSEASNEPPPPPPPKAVDLRRSRTAATQTPPPPRPMNARSGSRPPDIRRSRQEPSPLKSSRSMTS # MDYQRQRGHAPPVPPLPRNAHLVALSKPLPPSPAPSSERFGSPSRASVESKPHPEKTKKSRPKGKQIIKPPELTRIPTLLPIFREMVSPAYLHVGLTH # YSLKLGSQIRPLLRPRQRTHTSNTPTPNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g553 ### # start gene g554 4 AUGUSTUS gene 2156906 2157136 0.75 + . g554 4 AUGUSTUS transcript 2156906 2157136 0.75 + . g554.t1 4 AUGUSTUS start_codon 2156906 2156908 . + 0 transcript_id "g554.t1"; gene_id "g554"; 4 AUGUSTUS CDS 2156906 2157136 0.75 + 0 transcript_id "g554.t1"; gene_id "g554"; 4 AUGUSTUS stop_codon 2157134 2157136 . + 0 transcript_id "g554.t1"; gene_id "g554"; # protein sequence = [MDGSKRRLLIDALEALRKERKHRDADEEKLWRNLAKRVCAFGPLGGERGNEGDEGTGDSESKVDMGYSIRHFEDLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g554 ### # start gene g555 4 AUGUSTUS gene 2160422 2160997 1 - . g555 4 AUGUSTUS transcript 2160422 2160997 1 - . g555.t1 4 AUGUSTUS stop_codon 2160422 2160424 . - 0 transcript_id "g555.t1"; gene_id "g555"; 4 AUGUSTUS CDS 2160422 2160997 1 - 0 transcript_id "g555.t1"; gene_id "g555"; 4 AUGUSTUS start_codon 2160995 2160997 . - 0 transcript_id "g555.t1"; gene_id "g555"; # protein sequence = [MSFGSDSGSFLEYALSLPDPVGPDPETSDSSDRSSPSDHNSEQESVQSSTNSDPDQSSYDSEFPGPFDYDYLHESSDF # DLDHPGPYDLHYLHSYPSSSASDSVESFHLFASDNSEAPELRPGDDRSGHPHLGPDGRLVDSERERRRVLGLCFYCGGEHMKVNCLKLQARTGQNYDA # DNSESDVPGSDDGSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g555 ### # start gene g556 4 AUGUSTUS gene 2161976 2162910 0.53 - . g556 4 AUGUSTUS transcript 2161976 2162910 0.53 - . g556.t1 4 AUGUSTUS stop_codon 2161976 2161978 . - 0 transcript_id "g556.t1"; gene_id "g556"; 4 AUGUSTUS CDS 2161976 2162759 0.86 - 1 transcript_id "g556.t1"; gene_id "g556"; 4 AUGUSTUS CDS 2162870 2162910 0.53 - 0 transcript_id "g556.t1"; gene_id "g556"; 4 AUGUSTUS start_codon 2162908 2162910 . - 0 transcript_id "g556.t1"; gene_id "g556"; # protein sequence = [MFEQLGTRLRCLLSAKKDKEKKQRTSSKRKDDESSKGYSTGSGPGGYKSTSGYSKGGSPGPTTSNGSGSSNRPSPTSA # MTPRPPSRVDEDYDEGVADALTGLAAYRPPPAEGSSESHSYAPSISSGSRHSDSRPSVSHRDSISSNRSHMSPPPQPMKRALSPVPDDSNDDKRSRID # SVKRRASSPSNGRRTPVPSTRPSPIPFRTQPTSHSPDSVKHEAYPPSLPLPAVLLPHPRPIGAGAGVGITQPSSSASIALPPIATLVPHLKCTVSWCW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g556 ### # start gene g557 4 AUGUSTUS gene 2172085 2175648 0.99 - . g557 4 AUGUSTUS transcript 2172085 2175648 0.99 - . g557.t1 4 AUGUSTUS stop_codon 2172085 2172087 . - 0 transcript_id "g557.t1"; gene_id "g557"; 4 AUGUSTUS CDS 2172085 2175648 0.99 - 0 transcript_id "g557.t1"; gene_id "g557"; 4 AUGUSTUS start_codon 2175646 2175648 . - 0 transcript_id "g557.t1"; gene_id "g557"; # protein sequence = [MVNIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAVNTVDAKVAV # PLPELSPSVSPTILETPPGDSPRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLVTGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVHDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g557 ### # start gene g558 4 AUGUSTUS gene 2175981 2177636 0.99 - . g558 4 AUGUSTUS transcript 2175981 2177636 0.99 - . g558.t1 4 AUGUSTUS stop_codon 2175981 2175983 . - 0 transcript_id "g558.t1"; gene_id "g558"; 4 AUGUSTUS CDS 2175981 2177636 0.99 - 0 transcript_id "g558.t1"; gene_id "g558"; 4 AUGUSTUS start_codon 2177634 2177636 . - 0 transcript_id "g558.t1"; gene_id "g558"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDELDDDSGGLPRGEPG # DPSGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKV # NYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGKAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGL # AERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQN # SSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g558 ### # start gene g559 4 AUGUSTUS gene 2183857 2184210 0.94 - . g559 4 AUGUSTUS transcript 2183857 2184210 0.94 - . g559.t1 4 AUGUSTUS stop_codon 2183857 2183859 . - 0 transcript_id "g559.t1"; gene_id "g559"; 4 AUGUSTUS CDS 2183857 2184210 0.94 - 0 transcript_id "g559.t1"; gene_id "g559"; 4 AUGUSTUS start_codon 2184208 2184210 . - 0 transcript_id "g559.t1"; gene_id "g559"; # protein sequence = [MDTDYDAERGVVWAFVELPGVHRENLKVILANDPIIGQRGIQIWGFTLPPDSQFAGVSSNYGDSMAPMTDPSMSLAFG # YGTPPNLTLHERKYGEFFRFLPVPTMTKVGSSFSLPMIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g559 ### # start gene g560 4 AUGUSTUS gene 2192663 2194057 0.82 + . g560 4 AUGUSTUS transcript 2192663 2194057 0.82 + . g560.t1 4 AUGUSTUS start_codon 2192663 2192665 . + 0 transcript_id "g560.t1"; gene_id "g560"; 4 AUGUSTUS CDS 2192663 2192834 0.84 + 0 transcript_id "g560.t1"; gene_id "g560"; 4 AUGUSTUS CDS 2193195 2194057 0.97 + 2 transcript_id "g560.t1"; gene_id "g560"; 4 AUGUSTUS stop_codon 2194055 2194057 . + 0 transcript_id "g560.t1"; gene_id "g560"; # protein sequence = [MQSDDRAGATDSLASIVRKRKRSVEHEDLSQNVVVTLAGFEEQLVEPRDANCRAGPTPAGRNRESDQLSSPLQTRPAE # LPLQDLALLTPVSVSSSWRSPEDVARPLPITISLPLGTLPAVSSPQDVVTHTPTELSSPQYVAHTPPSSPPTSLPPPPPPSESSSTTVNHSVPSYSQP # RNALLELDYVSDDEDMEQIAPKLLTIRAPEHEVHMQSTQLQSDRVRHESGSIDTSAPLHNILSTMVPSPDLLHPVGYPSTALGKRKAEDSSIGEPTGL # SGSSDNVQQMNGESGVLKSKSRVGTGAKQARMELPSKLLIRMTKLIPNHLSQPLEEKCCENISLKAALPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g560 ### # start gene g561 4 AUGUSTUS gene 2194588 2195876 0.78 + . g561 4 AUGUSTUS transcript 2194588 2195876 0.78 + . g561.t1 4 AUGUSTUS start_codon 2194588 2194590 . + 0 transcript_id "g561.t1"; gene_id "g561"; 4 AUGUSTUS CDS 2194588 2195124 0.78 + 0 transcript_id "g561.t1"; gene_id "g561"; 4 AUGUSTUS CDS 2195244 2195876 0.99 + 0 transcript_id "g561.t1"; gene_id "g561"; 4 AUGUSTUS stop_codon 2195874 2195876 . + 0 transcript_id "g561.t1"; gene_id "g561"; # protein sequence = [MPASLNHQKVDIGADVINVDMRSIRPAATRRVPPRVGVEEVTDEEFNRTSTACGPSIDTLRAPSHTPTHNVPRPPSQS # GDNTKSSAPHPAESPTKHQKVVEVVDASVGAASRKTQSIPLHVNLEKNHPQESNCRSSATLPQPANARNRLPPQTYVEVDDDDEAVSSLTEPDNETQP # PLNLKFSDVQQSHFRKLLEAPVPDLSTILHHLYHYLATIHNLDPTGIILQDRPAINEQSESKESKPKRWSKTKHRSTTQVSMAESLRLEVKALMEPTF # VEDRIISVPSYVIEDWKHSRHPGPTVDDFLLQLEGKGKWTPWNKAAADVFAVHFVSLDGHKHYSKATIQKAFRAHLSNLKEKFQKQGSGSNPEEEDQA # RLERRMARRNRVIRNSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g561 ### # start gene g562 4 AUGUSTUS gene 2196654 2197226 0.49 - . g562 4 AUGUSTUS transcript 2196654 2197226 0.49 - . g562.t1 4 AUGUSTUS stop_codon 2196654 2196656 . - 0 transcript_id "g562.t1"; gene_id "g562"; 4 AUGUSTUS CDS 2196654 2197226 0.49 - 0 transcript_id "g562.t1"; gene_id "g562"; 4 AUGUSTUS start_codon 2197224 2197226 . - 0 transcript_id "g562.t1"; gene_id "g562"; # protein sequence = [MYLCLCLGLNSVPRFKTLDLSDLQNVVPRWQNKEVAGQIPDDICRQVLHEIYTISFKAELLLADQYLYELQSEGFDGD # GKGYDELDASSREDRKIKVMSFMPGFTTGVIGFGSGDQGERQRSIYALYKLMCSWTRVPSPASDTHNYLVKLEPKKYPSRSILDHAERLVAYHYIISF # ADFFKRAPVLPHVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g562 ### # start gene g563 4 AUGUSTUS gene 2199146 2201305 0.16 + . g563 4 AUGUSTUS transcript 2199146 2201305 0.16 + . g563.t1 4 AUGUSTUS start_codon 2199146 2199148 . + 0 transcript_id "g563.t1"; gene_id "g563"; 4 AUGUSTUS CDS 2199146 2199531 0.28 + 0 transcript_id "g563.t1"; gene_id "g563"; 4 AUGUSTUS CDS 2200135 2201305 0.39 + 1 transcript_id "g563.t1"; gene_id "g563"; 4 AUGUSTUS stop_codon 2201303 2201305 . + 0 transcript_id "g563.t1"; gene_id "g563"; # protein sequence = [MRRMVANCAPSPDFFPPTPASAAVPMTTTIDSLSDRLSAISIPTAFASPETAIPLPPTESRSAEREFVDPDSQLLVVE # QIRSQLSQIQNRWEPTDIQFNVEFTGTFRELSTSSVNSLLSQSSVNSPLRGEKPIEKSPKSKSRKKEHPVPNRTYSYQSLNHWIGWMYNRKELGQYLD # RPYEKPNNPDRTVSDLWDSDFLGEFVGPDGKNLFVSPGDTNESRLLFNLNADGFNPFGNRTAGKKVTVWGIYMVCINLPPALRYKPENVFLVGVVPGP # KEPTFDQISFILTPLLDDLEVLWETGIFLNRTRGHPLGRSIRAALIALVCDLPAARLLAGFSHFSGNLPCSMCKESDLNNLDESSFILRTMEEHRKLA # AEWLAAQSQEERDALYKTNGVRWSPLLRLVYWDPIQNTVIDPMHGFYLRILQRHCRDIWGMNVKFQDNDGLWDIEEPSPDEKIRAQQVFRHGTQSALN # KLLTCSIRYLALREELDYRRNKKALVRRLLELVSPVQKKTLCLTSLYM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g563 ### # start gene g564 4 AUGUSTUS gene 2201732 2203825 0.25 + . g564 4 AUGUSTUS transcript 2201732 2203825 0.25 + . g564.t1 4 AUGUSTUS start_codon 2201732 2201734 . + 0 transcript_id "g564.t1"; gene_id "g564"; 4 AUGUSTUS CDS 2201732 2202303 0.26 + 0 transcript_id "g564.t1"; gene_id "g564"; 4 AUGUSTUS CDS 2202952 2203825 0.77 + 1 transcript_id "g564.t1"; gene_id "g564"; 4 AUGUSTUS stop_codon 2203823 2203825 . + 0 transcript_id "g564.t1"; gene_id "g564"; # protein sequence = [MERESSVQPVSALYSTSVQLVAAPPPKQLSSKNTAVDFSTEQKDEVQTIYESAPKHQINKLTLPHLYQLSLFIAKLKL # ASSARSKLNSVDPLPDLYADEGWVAPPEEGHPQIGDEECYYDEESAESDDDEEEDNCEEEQSEVDPVETVLPIPNPSRKPLSKEETVQATNTLQDFVH # IHVSPPLATFKQPPXSYGTNYVHTILPKSETALLKGVNVQHFLPIATLYTDCFENVDNRGTRVADLFDDEIPSEPAVLDWASTSLPLLEKSSYALLQE # WINQSDTPGTAFIRAKIVWQAKFRDMNFATQDSGAPNSQVVFNMSGRPWSAGSIQCIFVAGWENEKVQHTKTFVEIYPYCALSNVDAQADNYRQFSFA # GRLFYNRLDRTQALVLPLDAIAGHFGHSPQFHSGMQEKTIHVLPLNRVCLGKYGICTLTKSKLSRNSCLTPTKWLRGVLMSLRRIFLSRLILSLLNIQ # VFQIMMFTMSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g564 ### # start gene g565 4 AUGUSTUS gene 2211711 2212316 0.99 - . g565 4 AUGUSTUS transcript 2211711 2212316 0.99 - . g565.t1 4 AUGUSTUS stop_codon 2211711 2211713 . - 0 transcript_id "g565.t1"; gene_id "g565"; 4 AUGUSTUS CDS 2211711 2212316 0.99 - 0 transcript_id "g565.t1"; gene_id "g565"; 4 AUGUSTUS start_codon 2212314 2212316 . - 0 transcript_id "g565.t1"; gene_id "g565"; # protein sequence = [MSLKWVKENIELGYADVYTADGSSSDPVFSLVQIDTDKMARIGFDFNLNVADFHESETITIRAAPELYLPDPARFTEN # RALSSGASLLEASELAEAWRDATAKLEASSGLGEHWMPILETLEDLDSGGYRVQFVNLEDLSETHWISTDDPEIKDFKAYLDERLKALDHAYEFEGGT # FVQKEDVTSAKAIDGLNAMFVVKTH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g565 ### # start gene g566 4 AUGUSTUS gene 2213027 2213242 0.58 - . g566 4 AUGUSTUS transcript 2213027 2213242 0.58 - . g566.t1 4 AUGUSTUS stop_codon 2213027 2213029 . - 0 transcript_id "g566.t1"; gene_id "g566"; 4 AUGUSTUS CDS 2213027 2213242 0.58 - 0 transcript_id "g566.t1"; gene_id "g566"; 4 AUGUSTUS start_codon 2213240 2213242 . - 0 transcript_id "g566.t1"; gene_id "g566"; # protein sequence = [MDVDNNASSKFRRRHISFDLEPLKPIMTSSARLRGMTAPNADEDPWARSLNHGVEPLPSILLQLYLIPEFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g566 ### # start gene g567 4 AUGUSTUS gene 2215430 2216167 0.56 - . g567 4 AUGUSTUS transcript 2215430 2216167 0.56 - . g567.t1 4 AUGUSTUS stop_codon 2215430 2215432 . - 0 transcript_id "g567.t1"; gene_id "g567"; 4 AUGUSTUS CDS 2215430 2216167 0.56 - 0 transcript_id "g567.t1"; gene_id "g567"; 4 AUGUSTUS start_codon 2216165 2216167 . - 0 transcript_id "g567.t1"; gene_id "g567"; # protein sequence = [MGTLPQFQTTQDEMVDVTFVSVSTDDRKGSAVSRVSSQEDALDHSDNDLRVFPQATSSDTMTARANLGLSHDSSSEAA # EKASPLLLPKLTVVSTYSQNAHYLVNARNIEPRRHGIYALSLLLFFTAFCSAYTWTNLSVADFEGAKDEATQFSRNEEPFLEPGLLTSHTFSDYRYRQ # WQSDIRMLQDITVGEILIGKSQFENEDLQSVAMYSYNGLLSSRTLDEYRCWQQRSLFVPESFEEKSSTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g567 ### # start gene g568 4 AUGUSTUS gene 2222275 2222910 0.91 - . g568 4 AUGUSTUS transcript 2222275 2222910 0.91 - . g568.t1 4 AUGUSTUS stop_codon 2222275 2222277 . - 0 transcript_id "g568.t1"; gene_id "g568"; 4 AUGUSTUS CDS 2222275 2222910 0.91 - 0 transcript_id "g568.t1"; gene_id "g568"; 4 AUGUSTUS start_codon 2222908 2222910 . - 0 transcript_id "g568.t1"; gene_id "g568"; # protein sequence = [MATISKAQASFPSFGSEVVAYVFPQSTVEKVVLRTFAEAMQTLSTVVERLILLAEVELANLERLEEHLSVLYDIVIRE # NFTISSTKAELLGDIWTWLGGNRSILKGYDEHLTLLSGVADYRKQALIQVISSLQALRALSNDMEGLREQMSKPTLSGQTIPVEIHTKSIELGVRRLK # SSRVLAKEKGDAARQSFLEDETTKKIFASLDGYKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g568 ### # start gene g569 4 AUGUSTUS gene 2229663 2230738 0.1 - . g569 4 AUGUSTUS transcript 2229663 2230738 0.1 - . g569.t1 4 AUGUSTUS stop_codon 2229663 2229665 . - 0 transcript_id "g569.t1"; gene_id "g569"; 4 AUGUSTUS CDS 2229663 2229772 0.58 - 2 transcript_id "g569.t1"; gene_id "g569"; 4 AUGUSTUS CDS 2229893 2230138 0.4 - 2 transcript_id "g569.t1"; gene_id "g569"; 4 AUGUSTUS CDS 2230186 2230653 0.4 - 2 transcript_id "g569.t1"; gene_id "g569"; 4 AUGUSTUS CDS 2230735 2230738 0.28 - 0 transcript_id "g569.t1"; gene_id "g569"; 4 AUGUSTUS start_codon 2230736 2230738 . - 0 transcript_id "g569.t1"; gene_id "g569"; # protein sequence = [MLLLITRYRFDVAAWVKANLAGGDDKNSDSPGAGLKIAGSDPNRPEDEGVGVVIASDKDEATRKMERDAQAELKRQQN # ALPSWHLKSTISGDLTALGIKESARAEAAVANGVGSTSNDEVLRGLGVVGMKPSQSTTALVVETKRESKPVTNPDADCDYYEQYYASLAASAVASVQV # TPSGSVPGSLDLDDFGEDEEDRKPSLEYLNSLNDYRKRSRSQENEGFSGRNKIAKTESNKWRTLNGNPVAFSKVTEEDHELMTPEEYTAYFEVMQSLE # E] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g569 ### # start gene g570 4 AUGUSTUS gene 2231930 2233758 0.18 + . g570 4 AUGUSTUS transcript 2231930 2233758 0.18 + . g570.t1 4 AUGUSTUS start_codon 2231930 2231932 . + 0 transcript_id "g570.t1"; gene_id "g570"; 4 AUGUSTUS CDS 2231930 2233226 0.18 + 0 transcript_id "g570.t1"; gene_id "g570"; 4 AUGUSTUS CDS 2233310 2233758 0.47 + 2 transcript_id "g570.t1"; gene_id "g570"; 4 AUGUSTUS stop_codon 2233756 2233758 . + 0 transcript_id "g570.t1"; gene_id "g570"; # protein sequence = [MTEIELLWFDWGPSWANTSSRSLWGFPVHCACWDIMVAVRPGQPPNVQHLFDLCRSFPVQGAINFGHNYGGAVPYEAR # TILSLGEEPWLNPTPTIRSEPQYKCNPFYDPELTRLFQQDSAVSPEGSYLPTVDPAVTFSGHKVNFTRGESDHFNKLPNEILLSLLYYLPSPSVASLK # LASRVYAAIVLPDRFWFSRFWPDQEFEHVFEAIQHAALWGGRWKLLFDSVKDLHHRLITRNAMSNRKRVWELAKSLQALLDEGGEGPCAGDPVCSFFE # PNAPLDDCICWATASRNLKSPIEIFGSGSRSLFERLLVLPSEIIAIFISTIEVSGHCYISGLRLELDDGETSVLGYIYPRNETLVTWDATTTTRVSIA # GFHVAQSNQGVSALAILSTEGYLSNWVGEIQGIPKRRLTIDLIEDGCSDPARFLKGGFDVKPSSILLDPAASLRNTAAWLPDIPDPNLFFMGEDYQGD # LPLTIITFDGSNGKNLRDFVISIWSQDGEIYGIKISYDHLLDGPKTLLLGDELLDAPVDEVDRCDISIDYANGEYITGMEIFERNRASMALKVPPSCN # SSRRSILIGNTRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g570 ### # start gene g571 4 AUGUSTUS gene 2239507 2241015 0.94 - . g571 4 AUGUSTUS transcript 2239507 2241015 0.94 - . g571.t1 4 AUGUSTUS stop_codon 2239507 2239509 . - 0 transcript_id "g571.t1"; gene_id "g571"; 4 AUGUSTUS CDS 2239507 2241015 0.94 - 0 transcript_id "g571.t1"; gene_id "g571"; 4 AUGUSTUS start_codon 2241013 2241015 . - 0 transcript_id "g571.t1"; gene_id "g571"; # protein sequence = [MFDPLPPSPPLTESLKTKIGSEFHQPLASQAVADMAQCATCDMTYPALFSIMFSPLPPSPPLTESLETKIGSEFHQPL # ASQAVADMAQCATCAVTYPTLFSIMFSPLPPSPPLTESLETKIGSEFHQPLASQAVADMAQCATCDMTYPALFSIMFSPLPPSPPLTESLETKIGSEF # HQPLASQAVADMAQCATCDMTYPALFSIMFSPLPPSPPLTESLETKIGSEFHQPLASQAVADMAQCATCAVTYPTLFSIMFSPLPPSPPLTESLETKI # GSEFHQPLASQAVADMAQCATCDVTYPALFSIMFSPLPPSPPLTESLETKIGSEFHQPLASQAVADMAQCATCDMAYPALFSIMFSPLPPSPPLTESL # ETKMGSEFHQPLASQAVADMAQCATCAVTYPALFSVMFSPLPSSPPLIESLEPKIGSEFHQPLASQAVADMAQCATCTVTYPTLFSIMFSPLPPSPPL # TESLETKIGSEFSVMFSPLPPSPPLSITRNQD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g571 ### # start gene g572 4 AUGUSTUS gene 2242212 2242694 0.65 - . g572 4 AUGUSTUS transcript 2242212 2242694 0.65 - . g572.t1 4 AUGUSTUS stop_codon 2242212 2242214 . - 0 transcript_id "g572.t1"; gene_id "g572"; 4 AUGUSTUS CDS 2242212 2242694 0.65 - 0 transcript_id "g572.t1"; gene_id "g572"; 4 AUGUSTUS start_codon 2242692 2242694 . - 0 transcript_id "g572.t1"; gene_id "g572"; # protein sequence = [MIGPIPRSTYAPYTVFLEDLFLIVAQWSLYAYADKIQEAKRLAALTAKSTQENQMEQEQRKAQRTQRKKANAPWSTNI # GKQEEREVRKQKKKRKRQWLKTQAASGDTQNNMKRTGEDFEEVEEDDNDEDWSEIAREERMAKKVRKGEISKREFDAEFGDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g572 ### # start gene g573 4 AUGUSTUS gene 2251794 2252519 0.98 - . g573 4 AUGUSTUS transcript 2251794 2252519 0.98 - . g573.t1 4 AUGUSTUS stop_codon 2251794 2251796 . - 0 transcript_id "g573.t1"; gene_id "g573"; 4 AUGUSTUS CDS 2251794 2252519 0.98 - 0 transcript_id "g573.t1"; gene_id "g573"; 4 AUGUSTUS start_codon 2252517 2252519 . - 0 transcript_id "g573.t1"; gene_id "g573"; # protein sequence = [MDFEREDSPPPAYSESDYDKKLSSAIQFLEISEETEEEWNEGRSEGVSSSGAQEPAPPVKSPSSHIPQPASAKISNRG # VRRLPVPPREAVANNDKPTRVHRKSASHSYTLSPAPKSRPKWHGDAEGSSNAKSPARSLRANVPLENRSRSPTAWVPTYSSPHRSGPKNDRAFSQSPP # TSPLTQSFSSQTASHTRAVSVSQLNFDASVAYSQSNFSPFSAGSTRFEPCHHHPPHTFNPNSLYK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g573 ### # start gene g574 4 AUGUSTUS gene 2254871 2255329 0.79 - . g574 4 AUGUSTUS transcript 2254871 2255329 0.79 - . g574.t1 4 AUGUSTUS stop_codon 2254871 2254873 . - 0 transcript_id "g574.t1"; gene_id "g574"; 4 AUGUSTUS CDS 2254871 2255329 0.79 - 0 transcript_id "g574.t1"; gene_id "g574"; 4 AUGUSTUS start_codon 2255327 2255329 . - 0 transcript_id "g574.t1"; gene_id "g574"; # protein sequence = [MFRYGAPYIELSESSSIISKNYVCSIDYKGKGYFSGKTHSFKATLNPAPGLGGTLGSHVIEGTWHTTSKFTSGPKTGM # EFHNVTGPKEEVTAIGGQTSGEMGEFETRELWKLVAKGIREGDFDMASREKSKIEVCSTFCAHMFLYELEFYPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g574 ### # start gene g575 4 AUGUSTUS gene 2257531 2257959 0.49 - . g575 4 AUGUSTUS transcript 2257531 2257959 0.49 - . g575.t1 4 AUGUSTUS stop_codon 2257531 2257533 . - 0 transcript_id "g575.t1"; gene_id "g575"; 4 AUGUSTUS CDS 2257531 2257959 0.49 - 0 transcript_id "g575.t1"; gene_id "g575"; 4 AUGUSTUS start_codon 2257957 2257959 . - 0 transcript_id "g575.t1"; gene_id "g575"; # protein sequence = [MFPALLYNLVVHSFLSAIVIPSLSLGMSLSSPYLAPDDLDSFMRRMLVSRISRRVLAQHHIALSENYAGKKKPWESAE # PNVGIITTGLNVKASIEKCANLLRHQSLEAEDAGGNAEIPAEVVIEGDVDMRFSYIREHLECVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g575 ### # start gene g576 4 AUGUSTUS gene 2258764 2259521 0.32 - . g576 4 AUGUSTUS transcript 2258764 2259521 0.32 - . g576.t1 4 AUGUSTUS stop_codon 2258764 2258766 . - 0 transcript_id "g576.t1"; gene_id "g576"; 4 AUGUSTUS CDS 2258764 2259123 0.98 - 0 transcript_id "g576.t1"; gene_id "g576"; 4 AUGUSTUS CDS 2259231 2259521 0.32 - 0 transcript_id "g576.t1"; gene_id "g576"; 4 AUGUSTUS start_codon 2259519 2259521 . - 0 transcript_id "g576.t1"; gene_id "g576"; # protein sequence = [MNDNVFVLLEDPLAPTRADVVQAIADKTAPPNFHPTHYRTTFLTLNPPGALEQLLAQLKARWVPVRQTSTNNAQRGQA # SGHQLLIEGQVFGIGSDWLAEYLPLPGLNVGPAADGTSELLSNLLTSVLPNVPDAKTVAVTISEAQWEDVLWDREEDEKAQKEVAQAKERESNGENDD # IFVYGLEDIPIKRRGDWTGVDRDRRSAFLIIGALKSEGIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g576 ### # start gene g577 4 AUGUSTUS gene 2262532 2264688 0.5 - . g577 4 AUGUSTUS transcript 2262532 2264688 0.5 - . g577.t1 4 AUGUSTUS stop_codon 2262532 2262534 . - 0 transcript_id "g577.t1"; gene_id "g577"; 4 AUGUSTUS CDS 2262532 2264688 0.5 - 0 transcript_id "g577.t1"; gene_id "g577"; 4 AUGUSTUS start_codon 2264686 2264688 . - 0 transcript_id "g577.t1"; gene_id "g577"; # protein sequence = [MFLENVLLLSLPLIVTAYPINVLNSSGSATTFAVLLAVALSVTVLVLTKFLYMRYRRSHVSYNFSDCSLQSSQRSTTS # FFYNSEKLVKPGKAAFLVGFFGSPSWETSVKTLYDGPSVYSNQLQFQSRRSQKFARRTSRFSISEFGGLRRSTRYSDTSDSRALSNTLVALSHPPPHS # YASSPTYPADARTNSSGRRYSLPVTRQMHPEHPNDRRRRPSSLKSSRSHRFDSLPIPGLRLVNLVNNNPDLLHQTSFLDFEPFSPTPSSIHSRSRSKS # SRASSCIPPLPPLPASVLLSPLPDLPESISNEGRSYISSPYALSPKQTSLNETKLSPVVPGADTGMTITRRPSQTSGTLPRIKAQPSRSPSLRSRKSP # VVGPSPLRIVTLPEGSLANLNKEIDKDLLPSIPSLSSSTGSATAPASHAGEWSKHQNYADLGIGYPSSWGLGLGLEEGGTSQIQSEIVSENRSSVPCR # LSQAASTQSQMPSSPDADAMLGIIQELVEETSQWDDSLFMDTSFKALIENSRSTSSDSPLSSSKSSHHSHQPSGPREVAPPVPSPPSSRSSSDSARPR # THSSSSVTSAKSKAPSIAVNGAAVTRAPGNTSSPRNSSTIGTERKLSPKSILKKTLMMPSRSVEFELGLVGLDAVRMENFRMSAYESPRLHGGGYDEP # IVDYVMHIPTMPGAYEHGSVLTPLQEISEEQEQEAEHVQVVQRLVVFFDKDC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g577 ### # start gene g578 4 AUGUSTUS gene 2271129 2271722 0.58 + . g578 4 AUGUSTUS transcript 2271129 2271722 0.58 + . g578.t1 4 AUGUSTUS start_codon 2271129 2271131 . + 0 transcript_id "g578.t1"; gene_id "g578"; 4 AUGUSTUS CDS 2271129 2271722 0.58 + 0 transcript_id "g578.t1"; gene_id "g578"; 4 AUGUSTUS stop_codon 2271720 2271722 . + 0 transcript_id "g578.t1"; gene_id "g578"; # protein sequence = [MIENRARIERQIFLGRQLVRRTLQNSGRQVNTQTIALPARLSTTPSYTGTDAPISVDTDAENAYASASRKYFRRRHQS # ANGQLKPRANNGGKGLSSRNASAELVNPGSTPNRRTEPMLNRTTNGDNLPSGHMLRPPTKSFPNVLVLRENEMDEDGWSSESSFDDDLVAMDEHRRYT # SHSSLPPVEDSDQLQRDEWSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g578 ### # start gene g579 4 AUGUSTUS gene 2272511 2272786 0.43 + . g579 4 AUGUSTUS transcript 2272511 2272786 0.43 + . g579.t1 4 AUGUSTUS start_codon 2272511 2272513 . + 0 transcript_id "g579.t1"; gene_id "g579"; 4 AUGUSTUS CDS 2272511 2272786 0.43 + 0 transcript_id "g579.t1"; gene_id "g579"; 4 AUGUSTUS stop_codon 2272784 2272786 . + 0 transcript_id "g579.t1"; gene_id "g579"; # protein sequence = [MLKESLDLHEEKKARASVSKQTVQEARAEVIEKVQLAFMEDRRTKMEHDERERQLRAARAEIAARKEARERANTDIEE # DNVIAADQPPPYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g579 ### # start gene g580 4 AUGUSTUS gene 2275888 2277741 0.76 - . g580 4 AUGUSTUS transcript 2275888 2277741 0.76 - . g580.t1 4 AUGUSTUS stop_codon 2275888 2275890 . - 0 transcript_id "g580.t1"; gene_id "g580"; 4 AUGUSTUS CDS 2275888 2276117 0.95 - 2 transcript_id "g580.t1"; gene_id "g580"; 4 AUGUSTUS CDS 2276229 2277741 0.76 - 0 transcript_id "g580.t1"; gene_id "g580"; 4 AUGUSTUS start_codon 2277739 2277741 . - 0 transcript_id "g580.t1"; gene_id "g580"; # protein sequence = [MYGQLSAIAREFNFPSTTGICLYFHFTENGITATPRISDESWQMIWSNVFDPSFPAPRVPIVGKVEFDIDIRHARWYS # AWIASTHREHVDVPASVGPSTAPSLAHFRGDSRNTELEINFQDDQLDNESISPPSITRHGRHVPKKLSLVDRLDSSLRAVARTATAAAHISPEHSASA # RALSPIFQEDEPKTAKLEDSLAKRVKSWRASASLTPSALAAKGQTSLEPANLPNTMSLDGVADGEDMEELNLEDFTWSVSSLGPNDWEEGSVASRPRL # PSVHLANRMESSVCMTPSVCTSFGPSDYTLPSPIPSWARVMTPDIAHRMYEDCPPTPSTATSWGPPSEYPASPISFGRVSSVDLGDRAVFSPPPTPMT # ATSWGPPSEYPQSPMSFGRAPSVHLGDRLVFSPPPTPSTATTWGPASWPSSPITPFYVQTPDVGQRAFDPEDLALPSAPWKQVWPYHQQHLDTVSGPE # SQVSPYNSAHAPSAELTMSVHAPWGHSWPYHSYANPSVYPYFDDLYPAKVLGVKSTTYLSSIDIYPAVDQRQKSNKLVNVKIVSGWPTFEICTSTMKL # NCFIPADLILDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g580 ### # start gene g581 4 AUGUSTUS gene 2278453 2279158 0.38 + . g581 4 AUGUSTUS transcript 2278453 2279158 0.38 + . g581.t1 4 AUGUSTUS start_codon 2278453 2278455 . + 0 transcript_id "g581.t1"; gene_id "g581"; 4 AUGUSTUS CDS 2278453 2278539 0.4 + 0 transcript_id "g581.t1"; gene_id "g581"; 4 AUGUSTUS CDS 2278631 2279158 0.61 + 0 transcript_id "g581.t1"; gene_id "g581"; 4 AUGUSTUS stop_codon 2279156 2279158 . + 0 transcript_id "g581.t1"; gene_id "g581"; # protein sequence = [MRPEPAEIARIAAKGKRKKTRDKVETATVNSKFTSSTNSQMEGRLEQAAALGQKDKGPAFISLINEIISRSDQSTVAR # DIPTLVGFVVNQESVGLVVGRQVLSELVRIVGDGTISDPEVRKRVVQETIETTQPKIVSYEEQVSFRKANQTAPLTVYLKVSNLRFQLADIYENEEEW # SDAARVLMGIQLDSNQRCVACFLLTIFC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g581 ### # start gene g582 4 AUGUSTUS gene 2279504 2280181 0.89 + . g582 4 AUGUSTUS transcript 2279504 2280181 0.89 + . g582.t1 4 AUGUSTUS start_codon 2279504 2279506 . + 0 transcript_id "g582.t1"; gene_id "g582"; 4 AUGUSTUS CDS 2279504 2280181 0.89 + 0 transcript_id "g582.t1"; gene_id "g582"; 4 AUGUSTUS stop_codon 2280179 2280181 . + 0 transcript_id "g582.t1"; gene_id "g582"; # protein sequence = [MAAVTAAVLAPAGPNRSRVLASLYRDERTTELPTYNILSKMFLDHILRPAEIKEFEGTLKPHQLAKIAISSNDRVATS # TNDEEIDTPSDPPISTRTAPATVLDRAVMEHNLLASSKIYHNISFRGLGALLDLTPGAAENMARKMIEQGRLRGTIDQVDKLIWFEGNHEEDDAQGKA # GGLGEVEEAEDTGAPFTKRWDAQIRITAANVRPSHSNGHEHYTDVECPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g582 ### # start gene g583 4 AUGUSTUS gene 2281247 2282206 0.91 - . g583 4 AUGUSTUS transcript 2281247 2282206 0.91 - . g583.t1 4 AUGUSTUS stop_codon 2281247 2281249 . - 0 transcript_id "g583.t1"; gene_id "g583"; 4 AUGUSTUS CDS 2281247 2282206 0.91 - 0 transcript_id "g583.t1"; gene_id "g583"; 4 AUGUSTUS start_codon 2282204 2282206 . - 0 transcript_id "g583.t1"; gene_id "g583"; # protein sequence = [MPPPSHPTQYPHNQYAYPYQYPAHYPAQYYAFPVPSRGAMVYGAPQMAHHHLPTHTPPPLQSPALPASLPERPPQPTS # SLPPPSASLPPKPSTNVTPNLPNHVEPQKSLTIPVPGSFIPIRNTALKPPKSSLKQFFPAFTEDEESASNTPQEQQAQTEAEVAGRDPEVTPTNNHLI # DEPHFVPSSNQLPPPSPKQSSVSDHGGQKTSKEPTPVPQAEESCVAALPSDAVAPPPPRPELYSIVGQVGEGTFGKVYKARNAITNTHVALKRIRMET # EKDGFPVTAMREIKLLQSLRHDNVVRLFEMMVSSGKHFHLLQFLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g583 ### # start gene g584 4 AUGUSTUS gene 2283013 2284188 0.31 - . g584 4 AUGUSTUS transcript 2283013 2284188 0.31 - . g584.t1 4 AUGUSTUS stop_codon 2283013 2283015 . - 0 transcript_id "g584.t1"; gene_id "g584"; 4 AUGUSTUS CDS 2283013 2283929 0.84 - 2 transcript_id "g584.t1"; gene_id "g584"; 4 AUGUSTUS CDS 2284179 2284188 0.31 - 0 transcript_id "g584.t1"; gene_id "g584"; 4 AUGUSTUS start_codon 2284186 2284188 . - 0 transcript_id "g584.t1"; gene_id "g584"; # protein sequence = [MMVSLLLSIMPHNGRNHQRRPRGNKDDDRSAYSREDDNSYYSRSRQSDHRYRENASGSGRHSYDAGSREVSSSRVADS # SWQHTGGNFQDRYQNKGRRDDYDAVAVLDSRETDVGWSSHRSTNDADLYSHPQREEWPPPPRYESNYSSTSYQDQYQPPASNSYPQPQPWEDDIRHHD # DRVQDQNSHRQSSRGADARWQREERAIYRQEQDNGWEPRRPEQDQRQNWDENSVDRQWEPAHHSWDSSQHGFDSSQRSHGYSQQNGHRNSSNRKNSRK # SDSHSKVNGSNKDWREVDELNKYVSFVVKKKFKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g584 ### # start gene g585 4 AUGUSTUS gene 2285004 2285858 0.62 - . g585 4 AUGUSTUS transcript 2285004 2285858 0.62 - . g585.t1 4 AUGUSTUS stop_codon 2285004 2285006 . - 0 transcript_id "g585.t1"; gene_id "g585"; 4 AUGUSTUS CDS 2285004 2285753 0.62 - 0 transcript_id "g585.t1"; gene_id "g585"; 4 AUGUSTUS CDS 2285856 2285858 0.62 - 0 transcript_id "g585.t1"; gene_id "g585"; 4 AUGUSTUS start_codon 2285856 2285858 . - 0 transcript_id "g585.t1"; gene_id "g585"; # protein sequence = [MEFKAADKFVAVAYVSSTTDAPAVAFNQVAETHRDDFLFGLSTDPDVIAAEAVTPPAVVVYRSFDEPRVVYPYPILDA # KPEDFEEWMADLSIPVIDEVSSDNYAVYASSTKPLAYVFLDPTAENKEEIIASVRPVAEEYKSKVNFVWIDAIKFGDHAKALNLQEPKWPSFVIQDLE # KQLKYPLDQSKEVSTESVKDWTKQFVSGELKPELKSQPIPEVQDESVYNLVGKEFEEVVFDDSKDVFVEFYASW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g585 ### # start gene g586 4 AUGUSTUS gene 2292511 2293169 0.25 + . g586 4 AUGUSTUS transcript 2292511 2293169 0.25 + . g586.t1 4 AUGUSTUS start_codon 2292511 2292513 . + 0 transcript_id "g586.t1"; gene_id "g586"; 4 AUGUSTUS CDS 2292511 2292552 0.25 + 0 transcript_id "g586.t1"; gene_id "g586"; 4 AUGUSTUS CDS 2292639 2293169 0.75 + 0 transcript_id "g586.t1"; gene_id "g586"; 4 AUGUSTUS stop_codon 2293167 2293169 . + 0 transcript_id "g586.t1"; gene_id "g586"; # protein sequence = [MELKWALKTLLLILVEPSNDETANLLRSPQHSDIEEVASLARDNSAEARDDNKEGRDEVESLAISHDDTPPLLHVRPL # EGDAPQRSVVEVSIDADDEVSRSSQAPTPTAETEHDRMEIDEEGVTSGDEPLQRARRASNYQIYTHVREYLLNDLIRSRKAPTQGQYSSSNEERTSSA # SPFHTRYRNGTRGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g586 ### # start gene g587 4 AUGUSTUS gene 2296599 2297144 0.53 - . g587 4 AUGUSTUS transcript 2296599 2297144 0.53 - . g587.t1 4 AUGUSTUS stop_codon 2296599 2296601 . - 0 transcript_id "g587.t1"; gene_id "g587"; 4 AUGUSTUS CDS 2296599 2297144 0.53 - 0 transcript_id "g587.t1"; gene_id "g587"; 4 AUGUSTUS start_codon 2297142 2297144 . - 0 transcript_id "g587.t1"; gene_id "g587"; # protein sequence = [MVSRPSVPSAQTTPVRASESSSTNGSGSDVPGSGSDPNNSQTSLPSADNAQGIGASQNGSQFVADAAVHRPTWDCVEE # LVQNLKTSFPLLILSLETLVDQIINRFKPSHEEDIYRHICMLLQDALQVCHPNYSNSNIHSAKHYMVRVNQTEDDGSLTASTVANLHRLAQGITHPQV # KVWML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g587 ### # start gene g588 4 AUGUSTUS gene 2297180 2298997 0.13 - . g588 4 AUGUSTUS transcript 2297180 2298997 0.13 - . g588.t1 4 AUGUSTUS stop_codon 2297180 2297182 . - 0 transcript_id "g588.t1"; gene_id "g588"; 4 AUGUSTUS CDS 2297180 2298997 0.13 - 0 transcript_id "g588.t1"; gene_id "g588"; 4 AUGUSTUS start_codon 2298995 2298997 . - 0 transcript_id "g588.t1"; gene_id "g588"; # protein sequence = [MINLLSKEYHIKQAEMRPNVIQTVLTGLHACTPPMILPPHLIKYLAKTFGAWYIALEILASSLEYLKDDELTLRDNAL # DSLADVYSELAEDDMFYGLWRRRCLQPETNNAIALEQNGMWDQAMNAYETAQQRARSGAIPYTEQEYCLWEDHWILSAEKLQQWDLLYELGRNEGNHD # LILESAWRVKDWLENREALEDHIAQLPEVPTPRRRVFEAFIALLKLPSPLEKNSEFTVILEDAMQLALRKWVSLPPHLSPAHVPLLQHFQQFVELQEA # VQIFGSLASTNAQNLEKKSSELKMVLQAWRERLPNVHDDISIWSDLVAWRQNVFHSINNAYIPLITPSTQTGAANTNTAGYRGYHETAWIINRFAHVA # RKHDLLDVCHTALAKIYTLPNIEISEAFLKLREQARCYYQKPNDLQAGLEVINNTNLGYFSVSQKAEFFTLKGLFHARFGRHEEANASFGQAVQMDMS # QAKAWAEWGRWNDRMFKEHPNDLSYAGNAVSCYLQAAGLYKSGKSRPLLARVLWLLSIDDTSFTVSRAFDTYKGEAAFWFWITLIPQLCSSLSHREVK # QARYVLLNLARLYPQVCICIHEHSELRQNRYRRCFSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g588 ### # start gene g589 4 AUGUSTUS gene 2302239 2303536 0.66 - . g589 4 AUGUSTUS transcript 2302239 2303536 0.66 - . g589.t1 4 AUGUSTUS stop_codon 2302239 2302241 . - 0 transcript_id "g589.t1"; gene_id "g589"; 4 AUGUSTUS CDS 2302239 2303336 0.91 - 0 transcript_id "g589.t1"; gene_id "g589"; 4 AUGUSTUS CDS 2303387 2303536 0.66 - 0 transcript_id "g589.t1"; gene_id "g589"; 4 AUGUSTUS start_codon 2303534 2303536 . - 0 transcript_id "g589.t1"; gene_id "g589"; # protein sequence = [MTITFLGVQQQILMSPGVVLARQNVTKGPVAAAAPAYEFMEAALSSLVSQGIKGRNAEELFVSTLEGAFDAVHITEVQ # EKAESFIRKLSQAVFDAELKRGPFRETSSYRSSPLLSSYLEALPYALARTQADQVTKARGLIASIVQDLVTHAKQNNIIMQDVYLILHQITNRFTALC # LDDSWSRKIAGCGCIKMMTETPEVGVKWVRDREIDLVRTLLHILKDLPADLPQDVDEIIGVLTEVLRIGSLDIDFHSDAGVQAQIRSKLIALVGVFFP # ELQSAVPVVRQAAQACIEFLVQLSGRPAVELLLPHRDRMLISIFTKPLRALTFPIQIGLIEAVRYCVSLNPPLLDLNDELLRLLHETLALADAEDAAL # LGRSNPRQGIIEMTKLRVSCIKLLTASMPMTDFFQKHPQTRQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g589 ### # start gene g590 4 AUGUSTUS gene 2304528 2304962 0.29 - . g590 4 AUGUSTUS transcript 2304528 2304962 0.29 - . g590.t1 4 AUGUSTUS stop_codon 2304528 2304530 . - 0 transcript_id "g590.t1"; gene_id "g590"; 4 AUGUSTUS CDS 2304528 2304962 0.29 - 0 transcript_id "g590.t1"; gene_id "g590"; 4 AUGUSTUS start_codon 2304960 2304962 . - 0 transcript_id "g590.t1"; gene_id "g590"; # protein sequence = [MYSRLLHYPALGNNLHTLFAKVLIGLSDAIVNKETPQNAAFLITLTFNTCLDRLDALTVIHEEIAAAAERTKNGETSI # LNDAYIEKARPVGGAVYALEKPEEIMMGMFECSSCRVTLIVHSRIPSSVSHIAARLSSMPRDVKKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g590 ### # start gene g591 4 AUGUSTUS gene 2307123 2307587 0.4 + . g591 4 AUGUSTUS transcript 2307123 2307587 0.4 + . g591.t1 4 AUGUSTUS start_codon 2307123 2307125 . + 0 transcript_id "g591.t1"; gene_id "g591"; 4 AUGUSTUS CDS 2307123 2307587 0.4 + 0 transcript_id "g591.t1"; gene_id "g591"; 4 AUGUSTUS stop_codon 2307585 2307587 . + 0 transcript_id "g591.t1"; gene_id "g591"; # protein sequence = [MEGYVSTDTLTIGDISIPHQLFAEATKEPGLAFAFGKYVINSRPSVPALIKHFRFDGILGLAYDTIAVNHIPPPFYNM # VDQNLVDEPVFSFRLGSSENDGGEVVFGGVDDNAYTGDITYVPLRRKAYWEVELEKISFGDEDVELENTGAAIDTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g591 ### # start gene g592 4 AUGUSTUS gene 2309212 2309873 0.45 + . g592 4 AUGUSTUS transcript 2309212 2309873 0.45 + . g592.t1 4 AUGUSTUS start_codon 2309212 2309214 . + 0 transcript_id "g592.t1"; gene_id "g592"; 4 AUGUSTUS CDS 2309212 2309329 0.45 + 0 transcript_id "g592.t1"; gene_id "g592"; 4 AUGUSTUS CDS 2309509 2309873 0.45 + 2 transcript_id "g592.t1"; gene_id "g592"; 4 AUGUSTUS stop_codon 2309871 2309873 . + 0 transcript_id "g592.t1"; gene_id "g592"; # protein sequence = [MTRIQLTVTAMLQGYLFDRRFTGRDIPDEWGRRDEGLVSYGVYLFSTLHDPESSSSPSSSTIVPPNLKRRRISRESPS # TSSTVSSSPPSEGAAVNLDLLDHLEREDGNQGEDEDLEEDDVVDPLRGEEPKAFYSWTDIVTPYRRFSGARNVDTVKDGAKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g592 ### # start gene g593 4 AUGUSTUS gene 2316076 2316434 0.39 - . g593 4 AUGUSTUS transcript 2316076 2316434 0.39 - . g593.t1 4 AUGUSTUS stop_codon 2316076 2316078 . - 0 transcript_id "g593.t1"; gene_id "g593"; 4 AUGUSTUS CDS 2316076 2316240 0.5 - 0 transcript_id "g593.t1"; gene_id "g593"; 4 AUGUSTUS CDS 2316294 2316434 0.8 - 0 transcript_id "g593.t1"; gene_id "g593"; 4 AUGUSTUS start_codon 2316432 2316434 . - 0 transcript_id "g593.t1"; gene_id "g593"; # protein sequence = [MESGANPSSEDADEALEDGATQVNNVVYSFRLQSTSFDKKSYLTYLKGYMKKIKNHLQAVNPDRVEPFEKDAAAFAKK # VVANFKDYEFVRSIISIRSNKAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g593 ### # start gene g594 4 AUGUSTUS gene 2320669 2321007 0.73 - . g594 4 AUGUSTUS transcript 2320669 2321007 0.73 - . g594.t1 4 AUGUSTUS stop_codon 2320669 2320671 . - 0 transcript_id "g594.t1"; gene_id "g594"; 4 AUGUSTUS CDS 2320669 2321007 0.73 - 0 transcript_id "g594.t1"; gene_id "g594"; 4 AUGUSTUS start_codon 2321005 2321007 . - 0 transcript_id "g594.t1"; gene_id "g594"; # protein sequence = [MPANPTPEMLKKMRIESEASEKGIETLPNSPGGKSKTRATVEDAMDEDEDQSFAPGGDADYFIEEDEDGRFYGGGLTS # EQKDILNIFERAGDEVLAEVSVQYFHVCDLTCNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g594 ### # start gene g595 4 AUGUSTUS gene 2324045 2324353 0.61 - . g595 4 AUGUSTUS transcript 2324045 2324353 0.61 - . g595.t1 4 AUGUSTUS stop_codon 2324045 2324047 . - 0 transcript_id "g595.t1"; gene_id "g595"; 4 AUGUSTUS CDS 2324045 2324353 0.61 - 0 transcript_id "g595.t1"; gene_id "g595"; 4 AUGUSTUS start_codon 2324351 2324353 . - 0 transcript_id "g595.t1"; gene_id "g595"; # protein sequence = [MISAVPNFSTAPDLSGSAPGQAGQIIAPGAENVGHAQILSSFSEPFELEGLFGAADAGAFGGGRSGPDVNMDAEGDGD # DMFWDANETLSNENADDGMQEGDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g595 ### # start gene g596 4 AUGUSTUS gene 2325282 2325578 0.39 - . g596 4 AUGUSTUS transcript 2325282 2325578 0.39 - . g596.t1 4 AUGUSTUS stop_codon 2325282 2325284 . - 0 transcript_id "g596.t1"; gene_id "g596"; 4 AUGUSTUS CDS 2325282 2325578 0.39 - 0 transcript_id "g596.t1"; gene_id "g596"; 4 AUGUSTUS start_codon 2325576 2325578 . - 0 transcript_id "g596.t1"; gene_id "g596"; # protein sequence = [MASEPTLSSLAQLASNAEDAFDFSQNQDPGSSTGKTKEQIRKHYLRTLHKVIDQSDIIILVLDARDPEGCRSRLVEEE # VRRRESEGKKLVFVLNKVGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g596 ### # start gene g597 4 AUGUSTUS gene 2326927 2327247 0.58 - . g597 4 AUGUSTUS transcript 2326927 2327247 0.58 - . g597.t1 4 AUGUSTUS stop_codon 2326927 2326929 . - 0 transcript_id "g597.t1"; gene_id "g597"; 4 AUGUSTUS CDS 2326927 2327247 0.58 - 0 transcript_id "g597.t1"; gene_id "g597"; 4 AUGUSTUS start_codon 2327245 2327247 . - 0 transcript_id "g597.t1"; gene_id "g597"; # protein sequence = [MDYSNSNSYYSQSTFDNPYHKPYAGPSYPAAGSSSNHSAPVPANAYEYDVGILAQQSVYVPGAMIDKRGGSGGKLAKG # GKRTTVLRKGGGKVWEDQTLLEWNPCEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g597 ### # start gene g598 4 AUGUSTUS gene 2327948 2328698 0.57 + . g598 4 AUGUSTUS transcript 2327948 2328698 0.57 + . g598.t1 4 AUGUSTUS start_codon 2327948 2327950 . + 0 transcript_id "g598.t1"; gene_id "g598"; 4 AUGUSTUS CDS 2327948 2327971 0.76 + 0 transcript_id "g598.t1"; gene_id "g598"; 4 AUGUSTUS CDS 2328075 2328397 0.57 + 0 transcript_id "g598.t1"; gene_id "g598"; 4 AUGUSTUS CDS 2328452 2328698 1 + 1 transcript_id "g598.t1"; gene_id "g598"; 4 AUGUSTUS stop_codon 2328696 2328698 . + 0 transcript_id "g598.t1"; gene_id "g598"; # protein sequence = [MGSPTGLLLGLADKYEGVAEPEGEFTLTEALDEEDAPRPFKCFLDVGLKRTSTGSRVFGAMKGASDGGIFIPHSEKRF # PGYDPESKELDAEVLKKYIFGGHVAEYMESLEEEDDERFKKQFATYLADGIGSEDMEEIYTNAHAAIREDPVFKPTEKTKDWKAESSKYATPRLTHAQ # RKEKINARIEQFRAGAGDDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g598 ### # start gene g599 4 AUGUSTUS gene 2330079 2330633 0.16 - . g599 4 AUGUSTUS transcript 2330079 2330633 0.16 - . g599.t1 4 AUGUSTUS stop_codon 2330079 2330081 . - 0 transcript_id "g599.t1"; gene_id "g599"; 4 AUGUSTUS CDS 2330079 2330633 0.16 - 0 transcript_id "g599.t1"; gene_id "g599"; 4 AUGUSTUS start_codon 2330631 2330633 . - 0 transcript_id "g599.t1"; gene_id "g599"; # protein sequence = [MTLARDLLSSILASSNGLSTALPSILHSIAAPEPQTQQPESLPPLSATVVTKPPSIVSVQAFNAQLAIGGKDEALRKA # AHLFKSVATRMERGRLQNERYWVDALKIRRGNWGLVPAPLPPGSAIGKGADKTSKDFIISYGLEECLSSLFHHSGALVLIVQLQHLRYFEEVLSPTCP # TAVLRRSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g599 ### # start gene g600 4 AUGUSTUS gene 2330698 2330991 0.3 - . g600 4 AUGUSTUS transcript 2330698 2330991 0.3 - . g600.t1 4 AUGUSTUS stop_codon 2330698 2330700 . - 0 transcript_id "g600.t1"; gene_id "g600"; 4 AUGUSTUS CDS 2330698 2330991 0.3 - 0 transcript_id "g600.t1"; gene_id "g600"; 4 AUGUSTUS start_codon 2330989 2330991 . - 0 transcript_id "g600.t1"; gene_id "g600"; # protein sequence = [MSRKLLSSQLCSLTSLVSKETPTEVLGRNLQRIYEERGLEFFELLKDGSLQSGVLPSVDAADKREDESQDTAFDEESN # HTMTKDELYKLKMEVMPQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g600 ### # start gene g601 4 AUGUSTUS gene 2333715 2334458 0.94 + . g601 4 AUGUSTUS transcript 2333715 2334458 0.94 + . g601.t1 4 AUGUSTUS start_codon 2333715 2333717 . + 0 transcript_id "g601.t1"; gene_id "g601"; 4 AUGUSTUS CDS 2333715 2334458 0.94 + 0 transcript_id "g601.t1"; gene_id "g601"; 4 AUGUSTUS stop_codon 2334456 2334458 . + 0 transcript_id "g601.t1"; gene_id "g601"; # protein sequence = [MISGIYLAIYPNGEDASIMHTILDTFVSDHDGLREVDETTRRELKTIEFLKSKALQRSKPDPPSVTPTTNGDTTNGSV # TTPDNAAQLLLNIHRSPPAVGSPKAPFPSLFNLDSDHINPTSTYNYNGNHAAGTTAHLTLSPTYQRLQHPPEYSPASSSPAAEESESTAQILFDHWCN # TVSNAPLESLNAPLAWGGQGGADLSGWAAQAAAGTSVQQLTGAVNGAVNGSDNQDWSFYWEALVNQIPRTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g601 ### # start gene g602 4 AUGUSTUS gene 2335844 2336365 0.86 - . g602 4 AUGUSTUS transcript 2335844 2336365 0.86 - . g602.t1 4 AUGUSTUS stop_codon 2335844 2335846 . - 0 transcript_id "g602.t1"; gene_id "g602"; 4 AUGUSTUS CDS 2335844 2336365 0.86 - 0 transcript_id "g602.t1"; gene_id "g602"; 4 AUGUSTUS start_codon 2336363 2336365 . - 0 transcript_id "g602.t1"; gene_id "g602"; # protein sequence = [MDNSFHGKYLVKYMVKRVKCNMIDCIQIASPSGESSPPANSTQPNGDSIPWGVGSLNSASANSSDNQESNSSLSATTV # TSAPSSTITASNSPPGSSSKLRKSRMSTTSTERQATPTIDIPSGTLTTDAAATAATFAAYRPNVQNGNSAQGWNQAFSAWTVVFVLVLIDLNNLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g602 ### # start gene g603 4 AUGUSTUS gene 2340319 2342501 0.44 + . g603 4 AUGUSTUS transcript 2340319 2342501 0.44 + . g603.t1 4 AUGUSTUS start_codon 2340319 2340321 . + 0 transcript_id "g603.t1"; gene_id "g603"; 4 AUGUSTUS CDS 2340319 2341326 0.98 + 0 transcript_id "g603.t1"; gene_id "g603"; 4 AUGUSTUS CDS 2341461 2341764 0.44 + 0 transcript_id "g603.t1"; gene_id "g603"; 4 AUGUSTUS CDS 2341858 2342501 0.78 + 2 transcript_id "g603.t1"; gene_id "g603"; 4 AUGUSTUS stop_codon 2342499 2342501 . + 0 transcript_id "g603.t1"; gene_id "g603"; # protein sequence = [MTDEVTPQAQPSVKKEDKKPVFSANNRGAKRSVSNSKPAGNTNNAQGNPRPSSRSSNKKPTQAPESGSESATRKGTDS # GKKSEQQQRKNTGGANRQQTHRKASASQAGRRDAKSSPVPQNKESSDALSSLQRVIADLKTTSPQPPVNNPGPIGSSVSSNLPVNAPVFQPGNTYAGM # ASNLDPKHRKVQSLGASGLSGNFNSFSPNLGSMMEDAEDSSGMPLEEGEIPSNYYTSPGHQMRSQSQSFTAPRFAALAAQQEQTDQLGPSGRPQLAPN # FMFGGGATKKPQRSGGMGPPINEDVGFQFPQQQQNYQSDVPVHESGHRKADSGEITGIMAEQVLSFQTPGLVPNRHRRVQSTAPGIGAGAFNVPQNPM # GQFNNLGGLGLGLDGQNQGIPRGHGRRHSVNVVNKSGPGTSIGGFNVNDGFEDGFAPPSNFNGHSHGGVGGIQNTAFTSDLAQAQAQLQSLQQFRAAA # GGHHHKMASFSFPNMLPNMMAANMMGMGLGGINLLQQQQQQFQSQLQQQSAQPQRKSLFAPYLPQASLPPLLAAGKLVVGILRVNKRNRSDAYVATEV # LDADIYICGSKDRNRALEGDIVAVELLDVDEVWGTKKEKEEKKRKKEENAAYDLKSTAGRKDDKKKDDVEVEGQGLMLFEDEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g603 ### # start gene g604 4 AUGUSTUS gene 2344768 2345187 0.98 + . g604 4 AUGUSTUS transcript 2344768 2345187 0.98 + . g604.t1 4 AUGUSTUS start_codon 2344768 2344770 . + 0 transcript_id "g604.t1"; gene_id "g604"; 4 AUGUSTUS CDS 2344768 2345187 0.98 + 0 transcript_id "g604.t1"; gene_id "g604"; 4 AUGUSTUS stop_codon 2345185 2345187 . + 0 transcript_id "g604.t1"; gene_id "g604"; # protein sequence = [MFKYDQNHVYDEHTHTLQIYWSNKDVITWLAENSDDEHLNKIKQNAEQHALKMEVTSRSVHDEKALFDEEDVEEDEII # LGRNDQSAGPETSKQRLLSIAKPAPVFEGLRKAPSGHKIQDIRELMTVPVSISAVCASHDH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g604 ### # start gene g605 4 AUGUSTUS gene 2346616 2347644 0.43 - . g605 4 AUGUSTUS transcript 2346616 2347644 0.43 - . g605.t1 4 AUGUSTUS stop_codon 2346616 2346618 . - 0 transcript_id "g605.t1"; gene_id "g605"; 4 AUGUSTUS CDS 2346616 2347644 0.43 - 0 transcript_id "g605.t1"; gene_id "g605"; 4 AUGUSTUS start_codon 2347642 2347644 . - 0 transcript_id "g605.t1"; gene_id "g605"; # protein sequence = [MLATASQPSDLHVPPSSFLFMNSNSRSTSNLSLKSSRSRKHSLTLSNTMGWLSRHSTQSSVSSFYKGNKNGSSPASQS # QHKPARSIELVNNARHGPLGSGATVVRTPEEALYDSGVDSRPSLQRSSTSQSFNSSRPTLQRSATSGSKPLESPPLPSLPPDLRNSDLSSEDEYYDEG # DNDILSASAGLSWPTPPSAIAPLPPTPSLPSLRSSLKPKLRSNSDEFRVPALPAHVTQSSPQPPFEPVLISGVPSGVVDPSTVLVTVETSTTSHKTTF # KTLTSRPSQLASYLHSLFPRPRRDSDASSVYSTASDDMSTYRNHLASQGLLPQAPVNIHIFLDRPSAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g605 ### # start gene g606 4 AUGUSTUS gene 2356792 2359833 0.6 + . g606 4 AUGUSTUS transcript 2356792 2359833 0.6 + . g606.t1 4 AUGUSTUS start_codon 2356792 2356794 . + 0 transcript_id "g606.t1"; gene_id "g606"; 4 AUGUSTUS CDS 2356792 2357947 0.66 + 0 transcript_id "g606.t1"; gene_id "g606"; 4 AUGUSTUS CDS 2358125 2359833 0.84 + 2 transcript_id "g606.t1"; gene_id "g606"; 4 AUGUSTUS stop_codon 2359831 2359833 . + 0 transcript_id "g606.t1"; gene_id "g606"; # protein sequence = [MLDRRVESCSLSHILSVTRAEGVTVDDASAQSKAKLTEVIIAQRPAIVNSILHRLQPPRQPVMERSFLTVPDEAGRRA # LVEKYIEATGNDAVRQVVCCICAREVFSSEAKSIHPDQIPHPELLHPAKPHSAHALTSGMLLYRDPWTKKVPEFACSTCIQSLSANPAKRPPLSLSNN # LWIGEVPFELRILTLCERILVSRFFSAAYIIKLYPKSRGARGWPKEMLTSAVKGNVSSYFLNTEDIVGMIDPGFLPPRPAILTATIGVTFIGPQNIPL # KFLPPYLRVRRKRVKDALEWLIRYNPLYLGQKLSPQHLELLPEDGVPPEVLHSMKWIDDVRVLDRENGGYIPNLESPGNDEDELASGEGIVADELAEV # FRSSYGTISDIAKYVNGNTIPQTEVFANALRNASGNNENYHISPGALVNTYGRFDANGKRSWGSVENPNHLLGCFPHLFPYGEGGFETARPVQVSYAA # HAKWALQYADRRFRLDQQFMFQVFGVIQRREICAKATLRISRSQFAKYESEIQQLKPKDLLQASEEEKKKQPFSNPAIRALRSQLTAVRSKVLATDEN # RASVRAQIWSLNVAFNPPSLWITINPSDTHNPIAQVFAGENIDLDNFVPTRGPTSTTRSINLASDPYAAAQFFHFVIKSTLESLYGFTKSPSGHPNRV # LGIVGTVRAYVGMVESQGRGTLHLHMIMWLEGAPTPAEMQEALKSKEFRDKVAKFISCTIRADVGKTMSELTQISTNPSIAYARPLSTKDPEYERKRA # EQEVHLARNLQLHECSPERCYRKGTARCKRRAPWPTSQFDFIDEDGTWGMKRSVGFMNGFNPTISEVQFCNNDQKLVTNGDETQDMTYYITTYSTKKR # DRSTNESAILAQRLAYHKEQERLNSDHVDVSRKLVMRCATALNRQQELSAPEVVSYLMGWGDRYISHNFTPIYIDGLNGMLRKHYPTLQEKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g606 ### # start gene g607 4 AUGUSTUS gene 2360031 2361383 0.85 + . g607 4 AUGUSTUS transcript 2360031 2361383 0.85 + . g607.t1 4 AUGUSTUS start_codon 2360031 2360033 . + 0 transcript_id "g607.t1"; gene_id "g607"; 4 AUGUSTUS CDS 2360031 2361383 0.85 + 0 transcript_id "g607.t1"; gene_id "g607"; 4 AUGUSTUS stop_codon 2361381 2361383 . + 0 transcript_id "g607.t1"; gene_id "g607"; # protein sequence = [MVAGQLGNRTQLDDYGDRGETLAHYNVKDFFAETYDKYEKAAGTEVSTRNPSSDDPSTRRGRAPGIRHPYLEGTKPNH # VRLVRQQGHETVPLYIGRWFPRNDRPEDRASYILVMLSLLKPWRRITDITDGFHNLEDAWDAFVSSCAEDILDFISNVQYFYRCSDQSAARREKEYKS # YIAQEGDETTGDDSQTLALDIQEGAEGSVSDAEVYAAQQKEGMAQELYAYVAMECAFGAGVFDREYDIEDGVATAGRCSIDDKVDFQEWHQQLVDYTA # TGGLLVDNDIVDVGHVTVNPPPPPRVTAVDDGVVDPSEGAIGGNLRKKLNEEQARAHDIVVDHVLRTLNGDPPPQLLMLLLGPGGTGKTVVINAINET # MTKLGVGSWLAKTATTGVAASHFGGKTLHSWAGIKVAAKASDDLIGNASAAVQNVGPLILAYRDISCATNAPWQRKNW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g607 ### # start gene g608 4 AUGUSTUS gene 2361983 2362576 0.49 + . g608 4 AUGUSTUS transcript 2361983 2362576 0.49 + . g608.t1 4 AUGUSTUS start_codon 2361983 2361985 . + 0 transcript_id "g608.t1"; gene_id "g608"; 4 AUGUSTUS CDS 2361983 2362576 0.49 + 0 transcript_id "g608.t1"; gene_id "g608"; 4 AUGUSTUS stop_codon 2362574 2362576 . + 0 transcript_id "g608.t1"; gene_id "g608"; # protein sequence = [MRAMILANIATEADLANGTRGTVTDIVLDDREPMDHEVKDGATLLHYPPAIVYFKPDGSTSVKLEGFPEGLLPIVPQS # NKFVAAVGDNKSRTILRRQVALTPGYAFTDLKGQGQTIEYVIVDLGRPSYGARLDAFGAYVALSRSRGRDTIRLLRGFDEALFVTHPSPDLEVEDARL # DELEEETTVAWNTGNLWHRPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g608 ### # start gene g609 4 AUGUSTUS gene 2379898 2380678 0.86 + . g609 4 AUGUSTUS transcript 2379898 2380678 0.86 + . g609.t1 4 AUGUSTUS start_codon 2379898 2379900 . + 0 transcript_id "g609.t1"; gene_id "g609"; 4 AUGUSTUS CDS 2379898 2379976 0.91 + 0 transcript_id "g609.t1"; gene_id "g609"; 4 AUGUSTUS CDS 2380059 2380678 0.87 + 2 transcript_id "g609.t1"; gene_id "g609"; 4 AUGUSTUS stop_codon 2380676 2380678 . + 0 transcript_id "g609.t1"; gene_id "g609"; # protein sequence = [MYERKYARSADSVAEPDLEEFVFRCVFAKAPSTSSVEEVKPPSPTANTSSPKGKGKAPAAKQLPGTPVYELEEIELYH # WEGEQGFVNQGIFSAHIVKTGQYSYVLCASTDEGILLEHDLNSSMNPKFNPRMHSVTWNHVKEGQDVNSWLFAFPSEEEYSKFCTIYLQCGWETLNQL # PFSKIKEEDRRYVMSSTNEDVEMLDIEDEEEDEEEVLSELDPDGMRSHCFTSAFPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g609 ### # start gene g610 4 AUGUSTUS gene 2381002 2381604 0.77 + . g610 4 AUGUSTUS transcript 2381002 2381604 0.77 + . g610.t1 4 AUGUSTUS start_codon 2381002 2381004 . + 0 transcript_id "g610.t1"; gene_id "g610"; 4 AUGUSTUS CDS 2381002 2381604 0.77 + 0 transcript_id "g610.t1"; gene_id "g610"; 4 AUGUSTUS stop_codon 2381602 2381604 . + 0 transcript_id "g610.t1"; gene_id "g610"; # protein sequence = [MVLMNPSDPHSLYQADVEYGKVVEEWKVHDDITVSHIAPTDKFAPTTHEQTLVGASHNALFRIDPRISGSKMVDSQYK # QYAGKNKFSGVVTTASGKLAVASEKGDLRLFDSIGKNAKTALPPLGDPIIGIDATADGRWIVATTKTYLLLIDTLIGEGKYQGSLGFDRSFPATAKPI # PRRLRLRNEHVAYMNHDISLTPAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g610 ### # start gene g611 4 AUGUSTUS gene 2391925 2392155 0.27 - . g611 4 AUGUSTUS transcript 2391925 2392155 0.27 - . g611.t1 4 AUGUSTUS stop_codon 2391925 2391927 . - 0 transcript_id "g611.t1"; gene_id "g611"; 4 AUGUSTUS CDS 2391925 2392155 0.27 - 0 transcript_id "g611.t1"; gene_id "g611"; 4 AUGUSTUS start_codon 2392153 2392155 . - 0 transcript_id "g611.t1"; gene_id "g611"; # protein sequence = [MDVDVPPEVTEEGIRIVEDFLRSWASSKDGEDVVMEEDEEKEASPEQQLEQLKAHVEKFLPQIESNPWLKSLLTTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g611 ### # start gene g612 4 AUGUSTUS gene 2399681 2400094 0.32 - . g612 4 AUGUSTUS transcript 2399681 2400094 0.32 - . g612.t1 4 AUGUSTUS stop_codon 2399681 2399683 . - 0 transcript_id "g612.t1"; gene_id "g612"; 4 AUGUSTUS CDS 2399681 2400094 0.32 - 0 transcript_id "g612.t1"; gene_id "g612"; 4 AUGUSTUS start_codon 2400092 2400094 . - 0 transcript_id "g612.t1"; gene_id "g612"; # protein sequence = [MFGAGLGGAALIVFLVLVSLDKTASGGSSNWISSQIGVGTAPAFFICWFAVALGFNVASTVTMSLLSKQLPPTVKWNG # MSSVMVQYSNYLGRVTGAVWGGAGVSVGMSRYVGLEIAITGIGMALASSVWKHLKAKTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g612 ### # start gene g613 4 AUGUSTUS gene 2402580 2403089 0.66 + . g613 4 AUGUSTUS transcript 2402580 2403089 0.66 + . g613.t1 4 AUGUSTUS start_codon 2402580 2402582 . + 0 transcript_id "g613.t1"; gene_id "g613"; 4 AUGUSTUS CDS 2402580 2403089 0.66 + 0 transcript_id "g613.t1"; gene_id "g613"; 4 AUGUSTUS stop_codon 2403087 2403089 . + 0 transcript_id "g613.t1"; gene_id "g613"; # protein sequence = [MKFMKLTWQVTAVQGKVPMNEPNMQSHVGTPQTPQAILIPDHGTTPTSLSTESLTQAPEVLDIEFTSVSADDGGLFAW # PSNAERVISRTRGRKRMTSGANGAASDDAQSEPIVVRNVNRIVANTGENSAPASTFHMTLPGIDHACFHTAVTARTPTTCIDGQNPLSEYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g613 ### # start gene g614 4 AUGUSTUS gene 2405242 2405695 0.26 - . g614 4 AUGUSTUS transcript 2405242 2405695 0.26 - . g614.t1 4 AUGUSTUS stop_codon 2405242 2405244 . - 0 transcript_id "g614.t1"; gene_id "g614"; 4 AUGUSTUS CDS 2405242 2405493 0.86 - 0 transcript_id "g614.t1"; gene_id "g614"; 4 AUGUSTUS CDS 2405534 2405695 0.26 - 0 transcript_id "g614.t1"; gene_id "g614"; 4 AUGUSTUS start_codon 2405693 2405695 . - 0 transcript_id "g614.t1"; gene_id "g614"; # protein sequence = [MQWLRLRPESPDELDMVDWRGRWLDDEDDEYDEDDEEEEEDRQMEDFDPVRSNPEANDDDDEEEEEEEEEDERPSNPL # PAGRQHAVANTTSARTTPTSNANARPPNTNISLPKMHTSIGNGKLRVIRSWSPAVGLAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g614 ### # start gene g615 4 AUGUSTUS gene 2417708 2419083 0.6 + . g615 4 AUGUSTUS transcript 2417708 2419083 0.6 + . g615.t1 4 AUGUSTUS start_codon 2417708 2417710 . + 0 transcript_id "g615.t1"; gene_id "g615"; 4 AUGUSTUS CDS 2417708 2418256 1 + 0 transcript_id "g615.t1"; gene_id "g615"; 4 AUGUSTUS CDS 2418418 2419083 0.6 + 0 transcript_id "g615.t1"; gene_id "g615"; 4 AUGUSTUS stop_codon 2419081 2419083 . + 0 transcript_id "g615.t1"; gene_id "g615"; # protein sequence = [MAIRGIVHENIQYTNDLSRSTQVAAGNPLSLDQSSVPLVGHAFEARIYAENPRNNFLPDSGQLLYLSTPTPTLTLPQS # YKPSPTLISSNVESVAPTLVSYESVAPSVRLEQGFAQGSQIGVYYDPMIAKLIVHGKDRSEALRMLRKALDEYHVVGVSTDVEFLRTLAGNQAFIDAE # LETGFIPQTSTAQSPWTSLVSRRFGGDVYERVIHLQDDTSTGEAQPMAVRIKSLVGGLFDVEVETSGTPVKFYDVSAKLISPTSLSITLNDKLSTITI # VSQPPPPSIPASLSHNTMERLHVFSAERKTTLVIPTPKWLLMQGGDVLSAATGTGALKAPMPSLVVEVRVKVGDRVEKGQGVIVLESMKTETVLRAGI # SGIVKVIGCKNGEMVQEGKELVNIEADEETKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g615 ### # start gene g616 4 AUGUSTUS gene 2419245 2420019 0.27 + . g616 4 AUGUSTUS transcript 2419245 2420019 0.27 + . g616.t1 4 AUGUSTUS start_codon 2419245 2419247 . + 0 transcript_id "g616.t1"; gene_id "g616"; 4 AUGUSTUS CDS 2419245 2419524 0.64 + 0 transcript_id "g616.t1"; gene_id "g616"; 4 AUGUSTUS CDS 2419580 2420019 0.27 + 2 transcript_id "g616.t1"; gene_id "g616"; 4 AUGUSTUS stop_codon 2420017 2420019 . + 0 transcript_id "g616.t1"; gene_id "g616"; # protein sequence = [MSEGTVVAESSSRGRGRGRGKSRGGLGKYLRARGRGRGIGRPAEFSKRLVLEGEEGEEENEEEAAARQAKYSRRNLGT # NADRYAEQEPELDSDGEPIVEPEVDLSVFLEKQRLTDARGPATHLPPEDDDDVDHSLDTLTSSKTPNLKGKAQQIQWDDSLEDLLHEKAAAEATRGTV # DLFLLHFCPSVTYMSYLELKNRFRAKSEKLRTSGRTTTTNSRKKGGSLLNREIYNTIWTRCVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g616 ### # start gene g617 4 AUGUSTUS gene 2420921 2423269 0.71 + . g617 4 AUGUSTUS transcript 2420921 2423269 0.71 + . g617.t1 4 AUGUSTUS start_codon 2420921 2420923 . + 0 transcript_id "g617.t1"; gene_id "g617"; 4 AUGUSTUS CDS 2420921 2422847 0.91 + 0 transcript_id "g617.t1"; gene_id "g617"; 4 AUGUSTUS CDS 2422947 2423269 0.71 + 2 transcript_id "g617.t1"; gene_id "g617"; 4 AUGUSTUS stop_codon 2423267 2423269 . + 0 transcript_id "g617.t1"; gene_id "g617"; # protein sequence = [MTRFLPLLDVPQGDLFNALSRIGPVLLSNPSLPLPPNSYVLLNEDTSNELDHIIPWLDEGAEKVVLPLSSAKEVIGLI # PQERLVLLLDAVSVSAVSDKVRNAVSGVLLKTPEIDLDLISSVSNFFSKSAIFVLVDSPDLPSIYNIRSLLQAGANLVLPSSQLTLDISSSTHLNVGD # VFLAPINSDRADGLFPTIVSTETGHSLGLVYSSIESLRESIITGKGVYQSRKHGLWRKGETSGSTQEVVSIRLDCDSDSLEFRVIQHGSGFCHLGRQS # CFGEASGLPLLESTLRSRFESAPAGSYTKRLFNDPDLLRSKIMEEADELCRADTEYEVAFEAADLIYFALTKCTAHGVSIADIERSLDKKAKRVTRRA # GNAKPQWSTPKPASAPTPATYMPPADDPNAPIRMRTAVLAGISEEERALLLRRPVLKSDEMIEKVKPIVSEIRARGDAALLEFTAKFDKAELLSTCMF # PPYSKESMKISPNVKDAIDKAYSNIRKFHAAQVDGSTLKVETMPGVVCSRFARAISRVGLYIPGGTAILPSTALMLGIPAQVAGCKEIVFATPPRPDG # SISPEVMYVAHLIGASAILKAGGAQAVAAMAYGTETVPKVDKIFGPGNQWVTAAKMLVQNDTDALVSIDMPAGPTADLLSQAEHGIDSQVVLVAVNLS # TEHLEQIENEVDKQARALSRVDIVRQSVAKSLIVQTTSVEEAIEYSNDYAPEHLILHLENAPDKVQLITNAGSVFVGPFTPER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g617 ### # start gene g618 4 AUGUSTUS gene 2426501 2427397 0.64 + . g618 4 AUGUSTUS transcript 2426501 2427397 0.64 + . g618.t1 4 AUGUSTUS start_codon 2426501 2426503 . + 0 transcript_id "g618.t1"; gene_id "g618"; 4 AUGUSTUS CDS 2426501 2426683 0.89 + 0 transcript_id "g618.t1"; gene_id "g618"; 4 AUGUSTUS CDS 2426811 2427135 0.69 + 0 transcript_id "g618.t1"; gene_id "g618"; 4 AUGUSTUS CDS 2427300 2427397 0.71 + 2 transcript_id "g618.t1"; gene_id "g618"; 4 AUGUSTUS stop_codon 2427395 2427397 . + 0 transcript_id "g618.t1"; gene_id "g618"; # protein sequence = [MQTAIRDQGAAKAMGAGHQAFIELHAKGSLLKPEDPGHVIAGLSVQCPKELSGQFVNWNDDHMVVLDSPDFKNDYSLR # PGLIKKSKLAPAHEAPYITLGNNMPKGHIDVHHHFFPTELAKIKEINFAEIGFQSPKENFPWTPEVSLKFMDQTGIDTAILSLPALGSGTVSALIEIK # YALDVLQADGVAISSSYGEGSEASK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g618 ### # start gene g619 4 AUGUSTUS gene 2431807 2432090 0.43 + . g619 4 AUGUSTUS transcript 2431807 2432090 0.43 + . g619.t1 4 AUGUSTUS start_codon 2431807 2431809 . + 0 transcript_id "g619.t1"; gene_id "g619"; 4 AUGUSTUS CDS 2431807 2431874 0.43 + 0 transcript_id "g619.t1"; gene_id "g619"; 4 AUGUSTUS CDS 2431955 2432090 0.67 + 1 transcript_id "g619.t1"; gene_id "g619"; 4 AUGUSTUS stop_codon 2432088 2432090 . + 0 transcript_id "g619.t1"; gene_id "g619"; # protein sequence = [MGTNRANPAAMILSATMMLRHLGIATATFDVINSGKVRTADMGGAPYYVLFTSCFHSMHAHRIIYHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g619 ### # start gene g620 4 AUGUSTUS gene 2432257 2432676 0.5 - . g620 4 AUGUSTUS transcript 2432257 2432676 0.5 - . g620.t1 4 AUGUSTUS stop_codon 2432257 2432259 . - 0 transcript_id "g620.t1"; gene_id "g620"; 4 AUGUSTUS CDS 2432257 2432676 0.5 - 0 transcript_id "g620.t1"; gene_id "g620"; 4 AUGUSTUS start_codon 2432674 2432676 . - 0 transcript_id "g620.t1"; gene_id "g620"; # protein sequence = [MPFIMGALRLLVNSFAPQEINAKAWGLYTQFRPAGEGWGERSEVRCTTILALRKLPSSDGANEEQINPGAESEVVDLV # KYQRYGEEANFTAEDRGSKRVKRGMTLEEYEAMLDEDHSFDNIDLDNLESIQTQSTKPALE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g620 ### # start gene g621 4 AUGUSTUS gene 2434861 2436138 0.53 - . g621 4 AUGUSTUS transcript 2434861 2436138 0.53 - . g621.t1 4 AUGUSTUS stop_codon 2434861 2434863 . - 0 transcript_id "g621.t1"; gene_id "g621"; 4 AUGUSTUS CDS 2434861 2435227 0.99 - 1 transcript_id "g621.t1"; gene_id "g621"; 4 AUGUSTUS CDS 2435624 2436138 0.54 - 0 transcript_id "g621.t1"; gene_id "g621"; 4 AUGUSTUS start_codon 2436136 2436138 . - 0 transcript_id "g621.t1"; gene_id "g621"; # protein sequence = [MPAQWEFQVGPCEGISMGDHLWMARYLLVRIAEQWGIKVSFHPKPLQGDWNGAGCHTNYSTKSMREPGGMKYIEAAIE # KLSKRHDEHIAVYGEDNDLRLTGRHETGHIGSFSSGVANRGASIRVPRHVAAQGYGYMEDRRPASNIGMIITSVPVLTVDISVSQTHIVSLASCFYIK # GQPGEDAVLCTQDKTYTIRSVSLSNSILVVTSPPDSDISFDGGDNGLPNIVIRDQLSQILELTQTVPKLHKLNTLLKGKEYGEDEEDNEDGMNVELAI # DHSQNMEVWIFMGKMKSRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g621 ### # start gene g622 4 AUGUSTUS gene 2437483 2437938 0.81 + . g622 4 AUGUSTUS transcript 2437483 2437938 0.81 + . g622.t1 4 AUGUSTUS start_codon 2437483 2437485 . + 0 transcript_id "g622.t1"; gene_id "g622"; 4 AUGUSTUS CDS 2437483 2437938 0.81 + 0 transcript_id "g622.t1"; gene_id "g622"; 4 AUGUSTUS stop_codon 2437936 2437938 . + 0 transcript_id "g622.t1"; gene_id "g622"; # protein sequence = [MDTSTPFLRCSGCQILNDDSIEYNITFVPRASPNTGIAAPGLETALTSYPRSLPIKPLTDVCFSGTTWYNDRGPESGV # SEGARAEFFRNSRKSGVSRPPAIVETTLAIPDGVSRPEGVWTPSTGATDTSSSSSSDSSSDSSSDSSMNECND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g622 ### # start gene g623 4 AUGUSTUS gene 2438491 2439434 0.79 - . g623 4 AUGUSTUS transcript 2438491 2439434 0.79 - . g623.t1 4 AUGUSTUS stop_codon 2438491 2438493 . - 0 transcript_id "g623.t1"; gene_id "g623"; 4 AUGUSTUS CDS 2438491 2439015 0.84 - 0 transcript_id "g623.t1"; gene_id "g623"; 4 AUGUSTUS CDS 2439108 2439434 0.82 - 0 transcript_id "g623.t1"; gene_id "g623"; 4 AUGUSTUS start_codon 2439432 2439434 . - 0 transcript_id "g623.t1"; gene_id "g623"; # protein sequence = [MVAQTTISPAQVNGITNGHTLKGKAVKSKNQLRRLKQKQKKASQVCHHFRLNIIFSNLLSFQPSANGNETDTEDGGKS # EIEESLSSDSNVEYVPEQLDVQGSALEAFSDQNEDQAPSKGEVIYSDDDMASDDEASDSEKKPLSKKKQRKMARLTVSELKQLVKKPEVVEWTDVTAA # DPRLLLHLKSYRNTVPIPIHWSAKRDYLQGKRGIEKPPFQLPAYIADTGIATMRDAVKEKEANMSLKAKTRERVQPKMGKIDIDYQKLHDAFFKFQTK # PPVTGFGEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g623 ### # start gene g624 4 AUGUSTUS gene 2440592 2442983 0.36 + . g624 4 AUGUSTUS transcript 2440592 2442983 0.36 + . g624.t1 4 AUGUSTUS start_codon 2440592 2440594 . + 0 transcript_id "g624.t1"; gene_id "g624"; 4 AUGUSTUS CDS 2440592 2441178 0.56 + 0 transcript_id "g624.t1"; gene_id "g624"; 4 AUGUSTUS CDS 2441339 2441765 0.59 + 1 transcript_id "g624.t1"; gene_id "g624"; 4 AUGUSTUS CDS 2441817 2442983 0.99 + 0 transcript_id "g624.t1"; gene_id "g624"; 4 AUGUSTUS stop_codon 2442981 2442983 . + 0 transcript_id "g624.t1"; gene_id "g624"; # protein sequence = [MAQSSLTYPNQSIHRGFLRRRKSNVVSTQTAIIIDKHELHSTWPVYCQPETRQITHEGVTLTVERNHTCYGPGDRISV # MATLKSDSLHTILLRGFELTLKESTIFRAGPYTSGKKSVPQVRVAVVAETRLPVNFSLYGGMVQKAELTCAVSPNHTTTTLNTARHIDITYVLSVKAL # LGTGQPLVMDLPVILSNWQSQVNTRPPMTIERPTTSSRGPPASISNTTGGTADMSSRPDELGYNTNGPKSTMSTVTSFDDFNKPTTAVRPNSSGTGAS # ASTGNQFVGNTLNQQIRKPTTPAPSAVTATSKWLSAEEEKKTLYERAKAKVEETQAGAMAQNNSSAITPPVSAPSAAAKNAGWLSAEEEKTRLFHKAQ # EAARKAQGLDAYSASPPPQDNPPAVTSSAAGGPQYLSAEEEKAALRRYEDAKRAVQRTQLGGTDDVGSSSSSSAYVPPPVTNDLPPSFEASVPVVDAR # TQLAEKERLRREYEARDAAAVAQRPSVDNVPAYSEDNSGSQPLTGTIIRSAIAEKEMLRRKFEMQDAQAAGSPSQPPRQASPVQSKSRPTPAPPSSTV # RVPTAAEEKAMLRARFEAEDSAPSHSTPPITPPPQINGYNYVNGYTNGTRAGPSTPSLPTFTPPPAPPPLAPKPPASYIQETQEEDARVSRYVNSAAP # IPGLDSYSISNGSLSRNTSANAANGLDMHPFTPFSSGFDGGLNPKHIGLTPPLPQSNKRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g624 ### # start gene g625 4 AUGUSTUS gene 2443900 2445633 0.73 - . g625 4 AUGUSTUS transcript 2443900 2445633 0.73 - . g625.t1 4 AUGUSTUS stop_codon 2443900 2443902 . - 0 transcript_id "g625.t1"; gene_id "g625"; 4 AUGUSTUS CDS 2443900 2444963 0.92 - 2 transcript_id "g625.t1"; gene_id "g625"; 4 AUGUSTUS CDS 2445018 2445633 0.73 - 0 transcript_id "g625.t1"; gene_id "g625"; 4 AUGUSTUS start_codon 2445631 2445633 . - 0 transcript_id "g625.t1"; gene_id "g625"; # protein sequence = [MYGFHKIPHLQQGALRSSSEAEYSQFAHPDFHRGQEDRLILIERKKQTTMHPKEQGVVDFPSVAPQAVPQPQTTDHST # DQALDIHAIINGIAAIRRHQVNLSSELNELKSSNQLLWQESMEARSRHQKQQDTLNSIIKFLAGVFGHQAANSGAKEKERGGPSSHSVVRGSRLMIED # KKRDLATRVGIVEVQDEEAGSPASRAESPGPSFSIETAGSTSHMTSPYPSPATEISSLSAAATPRFDLTYPPSEDQSTPLANSSTPSTSSQTGNNTVI # STQPKYPGTSIIQQDENMPTFSPSRSPALDDRIQTALSYLTPADLQQLFTALNNQPGIINDSLNIDSLQQGTQHQNQLPISPPPSQSLSTFNFGSLSP # QLPSQSAPGLTDTNGLISFTDVPYLEQWKQASDIEQEVEHINSGIDLLIHDLGIDPVVVADAETNQAKGRELDTSILDTSSLPSLPDSVSNDELFDSF # LNTFPSPALDNNLTGTGGATMEMSFPVVPPGSPSATATTSLQTVPPAERVKVSDGPGANTRAQKRKSDVSGEVMTKMPSNPKTKKRKDK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g625 ### # start gene g626 4 AUGUSTUS gene 2447506 2448162 0.62 - . g626 4 AUGUSTUS transcript 2447506 2448162 0.62 - . g626.t1 4 AUGUSTUS stop_codon 2447506 2447508 . - 0 transcript_id "g626.t1"; gene_id "g626"; 4 AUGUSTUS CDS 2447506 2448162 0.62 - 0 transcript_id "g626.t1"; gene_id "g626"; 4 AUGUSTUS start_codon 2448160 2448162 . - 0 transcript_id "g626.t1"; gene_id "g626"; # protein sequence = [MSWKESETKGKGKKAVTTARMDNIIVERPSHLRPFIMDQLQMHAKAKGEKEKIDADTKYDSHTIYLDEQLAAPWKEQQ # ELAKRAQKIGCNFMAEDLTKIENHVHRMWETHRTEVMNSQRVGSFTDLAIETRQDILRKLSRQFASGPNEEAMFLSHDQILRLKASYAYIYDFEKSSR # KWTRFPWNVTMRQLTEIKAKATGRSTTVTAEFYERLAMKKYC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g626 ### # start gene g627 4 AUGUSTUS gene 2448943 2449629 0.68 - . g627 4 AUGUSTUS transcript 2448943 2449629 0.68 - . g627.t1 4 AUGUSTUS stop_codon 2448943 2448945 . - 0 transcript_id "g627.t1"; gene_id "g627"; 4 AUGUSTUS CDS 2448943 2449629 0.68 - 0 transcript_id "g627.t1"; gene_id "g627"; 4 AUGUSTUS start_codon 2449627 2449629 . - 0 transcript_id "g627.t1"; gene_id "g627"; # protein sequence = [MLLLHPSDDSGEPRVFIRPSMNKITYPDQGLDRAQRIIDVLRTCHPRFRCKLSSETIINLAENGVPRHVFTSLLDQTL # DLLVTSLTTWDTIEDMANLWLTLSHLGGVFAARSTRRKSGMARVNGYSERDAQENDDEDGLDEADDEPSSTAWWNDEISGQPSSLEETVMRLIDGGFT # PQACPVMRDKLKRILISQINNHVTNFRIEVPMSFTAFILPGLFFPYFLSIGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g627 ### # start gene g628 4 AUGUSTUS gene 2454256 2456714 0.28 - . g628 4 AUGUSTUS transcript 2454256 2456714 0.28 - . g628.t1 4 AUGUSTUS stop_codon 2454256 2454258 . - 0 transcript_id "g628.t1"; gene_id "g628"; 4 AUGUSTUS CDS 2454256 2455483 0.52 - 1 transcript_id "g628.t1"; gene_id "g628"; 4 AUGUSTUS CDS 2455609 2456714 0.35 - 0 transcript_id "g628.t1"; gene_id "g628"; 4 AUGUSTUS start_codon 2456712 2456714 . - 0 transcript_id "g628.t1"; gene_id "g628"; # protein sequence = [MRRFASVFISSKREKNEKTSKRSTLNVRTQPAPSDITTFDSSLSTPQLSAGGSEPAHSSASSAGSVNLQTPEDIPISL # VNSKKTWIPWRAKKSGTIKANGRHESNWTPLPPPLLHTPPPGTRAPIVTHNDPNSDSESDAYGEEDDPRPIKPVLAKPIITPASQSKAQAVLQALIQN # SLISRPSSAPFVVQPGAPPYPRSSNRSRSVPSTNSLARTVLKRRMLQRLQDANPSSSEAKEIIAFSTRDTPRLEAPIDIDMIDENALSTFDHTASFSI # GLRSWINRPPFEDRFSVWSVVDGNITCQRVSNTPGFALAALEFSEAIEAEADVFGDIPPFQSSAESHLNVRSAAISDAPSSSSSASSHISCECGPTSS # SDGPQKEPLIQVLSATLPASKNTTSASPASLTEMTETSSPASNHNAIKRGVRFVEEEKDENIPIGYVMRHKKQREEKARFLREQKEKREFEEERARVE # EERKKRDAERRKWEQERLVWEREKRLKDEERKRKQYAEEVTAARQRAESSRMGMRSSSSASLREPERNLLASKRSSRGSEGPPTPRRQASESFSRDQS # PVNSRPPSIASGAGYFPMNSGPSSIHSSEDVRSIRPQSTAFYIPPVPPIPQFNPYQSAFPLDMPLLPPAAPFMVNQYSRRQSHSSQSSSRQRVPSNSS # TESLNRHSVHNREGSSPRESSNSSSSSPHRTHQRRTSDDSTRRVSTYSTSPHSLSSNHLPRGRLPNLAHTQQTLPSPWTAPPTLHGGPPSAYGGVNTV # TRHTPSRRQTTFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g628 ### # start gene g629 4 AUGUSTUS gene 2457425 2458797 0.81 - . g629 4 AUGUSTUS transcript 2457425 2458797 0.81 - . g629.t1 4 AUGUSTUS stop_codon 2457425 2457427 . - 0 transcript_id "g629.t1"; gene_id "g629"; 4 AUGUSTUS CDS 2457425 2457813 0.94 - 2 transcript_id "g629.t1"; gene_id "g629"; 4 AUGUSTUS CDS 2458320 2458797 0.81 - 0 transcript_id "g629.t1"; gene_id "g629"; 4 AUGUSTUS start_codon 2458795 2458797 . - 0 transcript_id "g629.t1"; gene_id "g629"; # protein sequence = [MVCKDLWALHLSLLQDPPPSEPFFDARPTRSFTPNLAKGKVQPDHQPSNIRSKTKSRLHSTETRPSSPLPSDSPSSSS # SEHDVPGDAKDSDDDDDQDSGVGGVGKKRSEEQEDSEDSEMAELMRENSESEDDDDSELNDADSKGQRRGEAGEKRRKRGHTTLYAMTKSLSHRLSLP # MVLHQSLAPRMQNLQARDPQTHNLDNAPVEASLLATVIVVLKMVYGLDGKRRQAISNSVVAGADFFFRSRSPKDSNDPAFALPCIEDYLALVRHMGDV # DPRKEAIFNSEKPM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g629 ### # start gene g630 4 AUGUSTUS gene 2464602 2465123 0.64 + . g630 4 AUGUSTUS transcript 2464602 2465123 0.64 + . g630.t1 4 AUGUSTUS start_codon 2464602 2464604 . + 0 transcript_id "g630.t1"; gene_id "g630"; 4 AUGUSTUS CDS 2464602 2465123 0.64 + 0 transcript_id "g630.t1"; gene_id "g630"; 4 AUGUSTUS stop_codon 2465121 2465123 . + 0 transcript_id "g630.t1"; gene_id "g630"; # protein sequence = [MNGVQPFVYISTCGCVFSQAGLKTVVSASSSPKEKNKVLAQGEPTSHEQELELCPQCATKFSRLDDIVVLNPLPEEEE # HMREKMEQQRLKEPTRKSKKRKNASSVDDSEAPANKKKVVTPMQPSIAAVSRAALAMEEAKRKATMSEAVKSLYGDGKPARNETFMTRGTFTRYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g630 ### # start gene g631 4 AUGUSTUS gene 2469163 2469933 1 + . g631 4 AUGUSTUS transcript 2469163 2469933 1 + . g631.t1 4 AUGUSTUS start_codon 2469163 2469165 . + 0 transcript_id "g631.t1"; gene_id "g631"; 4 AUGUSTUS CDS 2469163 2469933 1 + 0 transcript_id "g631.t1"; gene_id "g631"; 4 AUGUSTUS stop_codon 2469931 2469933 . + 0 transcript_id "g631.t1"; gene_id "g631"; # protein sequence = [MARSKELVPGVGRFSRSQVAAKRGLYKGLKKSEKPAVEPTPETVEKTIGGNNNGEKRIVPTSKAPRFYSAEDVRQPKK # SRKTAKPPQLRSSITPGTVLILLAGRFRGKRVVFLKQLESGLLLVSGPYKVNGVPLRRVNQAYVIATSTKVELEGIKVRLYVIQCLRLSLIILYQLSE # ELNDAYFAKPSSKGAKSAEEEFFEEGKPKEKEAFPASKAALQKEVDSTLITAIKKTENLVKYLRSTWGLSKGQYPHQMAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g631 ### # start gene g632 4 AUGUSTUS gene 2481173 2484250 0.99 + . g632 4 AUGUSTUS transcript 2481173 2484250 0.99 + . g632.t1 4 AUGUSTUS start_codon 2481173 2481175 . + 0 transcript_id "g632.t1"; gene_id "g632"; 4 AUGUSTUS CDS 2481173 2484250 0.99 + 0 transcript_id "g632.t1"; gene_id "g632"; 4 AUGUSTUS stop_codon 2484248 2484250 . + 0 transcript_id "g632.t1"; gene_id "g632"; # protein sequence = [MSFVSLSTSPDANLDSYRLIVEDINVNVGLSNFDRNLLHRKLAGRNDPKEAFDSDIYSLDMNVNGIQLTRTSGRDKLR # LVNVGPLGLNIVTTQWPSPLLVTSPFLGGDPNAPTVLFKLGVDSVSVTDRLDSLLELVEQIPHNEKSIPPAQPSFSLIPVPRIEIEVSCGPIQTQLLV # GSPESPHTIEMRTDGFLLLINSHFDNRYPLVASTLAEFDKLLLRMVFELSFIWKPTFIRIRSRQSKRASVVSDFAEDPALVSLDAIEAVGKGDILAEI # RDDTQNTPSIDLSTLVSDISFSSDALCLELWHPEVLDALVELLEVLPSAVKEGNSHKSLQARLPLGCSATVSLSRFVIFVTASELNPNDNLELSRGFA # LRVTGLSAQYCALHYTHLQRYKEPINLSSSRIKLFLPKERSVAAWEEAKRSASISTFMSLSFLRLSLRSAISTQYSTDDPFIAERDNPAFENRDCLQM # HGFLTDARLHGQGGKEVLDIMMRVPYVQAMVQVADVYSVMLAARTLKTLSTTRPRASASENTRHVSGSILLSLQVTATVDNLQAHFVLRNSKIFCRLD # SLSTHLTSDGPLTVGWDKLVLWTRVPAAVNRWQQRIGQKWEEFLTLQKWNVCLKQQPAVGNSVSVEGVAARVRIPFGFILADLVLDVSVVIKALRHLH # LITTSNLFSPFPKPEAEAPKAVPNLSVQVGYLSLEAADDPLETKLGRIFKIGLDAVKNRMDREDAFAVKVNNILATQGAQTPERDADWEFSTHHSVSI # QDARDRLDQVHVLDWVMRLERLKNEQKEVQAELFRQLHPSPTSRGINIPTIIPCTPVKEDPPLIRTTITNLSMIISRPTFPPECTPDFLFEQGQLPKD # TQYSLLIPLHLHYSVSSFQVTLRDYPLAMVDIPAHPDPTLAALEFDTDLVIAEEMGTDLSIDWVECPIILPETEYLDVEPFYLMVPKTIMPVKTYANP # EVKVTTADPTTFCWGVSYGPATQDLMRIVDTLSSSPRDPSPPLGFWDKVYDLAALFMNSLTLRGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g632 ### # start gene g633 4 AUGUSTUS gene 2486100 2486758 0.73 + . g633 4 AUGUSTUS transcript 2486100 2486758 0.73 + . g633.t1 4 AUGUSTUS start_codon 2486100 2486102 . + 0 transcript_id "g633.t1"; gene_id "g633"; 4 AUGUSTUS CDS 2486100 2486117 0.79 + 0 transcript_id "g633.t1"; gene_id "g633"; 4 AUGUSTUS CDS 2486198 2486238 0.95 + 0 transcript_id "g633.t1"; gene_id "g633"; 4 AUGUSTUS CDS 2486323 2486758 0.97 + 1 transcript_id "g633.t1"; gene_id "g633"; 4 AUGUSTUS stop_codon 2486756 2486758 . + 0 transcript_id "g633.t1"; gene_id "g633"; # protein sequence = [MYFRYIAADNDAVLPLFARSAVKFIRDQAEAILATEATIDSDEQKTQNPAHVAASAIRKIVGDAFKSGSDNSKVHVTK # AETSAHFNPMDGWSESVSLRKSHCCLLLKPQIVLRNRGEVDETCVVAALQAKLQSFAIMDDANADDPVTGKIMTRLEDMWSPMLFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g633 ### # start gene g634 4 AUGUSTUS gene 2488597 2489088 0.41 + . g634 4 AUGUSTUS transcript 2488597 2489088 0.41 + . g634.t1 4 AUGUSTUS start_codon 2488597 2488599 . + 0 transcript_id "g634.t1"; gene_id "g634"; 4 AUGUSTUS CDS 2488597 2489088 0.41 + 0 transcript_id "g634.t1"; gene_id "g634"; 4 AUGUSTUS stop_codon 2489086 2489088 . + 0 transcript_id "g634.t1"; gene_id "g634"; # protein sequence = [MSWKGWVKMAFQQPLVPVLPVARELISKTKWIASKSTAAVIEHTSPPKSTQHKAIANVSHANNGTEEEKGHETLPSLP # SFLDAPPPPPPRHWKKTSHRKVEAATILGAGPLTVDPEPIDDEEFGAANVSRPPGRKRVLSLFSRSSSKSGKIETAINGVCHFKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g634 ### # start gene g635 4 AUGUSTUS gene 2491081 2491446 0.7 + . g635 4 AUGUSTUS transcript 2491081 2491446 0.7 + . g635.t1 4 AUGUSTUS start_codon 2491081 2491083 . + 0 transcript_id "g635.t1"; gene_id "g635"; 4 AUGUSTUS CDS 2491081 2491446 0.7 + 0 transcript_id "g635.t1"; gene_id "g635"; 4 AUGUSTUS stop_codon 2491444 2491446 . + 0 transcript_id "g635.t1"; gene_id "g635"; # protein sequence = [MWGLNRFERPAWSTGILIPLGFLCGIGSAVVIALGSAKTKRTAEVEQRLKDALALYHGSEDHGSNTEIADTDVADNIP # RRSGSTSLRAIPEGSSHVGGQAMQEKSSIKEENGFVPQKELSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g635 ### # start gene g636 4 AUGUSTUS gene 2491839 2493338 1 - . g636 4 AUGUSTUS transcript 2491839 2493338 1 - . g636.t1 4 AUGUSTUS stop_codon 2491839 2491841 . - 0 transcript_id "g636.t1"; gene_id "g636"; 4 AUGUSTUS CDS 2491839 2493338 1 - 0 transcript_id "g636.t1"; gene_id "g636"; 4 AUGUSTUS start_codon 2493336 2493338 . - 0 transcript_id "g636.t1"; gene_id "g636"; # protein sequence = [MPRHVPVTDTFPDFAGHLLDNGRFKLIEPLGSGAYGKVYKAIDLTSPCENPIYFAVKCLLRPRFGSRHEDFQLREFTL # HRLVSSHPNIIGFHKVLYDQTYVYVVLDLCLGGDLFAAITERKALRQNNELIKSIFIQLLDAVHHCHENGVYHRDLKPENILCSKDGRRVYLADFGLS # TQNKVSEDFGCGSSYYMSPGHLHFTDSSAMYSRLSFSECIGKEFKHGRYSTRHSDIWSLGVILTNMIAGRNPWRYAMTTDDCFSAFLYNRDFLRTVLP # ISDQANLILKRIFHLNPLNRISIPDLRREILDVDTFFMSEDELHRSSDVVRTAAANYAAPPVTPLEDAHECPKTPIASEPVASKSLSSAPRDSEEVYL # YARPTEGLQPLPDHPHNSLLDVLAVGSSSTSTSEPESAGPITPESRPVNEPLVEVPELSSDVLGGGSNTITFNTVRATAKIELKSVQLPRHRAPSDTA # SRPPPRRVGKQLFRKAVQRLKALSESVSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g636 ### # start gene g637 4 AUGUSTUS gene 2496889 2497548 0.69 - . g637 4 AUGUSTUS transcript 2496889 2497548 0.69 - . g637.t1 4 AUGUSTUS stop_codon 2496889 2496891 . - 0 transcript_id "g637.t1"; gene_id "g637"; 4 AUGUSTUS CDS 2496889 2497548 0.69 - 0 transcript_id "g637.t1"; gene_id "g637"; 4 AUGUSTUS start_codon 2497546 2497548 . - 0 transcript_id "g637.t1"; gene_id "g637"; # protein sequence = [MVEAGVSQNDLQQILNQLRTLMRSNVQASALPPPPPTHTQQWSSTSYPTIPASMPLPPPATAPVTFNTTPVYPLANFK # SETYVSANPSSGIAPTPVPTIAAAGSSTQTPDFAGLLSSLMKAGVVTANSTPTGAGATTHDDSTADMLEAVNQSRETARAYRKSVLSHSVQLTAAAIT # KYVLFLPWSNNININHYLELGRPSTICSTNNLELNVNNAAFDF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g637 ### # start gene g638 4 AUGUSTUS gene 2501552 2503508 0.51 + . g638 4 AUGUSTUS transcript 2501552 2503508 0.51 + . g638.t1 4 AUGUSTUS start_codon 2501552 2501554 . + 0 transcript_id "g638.t1"; gene_id "g638"; 4 AUGUSTUS CDS 2501552 2502131 0.52 + 0 transcript_id "g638.t1"; gene_id "g638"; 4 AUGUSTUS CDS 2502256 2503508 0.97 + 2 transcript_id "g638.t1"; gene_id "g638"; 4 AUGUSTUS stop_codon 2503506 2503508 . + 0 transcript_id "g638.t1"; gene_id "g638"; # protein sequence = [MFLNKQDRPGASFKLSIRSLLTHRLHPHPMVLTLPIASFDPQDYMHAEPGIQGLVDLLKWEIWRWNEAGESTCYPLPT # DVQALEELEFIPSHHPIIPQLAPARTQLLENLSMFSEDLMETLLALPSEPSSYLGIKYSDIIPHLRKSTLENKILPVVCGSAIKHIGTSIAMDYVGEL # FASPLDVPHDSAKNAPLRKLTRQSAVLNATRNQKEKVSKLLLMYASEPVEVDELPFGAVGVVLGLKFTRTGDTLVSPGAPPSARSVMQDIVPPKAVIS # ASVIPHSHSDLEPVQNALESLSRTDPSVRYDLQEGQILVHGLGALHLEIVEGRLRSEFQANFELGKRRVSYRESLGPNYDPPHYEKPLITNNDKADIA # GTSVVVALDIRPLQDDEEGSPLWDGNLVLNKAGVAIPSPESSSTANPELLIASGIATALSSSPHSSLPMSHLRIQIREWSTPSPLSLLTGASAIIMRN # RIRKAGMGSLMEPYSFFKVAATEDTLGKVVKDLTEHGAELQDLGDGISDGMDEVVGYPVEGNYIPPDMLSPSSSNLTGSGASPKLRRFVHALAPLSQM # LDYNSRLRALSGGHGQFDMVNAGFRVVAEPRKMEILREIGRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g638 ### # start gene g639 4 AUGUSTUS gene 2503552 2504349 0.53 - . g639 4 AUGUSTUS transcript 2503552 2504349 0.53 - . g639.t1 4 AUGUSTUS stop_codon 2503552 2503554 . - 0 transcript_id "g639.t1"; gene_id "g639"; 4 AUGUSTUS CDS 2503552 2504349 0.53 - 0 transcript_id "g639.t1"; gene_id "g639"; 4 AUGUSTUS start_codon 2504347 2504349 . - 0 transcript_id "g639.t1"; gene_id "g639"; # protein sequence = [MKRKSKTGGVSQILRKKQKTKGKSRAIDDSESEEPLSEEYAEVNNTSGATPGIRLRQTAALDLDGDSHMREGDDENDD # DDDNDDDDYIPKPRKNEKARAKTIHFSLEIEDDEEEKPKPLLHLKYQGFKILGSCLCIVVEPWPPLHASSRAPSILRSTPRAPSIAPRDFVTANEARA # RSKTPLFLPDPDERDRSATPFPDAIHVRPFPLYDNEGVDEDMDDADYGGMMEFSQILNAAGDVRAGALDDDEDMEGAVFFGDADEIREL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g639 ### # start gene g640 4 AUGUSTUS gene 2506256 2507131 0.45 + . g640 4 AUGUSTUS transcript 2506256 2507131 0.45 + . g640.t1 4 AUGUSTUS start_codon 2506256 2506258 . + 0 transcript_id "g640.t1"; gene_id "g640"; 4 AUGUSTUS CDS 2506256 2506627 0.45 + 0 transcript_id "g640.t1"; gene_id "g640"; 4 AUGUSTUS CDS 2506703 2507131 0.97 + 0 transcript_id "g640.t1"; gene_id "g640"; 4 AUGUSTUS stop_codon 2507129 2507131 . + 0 transcript_id "g640.t1"; gene_id "g640"; # protein sequence = [MVLPDGTTKISPDLSERTMLAHASYINSCTGLSLKSDQVANLLSKMSLFPNVSTTNADEIEVSMPPTRPDIFHECDIM # EDAAIAYGFNNLPHTFPPTTTVGQPSTINKLSDIVRLEWALAGWVECSHEENFAFLNHEDDNNTAVKIANPKTLEFQVVRTTLIPGLLKTIRENRSHS # LPLKIFETGDVVFKDIKRERQSRNERHAAAVWCNKTAGFEIVHGVFDRAMKMLEIPRISSSDSNAETGYYMKETSGTLLPVSKYPIFFSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g640 ### # start gene g641 4 AUGUSTUS gene 2507446 2509428 0.3 - . g641 4 AUGUSTUS transcript 2507446 2509428 0.3 - . g641.t1 4 AUGUSTUS stop_codon 2507446 2507448 . - 0 transcript_id "g641.t1"; gene_id "g641"; 4 AUGUSTUS CDS 2507446 2509428 0.3 - 0 transcript_id "g641.t1"; gene_id "g641"; 4 AUGUSTUS start_codon 2509426 2509428 . - 0 transcript_id "g641.t1"; gene_id "g641"; # protein sequence = [MNSPKCTPWSALHFSAHFDLASTCSEIIYQHQKRHKKFLRSLFLSKLRSRGSGSNKDYYLDIQDDYERTPLMIAASRG # NFDMVRMLLGHNVDVDARDLHARTPLSYAMGSRSKEVVELLLKQGVQDVNAKDIFGRTLLFDAVDSGSTDLVLLLLHYHDNVRLNAEDHSRRSALSHV # AQYGYSDVVKILLQDEGIDVNQRDGKGMVPLLYASMEGHALVTRILCDRKDISINASNDDGRCSLSLAAQRGYESVVKYLLASPEIDVNLADLKLRTA # LSFGAQHGRTEIVRALLSRKEVAVNRRDILGRSPLSYAADQTTKGEEVVSLLLAAGADEDSVDNFGLTPLKYALKRGNRGIVNILLSCPTLSLRTTAG # SRSILSYAAEYGWTDMIENMMEHPEIDLNEKDDQGMDVLAYATMKGHLEIVHLLLARYETDITSSDVHHKTPLHHAASFGSEPIVKLLISKLSSAYIN # QLDDLGRSPLSLASLNGHLDVVKTLLPLKDLHINSTDKSGLTPLFHAASSGHLEIVRLLLQQQDLEIWSLNYQGQSVLTEVAKQGHVDVLSLLLAHSG # ASRMVDLKDGNFRTPLSYAAQHGRTEVVRRLLECPEVDPQSKDCLNTVFEYAAEMKYRRDVGVGSYINVMTMVSSATNQGPKAMRFDVQTFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g641 ### # start gene g642 4 AUGUSTUS gene 2525603 2526967 0.62 - . g642 4 AUGUSTUS transcript 2525603 2526967 0.62 - . g642.t1 4 AUGUSTUS stop_codon 2525603 2525605 . - 0 transcript_id "g642.t1"; gene_id "g642"; 4 AUGUSTUS CDS 2525603 2526967 0.62 - 0 transcript_id "g642.t1"; gene_id "g642"; 4 AUGUSTUS start_codon 2526965 2526967 . - 0 transcript_id "g642.t1"; gene_id "g642"; # protein sequence = [MTERLHLQKDDRLPAELIDFILASDTVFLGTTYVALEKDAALFPSHLGMNQRGGRKGFIRVSLKDQRTLVLPDFSGNR # ILTSLGNIEASSLASFTFVDFESGSILYLTGEAKNLVGEDAQRIMPLHTQMALTTLFVTGYIFVLDALPVRQTVGTHAEQSPYSPPLRFLAEEAGGRV # ISSNPNQTVLLSRIDMHSSSIATFWFQSSVPLTINPGQAAILSFADLLGKPKYAHMAPSNPKSLNDDRVRTWTVSDSSTHEFALTMREIPGGVVTGAL # FNLARALAKSRPELLTNTSDLEIRLGLVGFSGSFCLPSPAKDSEVKLLWIAGGIGFTPFLRMLKVLKADNSGCRWDIHMVLSTRDPDVLLPLLMKAAD # STGEKVKFMLDLFTSRKVTAMAGSIDDVRIHSERVDSKYLRSTDLSRKIYLCGPKPFEQAVLGGLANSSVSAHQVTVEGFAY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g642 ### # start gene g643 4 AUGUSTUS gene 2528825 2529511 0.74 + . g643 4 AUGUSTUS transcript 2528825 2529511 0.74 + . g643.t1 4 AUGUSTUS start_codon 2528825 2528827 . + 0 transcript_id "g643.t1"; gene_id "g643"; 4 AUGUSTUS CDS 2528825 2529511 0.74 + 0 transcript_id "g643.t1"; gene_id "g643"; 4 AUGUSTUS stop_codon 2529509 2529511 . + 0 transcript_id "g643.t1"; gene_id "g643"; # protein sequence = [MNPHDHKNPRWSSRVLGTFLFGSQFEESIFQQWRPSYTEESIVIARSDDDMGMDMDVDTNDAQGSELYQSDARTLLHS # QVIDIFVALLRELVAADQRDLQTKAREGAAASIHAPSTLRSIHAPKRDVKVSDMAFEDILNYVAHPPGCRPINLREGNLSLTRFLSKPYQAYTGWRNG # NDWSRQDWLIALKKLKEIGEAWGKRGADIVNILKYDLLPHIQVVFCDDDIRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g643 ### # start gene g644 4 AUGUSTUS gene 2531142 2532092 1 - . g644 4 AUGUSTUS transcript 2531142 2532092 1 - . g644.t1 4 AUGUSTUS stop_codon 2531142 2531144 . - 0 transcript_id "g644.t1"; gene_id "g644"; 4 AUGUSTUS CDS 2531142 2532092 1 - 0 transcript_id "g644.t1"; gene_id "g644"; 4 AUGUSTUS start_codon 2532090 2532092 . - 0 transcript_id "g644.t1"; gene_id "g644"; # protein sequence = [MSQKKPNTGPIPSNPSDPGKVKVSPEDYSQGELAYEIVEHMYVQLQTEIDHRASLGIPYDPHLGAAFLAVSQTRADLR # ERIDDYKAYLEPDKVFDKVLENYPKDSMKKEGVWLGEGNDPFVNTAKGIFSDVNSFAQENFPAKEAAVTWLEDYRLQSGINEQLEKAGALNPAGNVGG # GQAPKIEELQNSRMRKDLEEERRAEERAERLWKAETGRLKDMNGKEIKPSEIDMTQAQRDRTRKRADKERKKLEDWEKHVKEEQLKPVQEKEEVEERE # RKKREFWDKFDKERVQKEKETEKRRKEQEKKYKPAGRVLRSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g644 ### # start gene g645 4 AUGUSTUS gene 2533121 2534400 0.5 - . g645 4 AUGUSTUS transcript 2533121 2534400 0.5 - . g645.t1 4 AUGUSTUS stop_codon 2533121 2533123 . - 0 transcript_id "g645.t1"; gene_id "g645"; 4 AUGUSTUS CDS 2533121 2534026 0.79 - 0 transcript_id "g645.t1"; gene_id "g645"; 4 AUGUSTUS CDS 2534104 2534400 0.53 - 0 transcript_id "g645.t1"; gene_id "g645"; 4 AUGUSTUS start_codon 2534398 2534400 . - 0 transcript_id "g645.t1"; gene_id "g645"; # protein sequence = [MKVPVDKKQASHYTAELEFDLGHPHLSFATAEIMTGCAATLRIPFAVKSSMQWYTKKGDMDGEPDVMTVENGVYELQV # TVPLKNVTGDVEPGDVDAKATVRTVSKLHTSYSTSAVRPQYIDSYVSFPSVLLHMLTYSACDQINISGKENKLDEPLSDAIDKVKAWFGDHNNLNQID # YRLATVKSIKVDADPNGLLQPKSFIFAASGEKDDGVLSIFIQTVGSGSPSGNLAATFTSTSATPIHPIPKDQDASIIISHETFSRGVYLKQLEAYRVD # RKLGDDKKAKEETVAKGFKYTFYLESDWDVQLNDVPQRSLFGTSSHFESFHVKLQESPCTMTIQDGQAKVQLAYSHDCDWYSIQHLNQYMGMGPSSKY # TYGTVRVAVNVDQVNGYLQSNDTLTDAM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g645 ### # start gene g646 4 AUGUSTUS gene 2535198 2537735 0.67 + . g646 4 AUGUSTUS transcript 2535198 2537735 0.67 + . g646.t1 4 AUGUSTUS start_codon 2535198 2535200 . + 0 transcript_id "g646.t1"; gene_id "g646"; 4 AUGUSTUS CDS 2535198 2536802 0.67 + 0 transcript_id "g646.t1"; gene_id "g646"; 4 AUGUSTUS CDS 2536872 2537735 0.75 + 0 transcript_id "g646.t1"; gene_id "g646"; 4 AUGUSTUS stop_codon 2537733 2537735 . + 0 transcript_id "g646.t1"; gene_id "g646"; # protein sequence = [MGGNGGQGASTADDKSGGKGGDGGAGGTIKAVIGGNGTIQFRLLESAMSLLDMDDGTSESVRCDLMLKIVDDFERASE # RYSEQHKITGTENALADISVAIAPLVKAVSEKADFKTQWKVFHRFASWLDNRADEVQTTVQSKTSWSGGQAGAGGQGKKGRGQNGVMGKTLETPQISF # LRFTPDMMRKIPIAIAHPDQCAMVLHQAKIDYFVNTTESNSKACLRLIRLRDRLSFLEDLKATDPIYVAYQEAEPRMHLVPSDSHSLGSAELSSITRL # RRVAAEVDVLLRQIDSGLDFFNHTPQWVPRASYTFYEDLTESLLDNFIRTEGAWHRYESAATAQDARLRSVQEMKDSCRIQIINLNERVRRLGIDLEK # AVNTIGDQDTLMRETKAALMEQINVNKEAIRTCKITGGVEFEDLVEAATTIAFCPNPGMISVQAVGLSYKDNKRAGIESDDGDHIKPELLLEKVVSVR # GGVEKLVQGYKLSKVESGTVDMDDPGATKLIMEKNEYMDIVGKFKKALGKANLKLVEDAFQAHIGSILDYNASVNILVKHKERVVALQEKSSDLSDAV # LAGTDPNLPGIAIMMQQLHAESLWALLEGLYMTQRALRFHSLAVDTELFPPTTSQNLSALDSATLGMVRTRLLRSYRNSIEETGRNPQQFVRIRYYLT # EADLKRWKRQITMKTIIDIPPVYHETPIGDHSLAGRSNIRLDTVRFFVEGLKTTYPTVTLTLTQLGTEIIVDHRNKQNEFQHEQVRLQFQYEAGTMSL # VESGTVDGNLSKNFNDPYAKIGPFASWMLEIDPRYNPGVNIKEATSAWFEFSGEFYTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g646 ### # start gene g647 4 AUGUSTUS gene 2539123 2540436 1 + . g647 4 AUGUSTUS transcript 2539123 2540436 1 + . g647.t1 4 AUGUSTUS start_codon 2539123 2539125 . + 0 transcript_id "g647.t1"; gene_id "g647"; 4 AUGUSTUS CDS 2539123 2540436 1 + 0 transcript_id "g647.t1"; gene_id "g647"; 4 AUGUSTUS stop_codon 2540434 2540436 . + 0 transcript_id "g647.t1"; gene_id "g647"; # protein sequence = [MCIAPLVCLDFHLTLRNISEYLLWTDDSSREFIAENYPWFLDTFNDYKYAIQRADAIRYFVLHHYGGVYLDLDVGCLR # PLDPLLVYPVILPKTIPVGVSNDLMFAEKGHPFLAQTIHNLVTFDHNWILNYPTVMFSTGPMFLSAQYGIYTSSHAGAQGDPVRILPKSLYGKNAKEG # EAPDSFFSHFYGSSWHADDAAFIGFLGHWGKVLLWVGLIVLIGGLAIMVIPGKQRRYTLRRIGGYDVLFPRWSSRTGQWHFHLPRSEASSQSDSNPTS # PTYTDGYDDERLPFEMRPVSPASTESSFAGDQLAGRPSPLAETFRRVRNRVAAFTHTIPDEVPRTPHRPGRHRFSRGYLFFLPAIFTTQPTDIEAGSE # PPVPLLSRPIARSDRPPRYMDLNDGAKNQPAEAEAQLIDLGAGTEHSSSSFSRRPSSASASSSSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g647 ### # start gene g648 4 AUGUSTUS gene 2542825 2543154 0.82 - . g648 4 AUGUSTUS transcript 2542825 2543154 0.82 - . g648.t1 4 AUGUSTUS stop_codon 2542825 2542827 . - 0 transcript_id "g648.t1"; gene_id "g648"; 4 AUGUSTUS CDS 2542825 2543154 0.82 - 0 transcript_id "g648.t1"; gene_id "g648"; 4 AUGUSTUS start_codon 2543152 2543154 . - 0 transcript_id "g648.t1"; gene_id "g648"; # protein sequence = [MTWSVMRYTDPDVPLAQADEDKLLGFDPPVIDEQGKFMALQINLTLGTASYATMALREITKTETSSHYQTSLTNAAED # QKYRGVADGDIEMDQGTAVVGDAEDAAVETV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g648 ### # start gene g649 4 AUGUSTUS gene 2544777 2546358 0.84 - . g649 4 AUGUSTUS transcript 2544777 2546358 0.84 - . g649.t1 4 AUGUSTUS stop_codon 2544777 2544779 . - 0 transcript_id "g649.t1"; gene_id "g649"; 4 AUGUSTUS CDS 2544777 2545530 0.9 - 1 transcript_id "g649.t1"; gene_id "g649"; 4 AUGUSTUS CDS 2545577 2545734 0.99 - 0 transcript_id "g649.t1"; gene_id "g649"; 4 AUGUSTUS CDS 2546117 2546252 0.92 - 1 transcript_id "g649.t1"; gene_id "g649"; 4 AUGUSTUS CDS 2546336 2546358 0.93 - 0 transcript_id "g649.t1"; gene_id "g649"; 4 AUGUSTUS start_codon 2546356 2546358 . - 0 transcript_id "g649.t1"; gene_id "g649"; # protein sequence = [MCDQFAILHTDICKFAIFEDNKVMFDAQILQLLDERLIKVFNYVNVGLDLERRAAPTDVDDEAEIEIVEETPYILPPS # HSLLGVPPPTVIEGRAINFLETDVGISEGASSFNLTTTRTKFFFRFTDFLVNEVDLDGNVIHLKSLAMPESSKKNSAELSSIIAGNNQTDSNTIDGAK # EVPAAKSDERADAAPTISTSEPANSKPEVKMPKEPWPESFNTELAPYLSEAAILQLKEMFLQGPEPPRVPDSGWGGRTGKGSPEDVSSSAVEISSAEP # ESNDRGKRGRGRGRDRGRGGRGGGRGGGSAREDHRKIVSEVCSSYYHHLLQDLSVNLLYSQLVQRRLGLPSIKLFASFLVES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g649 ### # start gene g650 4 AUGUSTUS gene 2547199 2547633 0.97 + . g650 4 AUGUSTUS transcript 2547199 2547633 0.97 + . g650.t1 4 AUGUSTUS start_codon 2547199 2547201 . + 0 transcript_id "g650.t1"; gene_id "g650"; 4 AUGUSTUS CDS 2547199 2547633 0.97 + 0 transcript_id "g650.t1"; gene_id "g650"; 4 AUGUSTUS stop_codon 2547631 2547633 . + 0 transcript_id "g650.t1"; gene_id "g650"; # protein sequence = [MYSSSSPSSSSSIPQASSATVSALDVLETPQPEIVTSPDGSEAVFIDPGPPYGSSISDGDASTQAARSLVMGYYPYWV # GSTFPPEQIDFTKYDWVDFAFASLNQTFQLSFEDPSCPDLLRRTVAAAHAKGKYVKASIGGWGGSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g650 ### # start gene g651 4 AUGUSTUS gene 2548003 2548611 0.65 + . g651 4 AUGUSTUS transcript 2548003 2548611 0.65 + . g651.t1 4 AUGUSTUS start_codon 2548003 2548005 . + 0 transcript_id "g651.t1"; gene_id "g651"; 4 AUGUSTUS CDS 2548003 2548611 0.65 + 0 transcript_id "g651.t1"; gene_id "g651"; 4 AUGUSTUS stop_codon 2548609 2548611 . + 0 transcript_id "g651.t1"; gene_id "g651"; # protein sequence = [MSGNVSPHTSVIISSSPSRLASSTPGPNAPLYDGCHNSTQPQASAASAVKQWGQAGFPLNKQVLGVPYYGYLSNSNAT # RLRTRASSPSVRLTADEGADQGSVTFRNLVKQGALVASPSSDGRRRTFTASSGFNRYWDECSATPFLRSQTSRQLVSYDDPESLHMKGQFVKKMGMLG # TNTWDMSGDTPQNDLVVALMDGLFSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g651 ### # start gene g652 4 AUGUSTUS gene 2555984 2556389 0.7 + . g652 4 AUGUSTUS transcript 2555984 2556389 0.7 + . g652.t1 4 AUGUSTUS start_codon 2555984 2555986 . + 0 transcript_id "g652.t1"; gene_id "g652"; 4 AUGUSTUS CDS 2555984 2556004 0.7 + 0 transcript_id "g652.t1"; gene_id "g652"; 4 AUGUSTUS CDS 2556063 2556389 1 + 0 transcript_id "g652.t1"; gene_id "g652"; 4 AUGUSTUS stop_codon 2556387 2556389 . + 0 transcript_id "g652.t1"; gene_id "g652"; # protein sequence = [MLPTRENDYEDESTFYSQEALLRDHAYFTTPSNSGTRLGDTAVLQSRVTELESEVALLRGQLGQAKGVNDLMWETVVH # KVIHGQAKGTNNANGESTEDERQRKRGRVDSDLEVHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g652 ### # start gene g653 4 AUGUSTUS gene 2559588 2560525 0.93 - . g653 4 AUGUSTUS transcript 2559588 2560525 0.93 - . g653.t1 4 AUGUSTUS stop_codon 2559588 2559590 . - 0 transcript_id "g653.t1"; gene_id "g653"; 4 AUGUSTUS CDS 2559588 2560326 0.96 - 1 transcript_id "g653.t1"; gene_id "g653"; 4 AUGUSTUS CDS 2560392 2560525 0.93 - 0 transcript_id "g653.t1"; gene_id "g653"; 4 AUGUSTUS start_codon 2560523 2560525 . - 0 transcript_id "g653.t1"; gene_id "g653"; # protein sequence = [MKLINKYVDKHGAGHVTLRPEDDEDMWHLYNLIQKGDSVRAPAIRRVQKTSATGSIDSQRIRLNLTLEVTNVEFSSYS # AAAEQSSSTDPSGSNNSAALQIAGRVIVENPHVKLGAFHTLDIEANRDVRIEKADGWDSIALSRVQEAIVPGRGAEVGAIVCGEGTAAFCLLSEHMTL # VTHRISVPIPRKAASAGSSQHEKALTKFYGVLYDAFIRHIPFGNVGLKAIVFASPGWVRDAVYDYVMQEAGRRNDKVLQRALKEKGIKIHISSPHVHS # LVEVLKSPEVNSLSLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g653 ### # start gene g654 4 AUGUSTUS gene 2571961 2573367 0.62 - . g654 4 AUGUSTUS transcript 2571961 2573367 0.62 - . g654.t1 4 AUGUSTUS stop_codon 2571961 2571963 . - 0 transcript_id "g654.t1"; gene_id "g654"; 4 AUGUSTUS CDS 2571961 2573367 0.62 - 0 transcript_id "g654.t1"; gene_id "g654"; 4 AUGUSTUS start_codon 2573365 2573367 . - 0 transcript_id "g654.t1"; gene_id "g654"; # protein sequence = [MRNELIFPWRAAFDLDLTSGWFGGVIEDVISHALTMPDLSSASTSTTEFLSSTVPPTSYLPPIKSLSLFTETRILHQC # LAYLRQIYVPNVRGSRRKKAKTPTNLTELHSPSSSSPLTTIRKDSFEHAYALRWLSALIRLDSDSADSPDLADIQDEAAALLAICAGTASAGTVRRHF # EFDSGRIQITLSDVPLSTNASNGDYFGSVGAQTWGGACVLAEEIADNTVVFFPNPADVKDVSERIFRVLELGAGTGLVSLVAGKAAMLKIPECKMDII # STDYYPSVLDNLKANIEANFPVPSPSLTISSQFLDWSSFSSPSDISSGADTSSTVGLFDVIFGADIIYEPLHASWIRKVVQNTLRKPSSSEKDCPDRN # NNNNNGQGGVFHLVIPLRPTFVAESNTIEQEFRFAGPGLDKVKNDLVILSREIIVCDAEEEEEDDIDQYSVSDDVGNQAGEGNIVRYAYYIIGWAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g654 ### # start gene g655 4 AUGUSTUS gene 2576552 2577866 0.92 + . g655 4 AUGUSTUS transcript 2576552 2577866 0.92 + . g655.t1 4 AUGUSTUS start_codon 2576552 2576554 . + 0 transcript_id "g655.t1"; gene_id "g655"; 4 AUGUSTUS CDS 2576552 2577148 0.92 + 0 transcript_id "g655.t1"; gene_id "g655"; 4 AUGUSTUS CDS 2577336 2577866 0.97 + 0 transcript_id "g655.t1"; gene_id "g655"; 4 AUGUSTUS stop_codon 2577864 2577866 . + 0 transcript_id "g655.t1"; gene_id "g655"; # protein sequence = [MTLFCRTDVETVIHSDNDFATVAYLRIKNARLEPKPTSDAHAQLTVPPILDEDFEAVRTSITEVEPHSFAVHLSESVP # HSLDFTTATKSNGKWVAVTNVQIECSADASIEDEITQCFHLLQGLNFMAYYQSNSSLIHLQSGLPPIIYHSPTAPLSTSSFHQWMISPALIRYMLHSL # VQALRPEPASRSTYPRVFAPGSIAGERLLISGQIGLLPSSIALPSPRSLATETALAIQHADRVVAALRNGWEGHTQMAIYWLSEVGYINAVRKAIDVY # DRDKVRGSSDVMLSSFRVTKYLSFLLEVSVKLLVAVKTLPKGALVEKQVMAHTGRAWIEEEDSDYDSDEKKELVLKTVQPIFEQGLSSFHVARFFIDK # GAH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g655 ### # start gene g656 4 AUGUSTUS gene 2578906 2579643 0.71 - . g656 4 AUGUSTUS transcript 2578906 2579643 0.71 - . g656.t1 4 AUGUSTUS stop_codon 2578906 2578908 . - 0 transcript_id "g656.t1"; gene_id "g656"; 4 AUGUSTUS CDS 2578906 2579643 0.71 - 0 transcript_id "g656.t1"; gene_id "g656"; 4 AUGUSTUS start_codon 2579641 2579643 . - 0 transcript_id "g656.t1"; gene_id "g656"; # protein sequence = [MLLPPIATLVEDHPTPDSPESMNLDTQQMDEDIRPPLEGPTLGNSLGTLTTLFEFYHYERRWIHQQRNSLQDDPGLDP # VSRVQESSSTDEKSSSSLSLSSGESSKLKCEPEEICISDPSTARASSTLRFSRWPWSDRIRGPFEPESGTGANPHRGLSDPRLILPPAGRRTGSSADD # TGYSLAVSQTESSPDIVILDLFENMMEARLESCQRIDKLVRRAHGRKTDIDRGGFTRSIGDRRMVCTSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g656 ### # start gene g657 4 AUGUSTUS gene 2583187 2584146 0.26 - . g657 4 AUGUSTUS transcript 2583187 2584146 0.26 - . g657.t1 4 AUGUSTUS stop_codon 2583187 2583189 . - 0 transcript_id "g657.t1"; gene_id "g657"; 4 AUGUSTUS CDS 2583187 2583363 0.54 - 0 transcript_id "g657.t1"; gene_id "g657"; 4 AUGUSTUS CDS 2583569 2583942 0.34 - 2 transcript_id "g657.t1"; gene_id "g657"; 4 AUGUSTUS CDS 2584023 2584146 0.57 - 0 transcript_id "g657.t1"; gene_id "g657"; 4 AUGUSTUS start_codon 2584144 2584146 . - 0 transcript_id "g657.t1"; gene_id "g657"; # protein sequence = [MTTTLSASNPIITYSDNWNFNETDGTMVTTTAGSTANVTFDAQVQDPASSYSLDDAPPVLFYATRFEGDEVEKFSLYQ # SNLGLARGNHSLVITSLTDGPDFVLDSMVFSSNFIVPSTSFTASTEIPSSSSSPPLSSGGSGSDVGAVVGGIVVGALILVGALAAFLVHGNDCTFGSS # SIIPYQFGQWDMILFACENLVKQSVCRIYIYIVWYVTVLSTFKTQTKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g657 ### # start gene g658 4 AUGUSTUS gene 2586066 2586284 0.95 + . g658 4 AUGUSTUS transcript 2586066 2586284 0.95 + . g658.t1 4 AUGUSTUS start_codon 2586066 2586068 . + 0 transcript_id "g658.t1"; gene_id "g658"; 4 AUGUSTUS CDS 2586066 2586284 0.95 + 0 transcript_id "g658.t1"; gene_id "g658"; 4 AUGUSTUS stop_codon 2586282 2586284 . + 0 transcript_id "g658.t1"; gene_id "g658"; # protein sequence = [MPPTLNLDVPPLDPDEEDEDDDGGFGVSLAIVGDVAVRFDEKTIESKMKSAPFVREVITNEWFPLARSRLDW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g658 ### # start gene g659 4 AUGUSTUS gene 2587178 2588220 0.43 + . g659 4 AUGUSTUS transcript 2587178 2588220 0.43 + . g659.t1 4 AUGUSTUS start_codon 2587178 2587180 . + 0 transcript_id "g659.t1"; gene_id "g659"; 4 AUGUSTUS CDS 2587178 2587592 0.76 + 0 transcript_id "g659.t1"; gene_id "g659"; 4 AUGUSTUS CDS 2587652 2588220 0.6 + 2 transcript_id "g659.t1"; gene_id "g659"; 4 AUGUSTUS stop_codon 2588218 2588220 . + 0 transcript_id "g659.t1"; gene_id "g659"; # protein sequence = [MEAAFDDDSDDEEVSESHPLTRNTNPPPTNRTPGSYDFENVDYDYPPPGSPPATSRPIPSNFGTSNGRITTFELHPSQ # TAPRRTWMSRVLSNVIPSRYGERFGYTQLPHTGVVGGGTGNDGVFANITAKPGRPVTLQEGDDTYVVPEDSRNEAPPTYQSAQADAVPPYWETTVHAP # FAPDSIGEMIIDSLPTGSLFSFLWNMLVSVSFQFVGFLLTYLLHTTHAARLGSRAGLGITLIQYGFALRSRLETDAVGEDNTWADNWGFGNNEKFPTA # AEASSNDYYKSYNASFVGNSTMPSLTEEQATMLVADATTEWLSFFLMTFGAYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g659 ### # start gene g660 4 AUGUSTUS gene 2588771 2589397 0.58 + . g660 4 AUGUSTUS transcript 2588771 2589397 0.58 + . g660.t1 4 AUGUSTUS start_codon 2588771 2588773 . + 0 transcript_id "g660.t1"; gene_id "g660"; 4 AUGUSTUS CDS 2588771 2589397 0.58 + 0 transcript_id "g660.t1"; gene_id "g660"; 4 AUGUSTUS stop_codon 2589395 2589397 . + 0 transcript_id "g660.t1"; gene_id "g660"; # protein sequence = [MSASTPFDMPITIRKALETDAPSLSRICLLTANAGSTAEALHDFGELPGLVYAVPYVKLPTTWGFVMVDDLRDDEVVG # YIVGSTDTRAFEAYAAEHWWPQIAEKYPPSLAKKPADEQYMNLLRNMHTGSDACIKLSPAHMHINILPSYQKQGWGRKLIDTAADFLKGQGLDGVWLG # LDPRNNGARLFYEKMGFKHVDGAPDNNMGIKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g660 ### # start gene g661 4 AUGUSTUS gene 2589466 2590506 0.82 + . g661 4 AUGUSTUS transcript 2589466 2590506 0.82 + . g661.t1 4 AUGUSTUS start_codon 2589466 2589468 . + 0 transcript_id "g661.t1"; gene_id "g661"; 4 AUGUSTUS CDS 2589466 2590506 0.82 + 0 transcript_id "g661.t1"; gene_id "g661"; 4 AUGUSTUS stop_codon 2590504 2590506 . + 0 transcript_id "g661.t1"; gene_id "g661"; # protein sequence = [MTFLKFQLELSSCLPRGLLLFQIRLQTTQILSNVVLNNSPFWCASQSLKAVNTSLDMSTEHRAHSKSPRNRDARRASN # YNTDHLAEPQNTYDSSAPRFRNPFSNDNTEEMFTAPRATLPYYGNSVAYDPNINPSRPISQVPLDPSNHTSRSSASNDSPGYFNDSDKYSFSSYQHPA # DINPPPNAYPGDDHSPPPNRPLRSSVRRSVSFAKGSALREYDPDEEYQDPEKNRALKNRGLPSQMLDLFELNREMKSQHSDDSNDYDYRPYRPDFRHN # DSMVSTYSQVMDPDDPRVTGVKAKYLEDPHDIEKNTLRQMDYRHRRKHLMRVKIEFNVTCKVFDYYGLHTPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g661 ### # start gene g662 4 AUGUSTUS gene 2592587 2593498 0.89 - . g662 4 AUGUSTUS transcript 2592587 2593498 0.89 - . g662.t1 4 AUGUSTUS stop_codon 2592587 2592589 . - 0 transcript_id "g662.t1"; gene_id "g662"; 4 AUGUSTUS CDS 2592587 2593498 0.89 - 0 transcript_id "g662.t1"; gene_id "g662"; 4 AUGUSTUS start_codon 2593496 2593498 . - 0 transcript_id "g662.t1"; gene_id "g662"; # protein sequence = [MSANGHSVNPGIARTMTGLLERTRSRRTFTKDSFTSATSTPSPPSKPKTPKVEDLLAEQSRLQSELEKAVQDCKVAEK # GKAEAELRSQDSLQLLAKERQASQDVKAERDEAVKDADTSKNALRAAEERAEKAEEESRAAREQMEEELREARRLAEEMEGKLVQAEKDLAEAEQAKL # AAMTEVEAKRQALEQALQLTDRYRVAAEQMATEKSELEQVSRQSLERARLEAQSSRAALGEVERRVSEEQEAREKAERELRRRNEEVPTPHTLFGYAM # STLRSRDHTNGNSTRGSSSSSWISGCVIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g662 ### # start gene g663 4 AUGUSTUS gene 2594393 2594999 0.42 + . g663 4 AUGUSTUS transcript 2594393 2594999 0.42 + . g663.t1 4 AUGUSTUS start_codon 2594393 2594395 . + 0 transcript_id "g663.t1"; gene_id "g663"; 4 AUGUSTUS CDS 2594393 2594462 0.73 + 0 transcript_id "g663.t1"; gene_id "g663"; 4 AUGUSTUS CDS 2594611 2594999 0.45 + 2 transcript_id "g663.t1"; gene_id "g663"; 4 AUGUSTUS stop_codon 2594997 2594999 . + 0 transcript_id "g663.t1"; gene_id "g663"; # protein sequence = [MKDHQLFIANHLNSGEYAKDIPTIVAAGAVDTPFPAVLVKVVTGLVALVLVLELLSEGTGLLVTEATEDERTLVTLPL # ALEVADEKVDGTMTGTEEVNEIGGDGVAESVNVAVTVTDEPPGRVVVRVITPGSDSVVVIAEEEADVVSENVPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g663 ### # start gene g664 4 AUGUSTUS gene 2596664 2598793 0.66 - . g664 4 AUGUSTUS transcript 2596664 2598793 0.66 - . g664.t1 4 AUGUSTUS stop_codon 2596664 2596666 . - 0 transcript_id "g664.t1"; gene_id "g664"; 4 AUGUSTUS CDS 2596664 2598793 0.66 - 0 transcript_id "g664.t1"; gene_id "g664"; 4 AUGUSTUS start_codon 2598791 2598793 . - 0 transcript_id "g664.t1"; gene_id "g664"; # protein sequence = [MAMKSRVATLLSKTRSSKGSVKQATIDELRTEKEELEVKVDKLQDECNIYQKNAEDARTACRQAEEVAQKAKEMQLRA # EEEKQTAIEKMEEAQRIAAEHEEETKKQISAAEVSASAAREAAEREKQALEAQGAAERAAEEERAKFEKADQTRILTEQELGARLSEVVDTKDAAEAA # RDAALEEAERARAAREEAETVAREERQARDIANERCRDAELTAETKVQEAYTANLQREDALILLADMEQAKLKAEDSASLEKLARENAENEMRQAEAL # SADLAEQVRKLAEEKEGLVASLREMEFSLSRAQDELVQTQISLSDAKDNAELGLRESERRVEELTVLVQEWRERAEDARSMKEDFERALEKSRDAQYD # AQKQAEDHRKAKEKAEVEKRNAERYSQKQEAQAKKDREAAISAIAAKDEAERNARKALEAFDEAQRKWKDGVQPATSPSESQVDALRRSRQFREGAFH # VGVAGLTGTGKSSLINALMGVITGTAEAVPTGTQSTKSVGRYIDARRNYPHIWYDVPGAGTLTAPSWNYFHDQGLFVFDAIMVVWDNRFTDVDIAVLE # NCVRLKIPAFIIRTKSDVHITNIEERMRDVVEADPTLTNKDRKSRFTVIPFSARAEYISETRQGVELSLHNANLPSMKVYLVSNKTITKIVQGDKNMR # NVRVIDEFDLLNDIWALRRATSRGGGSIIPRMHNVRANTTPVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g664 ### # start gene g665 4 AUGUSTUS gene 2602809 2603183 0.35 + . g665 4 AUGUSTUS transcript 2602809 2603183 0.35 + . g665.t1 4 AUGUSTUS start_codon 2602809 2602811 . + 0 transcript_id "g665.t1"; gene_id "g665"; 4 AUGUSTUS CDS 2602809 2603183 0.35 + 0 transcript_id "g665.t1"; gene_id "g665"; 4 AUGUSTUS stop_codon 2603181 2603183 . + 0 transcript_id "g665.t1"; gene_id "g665"; # protein sequence = [MTFSNATQLFSSEGVQEPETTPTHPINTPYITDCQHTYCYHCIAERMMRNADDTHDTQGWECLRCAQIIQSAERFVVD # PSAGTAESEVNGSDYAFSSDLDFDVTDISESIGSYSESGLSDGYST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g665 ### # start gene g666 4 AUGUSTUS gene 2605513 2605869 0.47 - . g666 4 AUGUSTUS transcript 2605513 2605869 0.47 - . g666.t1 4 AUGUSTUS stop_codon 2605513 2605515 . - 0 transcript_id "g666.t1"; gene_id "g666"; 4 AUGUSTUS CDS 2605513 2605869 0.47 - 0 transcript_id "g666.t1"; gene_id "g666"; 4 AUGUSTUS start_codon 2605867 2605869 . - 0 transcript_id "g666.t1"; gene_id "g666"; # protein sequence = [MVCYKQIPLFSTTEINDSVLTANFIDNAVKIIITRLLPLTKDDLEGLEQDPEEWVNAEEQENQQWGYELRPCSERVLV # QISNQYPEYVTPLLKTTFAEVAGGCSNFLHKSNNSRAFHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g666 ### # start gene g667 4 AUGUSTUS gene 2607613 2609763 0.93 + . g667 4 AUGUSTUS transcript 2607613 2609763 0.93 + . g667.t1 4 AUGUSTUS start_codon 2607613 2607615 . + 0 transcript_id "g667.t1"; gene_id "g667"; 4 AUGUSTUS CDS 2607613 2609763 0.93 + 0 transcript_id "g667.t1"; gene_id "g667"; 4 AUGUSTUS stop_codon 2609761 2609763 . + 0 transcript_id "g667.t1"; gene_id "g667"; # protein sequence = [MPPRYRRKIEEEVVEDSEPEREAARLEQLQTSKAMGSHFEKPSDSYTKSTSQNFELSNSVIEISGASSHHSSSRLKLI # REPTDDSLVETSSHVLNKRNMSDLPQSKSHGEVDNSIIDISGTRLSFVVVSAHQTNTTDSSIELLQSAGTIPKSFAPKTAGPAQLFVDLGDYNSELDN # TLPELRLARYAHTSARPNKPKTNPSHSARAMSTSFGSSRSAIVKKITAQTLVQRLSDEFNADSISRLLMCVCCNLKWTTRKSVSQKLTHFKTCAKKHG # VQDDTLVDLIRKGIMVSPAVQPKGKGTSIVVDDASPKTFFDEVMHDAAPKKRTRRQEVKSTVKDIAEMRNAILLKARAIVAKGDSDVRALREHGTGEH # SDSDLSINFVLSSTPRFAKSSLASRSGLQAQYMFYNDGGTHESPPSSPNTSFSPFSPPIQQLPPSPPISSSGMGEVLQPLMDIDVHNLHTLSNNKYPV # RQPMLFIEKQTDNSQVPRNSYSHSQSPISTSSRPNQATLKISKTFGTPNSPPLTPSPQKVISLTSSASPPTYSPFKDRYYTSDEDMRQYMDDAYLHYD # PEDNTHSLSTTNQPLRRTPSQLSPAPLSPKSKSRSRSTTALRKKPAIKEKIVIDAAWAEDIRNKIMKDTTLHLRILRLEVGFCRVEFLQRVTDVSDLL # LQPIHFDVFLSKIEGQDQQPSAKLKHHLREFLDKQAINFYGAEPVGRQRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g667 ### # start gene g668 4 AUGUSTUS gene 2615589 2616587 0.62 + . g668 4 AUGUSTUS transcript 2615589 2616587 0.62 + . g668.t1 4 AUGUSTUS start_codon 2615589 2615591 . + 0 transcript_id "g668.t1"; gene_id "g668"; 4 AUGUSTUS CDS 2615589 2616587 0.62 + 0 transcript_id "g668.t1"; gene_id "g668"; 4 AUGUSTUS stop_codon 2616585 2616587 . + 0 transcript_id "g668.t1"; gene_id "g668"; # protein sequence = [MGLAGLISAADDGEHERHERPQSKASLSSDPDVKHDDHSEHRRSRRARVPPEIWQDTISLLLDADYAVRADYANALVF # YIVHEMPKHGDVTDAETKTRFRRVADGSQTAPMNSLLHSSDLGSKFLHAVYAFVYILSSSSLNLPSTSNSSPRLSTKDELEINIEPATPLPETRIFGD # MSSQHDRRPGAFHSRTRKIAAALSRLDKSQKLSSSTSATVSDYLLIQNILIAVHQQLPVRSLMVGVPVLLALDSLCQQSECDSSEVMARVHTIRYVLA # KVWLAIGKEWGSTELQAISEKVLFLPLSLSRALNLLSSHRLSHPYHHHYFHWTPKQQK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g668 ### # start gene g669 4 AUGUSTUS gene 2621172 2621666 0.2 - . g669 4 AUGUSTUS transcript 2621172 2621666 0.2 - . g669.t1 4 AUGUSTUS stop_codon 2621172 2621174 . - 0 transcript_id "g669.t1"; gene_id "g669"; 4 AUGUSTUS CDS 2621172 2621666 0.2 - 0 transcript_id "g669.t1"; gene_id "g669"; 4 AUGUSTUS start_codon 2621664 2621666 . - 0 transcript_id "g669.t1"; gene_id "g669"; # protein sequence = [MQREIYSLRSAFTAGPSAPTSDLQHSSYQFGSPASRPATTRSHGQYYSPISPVPQISDPFSQGSSSSPIRQYNPSTTN # YPMSASSQYSSPMSPAPSSSSSPLDSPMIMPGSDSPIGISALSPKLPSDKGSNNDDWLEDPAHNGDHYQRKCRSIQVRVFALKIID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g669 ### # start gene g670 4 AUGUSTUS gene 2625792 2628949 0.69 + . g670 4 AUGUSTUS transcript 2625792 2628949 0.69 + . g670.t1 4 AUGUSTUS start_codon 2625792 2625794 . + 0 transcript_id "g670.t1"; gene_id "g670"; 4 AUGUSTUS CDS 2625792 2626843 0.69 + 0 transcript_id "g670.t1"; gene_id "g670"; 4 AUGUSTUS CDS 2626897 2628949 0.74 + 1 transcript_id "g670.t1"; gene_id "g670"; 4 AUGUSTUS stop_codon 2628947 2628949 . + 0 transcript_id "g670.t1"; gene_id "g670"; # protein sequence = [MSPNSHRSRQQQNIPWERPLSASMSSGVISSSPGSSTVMLPEAPLTRKQSSAAPTSWSSQNLPSRRLSRTIHIPSRPP # RSGQSSRSTSRSRSPLPPLQSHASFSEYPVSSSPSNRRSSRILIDDPVDPIMTTLYELIGVATDITDMSVTQITAQPKCCEALVQRVQNIGKAWEEHP # DWHGRNWYVQVLLAVASLSRVVEWWEAEKQFWNFDDNQNELDEPLTFVMKPADEFAVPAPTPTRRTEPSELEDFRLNHDNDNKLRLHRPTSHNRKSRD # EHPKTLSASTAHSQEHLEHEGRSASKSHDNAESARVLATERLRLQAETAQNQNIVLELSLDGEHLIWINYAWSVVVGSEPEDLFGSRVSQFLHPADTQ # VFDTATQRLLEDDSHTVEARFRLRVEPEGDREPPAGQALFQQMEGKGMLMIDREDGEPSHTMWVIKPIAPPRYELESPAITLVSAGDIEPDEIPASAD # VSYIDAGQDVPETPFPFPQPIITDPILCRICECHIPQWYFEKHSETCVETHRLEAEIGECNETIQELRNTIRDLILAMDRSSPATPPEYRGMPIFSPS # SSPILSSPLHLFRANKMQKFGVKKMQRRLLDQLDDILQVAAEVSVPSLKEEEAKEPIERQRLLSPGSERKMSQIRNWCKPIAEDSALGQLAQDVERVM # RQKMDTVVRMQNTIRYSEKIWHEWEERVVAHLATYADDSSDSESSSDEEEGNMHGPSGTREDECDDHSSTKSEYAFSGEYSSSGPTPLAPSPAPMAVS # AEFRPSSAVSMASMSYGARSLHTRSSTPSSVSSPLALAAPIVAPSSPDVPAMNLDGPSTSAKLTITTRKSSSSLLEPKFIVTPPASPQILARDALTRE # SSTKRGHRRHSTINPITSPPGPGGGGPLSPRNPSVAPLSRTTPTSIKDFDIIKPISKGAFGSVFLARKKATGDYYAIKVLKKADMIAKNQITNVKAER # MILMKQAESPFVAKLYFTFQSKENLYLVMEYLNGGDCAALIKTLGALPEEWTKQYIAEVVLGLEYLHQRGVVHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g670 ### # start gene g671 4 AUGUSTUS gene 2629730 2631160 0.8 + . g671 4 AUGUSTUS transcript 2629730 2631160 0.8 + . g671.t1 4 AUGUSTUS start_codon 2629730 2629732 . + 0 transcript_id "g671.t1"; gene_id "g671"; 4 AUGUSTUS CDS 2629730 2631160 0.8 + 0 transcript_id "g671.t1"; gene_id "g671"; 4 AUGUSTUS stop_codon 2631158 2631160 . + 0 transcript_id "g671.t1"; gene_id "g671"; # protein sequence = [MEKLLVTDPSARLGANGAEEVKAHPFFATIEWDKVTTTEAAFIPQLNDPESTDYFDARGAVPMLFKDDEEGQSAAVTQ # PSALNSPIIDSSMPPPSMPVPIGGGGRDTATSTPSDDFGSFSFKNLPILKQANDDVIRKLKTDQMVPLTHAISESTGLHNRRKSVSHRIKKPPSVVTT # MEPSSRILATGPPSPATSTSSIASSPSRSSLPPSTPGTGSGTHARKPSEYGAVERFKQSHLEGVERRNSMPSRLRTASVSSAGDGSGSETWNSSVGHG # TINTPPSSVHSIDLRKGPDPNDRAVTCLLAEDNPITAKIIETLLIRLGCRCVVVADGSEAISVAMGDISKFVFVSTFPSSNKANFVAEFDCILMDLHM # PVLDGEGAARYIKSTNSKNTNAPIIAISAYSAAGEQGDSNNLFAASLAKPLQKADLIGPFFSIWSIQINLYDIIAVFRQLGFKTTTMQGPNSTKVMAS # HSIAVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g671 ### # start gene g672 4 AUGUSTUS gene 2632402 2633628 0.8 + . g672 4 AUGUSTUS transcript 2632402 2633628 0.8 + . g672.t1 4 AUGUSTUS start_codon 2632402 2632404 . + 0 transcript_id "g672.t1"; gene_id "g672"; 4 AUGUSTUS CDS 2632402 2633628 0.8 + 0 transcript_id "g672.t1"; gene_id "g672"; 4 AUGUSTUS stop_codon 2633626 2633628 . + 0 transcript_id "g672.t1"; gene_id "g672"; # protein sequence = [MKVCWNSGTLFLSHDKSITASWRKENKVNLQIRSPPSPLLPRIIMDESPSTVHSADLFFSTPPTLTRNRPTSRRSYST # GKPRSPSNLNRSRTSPSQSQPSSFVPPPPPPPLKIGTQLNPECPEDQRDLRTVMQLSKSETERQALFLDKLSSQEEDDLARALAESLRMDEKSHSLSS # PGAGPSRPPIIPVHTRPHAQSLPSPLRPSSESTRPLVEAVAVTNCRSKSPEIEIRYQSEPSMRSSPPHNSVSLLDDEALARQLAAEEEREDERWRESA # RLSGENLQPSVEDDEAFARQLALEEEEEDKHETPATVPTLPPAYADAVSPSASVTNASLSRSDSSASSESLPARSLQPMRSSSDQAFANEKSRHSVPS # ASLPSLKEQLEVEDNMGSINVNQFVDRELLRGVCES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g672 ### # start gene g673 4 AUGUSTUS gene 2635661 2636223 0.95 + . g673 4 AUGUSTUS transcript 2635661 2636223 0.95 + . g673.t1 4 AUGUSTUS start_codon 2635661 2635663 . + 0 transcript_id "g673.t1"; gene_id "g673"; 4 AUGUSTUS CDS 2635661 2635722 0.95 + 0 transcript_id "g673.t1"; gene_id "g673"; 4 AUGUSTUS CDS 2635773 2636223 1 + 1 transcript_id "g673.t1"; gene_id "g673"; 4 AUGUSTUS stop_codon 2636221 2636223 . + 0 transcript_id "g673.t1"; gene_id "g673"; # protein sequence = [MEYDLIAEKVNTLPSREELEKTIEALENDMVAIRDEHETQSRTIQSQKVALDGIISDLGSLRFHGGDPTVSGVPSHRG # TPSFESRASEGLEELESIQASEVTLGLSKGDEREEGEEGEEKPPELEVNGDIEMGEVEEKTKNSRARKAREDLEEGEATDASSELSEPPDNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g673 ### # start gene g674 4 AUGUSTUS gene 2636399 2637172 1 - . g674 4 AUGUSTUS transcript 2636399 2637172 1 - . g674.t1 4 AUGUSTUS stop_codon 2636399 2636401 . - 0 transcript_id "g674.t1"; gene_id "g674"; 4 AUGUSTUS CDS 2636399 2637172 1 - 0 transcript_id "g674.t1"; gene_id "g674"; 4 AUGUSTUS start_codon 2637170 2637172 . - 0 transcript_id "g674.t1"; gene_id "g674"; # protein sequence = [MLSRPYVVHELRFPSDPQNGDYTNLWRLRSESPTGRNIPQVDGVWSDVYKDNILSVSAAPIYHSVPCIGYTITESPVP # GKIDPKKYIPDIKRTNTPMSVMRLLQAGESVRLSDGTVLQGPTPRNGRKLVILGDTHDPSPMIPIAQDADLLIHEATNAHLPGIVPNTRDDDTFESIQ # RTAMERGHSTPQMAGAFAKRIGAASLILNHFSARYPGNDNVDPEAKIIMDAIGNLAAMEYGKPVTCARDLMSIDIGFRAME] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g674 ### # start gene g675 4 AUGUSTUS gene 2638474 2639683 0.72 - . g675 4 AUGUSTUS transcript 2638474 2639683 0.72 - . g675.t1 4 AUGUSTUS stop_codon 2638474 2638476 . - 0 transcript_id "g675.t1"; gene_id "g675"; 4 AUGUSTUS CDS 2638474 2639030 1 - 2 transcript_id "g675.t1"; gene_id "g675"; 4 AUGUSTUS CDS 2639089 2639683 0.72 - 0 transcript_id "g675.t1"; gene_id "g675"; 4 AUGUSTUS start_codon 2639681 2639683 . - 0 transcript_id "g675.t1"; gene_id "g675"; # protein sequence = [MSHICMVSEFFSEANARVARSARALRVGLLRPAIVLYDEAHPLGDEIGIVQSSDVARKPDMLIIMGTSLKVHGLKKLV # KEFARVVHNQKSSSIPLSSSSSPLKVRKASSAKAFAGKVIFVNKTPPGAEWADVIDYHVSGETDKWTQRVVEDWKRMFPGDWEVQQTLLSSGLFKAVK # ETHNEAQVVAKGNGKGTSKAAKESKKKSPLCASDDEEENVPPLPSHSDAMILSTPDAHRLLKLKPTNNITDMVISPAPVSPSKRARTQSQSHYSAAAQ # ASLEASPSKRRVKPLPDSGVEFLESDRRILFGKITMNQAGVDNDEAEEEEDVLNMGDLSMQSPPKLKPSLRSKIRAAVKPIPKSRAGARRAARMQSTT # TTAVDVDVFSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g675 ### # start gene g676 4 AUGUSTUS gene 2640819 2641694 0.84 - . g676 4 AUGUSTUS transcript 2640819 2641694 0.84 - . g676.t1 4 AUGUSTUS stop_codon 2640819 2640821 . - 0 transcript_id "g676.t1"; gene_id "g676"; 4 AUGUSTUS CDS 2640819 2641694 0.84 - 0 transcript_id "g676.t1"; gene_id "g676"; 4 AUGUSTUS start_codon 2641692 2641694 . - 0 transcript_id "g676.t1"; gene_id "g676"; # protein sequence = [MSPVELLPSRASTIPTISDRSLNLYNKFPDISSDLTFSTLSFASPTMKVILSNQDSDLHIGSTCSLSEAFDTPPLRTP # FHPSSPSSPNAPVRIDWSAFPAFDATVGPTISDTSSNRPLFCKSQPMLPRGGLFDSWADESTELSPCIPSRKAVRLRRSSTYRPLNMVKSPSHKLSSI # QETSTSSQWQTEEISRPVQSSSQSSRLLALCSNKLHKQSTVSLVVVDDYDSNGRRSKPSRPPLVAGFLQSLPPFRLSDTPSSTSPISTSPVTPSRCAT # PLRSPFLIRKRDEPRVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g676 ### # start gene g677 4 AUGUSTUS gene 2642312 2642975 0.48 + . g677 4 AUGUSTUS transcript 2642312 2642975 0.48 + . g677.t1 4 AUGUSTUS start_codon 2642312 2642314 . + 0 transcript_id "g677.t1"; gene_id "g677"; 4 AUGUSTUS CDS 2642312 2642441 0.49 + 0 transcript_id "g677.t1"; gene_id "g677"; 4 AUGUSTUS CDS 2642527 2642975 0.48 + 2 transcript_id "g677.t1"; gene_id "g677"; 4 AUGUSTUS stop_codon 2642973 2642975 . + 0 transcript_id "g677.t1"; gene_id "g677"; # protein sequence = [MVLSAVVLRDYTTEIKDLVLSLGDVVEEEDVLGETNKELGNIVESSALASAINELVTTERSYVKKLQTLKRDYADPLR # NFARSKSTAIISKYEATTLFGNIDSLLPVNEAFLTDLEKMIAPNGYKAVGGVGDVALRHFKELKGFEQYRQYYVKREEAQRFIEQEMEKRSSPFEDYI # EVSAVSISGFSITSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g677 ### # start gene g678 4 AUGUSTUS gene 2643081 2643644 0.39 + . g678 4 AUGUSTUS transcript 2643081 2643644 0.39 + . g678.t1 4 AUGUSTUS start_codon 2643081 2643083 . + 0 transcript_id "g678.t1"; gene_id "g678"; 4 AUGUSTUS CDS 2643081 2643644 0.39 + 0 transcript_id "g678.t1"; gene_id "g678"; 4 AUGUSTUS stop_codon 2643642 2643644 . + 0 transcript_id "g678.t1"; gene_id "g678"; # protein sequence = [MIKHMPPYDPQRAKLEEADDIASKIALAEADEQTKRAAIVYCLIATIDGFPPNMFSNSRRFIDCIDVEDILLEAPSSS # SASSTSLVGSLHCTLFLFDDKLLIVKRPGNGEKSGRVLAGLDELDKITKSGLPTGKKKNGMVCKGVLDVTDVVATDQGGAGMQSFVRSCYFITLSNRF # SPLPGDSSSRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g678 ### # start gene g679 4 AUGUSTUS gene 2644365 2645589 0.23 + . g679 4 AUGUSTUS transcript 2644365 2645589 0.23 + . g679.t1 4 AUGUSTUS start_codon 2644365 2644367 . + 0 transcript_id "g679.t1"; gene_id "g679"; 4 AUGUSTUS CDS 2644365 2644839 0.23 + 0 transcript_id "g679.t1"; gene_id "g679"; 4 AUGUSTUS CDS 2644883 2645589 0.89 + 2 transcript_id "g679.t1"; gene_id "g679"; 4 AUGUSTUS stop_codon 2645587 2645589 . + 0 transcript_id "g679.t1"; gene_id "g679"; # protein sequence = [MGDFFAGSVSSRKRTKSTASRSSTYTQTTSTGESSITKFSSSRSNTMSTIATTVDDGSLASTRSRTKNDRGRSPGPSS # DADDSFSRSLSRSLSRSISRASKSRSVSRDRESDYTDTDDDAQIQILDRSDNDIDAQLALARRNSKSQNDRQVPVRSSQPNIFFIDWYPVEEFPHPAR # PASRASTARDSTSQCTITEDPRSPRSLSRHSSDRRPMGPRSPSPLPPPRSPRPPSPPLPELPSIDDELAAEISDIVQPTPTKSGIPRSKRQIFHPVNN # IDSTPKPHMNGMARASSSVEPLSIKKKTSVRNAIDSTDTPVTGRKSGRNSLSRTPARTVTSSPRRVSPQIRLGKVAGPSVSSPHMVHDLDKIVSLART # TKEDVSVTCFRPYLRSLPWTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g679 ### # start gene g680 4 AUGUSTUS gene 2647084 2648809 0.8 - . g680 4 AUGUSTUS transcript 2647084 2648809 0.8 - . g680.t1 4 AUGUSTUS stop_codon 2647084 2647086 . - 0 transcript_id "g680.t1"; gene_id "g680"; 4 AUGUSTUS CDS 2647084 2648339 0.82 - 2 transcript_id "g680.t1"; gene_id "g680"; 4 AUGUSTUS CDS 2648800 2648809 0.81 - 0 transcript_id "g680.t1"; gene_id "g680"; 4 AUGUSTUS start_codon 2648807 2648809 . - 0 transcript_id "g680.t1"; gene_id "g680"; # protein sequence = [MLRYATKKAFRSFSLALSHVSKTDYYAGLFSSSPKVTLHLSIEDPASEEPSGFGSWECEVCAYRNPPGLSPSAARVCA # LCGVPRSLPAKSASSSASSEVPQLSIDSSFPTSASTSALPQRFRKPSSISCPACTFLNHPSMQTCEICSTPLPKASGDHTQAKSAPTTRPTTPGLNDD # DIESKMLKLSFRKGGDKVFYTALKRSLKGRAWEITPSNAGTNGARSGICENTFLVDVITSDSLCLAGIMQAVENNAQNRDADMSNALQDLEALMVKAK # DMVRLAAELNERLTASSTTTANDPYSSVLSSTLTEPEEATFIRSSLSQLGLQMENTPVTLDMMKDEREWMEQLARELANILQGSEKVSSSSSGGMMKK # RGIIALDEVWGGWNRARGVGEQTHFRFLFLFLLFINHIQLLYHPQRSSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g680 ### # start gene g681 4 AUGUSTUS gene 2649818 2651801 0.94 - . g681 4 AUGUSTUS transcript 2649818 2651801 0.94 - . g681.t1 4 AUGUSTUS stop_codon 2649818 2649820 . - 0 transcript_id "g681.t1"; gene_id "g681"; 4 AUGUSTUS CDS 2649818 2651043 0.96 - 2 transcript_id "g681.t1"; gene_id "g681"; 4 AUGUSTUS CDS 2651096 2651801 0.98 - 0 transcript_id "g681.t1"; gene_id "g681"; 4 AUGUSTUS start_codon 2651799 2651801 . - 0 transcript_id "g681.t1"; gene_id "g681"; # protein sequence = [MLKSSDAVPVSISQLDSTSQSRRNSTATIDDAVRYVRSRSNSLVKDKDTSTPRNRSRLTFMDYLIKPVQRICKYPLLL # EQLKSSEPLYESKIRVPWLSDRNVVVESAAQAMRHVASTVDEARQRQDVAVRSALIASRILYSHVLQSPSPSPLQVLTPGFLSSLGPCHIAGSLDVIH # QRSIKQSTGTANINVKYLGAFLYRGGYFILAKVTKGRTYEPRHWFRLGDFKIIEAVESEAWLPCSFRLSCKGHEFEFAAACQQEREAWLTAIRESLAY # PTSSWINEPTASILLDGKGEIVPSMLDDPYEAIVPLPTINSVPELASDTGDQLTETLLDALATESQMLQATATSSPEVPSIPSRRSSSTSAQAFSTPT # SPEYETFVIRRNLPAARAQIDAGLSDVISDICLSARSQAATQEEELFQPPHIPRQSSSSHPAQNSKLNSRSSTSSSLSMAKNRLRKHESVRVPRRKSL # AQLVDDQSITKSSASRAQSFTTRKRPQKLNLTSKGPEEADPLLSHPPNSSRSYSSPTFPGGSANSNPVSSDPSSTLASPVLESHPAQMNGAPHSEPGC # NRSRPSSLVCNVRSLFAPRPPSLINTFTPVFTTSSPATFDFKHDKPSPKNVFRRWMGSVSRSHRRALSAPEIQTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g681 ### # start gene g682 4 AUGUSTUS gene 2656981 2658242 0.35 - . g682 4 AUGUSTUS transcript 2656981 2658242 0.35 - . g682.t1 4 AUGUSTUS stop_codon 2656981 2656983 . - 0 transcript_id "g682.t1"; gene_id "g682"; 4 AUGUSTUS CDS 2656981 2657154 0.98 - 0 transcript_id "g682.t1"; gene_id "g682"; 4 AUGUSTUS CDS 2657321 2657516 0.59 - 1 transcript_id "g682.t1"; gene_id "g682"; 4 AUGUSTUS CDS 2657578 2658242 0.54 - 0 transcript_id "g682.t1"; gene_id "g682"; 4 AUGUSTUS start_codon 2658240 2658242 . - 0 transcript_id "g682.t1"; gene_id "g682"; # protein sequence = [MGVLQEGYDADVVMWDSHPLQIGATPVYVWIDGMKQIPLTKESGRSTYSTGTGPEEVVEPDKTRMEAPGQPSYEKERQ # DTVDWDGLPPLKGRGEGNRVVFRNVKEVWTRGRNSIDESFVADEDEFGIVVVEQGRIICAGSADDCIISGDERTVDVDLHGGSISPGLLTFGSPLGLE # EIASEPSTTDGRLFNSLAVDIPSVFHDVGGIVRAVDALMFDSRHARMAYRFGVTAATSSLAKPHRLYENDDCMIWGLSTTFSTNAAHGLEPEAIIQTE # TALHVRITRPRFDGVIPLVVEVHNADIMASLIMLRAEVDAKIGGQMRMVFVGATEAWLLAKELSEQQNFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g682 ### # start gene g683 4 AUGUSTUS gene 2660705 2661391 0.39 - . g683 4 AUGUSTUS transcript 2660705 2661391 0.39 - . g683.t1 4 AUGUSTUS stop_codon 2660705 2660707 . - 0 transcript_id "g683.t1"; gene_id "g683"; 4 AUGUSTUS CDS 2660705 2661391 0.39 - 0 transcript_id "g683.t1"; gene_id "g683"; 4 AUGUSTUS start_codon 2661389 2661391 . - 0 transcript_id "g683.t1"; gene_id "g683"; # protein sequence = [MFIKAVGSDPNAAFPVQLFQATQVLKYLLSIGCNPSNIQIAGDSAGGNLITQLLSHMVHPFPLPSLVPPLNLPPGSRL # RGVYMMSPWVGLSNPDQWGPTFRIKHYDVTNIRGPGEEYVDTIFIDFPDKHSQIVPYAESVSAPDDWFSDLQNSVVDRILVTAGKEERLLDQIQVFFK # RKIKPYHSDAVLLVQDGGIHDDMIMDFAVANAPLGNELTPVVLEWIAKGFRM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g683 ### # start gene g684 4 AUGUSTUS gene 2662986 2663984 0.82 - . g684 4 AUGUSTUS transcript 2662986 2663984 0.82 - . g684.t1 4 AUGUSTUS stop_codon 2662986 2662988 . - 0 transcript_id "g684.t1"; gene_id "g684"; 4 AUGUSTUS CDS 2662986 2663984 0.82 - 0 transcript_id "g684.t1"; gene_id "g684"; 4 AUGUSTUS start_codon 2663982 2663984 . - 0 transcript_id "g684.t1"; gene_id "g684"; # protein sequence = [MSVRTVQTSFTSHSASTAALSTMIATSNVLTAVDLNVAYPPGLESYRADKGLVIRGRSYSGSAARNSYSNQASGGPNL # SYSRSSNRAGSNKRYPHGMRLPSSSYNQTQNQTRRAGFSSSTKQENSLLGPSLYQRTERFDPFGDSKEPPLSTSPVFTSTGPSNVSQPLYTHYYYYDP # NTNRPTLAYADDKNSANAANLTASTNLLLDTLLNGRRSPSPPQPTMSDPSPVAVTADSPVQPQTRSPSPPHSLRPRAAAISRPSSTITPSPILSQPIA # SVSPPPPPIKVSKAQRDAIARIVANMLLNRADGISRRGRRCNNTGYVKSGLSRVVSVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g684 ### # start gene g685 4 AUGUSTUS gene 2667408 2667551 0.81 - . g685 4 AUGUSTUS transcript 2667408 2667551 0.81 - . g685.t1 4 AUGUSTUS stop_codon 2667408 2667410 . - 0 transcript_id "g685.t1"; gene_id "g685"; 4 AUGUSTUS CDS 2667408 2667551 0.81 - 0 transcript_id "g685.t1"; gene_id "g685"; 4 AUGUSTUS start_codon 2667549 2667551 . - 0 transcript_id "g685.t1"; gene_id "g685"; # protein sequence = [MEILKAKKTNFDPTPSKTKRKPSKKFPSAETVDSSDKDENDEEEEDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g685 ### # start gene g686 4 AUGUSTUS gene 2668753 2669538 1 - . g686 4 AUGUSTUS transcript 2668753 2669538 1 - . g686.t1 4 AUGUSTUS stop_codon 2668753 2668755 . - 0 transcript_id "g686.t1"; gene_id "g686"; 4 AUGUSTUS CDS 2668753 2669538 1 - 0 transcript_id "g686.t1"; gene_id "g686"; 4 AUGUSTUS start_codon 2669536 2669538 . - 0 transcript_id "g686.t1"; gene_id "g686"; # protein sequence = [MSSVPPSKPHVSSKAKGKRRQHSVDPDTLDAPVKPKGKRKANSGDEVANTLDQPSIETRPKKKKKEHNPQQPQLPVNT # LPLNDGEPQISPSDFLAAIIAAATATSSDQQSSTGPFTDDPTAQAADVLSGEVSTEAVLRVLQDVDFSNIAQVLKVWLDPQQDSAASLSGLTLPNGTL # NTDLISQLMLQAPPPVGQVPVSAGKILSTKPTETASGPTYEHEVIENYNTEEDALLLSTKWISTSKLLDLAKNRGEISARVWLAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g686 ### # start gene g687 4 AUGUSTUS gene 2669834 2670457 0.47 - . g687 4 AUGUSTUS transcript 2669834 2670457 0.47 - . g687.t1 4 AUGUSTUS stop_codon 2669834 2669836 . - 0 transcript_id "g687.t1"; gene_id "g687"; 4 AUGUSTUS CDS 2669834 2670457 0.47 - 0 transcript_id "g687.t1"; gene_id "g687"; 4 AUGUSTUS start_codon 2670455 2670457 . - 0 transcript_id "g687.t1"; gene_id "g687"; # protein sequence = [MTSDQSFDMIPVLTYLGVEKDGSYSPSPSDQTIDFLIKHIHNLPPHLLLKFSSITSPKQRTVIHVIRNRRLKYIDTQP # AELSFTAARHTWPSVWPGRERRGVAEGHDEERWAQTDFMQGSTKHVKKLGSLLRDYEEEREAERVRNIRRTQSAAEESQFIPEEDEDSAEDEPVESGD # VEEATEADNRAEFERRIRERFIYGLLDVSMK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g687 ### # start gene g688 4 AUGUSTUS gene 2671115 2672149 0.97 + . g688 4 AUGUSTUS transcript 2671115 2672149 0.97 + . g688.t1 4 AUGUSTUS start_codon 2671115 2671117 . + 0 transcript_id "g688.t1"; gene_id "g688"; 4 AUGUSTUS CDS 2671115 2672149 0.97 + 0 transcript_id "g688.t1"; gene_id "g688"; 4 AUGUSTUS stop_codon 2672147 2672149 . + 0 transcript_id "g688.t1"; gene_id "g688"; # protein sequence = [MFYEDLDHRDFMAQSTHILLSDALEPPSPGFASLDASTGSPRPGSIPPSPSFSDILASSTQKGLAKPQSPIPSRLLAH # TLSYDSSSSSNSCAIVEEQLTPDDDFLFDENRDRLSQSLPVAGEESDHSDFSQGVHELGASQMFPTQQPEETESQNSHQTRPPFLHVRGVQNTTLSSS # TSSQLPPPEVAGPTRKQSWYGPTTRPRKRSRGSNLSPSVSPVNTPAASPHGVTAFAVSSSSSRSRRTRGIPDQATPHRIRDDPSHSGLYRKRYNVNSS # TDPDDANSRLPKIRYNMPAQRSSHDEDCDADVSQMQTETQLTMSPAIQQEPSYGMYDYAIQTQAPYDSQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g688 ### # start gene g689 4 AUGUSTUS gene 2674856 2675224 1 - . g689 4 AUGUSTUS transcript 2674856 2675224 1 - . g689.t1 4 AUGUSTUS stop_codon 2674856 2674858 . - 0 transcript_id "g689.t1"; gene_id "g689"; 4 AUGUSTUS CDS 2674856 2675224 1 - 0 transcript_id "g689.t1"; gene_id "g689"; 4 AUGUSTUS start_codon 2675222 2675224 . - 0 transcript_id "g689.t1"; gene_id "g689"; # protein sequence = [MISPTSAGVDAARAYGTGCFKTHRTHDLRGLTEAELRVCDFLPLSRRKVTKSTQGVHHWKEFYANHAEYKKVGRVNHP # LINPASPIPEPCKPPKVKNDGKDGKAKEKDKSEAKESTMVHEEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g689 ### # start gene g690 4 AUGUSTUS gene 2678100 2678564 1 - . g690 4 AUGUSTUS transcript 2678100 2678564 1 - . g690.t1 4 AUGUSTUS stop_codon 2678100 2678102 . - 0 transcript_id "g690.t1"; gene_id "g690"; 4 AUGUSTUS CDS 2678100 2678564 1 - 0 transcript_id "g690.t1"; gene_id "g690"; 4 AUGUSTUS start_codon 2678562 2678564 . - 0 transcript_id "g690.t1"; gene_id "g690"; # protein sequence = [MPPNQAIELLSITCPEPPKTNDAPPTDYAEWTTSSSVVIGARLLDVENGDVLARFSDWPQPYRFVDTVDPGLKINVQS # SGDTKMSTISLQVKMPAKCVVLGVAGDGEDPKWSDNALDLMPGDTQIINVHGLEGRDLQASYLGKEKATGVVFQRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g690 ### # start gene g691 4 AUGUSTUS gene 2681774 2682631 0.98 - . g691 4 AUGUSTUS transcript 2681774 2682631 0.98 - . g691.t1 4 AUGUSTUS stop_codon 2681774 2681776 . - 0 transcript_id "g691.t1"; gene_id "g691"; 4 AUGUSTUS CDS 2681774 2682631 0.98 - 0 transcript_id "g691.t1"; gene_id "g691"; 4 AUGUSTUS start_codon 2682629 2682631 . - 0 transcript_id "g691.t1"; gene_id "g691"; # protein sequence = [MSYKHHSARLSKVARQTSRPLSEDPVSIVRKVFVECGSEVDTEGGGARARLMNRQTARSFGGMEIVDEEEEEKEQSFS # EPCIQETSQDQSIISSYSTPDSTGPPTPASYCFSPVAEISARALEANNVEILVPSNTQLPYLRNQSSAPLQSLGITLPSADTLSDKLQDQTLPSRLSK # LYADHRVSVVTWSDLVSFSSYGLDMIDDHGQAEKGKFHDDSSIYYDESWNEDRSLEEFDGNEDLVTNSLEDSGIDLTAVLDSMSILVGQGLDARLLLS # PPRQFCSTFTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g691 ### # start gene g692 4 AUGUSTUS gene 2683660 2686534 0.34 - . g692 4 AUGUSTUS transcript 2683660 2686534 0.34 - . g692.t1 4 AUGUSTUS stop_codon 2683660 2683662 . - 0 transcript_id "g692.t1"; gene_id "g692"; 4 AUGUSTUS CDS 2683660 2684748 0.9 - 0 transcript_id "g692.t1"; gene_id "g692"; 4 AUGUSTUS CDS 2685377 2686534 0.39 - 0 transcript_id "g692.t1"; gene_id "g692"; 4 AUGUSTUS start_codon 2686532 2686534 . - 0 transcript_id "g692.t1"; gene_id "g692"; # protein sequence = [MKYQRIPSTTSLSGDDDDEIHSKSILPFDEGDSQANITVVPAQWSRPTAPSARRNDRVSPMSRLPPELLIHILKHIHS # ARDLVSSLQVCRTWCECSVELLWHKPNLNKYFTVEKMARLLAVPDQTFTYASFIRRLNFLAVAKELRDDIFCNFGKCDRLERLTLVNCHQLSEVAILQ # TLPCFPNLVAVDLTGVVHTSDEAIVGLASVARRLQGINLTGCKHVSDEGVMALALNCPLLRRVKLSGLEDLTDEPLQALTKSCPLLLEIELSNCKLVT # DIAIRDAWSRSTHMREMRLSQCSELSDTAFPAPIRRDSKSVSEPSVNPFASSTSESADLPPLIINRTFEHLRMLDLTACSKVTDDAIEGIVSHAPKIR # NLVLSKCGLLTDRSNGTDDTEYEDDDDIEEEDTPELEIDGDLEDEYISRTSMANNHHITVHRGHRQNNYGAVWPSRNSTEEHVLPTIPTDRPIPNSLL # ARLNAVMAAGPSSARSPSSSNSNRLAPASVGAFRNIAEALPIIEQSQSPPPSDVASNASGATNNSNGAGFFRSYQDGLIHSRANEVRTPDLNFAEIGH # GRGAVAAGGLPASVTNATPTNFQMRRAQVLTPHPRPPPIDLQHATASSSAQPVFSNSSQPESSIAWPYSEPASPPLTGYDAEQEEKELERDQRDHTSR # ELHESVRAALAGPSGSIPASGSGDARGRGVRKSLRNTINAAEHNISSFLFGRAPLQVRGPTTSDEGHTSSSNARHAAARGGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g692 ### # start gene g693 4 AUGUSTUS gene 2692828 2694507 0.87 + . g693 4 AUGUSTUS transcript 2692828 2694507 0.87 + . g693.t1 4 AUGUSTUS start_codon 2692828 2692830 . + 0 transcript_id "g693.t1"; gene_id "g693"; 4 AUGUSTUS CDS 2692828 2694507 0.87 + 0 transcript_id "g693.t1"; gene_id "g693"; 4 AUGUSTUS stop_codon 2694505 2694507 . + 0 transcript_id "g693.t1"; gene_id "g693"; # protein sequence = [MPVPPDKIASYLFQSRIEGPVWLEAEEIALLRARRSEAESEAASLSDHSSALKDAYEKSLRREDAKLSEIALIQNILS # PIRRLPLEILSQIFEHVCLPKYHERPDEDVINTTFALCQVCIAWRMAAYTTPAIWSQICIELDKKPETFSGNVTWVKEWLTRSKGLPLDIYLFLIDVW # DVVTQDVKDRVNECLDFILNFHSQIRTLDLSGYPPFFIPLFRLPRASMPLLESVSIRVTDYDNDDDSIQNLIQQHPFVEVLLGAPRLQTLKIQECGCQ # MSILQGLALPVEQLTSLEIRADKKSVFDPIAYLNMLRQCTNLRSLKIRFPKRTSRHLSLFGSHNSFPILLPSLKSLDILDGHYGGEFLSCFSAPLLKD # LTLRMFGEANISDLPTALSGLQSRSMTILSSLALQVILNLNMNSVSRNLVAILAIFPTLDEFRLSAISIVSKFDLGPILRALTFVKGHPVLLPKLTVI # ELELTAIRMDRSRDEYPSDLIPMVLSRWWPDNSESQVHNGNHEEISEHPDVSQLRQVILHGVCYKEADVAPILALSGLELTLKECLELK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g693 ### # start gene g694 4 AUGUSTUS gene 2694722 2695904 0.13 - . g694 4 AUGUSTUS transcript 2694722 2695904 0.13 - . g694.t1 4 AUGUSTUS stop_codon 2694722 2694724 . - 0 transcript_id "g694.t1"; gene_id "g694"; 4 AUGUSTUS CDS 2694722 2695589 0.64 - 1 transcript_id "g694.t1"; gene_id "g694"; 4 AUGUSTUS CDS 2695645 2695814 0.29 - 0 transcript_id "g694.t1"; gene_id "g694"; 4 AUGUSTUS CDS 2695872 2695904 0.26 - 0 transcript_id "g694.t1"; gene_id "g694"; 4 AUGUSTUS start_codon 2695902 2695904 . - 0 transcript_id "g694.t1"; gene_id "g694"; # protein sequence = [MKSDPGCQAAQVSMTSLANGSWNNSISVQGCSLSWIVNDTAEVLFGVNATNCSTDTPQFSPVAFWFFEYSPSAQASAT # VCFPTFQLFDVEISYDLAAQNVTQVTELQPFTSSSNFSSASGNITGSPLNGRAYNGVEFNLTNPDQFVLARQAAIQLQMPAAVLQKAQLSTAGLQGSF # TSNSFVQYSTEVYVSFILVSSFSYTYGIIYRLQTTYLTLLAQTVYFLPSNELNTIQVKTIVERLFLSDVAVHLLAVAMIIVAFFGTIAQLFHRFDRRH # LRLRHQPGTIASAVSIGGQTGMGALLAGRQDQKDIDEVLSNRKFRIDPRTMKIIMEGEEGYEFASSPRNRRKSVFAALQNVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g694 ### # start gene g695 4 AUGUSTUS gene 2698137 2699105 1 - . g695 4 AUGUSTUS transcript 2698137 2699105 1 - . g695.t1 4 AUGUSTUS stop_codon 2698137 2698139 . - 0 transcript_id "g695.t1"; gene_id "g695"; 4 AUGUSTUS CDS 2698137 2699105 1 - 0 transcript_id "g695.t1"; gene_id "g695"; 4 AUGUSTUS start_codon 2699103 2699105 . - 0 transcript_id "g695.t1"; gene_id "g695"; # protein sequence = [MSKRKILTLVDEGFVNGWDDPRLYTLIALRRRGVPPGAILSFVSSLGVSTASSNIEINRFEQAVRQYLEGSVARLLMV # MQPLKVTIENLSEDYLEWIEKPFHPKVAALGNTRIPFTRTIYIDSEDFRLEDSEDYFRLAPGKTVGLFQAPHPVTCTSYKLHPTSGKVTELFCRLENG # GNVKKPKAFIQWVAEHTPSGSPVRIEETRVFHRLFKSDNPPSDFRSDINSDSLETIEGAMMEIGFWDLARRSIAGAREESKARAELVGKECVRFQGLR # TAYFALDKDSRVRCLEDETGNAPPARMQGDYLVLNRIVSLKEDAGKAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g695 ### # start gene g696 4 AUGUSTUS gene 2700464 2700826 0.97 - . g696 4 AUGUSTUS transcript 2700464 2700826 0.97 - . g696.t1 4 AUGUSTUS stop_codon 2700464 2700466 . - 0 transcript_id "g696.t1"; gene_id "g696"; 4 AUGUSTUS CDS 2700464 2700826 0.97 - 0 transcript_id "g696.t1"; gene_id "g696"; 4 AUGUSTUS start_codon 2700824 2700826 . - 0 transcript_id "g696.t1"; gene_id "g696"; # protein sequence = [MSNPTKGPKLEDSSITLFKSIGLTQAKAAEASKSPKCAALLKKLIEDNSLVSRKLDEKQAGLIAAFASQLAKSNGVDA # RSEKYVLDTILDGKLKSVDQVAGVFMIYIQTEILTVRLLKRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g696 ### # start gene g697 4 AUGUSTUS gene 2704238 2704609 0.74 + . g697 4 AUGUSTUS transcript 2704238 2704609 0.74 + . g697.t1 4 AUGUSTUS start_codon 2704238 2704240 . + 0 transcript_id "g697.t1"; gene_id "g697"; 4 AUGUSTUS CDS 2704238 2704609 0.74 + 0 transcript_id "g697.t1"; gene_id "g697"; 4 AUGUSTUS stop_codon 2704607 2704609 . + 0 transcript_id "g697.t1"; gene_id "g697"; # protein sequence = [MADSKTSAITISAHLLRKDSAQVYTKGQKYVQILPQEMTQFVPSYAGADGFIFTVKNHLDRLFMKEDSIAQYHILVPV # NVGSDDLEYFGIYRLHAMTLQEFNSQTQDVCNVISKLGTRVNCQY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g697 ### # start gene g698 4 AUGUSTUS gene 2705209 2705415 0.64 - . g698 4 AUGUSTUS transcript 2705209 2705415 0.64 - . g698.t1 4 AUGUSTUS stop_codon 2705209 2705211 . - 0 transcript_id "g698.t1"; gene_id "g698"; 4 AUGUSTUS CDS 2705209 2705415 0.64 - 0 transcript_id "g698.t1"; gene_id "g698"; 4 AUGUSTUS start_codon 2705413 2705415 . - 0 transcript_id "g698.t1"; gene_id "g698"; # protein sequence = [MTSNLGPYAVADYKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDSGDAEDDGEY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g698 ### # start gene g699 4 AUGUSTUS gene 2707359 2707873 0.95 - . g699 4 AUGUSTUS transcript 2707359 2707873 0.95 - . g699.t1 4 AUGUSTUS stop_codon 2707359 2707361 . - 0 transcript_id "g699.t1"; gene_id "g699"; 4 AUGUSTUS CDS 2707359 2707768 1 - 2 transcript_id "g699.t1"; gene_id "g699"; 4 AUGUSTUS CDS 2707849 2707873 0.95 - 0 transcript_id "g699.t1"; gene_id "g699"; 4 AUGUSTUS start_codon 2707871 2707873 . - 0 transcript_id "g699.t1"; gene_id "g699"; # protein sequence = [MFRAWKSNVACALLYRGDVVPKDVNAAVSIIKTKRTIQFVDWCPTGFKLGICNEPPAHVPGGDLAKVSRSMCMLSNTT # AISSAWSRLDHKFDLLYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSADIEESGEY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g699 ### # start gene g700 4 AUGUSTUS gene 2710178 2711673 0.13 - . g700 4 AUGUSTUS transcript 2710178 2711673 0.13 - . g700.t1 4 AUGUSTUS stop_codon 2710178 2710180 . - 0 transcript_id "g700.t1"; gene_id "g700"; 4 AUGUSTUS CDS 2710178 2710630 0.78 - 0 transcript_id "g700.t1"; gene_id "g700"; 4 AUGUSTUS CDS 2710682 2711082 0.46 - 2 transcript_id "g700.t1"; gene_id "g700"; 4 AUGUSTUS CDS 2711184 2711425 0.96 - 1 transcript_id "g700.t1"; gene_id "g700"; 4 AUGUSTUS CDS 2711495 2711673 0.31 - 0 transcript_id "g700.t1"; gene_id "g700"; 4 AUGUSTUS start_codon 2711671 2711673 . - 0 transcript_id "g700.t1"; gene_id "g700"; # protein sequence = [MLQQSPKHASHSESRASGKSKALDTDMGDCDIDLWEPKPPKVLMKDPDAVPLELRSQIQQQLTHPLVSPIVQGSLGNL # PPLYIIAGDGEVLRDEIIHLAHRAAHPEDYRVRSGLLREGNRQKENATKFTTPTKVHLQVFDVIPNYNAAELTYTNARQAKYAYRSIAEFVKHATNDD # PGLEPFPELQRPPSRASVDSEALGEHMAKRSPFTIFSRKTSPKAKNVLRQQSTGVKLYNQEVAAVANQIQNLEQENLSSSQSTTVFKGDRLETSNGRK # DGFFVMVRERVDIRGVTRDMEPREEMACLQINSSQIGLIKEAPTVRWHEGQKKWDIMFAHEARRVLKHRKKIERKIQDLLRSAREQGLLLVGETDSAD # HPQMRDASTERSTSMNPIDGTIRSDRRWGPLDLDDEHPPPSAIAKRRDTVYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g700 ### # start gene g701 4 AUGUSTUS gene 2715116 2715712 0.98 + . g701 4 AUGUSTUS transcript 2715116 2715712 0.98 + . g701.t1 4 AUGUSTUS start_codon 2715116 2715118 . + 0 transcript_id "g701.t1"; gene_id "g701"; 4 AUGUSTUS CDS 2715116 2715712 0.98 + 0 transcript_id "g701.t1"; gene_id "g701"; 4 AUGUSTUS stop_codon 2715710 2715712 . + 0 transcript_id "g701.t1"; gene_id "g701"; # protein sequence = [MKSKEPLQGAELEQYLQKEQAAREKEAASQAALARQQRILEADEDDSDSDSDSDEDEEDEVRRVLGQTDDPDERPLKP # RKGDNSDGNDWNHIDDEGLTKQLLSFDIYLKGNVSKATSFFKHVGGQTHRFRMFPYVEKKRRVDEYGETVDVGMWLRKSKILEDEAESDDIKDYRRRQ # AEEELKVQSFYDLHNLNTEVRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g701 ### # start gene g702 4 AUGUSTUS gene 2731983 2732831 0.63 + . g702 4 AUGUSTUS transcript 2731983 2732831 0.63 + . g702.t1 4 AUGUSTUS start_codon 2731983 2731985 . + 0 transcript_id "g702.t1"; gene_id "g702"; 4 AUGUSTUS CDS 2731983 2732370 0.63 + 0 transcript_id "g702.t1"; gene_id "g702"; 4 AUGUSTUS CDS 2732461 2732831 0.73 + 2 transcript_id "g702.t1"; gene_id "g702"; 4 AUGUSTUS stop_codon 2732829 2732831 . + 0 transcript_id "g702.t1"; gene_id "g702"; # protein sequence = [MQFTNSSVSNSKILMPELKDRSAWWDFLAGKPESVWNPTKKPKALKQKKFGRGMRAFHDDATALDYNGVSTHDGEVIS # QPVGMQPATPAQHDDNKARLESPLPPCKPVIPTPLLLGQIDDVSFFFFCLAKDRQPPFPRLTQAHFQWIFALLARVGEHISADDMNLLRNLTRACIAL # LKVTICERTSHKAHSGDKMVKKELKDQEDNGEEHEGGYSDEQASCWMIISIVIGIWGQRDLWMDAEDMLNSLSNAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g702 ### # start gene g703 4 AUGUSTUS gene 2737658 2739291 0.33 + . g703 4 AUGUSTUS transcript 2737658 2739291 0.33 + . g703.t1 4 AUGUSTUS start_codon 2737658 2737660 . + 0 transcript_id "g703.t1"; gene_id "g703"; 4 AUGUSTUS CDS 2737658 2737811 0.33 + 0 transcript_id "g703.t1"; gene_id "g703"; 4 AUGUSTUS CDS 2738390 2739291 0.61 + 2 transcript_id "g703.t1"; gene_id "g703"; 4 AUGUSTUS stop_codon 2739289 2739291 . + 0 transcript_id "g703.t1"; gene_id "g703"; # protein sequence = [MADHTGSSASSSRPLPTPRVPIMRPFRHEEAEICLTASSRDLVLILGTIGITVSDLIIHGHFQLSHIKDQLTSLSQSF # ELIQQRWEQENVEADTLRKELSSARALNERFQIRNQNLEAQLAQRKSSRARHTLGRLLREDVARVSGLSTISKNNPAYIQKANARLTHAREHDIISNS # DSVGDDVESEYGSVGTSLSTVRGHDRDSESRVAATDSEEEDRKSGEVPDDYLSPSSQTKPGALPSSSPGLSDNRVGQITTDSRTVKSPASSIKRYHET # ASVTSASSTLSSDFIPESFAVQSNAPQWTIQIQKPPVSARVRCGPMKGSHLSQKLGIEEDTVRVSLSRVSAQANPDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g703 ### # start gene g704 4 AUGUSTUS gene 2740404 2740691 0.96 - . g704 4 AUGUSTUS transcript 2740404 2740691 0.96 - . g704.t1 4 AUGUSTUS stop_codon 2740404 2740406 . - 0 transcript_id "g704.t1"; gene_id "g704"; 4 AUGUSTUS CDS 2740404 2740691 0.96 - 0 transcript_id "g704.t1"; gene_id "g704"; 4 AUGUSTUS start_codon 2740689 2740691 . - 0 transcript_id "g704.t1"; gene_id "g704"; # protein sequence = [MTHVVKVASVEVAIDVADEDVVLGKICVAEIEVTTSLKVEELEDVVEVETSSVEVEEVVAKLVLAPLLGLNEGEVKGT # EEGVDDVAEKGTNENGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g704 ### # start gene g705 4 AUGUSTUS gene 2741293 2741760 0.93 + . g705 4 AUGUSTUS transcript 2741293 2741760 0.93 + . g705.t1 4 AUGUSTUS start_codon 2741293 2741295 . + 0 transcript_id "g705.t1"; gene_id "g705"; 4 AUGUSTUS CDS 2741293 2741760 0.93 + 0 transcript_id "g705.t1"; gene_id "g705"; 4 AUGUSTUS stop_codon 2741758 2741760 . + 0 transcript_id "g705.t1"; gene_id "g705"; # protein sequence = [MDFADTRPYSTPSEPASHDLSHEPMDAYANRDPAFYLTHDPFVANAHNMPYAGSASLPEITYSYAQDVNNQYPYYGNE # VNNVVPPSVGMRSTPALPTHDPRNPFESVNITPPRNAAIPQELERISSNPFEEPAFRASYQPSVDSFYGASIDGRPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g705 ### # start gene g706 4 AUGUSTUS gene 2744646 2745107 0.17 - . g706 4 AUGUSTUS transcript 2744646 2745107 0.17 - . g706.t1 4 AUGUSTUS stop_codon 2744646 2744648 . - 0 transcript_id "g706.t1"; gene_id "g706"; 4 AUGUSTUS CDS 2744646 2744930 0.97 - 0 transcript_id "g706.t1"; gene_id "g706"; 4 AUGUSTUS CDS 2744994 2745107 0.17 - 0 transcript_id "g706.t1"; gene_id "g706"; 4 AUGUSTUS start_codon 2745105 2745107 . - 0 transcript_id "g706.t1"; gene_id "g706"; # protein sequence = [MEELFVPYTEGQRYLERESQSLGALYAGILVNFTRYHQAKAPKGKSSIFDRVVNQLSNTAATTSSGGVQTTSAQAANA # ILRFGGLNAEKNVVDEEPVREEDGQLSVDVAEKMLKWHAEAIGRCVELSAPNDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g706 ### # start gene g707 4 AUGUSTUS gene 2748981 2749490 0.48 + . g707 4 AUGUSTUS transcript 2748981 2749490 0.48 + . g707.t1 4 AUGUSTUS start_codon 2748981 2748983 . + 0 transcript_id "g707.t1"; gene_id "g707"; 4 AUGUSTUS CDS 2748981 2749490 0.48 + 0 transcript_id "g707.t1"; gene_id "g707"; 4 AUGUSTUS stop_codon 2749488 2749490 . + 0 transcript_id "g707.t1"; gene_id "g707"; # protein sequence = [MLIHPRFPPLLRPLPKLDSFALFRSEESAEEAEERQHLGLNVPLAQSKSVSAAIQDIDMDNSLKSAGLSIVPAPLSTG # LSITSQISTAFPVERRPDVGAPSLSMTTTAEFQRNLTSSLPSVTPRESAASFTQPSQASGSTEETNATTSEDLDLDEDMPSINLESDSDSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g707 ### # start gene g708 4 AUGUSTUS gene 2750117 2751193 0.66 - . g708 4 AUGUSTUS transcript 2750117 2751193 0.66 - . g708.t1 4 AUGUSTUS stop_codon 2750117 2750119 . - 0 transcript_id "g708.t1"; gene_id "g708"; 4 AUGUSTUS CDS 2750117 2751193 0.66 - 0 transcript_id "g708.t1"; gene_id "g708"; 4 AUGUSTUS start_codon 2751191 2751193 . - 0 transcript_id "g708.t1"; gene_id "g708"; # protein sequence = [MANLTYAISYDKWEYVLGEVCRVLSIGGRLELIDDHIFFPYGKPLSSPPTLPPMNSEAHRRNRPSSQERHDPDLFGVG # ADDEGDASDTATLNGNRAGPRPHRNARSPPLGVTTPAATSAFVSVPNVEFQYWAEQVDASQELEALFEQMMNIRFGIHLCPSEFIQEMLSEIFGHSRE # VRTMHLTTALHDARPITPTNTFPADSKESFPAQRTRASSSHAPDIDVEPADPNEHNPLEISPGLVLWPSTLLPMSNTELQAHAMKHPRILLSSKAALS # DHASETLDIDTEDDTFMEAMWEYERYALIFVELVIILISKKYKLPELTVEPTTTNDFEHLISAFFNILYLGGYRTWLQTGKSAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g708 ### # start gene g709 4 AUGUSTUS gene 2751294 2753177 0.93 - . g709 4 AUGUSTUS transcript 2751294 2753177 0.93 - . g709.t1 4 AUGUSTUS stop_codon 2751294 2751296 . - 0 transcript_id "g709.t1"; gene_id "g709"; 4 AUGUSTUS CDS 2751294 2753177 0.93 - 0 transcript_id "g709.t1"; gene_id "g709"; 4 AUGUSTUS start_codon 2753175 2753177 . - 0 transcript_id "g709.t1"; gene_id "g709"; # protein sequence = [MSSRTAAGRKRLQQPKQQKTSSFKSAFKKNFTSDAKSPPSSSSLPSSLSNLTVHQTTFRQPYNLSDTSDHEDFTLAVP # STSRIPSSETQWHPQISSGSGALHSHGPSEIRHKATRAPPSSYATGPTHPRTFDLYPSPPGSAEDIDFRGTSSDSSMRPFSLERIPSPSPLLKQPELR # SGHVPMRYGSAPTSMLSVSSVSATDSSSQSRMVSHAFHSNYPSPPESNSDPLSPLSLSPASAAHSTLPSLISESSSDSASTRSGGMRSSTSLAVNAPA # SIFSSSSDSSAELERPSSSSPSKTSPGFIYPSSRSVGRPSPGGPKFKFKKRSKGAELDAVTTGVVDKGSYSPQSPDYRVPSRATSAGLRLSMIGPSSI # STPSLKSPRSFGSASNSSGSSMKSSDPGFVFPTTRSRAHPNVGPRKFRKKKVLDQYENEGDKAAQKFMGISLNRKKKSSSRNQFPAIPEIPQSNDTIS # HVDPDTPTPTAAEFGEVYTAAHSGEAAVRIPSKLGTYPLDPYDSTLLDRSVFLDLILQAFKLLNVFLISSDKSTYTLLRRLNSTDTPSFCHFGNDPPS # SVLDLGSGQGHWILEAAIHWKGYGTHFTGVDIADTMKVLRPLAIKHGVAENIKFVRSNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g709 ### # start gene g710 4 AUGUSTUS gene 2756614 2757123 0.97 + . g710 4 AUGUSTUS transcript 2756614 2757123 0.97 + . g710.t1 4 AUGUSTUS start_codon 2756614 2756616 . + 0 transcript_id "g710.t1"; gene_id "g710"; 4 AUGUSTUS CDS 2756614 2757123 0.97 + 0 transcript_id "g710.t1"; gene_id "g710"; 4 AUGUSTUS stop_codon 2757121 2757123 . + 0 transcript_id "g710.t1"; gene_id "g710"; # protein sequence = [MRTTKFIALSYPKFASHAIGGIVGNILTALFAQASVAGFDGFTVIPGGWLDRHWIQLAWHVADSCAGVSYSFTMTVSL # SGFNFGKYSHRFIQTIILWIMHYIPGLRIRVPEGVEIVGIDESDMGEFAYDYVAMEPELKGVSYVSSVVRRESDPESLMKERHSTASGSNH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g710 ### # start gene g711 4 AUGUSTUS gene 2757571 2761210 0.25 - . g711 4 AUGUSTUS transcript 2757571 2761210 0.25 - . g711.t1 4 AUGUSTUS stop_codon 2757571 2757573 . - 0 transcript_id "g711.t1"; gene_id "g711"; 4 AUGUSTUS CDS 2757571 2759224 0.74 - 1 transcript_id "g711.t1"; gene_id "g711"; 4 AUGUSTUS CDS 2759346 2759508 0.74 - 2 transcript_id "g711.t1"; gene_id "g711"; 4 AUGUSTUS CDS 2759568 2759730 1 - 0 transcript_id "g711.t1"; gene_id "g711"; 4 AUGUSTUS CDS 2759825 2761210 0.29 - 0 transcript_id "g711.t1"; gene_id "g711"; 4 AUGUSTUS start_codon 2761208 2761210 . - 0 transcript_id "g711.t1"; gene_id "g711"; # protein sequence = [MFPASSSSTLKNRKSSQHMLYDTHNGLKSRRYSDTEEFHPHEISHLSPLPSSPMLSPAIYPHGLQQHSRSPHSGHSST # YPSPNPGYSRRSSYAQQPSSPSTASSSPPPVTSPLIAFTRLNDDHHYAYASRVQIVGRDTNESDLVRDGQYDEDVRYFSQNDENDLRPKLPSFKSLFG # KSERYDSLVQRPEEEDLRIRTYSSPISSPSFEATLPPLKNFSVIRPKPDVTSSYTLQPITKTSIPSTPQHIKGYTEIDVNKPQDNCTRNRTSSRTNAA # FGHVSLDLESTIPIQTISSHIIHQTPTRRKNLFSDTDTPSTSKDTEIIFYSPSKVSPFPRRTYFQESSERERCTPEPVNVRYRFNQLVEIADMANPDF # SEAKVDVLQQSTDQTEEALYIDSATSPLSSPSAYLSSLPPSSPPTSEAQLSPLMHGNDLSVTTATPLTDVMNLTAEPRVDVDCLGLQGIELEDNSSPT # SALTQDLIVTNFAVEADDDDDHPFSPAGAIDLESNKVAATLVTEESAPELNQNTESQHSPSQVIDDCGPYKSSSNKDEPPPASIFSESKLLSISADSV # QGIKNKTKMKSTSSAPSISSSAPRVTVTVVKRMRPVPKIHHIVNEASVKKGTSMSIKGKEKGSSKTKPLDSHSSSSKRGRTSQTASKGKVLDDPPRKK # LKLITEEDQTNTASNSLPSSLAEAICTSFDTSNTSITDSLSIVPAKRKASHEIPSPEISNSSAHSPTISSKHSPAFPSHSSNPQKRLRTVPVEVPVPS # KDKSSSPTDNNTWVDENWVDAVAAAYGSPHHSPQTLRRKTAAKTMPEIGSIEDEDEDDNERRSLKVKFPRSPHKRIVIESESESEDGEVEKRLPLRQS # SRQMVDSDSEPEQDVEIERRSKSHTSHPALSNDVESSESELTDSDESEAVDEEEKEKREEEGGEEEEQEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE # VPTKEKNALGSNHQKPRSSLSSISPFDRELVGIIVETMSLSRSSSHLAFSLYKTVRETRNSVFAQLMKANWAHLDVVTRELRSKGLCGHVPGNQDDLP # RRGRPKRNTSMNEEGGTAGMSETDIMWVSEFERVMTESADRYGMFGMVESSFRNVRLLSLAST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g711 ### # start gene g712 4 AUGUSTUS gene 2764835 2765734 0.45 + . g712 4 AUGUSTUS transcript 2764835 2765734 0.45 + . g712.t1 4 AUGUSTUS start_codon 2764835 2764837 . + 0 transcript_id "g712.t1"; gene_id "g712"; 4 AUGUSTUS CDS 2764835 2765197 0.83 + 0 transcript_id "g712.t1"; gene_id "g712"; 4 AUGUSTUS CDS 2765283 2765537 0.52 + 0 transcript_id "g712.t1"; gene_id "g712"; 4 AUGUSTUS CDS 2765600 2765734 0.94 + 0 transcript_id "g712.t1"; gene_id "g712"; 4 AUGUSTUS stop_codon 2765732 2765734 . + 0 transcript_id "g712.t1"; gene_id "g712"; # protein sequence = [MVKTLEICSVVTLIFAYANAQSTASQYGQVMLKDLNHNPDTDMLFLQCGGIGWTGATLCPSGWSCNVVNDYYSQCLPG # AATGTVTVSASSASTSGGSTSTSATAPVATSTLLPGNSFIRSVSITPGNATAAIMGVYTSAAQFQVTGGQLIQESTPPLYAIVEDRANSTVMKLGVSW # SETPATSGTFDFSGDTIEWSIPTIDRPQVNAWLVCPDDEENNLLFVNLGYYDYETPTGCADETIHFYTGATAVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g712 ### # start gene g713 4 AUGUSTUS gene 2771648 2772007 0.63 - . g713 4 AUGUSTUS transcript 2771648 2772007 0.63 - . g713.t1 4 AUGUSTUS stop_codon 2771648 2771650 . - 0 transcript_id "g713.t1"; gene_id "g713"; 4 AUGUSTUS CDS 2771648 2772007 0.63 - 0 transcript_id "g713.t1"; gene_id "g713"; 4 AUGUSTUS start_codon 2772005 2772007 . - 0 transcript_id "g713.t1"; gene_id "g713"; # protein sequence = [MKDTHTTVVRTTVVTGAVKTDALGEVEVEESVSEVELGAAEVGTFDVLVVVLDVGGKVVELVESVDEGEEVEVEEEVG # GEDVSGVDVVEEVSDVDVSEAGDDDDLESVKTTSKVGNGRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g713 ### # start gene g714 4 AUGUSTUS gene 2772587 2773201 0.58 + . g714 4 AUGUSTUS transcript 2772587 2773201 0.58 + . g714.t1 4 AUGUSTUS start_codon 2772587 2772589 . + 0 transcript_id "g714.t1"; gene_id "g714"; 4 AUGUSTUS CDS 2772587 2773201 0.58 + 0 transcript_id "g714.t1"; gene_id "g714"; 4 AUGUSTUS stop_codon 2773199 2773201 . + 0 transcript_id "g714.t1"; gene_id "g714"; # protein sequence = [MAEVEDDGMGGRLNGSAIGAGVVAPYPLHHPTTSPTRSAASPPPSARSWGNSSDAQHSLYNGHVADWRGPSPGPSIPT # QYTGGSGSAAPPSSYSHGMISNLPPGASPGPAGPGTPSSAYAYPGATGTHGRRYSAGTSASSGDRQPLYAAAATGSASSSTGGGSVQNSGRFAVANPD # DGTYAGGFNEDARRAYITGGPSGESCLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g714 ### # start gene g715 4 AUGUSTUS gene 2773585 2773974 0.71 - . g715 4 AUGUSTUS transcript 2773585 2773974 0.71 - . g715.t1 4 AUGUSTUS stop_codon 2773585 2773587 . - 0 transcript_id "g715.t1"; gene_id "g715"; 4 AUGUSTUS CDS 2773585 2773974 0.71 - 0 transcript_id "g715.t1"; gene_id "g715"; 4 AUGUSTUS start_codon 2773972 2773974 . - 0 transcript_id "g715.t1"; gene_id "g715"; # protein sequence = [MLTKNREQLLLEEWLKEQRNHSKHSETTQINSGMASQVIPFINCTNHEYPLDGFVHFTAPLSAMIWKILVQSGTTIQH # KDETLVILEAMKTQIPVKAGRQHVGRIIKAFEKGVQEGEQVNAGDNLFFLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g715 ### # start gene g716 4 AUGUSTUS gene 2776093 2776623 0.25 - . g716 4 AUGUSTUS transcript 2776093 2776623 0.25 - . g716.t1 4 AUGUSTUS stop_codon 2776093 2776095 . - 0 transcript_id "g716.t1"; gene_id "g716"; 4 AUGUSTUS CDS 2776093 2776623 0.25 - 0 transcript_id "g716.t1"; gene_id "g716"; 4 AUGUSTUS start_codon 2776621 2776623 . - 0 transcript_id "g716.t1"; gene_id "g716"; # protein sequence = [MASAFTVLSPGLETTVQDLPGRLVGMGIPVSGPMDPTAFRLANILVGNDQNTEAMETVIVAGMDLILHFHAKAVIAVT # GKDVIVEVNDAIHDTWTAIEVAQDTILRLQTKEAATTGFRNYIACRGGFPQIPKYLGSKSTSIKFGGYQVRLTFTELEHRTPHISDLLLYIINRADNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g716 ### # start gene g717 4 AUGUSTUS gene 2784570 2784959 0.62 - . g717 4 AUGUSTUS transcript 2784570 2784959 0.62 - . g717.t1 4 AUGUSTUS stop_codon 2784570 2784572 . - 0 transcript_id "g717.t1"; gene_id "g717"; 4 AUGUSTUS CDS 2784570 2784959 0.62 - 0 transcript_id "g717.t1"; gene_id "g717"; 4 AUGUSTUS start_codon 2784957 2784959 . - 0 transcript_id "g717.t1"; gene_id "g717"; # protein sequence = [MGFDWQRLSGAQITSIEGQDPYDYADFVADTVSGNYLDHGVRVNSVFSSYRISGTDFSQRLGDLGEYSFGMVVETEES # SNFLSRTAGPTGVKQTSLEVKLIVANSTTEETVTIPFIASFLGVAFTDQAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g717 ### # start gene g718 4 AUGUSTUS gene 2790077 2791372 0.47 - . g718 4 AUGUSTUS transcript 2790077 2791372 0.47 - . g718.t1 4 AUGUSTUS stop_codon 2790077 2790079 . - 0 transcript_id "g718.t1"; gene_id "g718"; 4 AUGUSTUS CDS 2790077 2791372 0.47 - 0 transcript_id "g718.t1"; gene_id "g718"; 4 AUGUSTUS start_codon 2791370 2791372 . - 0 transcript_id "g718.t1"; gene_id "g718"; # protein sequence = [MFLQTLIYSLLQALGTIRIERKLGDHSVQINRKLDELLRRTQVRNSINNGTVVDRDLAKAPIAIPLQVRTTSDSSSNS # SINALNVPGVALKSFSKTGITPSRMISRSKELSIQVSKYSSTAVVPISKNTSLKEPKTFALGRPRFMGFLSSLKSENSVTSMSANSSYEYQANELDSE # CKRLRSHQYLSEALIPGRKAVALRRITYATDKSVTTTAALARSLTYLTRCLKDIHVDSHLAGTQVSAELTAVLSESIALYKLAFKEDKACRVDLATAL # YNLSVLQSEPPKPKFSGNSSLNPNVILNNTIQRSRNLTSALAAAEEAVHHFTILEREDPDAFGMDLANALVNLSFILSDNGSHEEALSISRKAVMLAY # RFNSTDPHTHERARNIRTLHKALTRVSFCLYNLGRIREAQEAEMEANDVLKRPFFTIGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g718 ### # start gene g719 4 AUGUSTUS gene 2798794 2801676 0.55 + . g719 4 AUGUSTUS transcript 2798794 2801676 0.55 + . g719.t1 4 AUGUSTUS start_codon 2798794 2798796 . + 0 transcript_id "g719.t1"; gene_id "g719"; 4 AUGUSTUS CDS 2798794 2801676 0.55 + 0 transcript_id "g719.t1"; gene_id "g719"; 4 AUGUSTUS stop_codon 2801674 2801676 . + 0 transcript_id "g719.t1"; gene_id "g719"; # protein sequence = [MDAYTPPTPVSPNSRSVTANSSPFTTYTRHHRKRISALRLSSDTTSTLPEYIPTNPNIPSVAHWQTVPEATEIDDAPP # GYSSDSAQEADEDTDLSDEDRRRQIQRSVFATVGINSAPATATTFTSSPSLRPSRPKRELSHRRKRSNPTLSLDPIQSNSDLYLDSLLERSVHALEMS # NVLLQSSMSTKTSLSGILHQETDEDEPMVPSSAIRPSTSRSLAGSGMNSLERSARGLSARIMGGGYVHETWIEDLEQIGKDVDQLFSEEAQKERRQRN # RTRRNASQSGSSQGSISSSLPVVSSTPLQSYNKFDRDRIAHSSGTSPQQHSNHVNRRTLVDLRSHSQTRSFSNPNRPEHLESLKRHDAMAGVPHLRYD # VQDRERFISQPPRALTQYVVVKGDLTHGHEEENSFQHHQHHRRNSSRGLNGDGNDNNSDNGWQEGPIGKETELRKNDEDEPIVLPSTLGLRSLGTHST # IRRNKQLLSRSRSPSPERSVSRFVHHHDDQLSTPVTISTPTIVLDPSSSLPSHSSLPTRAPNAYNMLSSFVYPASSSSSNLTPKRSDSSSSNSRPKGK # TSPFASPWASRRSSINSTVAERPSFGATSGTNGHEHFARRRHSTSPAASMMSNRTTSTTRSGGSGSSSTVTAGSGSRSRSQTPKPLESGPIVTSSGRR # HMTPPLEVSSNSGSGGEGNCSERREGSEGSSDSCPTKQTILSLRKILDTHSPPEKLSSDDWTLISKPPLLLQQSSKAGVPVEAGTSNATASISKLFTR # GVHSHEGSVTRRFDEQRQSSFKGKGKATSTDSAASSAPSTPITTSRVPTLTPNKMSFDNIPKLLGTSVALALGASSPLSSTPSSGASTPATPSHLKRI # SFAELPEGTQGTGSNRKSRKRKGKQKASGSRLSNGGASYTKQSGSDDEGDEPRGWLRWLINAAGADSGRPDKIDERLGKGWGSASRGPGYGGMDEWGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g719 ### # start gene g720 4 AUGUSTUS gene 2810384 2812517 0.08 + . g720 4 AUGUSTUS transcript 2810384 2812517 0.08 + . g720.t1 4 AUGUSTUS start_codon 2810384 2810386 . + 0 transcript_id "g720.t1"; gene_id "g720"; 4 AUGUSTUS CDS 2810384 2810405 0.22 + 0 transcript_id "g720.t1"; gene_id "g720"; 4 AUGUSTUS CDS 2810669 2810868 0.27 + 2 transcript_id "g720.t1"; gene_id "g720"; 4 AUGUSTUS CDS 2810919 2812517 1 + 0 transcript_id "g720.t1"; gene_id "g720"; 4 AUGUSTUS stop_codon 2812515 2812517 . + 0 transcript_id "g720.t1"; gene_id "g720"; # protein sequence = [MTLSDSRNEQQHSSATPVISSKSADTASSAASMEEQHHTSTTSATASISAHFSDGNSDGTSIGVSTAQLASTTSTSST # SSGDKNSQTNGVGFPTSNSSAITPTNSLSSPAPTLTTKSFSDTGTHISGKTTDTGTQVSGKTTDTAISSQTFSTTTSSPGLSATSTHGHGISETQSSS # SNGHTRSTKGSASASVTLTTSATSSVASQHSKGHNDGETTSFGSGGLGIGLSVPGLGLSITVGKSGIGAGASLGVQGHSKFTASTTGSPRSSDSTHSQ # TDGVPSTTSSDNFPTRTPNQTLPPPTFPDPIRSIVTQVVSALNPHTTRSSNENHTPPQNPQSATQSSNGDGSHHSSSSQAGSPPPTGEPHRNSHTATA # ATSTQSSGSSNGNGNGNGNGSSNSNDGSPTATNPATSSSTPSSGSGNNNNGNGNGNGNGNSNDGSPTVTNPVTSSTHSSGSGSNNNGNVNGKGNNTGN # NDVGSTTSTQSDLASPTHSSGSGDDNGNGDSSSGDGSPTVTKSSGINDSSDKNPSPTVSSQTGGRLPDSGTPSLTPSQSPSDSIAQDRPGQTVVLTRT # TNALSTAATESKAALGGTASGNGQLVSGLCKHSILYLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g720 ### # start gene g721 4 AUGUSTUS gene 2815347 2816901 0.38 + . g721 4 AUGUSTUS transcript 2815347 2816901 0.38 + . g721.t1 4 AUGUSTUS start_codon 2815347 2815349 . + 0 transcript_id "g721.t1"; gene_id "g721"; 4 AUGUSTUS CDS 2815347 2815359 0.38 + 0 transcript_id "g721.t1"; gene_id "g721"; 4 AUGUSTUS CDS 2815484 2816901 0.94 + 2 transcript_id "g721.t1"; gene_id "g721"; 4 AUGUSTUS stop_codon 2816899 2816901 . + 0 transcript_id "g721.t1"; gene_id "g721"; # protein sequence = [MDLPRVSVSEYEKSPYYNGITGDVDHPNLVYRSDFLTTPFPKPFGRHASLLIKSLRGVFDTPLNDVWDSVGPQIIDLL # NARQIDWTSVDPVRFFTHAPLGEDPKGSPGPVVIWVGVIPDSTSADTAHEVSQQILTLLQKNGVNNAVVEWREAVLQMLAGLPLMCHVDVSDATHHVR # RFLTPLLGTPLTTEGMEEGTLTLWFHEIKDNDGNPSNKVYGVSNCHVLRKNTASDYEYTDGAPLHYVRVCGMRRFQRGLDEITKAISNHSFSADFWTL # DIAKLQAKAKEKTDAANEREIKARQRQLVNDTKATIDLQALHEDATKYWSDLKLYRNIGHVQYAEAISVDVEGGTRYTSDWAAFVADEAKVKDEFEGN # VVDLGAFLFAFDTSALKLNIYTGSKYSPYVLTHMFNPPGGGSTTFKFPYDRKLRIEGCATKEDLSHPAESDSEGQHCLMVGKNGNTTDLTIGRYETLC # RSSFVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g721 ### # start gene g722 4 AUGUSTUS gene 2829293 2829835 1 + . g722 4 AUGUSTUS transcript 2829293 2829835 1 + . g722.t1 4 AUGUSTUS start_codon 2829293 2829295 . + 0 transcript_id "g722.t1"; gene_id "g722"; 4 AUGUSTUS CDS 2829293 2829835 1 + 0 transcript_id "g722.t1"; gene_id "g722"; 4 AUGUSTUS stop_codon 2829833 2829835 . + 0 transcript_id "g722.t1"; gene_id "g722"; # protein sequence = [MLFCRIPTSYSLPSSPKPIEPYEVAKEILIPLGEYFQVQDDFLDFSGVPAQIGKVGTDIVDNKCSWCINTALAYATPA # QRKILDENYGVKPTEEEKEIAKKMAAGKNGEEQGYLGEAEKRVKKVFEEIGLRKKYAEYEEGVFQKLNEMIDNIDEGAQGQQGVLKKQIFISFLGKIY # RRQK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g722 ### # start gene g723 4 AUGUSTUS gene 2831198 2832558 0.43 + . g723 4 AUGUSTUS transcript 2831198 2832558 0.43 + . g723.t1 4 AUGUSTUS start_codon 2831198 2831200 . + 0 transcript_id "g723.t1"; gene_id "g723"; 4 AUGUSTUS CDS 2831198 2831983 0.43 + 0 transcript_id "g723.t1"; gene_id "g723"; 4 AUGUSTUS CDS 2832067 2832558 0.99 + 0 transcript_id "g723.t1"; gene_id "g723"; 4 AUGUSTUS stop_codon 2832556 2832558 . + 0 transcript_id "g723.t1"; gene_id "g723"; # protein sequence = [MPTQDLAAWVRGGTTTARIESSNDFLPAVKAISPLSLGEVVKDPFDSQRDGEGAVSFVLSYTNPHSCLATRSNVKSTS # AFSTTSYSSTASTSALRDPSTASTFSVAQPNHTAFTPLSSTVTSNAPVTSSISSSDPSETFVPDIPESPEVPTIPISKNSNPTGSEPDFDILVLGFEE # LDLSTEALLYSTSTAREDAWTVAVFAALGEKAEMYEKVNILFILLPCHSKSRSDTRKARLETTCRHARHGYCEEISTIMFFKYHDYGNKGGTAVRLTF # SPPTSSLEDLDSALNDASSIEHFQHGIENPGPTVLTFVVSHLAAFDEMVAKRNTDFHELSKRLVFDSSILATSASAGSVSTTNSSQRNNVGPVSSQAV # EDTSSAMPGGLAVSQGLISVPEKFGVFESDILFWIVSSRSPIKLLIDDIVLSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g723 ### # start gene g724 4 AUGUSTUS gene 2834812 2837639 0.01 - . g724 4 AUGUSTUS transcript 2834812 2837639 0.01 - . g724.t1 4 AUGUSTUS stop_codon 2834812 2834814 . - 0 transcript_id "g724.t1"; gene_id "g724"; 4 AUGUSTUS CDS 2834812 2835602 0.96 - 2 transcript_id "g724.t1"; gene_id "g724"; 4 AUGUSTUS CDS 2836687 2837038 0.37 - 0 transcript_id "g724.t1"; gene_id "g724"; 4 AUGUSTUS CDS 2837142 2837639 0.15 - 0 transcript_id "g724.t1"; gene_id "g724"; 4 AUGUSTUS start_codon 2837637 2837639 . - 0 transcript_id "g724.t1"; gene_id "g724"; # protein sequence = [MAEAAGVSESQPPRSTQIYMAAQGRDSPNDGSSPYSVRLRRAGSTFDLPSTPSPSPRPSGSSRKVTTGSAPGSGSATP # NAFPTLGGSLTPVSKSRDPAASLNGRLPSQATSSGSNTGPILGPIFSPSRQPAPKAPATAPRRVSYVHILYCFTSAHILMSTQKHQRQLQLEQGTSNI # NDKRSLLEIQQEEQAKREEEDFLKWWNAEEERVRLETEAVERLQSGDKGRQGSKGQYQKNQQKRSKKGKTPNVGRNTGNSGEGPSASAISPSRPSRDV # NLTQSASGPIRQIEHFPTTSGDAPTSPIVIEDCGELSPDDPSLAALPVGSDGDPYEDYPDDDDHEVSNPQVALDIAKSIREVGNKLFKEGRTDLALAK # YQSAFRVLNINASFLTFYKESIRYLDVHHVLPDDVSPELTEAYKALLSPLLLNSALAAIRAQPPTSLNAETAVKNATRALNTLTLNSADKGKLFACFI # TFHSYPTSNPIVAKALYRRAIAHSILKDDDEAEKDLIEANKLVPDDQAIVGELGRIRNKRKEKRDKEKKAYKKMFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g724 ### # start gene g725 4 AUGUSTUS gene 2838499 2841335 0.74 - . g725 4 AUGUSTUS transcript 2838499 2841335 0.74 - . g725.t1 4 AUGUSTUS stop_codon 2838499 2838501 . - 0 transcript_id "g725.t1"; gene_id "g725"; 4 AUGUSTUS CDS 2838499 2840019 1 - 0 transcript_id "g725.t1"; gene_id "g725"; 4 AUGUSTUS CDS 2840088 2841335 0.74 - 0 transcript_id "g725.t1"; gene_id "g725"; 4 AUGUSTUS start_codon 2841333 2841335 . - 0 transcript_id "g725.t1"; gene_id "g725"; # protein sequence = [MGRLHTAVISNSPTPIGSGSTLSLCGFGSGGRLGVTQHTQYALRPLSWAANAQAPSTPAKALTQFKVKVIAVALGQDH # TLALTENGEIYSWGLNRFSQLGYSIDDGSSAAHVFSLDDPSIFITQSTTRTDSTISSNGEQIQLIPRRVYGPLKKEFVLGVAASKGASACWVREGTDG # ASGGSNVYTWGLNGGQLGYDRTATGSGAQVQSLPRKVTKITRPVVQIALGESAMACLLSGIGSVGGGWKGDVLVFWGDQVGRVRYSCFLLIYSTLYEL # TVPPSFPIHTFPLSITPYRPPQALKSTRIVKIVCSDESPPPFSFSSISSSSAASAQSSSHNSASNLSAMLNSQSTNVNQNNINFACVSEGGEVFTFGV # PGVPPLGVLGSGSGSPDADGNAGSGLALAKIIKPQRVWALRRGLDVAIGGDGSLIVCTDSGHVYVRARSSDTIFGGSKSSSGGGKSKFVRIPYLQRIV # GVCASSTGAFGALRVDADIRPINWPTVDEELLTKKVGRGLKKAVDALKGWDLVHDLKSIRPWMWKKSVDSPLDVEWLEDSCDVNPNPPSISVPPQTGA # MSPVHQTKPDDDADEYDDDGDLSIKQDIKLLYELCAFVTRQDTNIRSSGKLPYGADLIVYINSEPSVAGTKKSRSKTKASSLPQQLTVPLHAVLLGAR # SNAMASALLSPSESVFKCQVDARTVALSKTISVSSIHGNAIARRSITFTNFHSLAVLILLHYIYTDELICIWDRRVSTGIPSLSSSEALEVTPTLATQ # VKSELQNLARIFVLPEMLKAMESVVKRPVTETLRTDLATVWNLNNSSSPLPTLHTSSALAPDIVIQLAEGRELVAHSTILRARSVYFEDFLSEEDWTK # KRKGHEGVLKVDLRHVKSNVMEYVMRWLCCGQTEGLFGSLGEAFRPHACLPYLIDHSRIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g725 ### # start gene g726 4 AUGUSTUS gene 2852521 2852862 0.51 - . g726 4 AUGUSTUS transcript 2852521 2852862 0.51 - . g726.t1 4 AUGUSTUS stop_codon 2852521 2852523 . - 0 transcript_id "g726.t1"; gene_id "g726"; 4 AUGUSTUS CDS 2852521 2852862 0.51 - 0 transcript_id "g726.t1"; gene_id "g726"; 4 AUGUSTUS start_codon 2852860 2852862 . - 0 transcript_id "g726.t1"; gene_id "g726"; # protein sequence = [MVQMSNSDLGNGGFCHSSVRKVMEQFVGSPEPIPVHAGEPSTLGFQDDHDDTDELSETLKKLQFSQSPERYSASNRLM # LIKSGIAANQGNGMDTNHDVFKRPVFWTIQPVRDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g726 ### # start gene g727 4 AUGUSTUS gene 2855003 2855664 0.39 - . g727 4 AUGUSTUS transcript 2855003 2855664 0.39 - . g727.t1 4 AUGUSTUS stop_codon 2855003 2855005 . - 0 transcript_id "g727.t1"; gene_id "g727"; 4 AUGUSTUS CDS 2855003 2855524 0.59 - 0 transcript_id "g727.t1"; gene_id "g727"; 4 AUGUSTUS CDS 2855587 2855664 0.49 - 0 transcript_id "g727.t1"; gene_id "g727"; 4 AUGUSTUS start_codon 2855662 2855664 . - 0 transcript_id "g727.t1"; gene_id "g727"; # protein sequence = [MANFDFCPSNLPGPSYGHPDHEAGLQTSVLFDFPAHGPISNGSGATAQLQPPTLNIDPVSASSSVASSPISGPFTPAS # TISSYYVPSSFDQFVAPARPDTWDLQQQIPTNFDIQTGVPIAHEMNNSFYPWDPNTIWRTEPSMLLQNDFNLEVIPPIEMKNPQYPDSAPFVGLPGEN # IAGAGYWSEFGDYSGDSEFWNST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g727 ### # start gene g728 4 AUGUSTUS gene 2873117 2875363 1 + . g728 4 AUGUSTUS transcript 2873117 2875363 1 + . g728.t1 4 AUGUSTUS start_codon 2873117 2873119 . + 0 transcript_id "g728.t1"; gene_id "g728"; 4 AUGUSTUS CDS 2873117 2875363 1 + 0 transcript_id "g728.t1"; gene_id "g728"; 4 AUGUSTUS stop_codon 2875361 2875363 . + 0 transcript_id "g728.t1"; gene_id "g728"; # protein sequence = [MLNSEIYTYPPSIPPSPITSAAVTPDTSESQTSDSYFSLSSLEERSSPTPLTLLDQLHTAYALDDLPLAKILLLKITQ # DVQDITSRTDPRLDAVKPEDFDVAFLPKGGLMTPEDEARLFARQEKEQKRLQKEAQEAQEEANRHREKVERERREQEEKDRVEKEERERVERERAWEG # WVEGVWESAKKEMEEMKEIREFARRCQEDVERACQEQRRQDQRRRVNADRRRTHTAKGSVSTPTPLPRISYAHLPTTRLDSLPPSQTELLYTLPNIPK # HSTQRRRLTCTKDGSSCSTASTPSHPLSLRKTIVPSSSPFLALESLRESSTASSSLGLDASKKYPSTVSVQEVLAAMRGELFPSEFLQPEKRDSSQHT # LHGRTKSDDLDLGGLRQRSKTPHHGLKANSISSSSSALTRKQKRNEALLSELLSTSNDQLGMDRLCNRRKGKASDDIRMKRMTPLRMDSSASVTSATS # AKSVCAACSENLMSPSTMSSGISRSGSWLSFMSSSSVSSVSTVLTTPSASTSGSSPPIQPLIRTGSVFSTWLKGVASQSSPTPTDQCTCEHLSVSRMY # TASRGIECRLIPVGKDESPLPLDLLDVTVSPSPTLTNTESSAAIKQFNMASGKPTHSMASPTGSKSLLRSVTNFLDVAKSFQSAYMHAAMFATLATVP # NVSLYGSDWDREYEHKQGRKQSNAVGEHGGSKVKRRLQPVGCRVGTNEVSLFTSAIKKSSQQPIDADAGQPVTGEVLFKADL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g728 ### # start gene g729 4 AUGUSTUS gene 2882079 2883190 0.21 - . g729 4 AUGUSTUS transcript 2882079 2883190 0.21 - . g729.t1 4 AUGUSTUS stop_codon 2882079 2882081 . - 0 transcript_id "g729.t1"; gene_id "g729"; 4 AUGUSTUS CDS 2882079 2882705 0.88 - 0 transcript_id "g729.t1"; gene_id "g729"; 4 AUGUSTUS CDS 2882792 2883190 0.21 - 0 transcript_id "g729.t1"; gene_id "g729"; 4 AUGUSTUS start_codon 2883188 2883190 . - 0 transcript_id "g729.t1"; gene_id "g729"; # protein sequence = [MNSFLLLNTKVCMYPVSALKVNNVALVANVGPWKRLAARRGAVLKYWTPTPTTPNNPYSVNYKVEELLPLITSKTRIL # AFAACSNILGTILPIKDIVYAARNTAKEKGSKKFEVSVDCVAYAPHRLIDVRDWDVYGPHISALYVRLSSLLGSVSAITHHFLKVDHKSYKLQPGGPG # YELVYGTTGVLPYLLSLTPSNDLKASFNAIAAHEQKLLQPLLAFLTAPEQIERGVRIVGEESPGTNRVPTISFVVVGEKATKSSDIVKVFDKQGGVRS # ESFRTTTKLTSVAQIGIRFGHFYAYSLIDQLQPKIDVDDGVVRISLVHYNTVKEVERVVEILKKALA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g729 ### # start gene g730 4 AUGUSTUS gene 2884650 2885048 0.6 + . g730 4 AUGUSTUS transcript 2884650 2885048 0.6 + . g730.t1 4 AUGUSTUS start_codon 2884650 2884652 . + 0 transcript_id "g730.t1"; gene_id "g730"; 4 AUGUSTUS CDS 2884650 2885048 0.6 + 0 transcript_id "g730.t1"; gene_id "g730"; 4 AUGUSTUS stop_codon 2885046 2885048 . + 0 transcript_id "g730.t1"; gene_id "g730"; # protein sequence = [MAWSEKEARIRLSSDSNFPINREEESQTHTPIPKDPISESKVALDPRSTMLSAPETFKSDDAARPALFQPSLMVYEGS # RTSFDRPGSVLMNDRQSTTSRLTVPASIATHESSNAASSNYSYSQKALALYNCK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g730 ### # start gene g731 4 AUGUSTUS gene 2890082 2891014 1 + . g731 4 AUGUSTUS transcript 2890082 2891014 1 + . g731.t1 4 AUGUSTUS start_codon 2890082 2890084 . + 0 transcript_id "g731.t1"; gene_id "g731"; 4 AUGUSTUS CDS 2890082 2891014 1 + 0 transcript_id "g731.t1"; gene_id "g731"; 4 AUGUSTUS stop_codon 2891012 2891014 . + 0 transcript_id "g731.t1"; gene_id "g731"; # protein sequence = [MSTNVKSSRNPFRNRTITDDTQTQSSSTNEVSSSSVSTRPVTPPASASAPSVHNDHPVNHQRSSPPSTPSTSSSTDIL # NEELPPAYTFTPDSTHGEQTVEYGPRRPFQNAPPPISPSHPQHPLTANSTGWSTIQNNVIPPPPSQPQSLWQQITGHLADQLTGLSTGSQYDNRHGPY # SIPHHSGYSHPSPSPSQSPWTSQQASSSVEPPPLPPRRNASQMSPTSEFAQEFYAAGTGSPSDNVTEAIRYQPPLGPPPSGSPRTPDDDGRPTKTPVP # GHPLLNHGRLLVYPPGFQCEKCASFLPIHTYSLLIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g731 ### # start gene g732 4 AUGUSTUS gene 2894514 2894894 0.76 - . g732 4 AUGUSTUS transcript 2894514 2894894 0.76 - . g732.t1 4 AUGUSTUS stop_codon 2894514 2894516 . - 0 transcript_id "g732.t1"; gene_id "g732"; 4 AUGUSTUS CDS 2894514 2894894 0.76 - 0 transcript_id "g732.t1"; gene_id "g732"; 4 AUGUSTUS start_codon 2894892 2894894 . - 0 transcript_id "g732.t1"; gene_id "g732"; # protein sequence = [MTFASPTKSIPAAENLVIAGSKGWLACNSTSEGFKIVVKVVEEKENEKTGEEAEYEEREEIISFPRKGVETELAAFFD # AIGRQGTGESALDIGNPREALKDVAFIQAALNSEGNLIDLLELIQASS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g732 ### # start gene g733 4 AUGUSTUS gene 2896148 2896618 0.42 + . g733 4 AUGUSTUS transcript 2896148 2896618 0.42 + . g733.t1 4 AUGUSTUS start_codon 2896148 2896150 . + 0 transcript_id "g733.t1"; gene_id "g733"; 4 AUGUSTUS CDS 2896148 2896618 0.42 + 0 transcript_id "g733.t1"; gene_id "g733"; 4 AUGUSTUS stop_codon 2896616 2896618 . + 0 transcript_id "g733.t1"; gene_id "g733"; # protein sequence = [MASDSLTKLLPKDFIWGFATGKLIFYYLSTYRSQYTLASFQIEGSTDVDGRGKSFWDDFSRTPGKTLDGRNGDVATDS # YKLWKEDVELLAQYGVKSYRFSIAWSRIIPLGGRDDPVNPKGIEFYSKLIDALLEKNIIPFVVRLDFPFHILQLRSLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g733 ### # start gene g734 4 AUGUSTUS gene 2898268 2898806 0.35 + . g734 4 AUGUSTUS transcript 2898268 2898806 0.35 + . g734.t1 4 AUGUSTUS start_codon 2898268 2898270 . + 0 transcript_id "g734.t1"; gene_id "g734"; 4 AUGUSTUS CDS 2898268 2898380 0.36 + 0 transcript_id "g734.t1"; gene_id "g734"; 4 AUGUSTUS CDS 2898451 2898487 0.96 + 1 transcript_id "g734.t1"; gene_id "g734"; 4 AUGUSTUS CDS 2898603 2898806 0.98 + 0 transcript_id "g734.t1"; gene_id "g734"; 4 AUGUSTUS stop_codon 2898804 2898806 . + 0 transcript_id "g734.t1"; gene_id "g734"; # protein sequence = [MVLTLRRTSRGVRFDLYRGNVVTNMFHFVPGLLDNFEWADGYVTRFGLTYWFKEHQEESSSSPSGIYKRGTSSLSESS # TKVPGTPEAADAIKIATSKPSKDPSRLKKIKQAVWKLIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g734 ### # start gene g735 4 AUGUSTUS gene 2899141 2901122 0.5 - . g735 4 AUGUSTUS transcript 2899141 2901122 0.5 - . g735.t1 4 AUGUSTUS stop_codon 2899141 2899143 . - 0 transcript_id "g735.t1"; gene_id "g735"; 4 AUGUSTUS CDS 2899141 2900407 0.82 - 1 transcript_id "g735.t1"; gene_id "g735"; 4 AUGUSTUS CDS 2900483 2900640 0.51 - 0 transcript_id "g735.t1"; gene_id "g735"; 4 AUGUSTUS CDS 2901003 2901122 0.94 - 0 transcript_id "g735.t1"; gene_id "g735"; 4 AUGUSTUS start_codon 2901120 2901122 . - 0 transcript_id "g735.t1"; gene_id "g735"; # protein sequence = [MFLISRLEIEVAYPAAGDNEFQFVRDLIENNEIPDDVAIQTEPEFAVELGNRVLMEWGKASPEDKVYFNLAATVECAP # SNHYADMVSFVSNLLIHPHNDRGRSSRNVHITDIFKTSTGTGVAATELALLAGGDRVEGCLLGNGERTGNVDLITLALNLYSQGVSPGLDFSNLPEIV # QVVCRCNESAVPVRYPYAGTLVFSAFAGTHQDAIKKGLDSQAARWEKVDRTGEGIKYWAMPYIPIDPKDIGYGYENLIRVSSQSGKAGTAYVIKQTLQ # LDLPRRMQVSFYGVVQSECENSGKEMSTALITNAFKQKYCLSSKPIGRLHLQSLNITPLSPLSESSSLESDGTSTPPEQGTNLIRFEGHISVDGRIRK # IMGDGKGVLSALLDGLRSDLELEINIGEIVSQHLEGDSTKAVTYLEVSTPGSPASKSGVGSVWGVGISSDSATSQCRAIISGINGLVGDRRFPRPKMV # FTPRRDQSAQRSESWLRDFTFRAGHSVLQTPEHERSELIAASPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g735 ### # start gene g736 4 AUGUSTUS gene 2916308 2916766 0.5 - . g736 4 AUGUSTUS transcript 2916308 2916766 0.5 - . g736.t1 4 AUGUSTUS stop_codon 2916308 2916310 . - 0 transcript_id "g736.t1"; gene_id "g736"; 4 AUGUSTUS CDS 2916308 2916766 0.5 - 0 transcript_id "g736.t1"; gene_id "g736"; 4 AUGUSTUS start_codon 2916764 2916766 . - 0 transcript_id "g736.t1"; gene_id "g736"; # protein sequence = [MEARGMDLTDVRFEEGEAHRSRACMPAPDDSELEHDQSAGNLEPEVPTDGPTSQQHADQEGKETQIPGSSDSLPPPTT # SGFSQPPQPRRSTRIRTPSCVAIENRALEEREHGAQANREDWATNSPPTGQTLALIAANPWAFASAMMTCINFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g736 ### # start gene g737 4 AUGUSTUS gene 2925203 2925574 0.99 - . g737 4 AUGUSTUS transcript 2925203 2925574 0.99 - . g737.t1 4 AUGUSTUS stop_codon 2925203 2925205 . - 0 transcript_id "g737.t1"; gene_id "g737"; 4 AUGUSTUS CDS 2925203 2925574 0.99 - 0 transcript_id "g737.t1"; gene_id "g737"; 4 AUGUSTUS start_codon 2925572 2925574 . - 0 transcript_id "g737.t1"; gene_id "g737"; # protein sequence = [MTRTARATYPRAALKDRSQSRSGMDKSLKKDGAGRGNWGKLGEAGYDDDDEYDEESYEAETANLDASETGSEGSIFIA # TFSSPNSRACLRSASSTLEPKHSVSDQKEVEAARAFRKRALSGTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g737 ### # start gene g738 4 AUGUSTUS gene 2928532 2930220 0.09 - . g738 4 AUGUSTUS transcript 2928532 2930220 0.09 - . g738.t1 4 AUGUSTUS stop_codon 2928532 2928534 . - 0 transcript_id "g738.t1"; gene_id "g738"; 4 AUGUSTUS CDS 2928532 2928708 0.95 - 0 transcript_id "g738.t1"; gene_id "g738"; 4 AUGUSTUS CDS 2928768 2929137 0.52 - 1 transcript_id "g738.t1"; gene_id "g738"; 4 AUGUSTUS CDS 2929291 2929571 0.75 - 0 transcript_id "g738.t1"; gene_id "g738"; 4 AUGUSTUS CDS 2929646 2929855 0.72 - 0 transcript_id "g738.t1"; gene_id "g738"; 4 AUGUSTUS CDS 2930098 2930220 0.34 - 0 transcript_id "g738.t1"; gene_id "g738"; 4 AUGUSTUS start_codon 2930218 2930220 . - 0 transcript_id "g738.t1"; gene_id "g738"; # protein sequence = [MFIGRSMEEDIWDPINALIDDAQRDQEFKQWWNEVDEWLEKAGTTDFHSTAANSGSSYVPYQVGDVNATAAGPTSTAQ # PTSTNQRSANTQPATRGKYREHFDNVFEGIGKFQIPCRFGTDIQRLTKDLLFDSEGKLTFKAELWNDVRNTIVPGLIQRVCIIIVSHALSSITFRFQI # GLVPIPRIEYTDDSLDLVLENLTLSAQNLHSLHLHLSHIQTDMRDVAFYFRKKSGLPKLKDSGLADVLLGGDGLSVRSLNDVLLKFGLTIKFSQATIH # LESSSDPTTLYDIKNITVKVDTLKFAIRDSKHDLLYKTLKPLATGLIKKQIQKAVADGMRTGLEWLGEELIAVKDRMHEAREGANEEEEVGRFKAMQE # VRNDVDAIREVSCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g738 ### # start gene g739 4 AUGUSTUS gene 2930928 2931837 0.38 - . g739 4 AUGUSTUS transcript 2930928 2931837 0.38 - . g739.t1 4 AUGUSTUS stop_codon 2930928 2930930 . - 0 transcript_id "g739.t1"; gene_id "g739"; 4 AUGUSTUS CDS 2930928 2931169 0.83 - 2 transcript_id "g739.t1"; gene_id "g739"; 4 AUGUSTUS CDS 2931369 2931837 0.38 - 0 transcript_id "g739.t1"; gene_id "g739"; 4 AUGUSTUS start_codon 2931835 2931837 . - 0 transcript_id "g739.t1"; gene_id "g739"; # protein sequence = [MSSLPSARGAVTDPIERDRKEQDVERKLRLYTTVNALRESKLPANKQLDGWLDVLQQNLGSDGHSKFSDLSSLSVLTI # HSGQKLSRQGQKLTTDLRDILDTVRLMLKNKNGDELLQDVIWNTRDIESPNSIKGEDLANDSHVLGVNKNKAQEDAQQALITASGKASEGLRPDEDQL # KLVDESHRGEGGAFSVASPEQRAREQEEIGVDGMAKARVPSDIKDSANAVAEEASRTKDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g739 ### # start gene g740 4 AUGUSTUS gene 2940104 2941102 0.65 - . g740 4 AUGUSTUS transcript 2940104 2941102 0.65 - . g740.t1 4 AUGUSTUS stop_codon 2940104 2940106 . - 0 transcript_id "g740.t1"; gene_id "g740"; 4 AUGUSTUS CDS 2940104 2941102 0.65 - 0 transcript_id "g740.t1"; gene_id "g740"; 4 AUGUSTUS start_codon 2941100 2941102 . - 0 transcript_id "g740.t1"; gene_id "g740"; # protein sequence = [MANEFARITEENKHLRAVEATQASDIDNLNSQIQSLREMNIDNKERVTTLLAETSTLQAALAQSTQRCSSLDAQLSAG # TAEIASLQVSLDTKNQRITDFVQKLQDTNTTLEARTQDLNSAQLVAAKLENDLAAMISQLDNREVELTSQLVAVKRSMEDTSSTLQQKITELSNLHED # LRKAQKSITAYQEELEAHTAAHVAEIGECSATIDSLRASLSSADTTTVDLRSKIDLLTETCTQLQSKLEQAASDRSRLGEELAVERLHSATIKGELDR # ALLRIHEAEQEMGEMESLRSEDAATIMKLRNTIERIHVAQMEQWAGITQEVCDFFSVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g740 ### # start gene g741 4 AUGUSTUS gene 2944768 2945043 0.67 + . g741 4 AUGUSTUS transcript 2944768 2945043 0.67 + . g741.t1 4 AUGUSTUS start_codon 2944768 2944770 . + 0 transcript_id "g741.t1"; gene_id "g741"; 4 AUGUSTUS CDS 2944768 2945043 0.67 + 0 transcript_id "g741.t1"; gene_id "g741"; 4 AUGUSTUS stop_codon 2945041 2945043 . + 0 transcript_id "g741.t1"; gene_id "g741"; # protein sequence = [MDKFESQFADLDVQTSYMEDTMSATTATSTPQDQIDQLLKQTAEEANIELQHDLAAKDLDNVPDLAAPKDKIGEEDDK # LAERLRALRPATQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g741 ### # start gene g742 4 AUGUSTUS gene 2945834 2948584 0.4 - . g742 4 AUGUSTUS transcript 2945834 2948584 0.4 - . g742.t1 4 AUGUSTUS stop_codon 2945834 2945836 . - 0 transcript_id "g742.t1"; gene_id "g742"; 4 AUGUSTUS CDS 2945834 2948189 0.96 - 1 transcript_id "g742.t1"; gene_id "g742"; 4 AUGUSTUS CDS 2948541 2948584 0.44 - 0 transcript_id "g742.t1"; gene_id "g742"; 4 AUGUSTUS start_codon 2948582 2948584 . - 0 transcript_id "g742.t1"; gene_id "g742"; # protein sequence = [MESDPHVNYVLVPNTFLTRSRSRSSPRTNASASIPEEIASAVLENPQNHEHSIHSRNSSWSSVGSSQKRPVSSTTSTA # KPATILQSRPLSSTTTATNTTITPPTPKARRQPSPLIQKPPEPSPSAPKSPRSAKQRLHNIFGRKSSISSSRDTSPGQSNTDLENVPPILVHTDSFPK # EGRGNTPHSNRNSVSRPTSPSPFPRSRQNYSEPSTSTTNSNLNSSSKLENLFKPKFFSGSRRAHSPPPAISLSHSSNEVSPMPTPSSSNSGSSNANNH # VLFVSGPSKQTSTPRISRRRASTNESISSVSSVQRAAQLYAPQPRPAPGSTTVAVSLPVPRITHTPATPSRSGTAPPRLSQTHRKDSLDSGYRFRPLV # MDMVDEERDSREVDVKGKGKETDDLIRSRTSSKGKESDHSSASGHKSSSANHHHRQHSTRHQTVKPKTSSITNIRSVKHGSFDFERPGWGLGASTVTR # SLSGTSGNSGVTGFSRGRYSNRSGESVESASRSNNQELEKKKTTDLKSKSSSKREEYKSQKRNAPAIDDPAPPYSPTPASTDPGSGRGLSSSLGRSAG # KRTGIARLIGLGGYTAHGAFSFEPPVPSPISPTFSHASQESNADSGRREEKEREKEQRRVKEEEKEKERVKNNHRYSEQDTLGVSSFSGASRNPGRKG # RSLDLGIGLSWAPTRVREDVLLPGGRFANGRGLNGRISESTSSRNGLRADRARAVDEFGVEERSKVGRDVAEMFKKALDPEGYRAFKKCEPSLYLAAA # FFLLISVSLQMSTSLMPMKSLSMVRMESSRARKGC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g742 ### # start gene g743 4 AUGUSTUS gene 2968453 2969412 0.21 - . g743 4 AUGUSTUS transcript 2968453 2969412 0.21 - . g743.t1 4 AUGUSTUS stop_codon 2968453 2968455 . - 0 transcript_id "g743.t1"; gene_id "g743"; 4 AUGUSTUS CDS 2968453 2968566 0.61 - 0 transcript_id "g743.t1"; gene_id "g743"; 4 AUGUSTUS CDS 2968828 2969412 0.21 - 0 transcript_id "g743.t1"; gene_id "g743"; 4 AUGUSTUS start_codon 2969410 2969412 . - 0 transcript_id "g743.t1"; gene_id "g743"; # protein sequence = [MYVAHRWHFALLLPEKKTYLGQKYYSKQTVYDAHLTSKKHVKASVKQAQNSADTAPTNPNGLSTSAVSASSNLSSLKT # RLHNSALHTHLVTSLLVPLAGTLNDTKSNVERRFSLTAREREQELLEQAKPKNTSGSAAQNGPSGDGDEGEGEEEEEERIYNPLKLPLGWDGKPIPYW # LYKLHGLGVEYRCEICSDFEGKHEVFEQETMEELEDDEGNVYNRKTYEDLKKQGII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g743 ### # start gene g744 4 AUGUSTUS gene 2969795 2970325 0.35 - . g744 4 AUGUSTUS transcript 2969795 2970325 0.35 - . g744.t1 4 AUGUSTUS stop_codon 2969795 2969797 . - 0 transcript_id "g744.t1"; gene_id "g744"; 4 AUGUSTUS CDS 2969795 2970325 0.35 - 0 transcript_id "g744.t1"; gene_id "g744"; 4 AUGUSTUS start_codon 2970323 2970325 . - 0 transcript_id "g744.t1"; gene_id "g744"; # protein sequence = [MDSIIDVQRQTHEEIERFERALYTLLSRNTSTHEGKVQNEHRAAQVLDRISSRVVALNNLYDDKNAREQEINSLSTPP # NQQNNLEEFYSRLSKIREHHSKYPDSVTGGFELELASLLEEPTQDDDDYEDEDRTLDNCSTVSMTLNVLLQLFLYYFLEKRSMESILTFTQTTPHTII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g744 ### # start gene g745 4 AUGUSTUS gene 2970408 2971332 0.72 + . g745 4 AUGUSTUS transcript 2970408 2971332 0.72 + . g745.t1 4 AUGUSTUS start_codon 2970408 2970410 . + 0 transcript_id "g745.t1"; gene_id "g745"; 4 AUGUSTUS CDS 2970408 2970413 0.72 + 0 transcript_id "g745.t1"; gene_id "g745"; 4 AUGUSTUS CDS 2970469 2971332 0.98 + 0 transcript_id "g745.t1"; gene_id "g745"; 4 AUGUSTUS stop_codon 2971330 2971332 . + 0 transcript_id "g745.t1"; gene_id "g745"; # protein sequence = [MLKLVFESSEAVSVVSTFDDLGLKEDLVRGIYAYSEFIFDFSSAAPVLNLYFLPDFEKPSAIQQRAILPITQGRDVIA # QAQSGTGKTATFSISILQSIDVTVRETQALVLSPTRELATQIQSVVLALGDYMNVQCHACIGGTSIGEDIRKLEYGQHVVSGTPGRVFDMIRRRSLRT # RNIKMLVLDEADELLNKGFKEQIYDVYRYLPPATQVVVLSATLPYDVLEMTTKFMTDPIRILVKRDELTLEGIKQFFVAVEKEDWKFDTLCDLYDTLT # ITQAVIFCNTRRKVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g745 ### # start gene g746 4 AUGUSTUS gene 2976059 2976397 0.98 - . g746 4 AUGUSTUS transcript 2976059 2976397 0.98 - . g746.t1 4 AUGUSTUS stop_codon 2976059 2976061 . - 0 transcript_id "g746.t1"; gene_id "g746"; 4 AUGUSTUS CDS 2976059 2976397 0.98 - 0 transcript_id "g746.t1"; gene_id "g746"; 4 AUGUSTUS start_codon 2976395 2976397 . - 0 transcript_id "g746.t1"; gene_id "g746"; # protein sequence = [MFISPQSSYVILAFIQPADFNSTGPELVNASTSRNNFNLTTFGEAVNLGAPIAGTYFLTGPSSNSSASSTSPASSTSS # AATSSGVGRSLKARGIGLKATWGLTLGLVMYALS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g746 ### # start gene g747 4 AUGUSTUS gene 2978853 2979407 0.98 + . g747 4 AUGUSTUS transcript 2978853 2979407 0.98 + . g747.t1 4 AUGUSTUS start_codon 2978853 2978855 . + 0 transcript_id "g747.t1"; gene_id "g747"; 4 AUGUSTUS CDS 2978853 2979407 0.98 + 0 transcript_id "g747.t1"; gene_id "g747"; 4 AUGUSTUS stop_codon 2979405 2979407 . + 0 transcript_id "g747.t1"; gene_id "g747"; # protein sequence = [MFLTPVNLNDPSMIQEPREAPAPTIQPDWITAAVLEDNMTVAPRTPKPPSSPCPQIEISSPGPVDDLYDDAYMSDYHR # EEVPEHQVSPGAPHSPFASRSPRGKPDSEYSEKEHFERAYSPRLPVFSPRLVHLPPSPLPPSSYHSHPTPSDTDSFYDDSETPETPDRWSDEDEVEEE # YHAAHLRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g747 ### # start gene g748 4 AUGUSTUS gene 2980488 2980826 0.46 - . g748 4 AUGUSTUS transcript 2980488 2980826 0.46 - . g748.t1 4 AUGUSTUS stop_codon 2980488 2980490 . - 0 transcript_id "g748.t1"; gene_id "g748"; 4 AUGUSTUS CDS 2980488 2980826 0.46 - 0 transcript_id "g748.t1"; gene_id "g748"; 4 AUGUSTUS start_codon 2980824 2980826 . - 0 transcript_id "g748.t1"; gene_id "g748"; # protein sequence = [MKDCKERDEWKENLAPRKKMKKVVIDSVDSKPMLMTPEAKKLEMEQLIKAKSTPATPRKTAAKEWQEDTSPTPRRTGL # RFQAGTPAISEEEKRQRRRMLKDEVEADRMDEDM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g748 ### # start gene g749 4 AUGUSTUS gene 2982386 2984951 0.54 - . g749 4 AUGUSTUS transcript 2982386 2984951 0.54 - . g749.t1 4 AUGUSTUS stop_codon 2982386 2982388 . - 0 transcript_id "g749.t1"; gene_id "g749"; 4 AUGUSTUS CDS 2982386 2983428 0.63 - 2 transcript_id "g749.t1"; gene_id "g749"; 4 AUGUSTUS CDS 2983670 2984951 0.54 - 0 transcript_id "g749.t1"; gene_id "g749"; 4 AUGUSTUS start_codon 2984949 2984951 . - 0 transcript_id "g749.t1"; gene_id "g749"; # protein sequence = [MEGINLHAGTKVPGHLWGSDSKEDQVVFMDGELLCGVLDKAAFGASDFGIVHSVYELYGADIAGKLLGILSRLFTKFL # QHRAFTCRMDDLMLTPEGDQKRTEILQEGKNLGTKGAIENFPSLDNLPPHEVPQALKVLLQEVLRDDNKMAGLDMTVKSGLSKLTTSIEKAVMPSGLL # RRFPHNHMQAMTLSGAKGSAVNARQISCALGQQELEGRRVPVMVSGKTLPSFKPFETKAMAGGYVASRFLTGVKPQEFYFHCMAGREGLIDTAVKTSR # SGYLQRCLIKHLEGIRVHYDNTVRGSDSSVYQFQYGGDSLDVTKQKHIRQFEFIARNEKSFVNKLRPKSILPFVAGDDGTVYMKSVIKRKPAKRYGMD # PCLALYSPSRYLGSTSEAFADALKHYTKKNPDRLIKGDFEEMWSTRKTPLSAGTFRHGAANVTLGIPRLREIVMTASQKPKTPSMNMRIRTGIPQEDI # DVFCKRASKLTLSQLVENVTVTEQLQAEGDSRRMQYTVCINLFPREEYEAVHDVEPDEILNAFAVKYPLMLKKEMTAEMKKLDDDLKSQIAQLGKGKK # ERGDRGEPADTGDGDEEGASGTKRRNDDEESEIGDGDADDEKRARQKKEQATYEDDSEDEDEEMGAYDDDELEAELADGEENEGLQQDPTDVKRVSQS # FKNRVKLVGDSFQRNFTQAVSFAFNETQCTFQLDVSHANICWAVQKFNKCFQCQLASDMPKLLFVGIIERTCRSTVIREIPGITDCFQNKEEGKKGEE # SVVKVSLISR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g749 ### # start gene g750 4 AUGUSTUS gene 2985851 2986886 0.09 - . g750 4 AUGUSTUS transcript 2985851 2986886 0.09 - . g750.t1 4 AUGUSTUS stop_codon 2985851 2985853 . - 0 transcript_id "g750.t1"; gene_id "g750"; 4 AUGUSTUS CDS 2985851 2986138 0.22 - 0 transcript_id "g750.t1"; gene_id "g750"; 4 AUGUSTUS CDS 2986191 2986886 0.44 - 0 transcript_id "g750.t1"; gene_id "g750"; 4 AUGUSTUS start_codon 2986884 2986886 . - 0 transcript_id "g750.t1"; gene_id "g750"; # protein sequence = [MDNEDAEMSDAPDSEGEGDSLDEEDEEDENEDAVNEDQPKDSDGKPLPRAANGKIKTKRGRNERVVAPEECRAHLRRL # FRNERVICALLYGKHGCYAKLTSEELSEASADMFFLDVITVAPTRFRPPAKMNEVLFEHPQNDLLARVLNTSYRLRDFNDDLRAASQKGADYDEKKRQ # KVMEQLLATLIQLQVDVNSFMDSSKNPQVVRQGKLPPAGVKQGLEKKEGLFRKHMMGKRVNYAARSVISPDVNIEPNEIGVPPVFAKKLTFPEPVTPA # NFHEMRARVINGPRGYPGATMVEYEDGTQISLVRLACSILQRLLNASLFHRIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g750 ### # start gene g751 4 AUGUSTUS gene 2988589 2989050 0.54 - . g751 4 AUGUSTUS transcript 2988589 2989050 0.54 - . g751.t1 4 AUGUSTUS stop_codon 2988589 2988591 . - 0 transcript_id "g751.t1"; gene_id "g751"; 4 AUGUSTUS CDS 2988589 2989050 0.54 - 0 transcript_id "g751.t1"; gene_id "g751"; 4 AUGUSTUS start_codon 2989048 2989050 . - 0 transcript_id "g751.t1"; gene_id "g751"; # protein sequence = [MSAPPGPRNVPVSAVIPSSASHSRAGSRAPSRTGSPHPSNSARPNQSHFGPRPVLDETKISELLDLDMGKTAFDLNLE # IEANERSRGSDTGAARSSRATARRIPHPDGHYEYTAHFLTANAGRSAARFRDIQWPHCGACWGSAEDKIREEITS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g751 ### # start gene g752 4 AUGUSTUS gene 2989134 2989748 0.56 - . g752 4 AUGUSTUS transcript 2989134 2989748 0.56 - . g752.t1 4 AUGUSTUS stop_codon 2989134 2989136 . - 0 transcript_id "g752.t1"; gene_id "g752"; 4 AUGUSTUS CDS 2989134 2989748 0.56 - 0 transcript_id "g752.t1"; gene_id "g752"; 4 AUGUSTUS start_codon 2989746 2989748 . - 0 transcript_id "g752.t1"; gene_id "g752"; # protein sequence = [MDDDLTFGASVWGADVPSPFPPTKLKPPTLSLEDDFISTPNGDDGFDDFEDFGPTETVAGDDDDFGDFGDAIEDIAVT # PADFPETPVAGPSKSQISTQWEPLRLDPFPDRQQLERDIDEILEPVWDDEEAQEQVFTKDGIREIEGVNQILVTNERYVKTLFQSFLSRDLGSAVENC # TKCFSERPQQPNLRTGHDLEYEGNILSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g752 ### # start gene g753 4 AUGUSTUS gene 3004745 3005215 0.44 + . g753 4 AUGUSTUS transcript 3004745 3005215 0.44 + . g753.t1 4 AUGUSTUS start_codon 3004745 3004747 . + 0 transcript_id "g753.t1"; gene_id "g753"; 4 AUGUSTUS CDS 3004745 3005215 0.44 + 0 transcript_id "g753.t1"; gene_id "g753"; 4 AUGUSTUS stop_codon 3005213 3005215 . + 0 transcript_id "g753.t1"; gene_id "g753"; # protein sequence = [MLTNNAVSAAVGLIPFAGDVVLAAFKANSRNAALLEEFLRIRGEEFMKLGVAGSAAAADKNQTKGKGKMVAHGVSKTD # AEQVKPGAGIEAGAIPGGTTVIVSDSKQAPTRTPGSGKSGKSVGRKGFGSFFAKSGKLPAPGEKGRFVENVDGGQHQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g753 ### # start gene g754 4 AUGUSTUS gene 3007098 3007727 0.89 - . g754 4 AUGUSTUS transcript 3007098 3007727 0.89 - . g754.t1 4 AUGUSTUS stop_codon 3007098 3007100 . - 0 transcript_id "g754.t1"; gene_id "g754"; 4 AUGUSTUS CDS 3007098 3007727 0.89 - 0 transcript_id "g754.t1"; gene_id "g754"; 4 AUGUSTUS start_codon 3007725 3007727 . - 0 transcript_id "g754.t1"; gene_id "g754"; # protein sequence = [MLRELDKLGRLNVQNFPGLEYFLRYTIEWTEWAKDELVNHLHLRSDILPHLGVCKAIAYRLFKDQTVEDHTLHLARIR # EWVQWLEPRATEEDHDYAGTKGWVQDWLIQEWPSLLLGVNPWYLAGEDDNSLLKDPRLDLALEWDSFSIYRQENPLVPPKGLSWEFKDWSKEDRDAHR # DGTVFEIPSSGDGDGNGSDKESMGWGMEHSFWQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g754 ### # start gene g755 4 AUGUSTUS gene 3014572 3015037 0.31 - . g755 4 AUGUSTUS transcript 3014572 3015037 0.31 - . g755.t1 4 AUGUSTUS stop_codon 3014572 3014574 . - 0 transcript_id "g755.t1"; gene_id "g755"; 4 AUGUSTUS CDS 3014572 3014835 0.53 - 0 transcript_id "g755.t1"; gene_id "g755"; 4 AUGUSTUS CDS 3014894 3015037 0.53 - 0 transcript_id "g755.t1"; gene_id "g755"; 4 AUGUSTUS start_codon 3015035 3015037 . - 0 transcript_id "g755.t1"; gene_id "g755"; # protein sequence = [MVDDETDEELEEELEEEMDDWGSREFVSDISGDEDDDDDGLSDLEDVVGSGSDEDGEDGDSNEENSKPKPSTLGKRKA # PAPKAPKKRPEKRPKSKSSYVLLCPFESLTNICIEGPRVEVEYEQEVESVPLSLANW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g755 ### # start gene g756 4 AUGUSTUS gene 3019498 3019869 0.59 + . g756 4 AUGUSTUS transcript 3019498 3019869 0.59 + . g756.t1 4 AUGUSTUS start_codon 3019498 3019500 . + 0 transcript_id "g756.t1"; gene_id "g756"; 4 AUGUSTUS CDS 3019498 3019869 0.59 + 0 transcript_id "g756.t1"; gene_id "g756"; 4 AUGUSTUS stop_codon 3019867 3019869 . + 0 transcript_id "g756.t1"; gene_id "g756"; # protein sequence = [MRIRESELPEVPDSVTLPVAPMAEEDSSTTSLPAPSEPLQVSGSQSGTHQPSQSTVQDKNRSELISRARIFLRSSQIQ # SQDIFAKRRFLLDKGLNENEIELLLRELVRLASSCITFSHKFTFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g756 ### # start gene g757 4 AUGUSTUS gene 3021672 3022028 0.27 + . g757 4 AUGUSTUS transcript 3021672 3022028 0.27 + . g757.t1 4 AUGUSTUS start_codon 3021672 3021674 . + 0 transcript_id "g757.t1"; gene_id "g757"; 4 AUGUSTUS CDS 3021672 3022028 0.27 + 0 transcript_id "g757.t1"; gene_id "g757"; 4 AUGUSTUS stop_codon 3022026 3022028 . + 0 transcript_id "g757.t1"; gene_id "g757"; # protein sequence = [MVTPSGQRIERLPTWIKRVTQDLSVSPVYDARFWNPPESQKYKFKNTRPPKPKDAKIYEAHVGISTSESRVGTYKEFT # QNILPRIQKLGYNIIQMMAVMEHAYYACEAVRSPVVALKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g757 ### # start gene g758 4 AUGUSTUS gene 3024287 3024778 0.38 + . g758 4 AUGUSTUS transcript 3024287 3024778 0.38 + . g758.t1 4 AUGUSTUS start_codon 3024287 3024289 . + 0 transcript_id "g758.t1"; gene_id "g758"; 4 AUGUSTUS CDS 3024287 3024778 0.38 + 0 transcript_id "g758.t1"; gene_id "g758"; 4 AUGUSTUS stop_codon 3024776 3024778 . + 0 transcript_id "g758.t1"; gene_id "g758"; # protein sequence = [MRLKCREHQKAHWKVHKEFCKQRATEANPSIRLRELEDFVRLHQAAFKVALAELFHIDDPDDPIDWSKELAVFEFDST # SDPNPARRFRLKDAFLTPDMPVGTRDGDRIATYRRTTYASHTEVPMPEGYINYVLCLCEIPLHEGPTHVLIGVCQVIAQTANVSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g758 ### # start gene g759 4 AUGUSTUS gene 3033988 3034638 0.6 + . g759 4 AUGUSTUS transcript 3033988 3034638 0.6 + . g759.t1 4 AUGUSTUS start_codon 3033988 3033990 . + 0 transcript_id "g759.t1"; gene_id "g759"; 4 AUGUSTUS CDS 3033988 3034638 0.6 + 0 transcript_id "g759.t1"; gene_id "g759"; 4 AUGUSTUS stop_codon 3034636 3034638 . + 0 transcript_id "g759.t1"; gene_id "g759"; # protein sequence = [MAVNPIPSSTSSTDSAESGPEPPYARPNPKSYHVYHDPAPLQLTYSSQLPSFDVAYETWGKLSPKKDNAILLHTGLSA # SSHAASTALNSAPGWWEKFIGPGKALDTNQFFIICTNVIGGCYGSTGPSSIDPTSGTHYATNFPILSIFDMVRAQFRLLDHLEIDKLYASVGSSMGGM # QSLAAGWLHPERVGKIVSISGTARSSPSAVAMRYAQRSGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g759 ### # start gene g760 4 AUGUSTUS gene 3036223 3036450 0.45 + . g760 4 AUGUSTUS transcript 3036223 3036450 0.45 + . g760.t1 4 AUGUSTUS start_codon 3036223 3036225 . + 0 transcript_id "g760.t1"; gene_id "g760"; 4 AUGUSTUS CDS 3036223 3036450 0.45 + 0 transcript_id "g760.t1"; gene_id "g760"; 4 AUGUSTUS stop_codon 3036448 3036450 . + 0 transcript_id "g760.t1"; gene_id "g760"; # protein sequence = [MYESQLAQLAQQTFNMESAALTTENMRNTMATVDALQASNKEIKKQYGKINIDKIEVRERLYPLNLRLIVANFRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g760 ### # start gene g761 4 AUGUSTUS gene 3039771 3040412 0.77 + . g761 4 AUGUSTUS transcript 3039771 3040412 0.77 + . g761.t1 4 AUGUSTUS start_codon 3039771 3039773 . + 0 transcript_id "g761.t1"; gene_id "g761"; 4 AUGUSTUS CDS 3039771 3040412 0.77 + 0 transcript_id "g761.t1"; gene_id "g761"; 4 AUGUSTUS stop_codon 3040410 3040412 . + 0 transcript_id "g761.t1"; gene_id "g761"; # protein sequence = [MEPRRSSRAASAKPASKVAPKPAPKKATSEKPPSRPSRTAASKKRAASPERDPSPPPKRAKGEEQNIAPTKAKPNSKA # AGKSAAENPKRSRTKLAPIAEKETPASEPKPPKPAHVQVKPYLNPLPSPPEQVRPGLQLFVWGAGNFGQFGLGPDALDEFDKPKKHGWAEEQIQDGTF # GEEGAGLEEIAGGGMHSLFIDEKGTVSFDEIFVAIIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g761 ### # start gene g762 4 AUGUSTUS gene 3040642 3041583 0.96 + . g762 4 AUGUSTUS transcript 3040642 3041583 0.96 + . g762.t1 4 AUGUSTUS start_codon 3040642 3040644 . + 0 transcript_id "g762.t1"; gene_id "g762"; 4 AUGUSTUS CDS 3040642 3041583 0.96 + 0 transcript_id "g762.t1"; gene_id "g762"; 4 AUGUSTUS stop_codon 3041581 3041583 . + 0 transcript_id "g762.t1"; gene_id "g762"; # protein sequence = [MGLFPGKIIGSLMYLNIPLTSSPSRQVNEGSLGFANGLKHQFIPVPILNDSLSHRPGDVEKVSDITAGVNHLLVLTTH # GNIYTWGAGEQAQLGRKVLERRKIHGTVPEKVSLGSRTRKAKVIGAGSFHSFAVDDKGDVWGWGLNTMGQAGTGYATEDDSQVQLPTKVEGLSKEALD # GDSVVQISGGEHHSLFLTQSGKVFAVGRCNAGQIGLADDDPALEDRADPDFVADPVQVKFPDDDDPIVRISVGTHNNLAVSKDGALYCWGQGTQGELG # VSDVEVRTPRMIVRREGGSWAAIKVACGGQHTLGLFRKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g762 ### # start gene g763 4 AUGUSTUS gene 3041840 3043003 0.51 - . g763 4 AUGUSTUS transcript 3041840 3043003 0.51 - . g763.t1 4 AUGUSTUS stop_codon 3041840 3041842 . - 0 transcript_id "g763.t1"; gene_id "g763"; 4 AUGUSTUS CDS 3041840 3042805 0.97 - 0 transcript_id "g763.t1"; gene_id "g763"; 4 AUGUSTUS CDS 3042866 3043003 0.52 - 0 transcript_id "g763.t1"; gene_id "g763"; 4 AUGUSTUS start_codon 3043001 3043003 . - 0 transcript_id "g763.t1"; gene_id "g763"; # protein sequence = [MRTGVLEEYQAAVKTSISKRRQIERLKASSNIRPERVDEALEELKEANKYEQVLAKRAEGISQNLHRALETHNNHVNE # DVTAALIEHARSSIMYERQLLRELEALRSDVANAANKVVPSTNVPKPTVILPLEEPIRPLPPPAPTPMPTGSYRQETPPPPRMQTPPRLKATLPVNSP # SDPLASGPPSLSSQPPISPSPSQQTFASRGSISTSSSFASRQGQFSPSIPPSPRQPLPAQSPGAGPSTPTIERFSDAKPPLDDGPPLGGRFGDGTKSM # FVNNSSPLVPPSPSSPTFNRGGGDPLMGSGAPVRPSSALDGNRRGMNGHPALQNDLDPLGLAKPTYMSSSVRVQPTRPRLDAKEAASKLANMF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g763 ### # start gene g764 4 AUGUSTUS gene 3045577 3046518 0.95 - . g764 4 AUGUSTUS transcript 3045577 3046518 0.95 - . g764.t1 4 AUGUSTUS stop_codon 3045577 3045579 . - 0 transcript_id "g764.t1"; gene_id "g764"; 4 AUGUSTUS CDS 3045577 3046518 0.95 - 0 transcript_id "g764.t1"; gene_id "g764"; 4 AUGUSTUS start_codon 3046516 3046518 . - 0 transcript_id "g764.t1"; gene_id "g764"; # protein sequence = [MVLLPVACIRYRGDESAYREYLRSPYITHFECLSQQDAKKLIYFALSLSGACREELGYDSTVRRVQGKNRTGPRYIFT # IDSKQYITTEAITVRKAKFLLGCATRLFKVQQVLDDEGELDSEVKVIKDFWLPEDSCTELETRLAIEANIQKVNAVPNLDRSAFNRYFVKIEACEKVP # VPSTTEKGQTSDSTSNFLRGQTLPSDVNRFTVSTQSSTYQRVMSVSIPASIMMESGPERERRQETVLREATAVHLARLDRRIYAPKVHCRQLSEFAGE # PLDQMTNWDIVLKALESLIIGKPSFILLWKYINLSNSKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g764 ### # start gene g765 4 AUGUSTUS gene 3046620 3047162 0.97 - . g765 4 AUGUSTUS transcript 3046620 3047162 0.97 - . g765.t1 4 AUGUSTUS stop_codon 3046620 3046622 . - 0 transcript_id "g765.t1"; gene_id "g765"; 4 AUGUSTUS CDS 3046620 3047162 0.97 - 0 transcript_id "g765.t1"; gene_id "g765"; 4 AUGUSTUS start_codon 3047160 3047162 . - 0 transcript_id "g765.t1"; gene_id "g765"; # protein sequence = [MSIPEITFDLFKQAVLPVVEDYSIEEAHQKLRERCILIDEGWKGITFGVGEQEQEQEQEVEELKVKMEIEVVEVEVEK # EKESLFYAPLFEGLNSIMGADSAVKFSDNLGKHLLSEDDHSHYKADINGLLTKTTAVHPITEGAEYECDVLMTGELNKKSTPDTVDDVGKNSVRASDM # LISV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g765 ### # start gene g766 4 AUGUSTUS gene 3047613 3047786 0.61 + . g766 4 AUGUSTUS transcript 3047613 3047786 0.61 + . g766.t1 4 AUGUSTUS start_codon 3047613 3047615 . + 0 transcript_id "g766.t1"; gene_id "g766"; 4 AUGUSTUS CDS 3047613 3047786 0.61 + 0 transcript_id "g766.t1"; gene_id "g766"; 4 AUGUSTUS stop_codon 3047784 3047786 . + 0 transcript_id "g766.t1"; gene_id "g766"; # protein sequence = [MGLLRSAIEKYADANASRCMGEPVEGRLSDEEEILDATVEELDGFDSEGYDSEEDYK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g766 ### # start gene g767 4 AUGUSTUS gene 3048132 3048680 0.74 + . g767 4 AUGUSTUS transcript 3048132 3048680 0.74 + . g767.t1 4 AUGUSTUS start_codon 3048132 3048134 . + 0 transcript_id "g767.t1"; gene_id "g767"; 4 AUGUSTUS CDS 3048132 3048680 0.74 + 0 transcript_id "g767.t1"; gene_id "g767"; 4 AUGUSTUS stop_codon 3048678 3048680 . + 0 transcript_id "g767.t1"; gene_id "g767"; # protein sequence = [MSIPEITFDLFKRAVLPVVEDYSVEEAHQKLRGRGFLIDEGWKEINFGVGEQEQEQEQEVEELKVKMEIEVEDVDVEK # EKKESLFYAPLFEGLNSIMGADSAVKFSDNPGKHLLSEDDHSHYKADINGLLTKTTAVPPITEGAEYECDVLMTGELNKKSTPDTVDDVGKNHSVRAS # DMLIFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g767 ### # start gene g768 4 AUGUSTUS gene 3185418 3186176 0.96 - . g768 4 AUGUSTUS transcript 3185418 3186176 0.96 - . g768.t1 4 AUGUSTUS stop_codon 3185418 3185420 . - 0 transcript_id "g768.t1"; gene_id "g768"; 4 AUGUSTUS CDS 3185418 3186176 0.96 - 0 transcript_id "g768.t1"; gene_id "g768"; 4 AUGUSTUS start_codon 3186174 3186176 . - 0 transcript_id "g768.t1"; gene_id "g768"; # protein sequence = [MTDRPQIEVLTPSVPMYFHVSNQDLFLDLARTLTALNILFVDLGKLYDNPPPLNPLSPVQHVYPYPRGFKRGTEVVTF # TYLKRVDPIRLVFEVETEEKDILYVKYTQQYGVEAHRRAHELGIAPELLAYDDTLPGGWKMIVMNPIPPGYVETDSIKQGSEEQGKVRALVIAQMKRY # LDEGFVHGDLRAANIFVDGERQNIMVIDYDWAGRTKEVMYPPDVRSSIEVWRPHAELSLRAIETEHDWQMLEHLYY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g768 ### # start gene g769 4 AUGUSTUS gene 3186644 3190720 0.82 + . g769 4 AUGUSTUS transcript 3186644 3190720 0.82 + . g769.t1 4 AUGUSTUS start_codon 3186644 3186646 . + 0 transcript_id "g769.t1"; gene_id "g769"; 4 AUGUSTUS CDS 3186644 3190720 0.82 + 0 transcript_id "g769.t1"; gene_id "g769"; 4 AUGUSTUS stop_codon 3190718 3190720 . + 0 transcript_id "g769.t1"; gene_id "g769"; # protein sequence = [MSSSSNMPNVQRFPTGIALEGEDNWWPYKREVSLAVESKGMQGYLHGTIPKPSNAKPAVTVTSPEGTTTTPTVTTPPY # SQTPSPEEWYARDRYVASTIVSNIVDPTGLGVDYTESASDIWGELVKQFEQKSEELLLFHDSNLRAHRYSYPEETMEEHKRTMRNLLRKATNAGAVIT # DGQFRVIVLASLPRDWDADIRHLPGKTSSEAFIYLQGIWLQREKRRTEEEREEKKVKALLAMHVASVQTPERNRPTCTNPNCKKVGHTIQRCWAKGGG # AEGKGPNGWRFNKNNEPNRSQTTPGNAVAATANTIAVAPPLETYVLSADTNQVDRDMSSCTSNSTPHQSAPSTDKPPDSDDHSFLKGWERQELREANG # VKDVHRHNVALRSLACEVYRSNTLLYTPTRTSHARTFIDSGATEHCWVNKSDFVEYHRVQGQSGTSAPSGNAGKFTIEGTGTVEFTTRVGEAARRIRL # TNVKHTPEFGHNLISLSTLDQRAFRGEWGDGVLSVKSPEGLVVMMGKGQTKMYEVEILDQTLASSARSHEKPADVHTWHRRLGHVSVPRILRMESRGL # VDGLQIKSKRLAGMCIDCLYGKATRRPFDEKLTHEMEVLERVHIDLWGPATTQSIGGARYMMLFSDGALSVRVPAFLKDKRKETSLKEFHRFRIMAEN # QTGRKVKIIRVDGGGEFDNSLMEGYCADHGITIEKITPYSSSANGMAERGNRTVIEGVRTFLEESGLPRSFWAEAAATFTYVDNFVPTARFPDRVPIE # YWSGKHQDISHLRPFGCRAWATLPESKREGKLARQAVECILIGYMGRRGYRLWHPPSRTFMESRDVRFEEGEAHRSREDITDHDNDGELEDVLPAGSP # EPATPTDGPTAQQHADQEGGEMRISGPATDPPQTNLRRSSRIRTPSRVAIENQESEERELTAQANREEWATDSPPTNQTLALIAVNPWAFASTTSDTW # VPSTFKQAMKVPELWLPPMKTEYKTLVEKGCWDLVHLPPDANLTGGRWTYAIKWGPGGEVLKRKARWVAQGYTQIQGQDYDKTYGAVARMESVRIVLA # IIATLRLSLFQVDFTAAFLNSPISHEVYMRQPDGFIQPGAEDKVCKLRKSIYGTMQGSHDWQETLAAGYSEDRYTTSRADPCIRYRRQGDEYTLTSTY # GDDVCGGSSTEQGRTRAVKDLAKHWESSEVLSRVLLGMNIQQDPTTKAITISQKAYILRMLDHFQLLHVRRRHTPLPPNVKLSEAPNPLPPDDHQFMA # SKPYREFVGAILWCQTCTRADISFAAGLLARYQLHPGRSHWECVEWLAGYLLWSSDYAITYEAPAAGDEHTPAAGDEHTPGLGLKPKGYSDSDHAGCH # EAAEAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g769 ### # start gene g770 4 AUGUSTUS gene 3191190 3192752 0.3 - . g770 4 AUGUSTUS transcript 3191190 3192752 0.3 - . g770.t1 4 AUGUSTUS stop_codon 3191190 3191192 . - 0 transcript_id "g770.t1"; gene_id "g770"; 4 AUGUSTUS CDS 3191190 3192752 0.3 - 0 transcript_id "g770.t1"; gene_id "g770"; 4 AUGUSTUS start_codon 3192750 3192752 . - 0 transcript_id "g770.t1"; gene_id "g770"; # protein sequence = [MAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLV # YYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLP # NSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDCGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEK # YIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQ # FKIGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILD # SRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g770 ### # start gene g771 4 AUGUSTUS gene 3192846 3194906 0.9 - . g771 4 AUGUSTUS transcript 3192846 3194906 0.9 - . g771.t1 4 AUGUSTUS stop_codon 3192846 3192848 . - 0 transcript_id "g771.t1"; gene_id "g771"; 4 AUGUSTUS CDS 3192846 3194906 0.9 - 0 transcript_id "g771.t1"; gene_id "g771"; 4 AUGUSTUS start_codon 3194904 3194906 . - 0 transcript_id "g771.t1"; gene_id "g771"; # protein sequence = [MFTTSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTGSPILELPE # PESPAENPHIEVPPEATLEQSESVAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g771 ### # start gene g772 4 AUGUSTUS gene 3194957 3196123 0.86 - . g772 4 AUGUSTUS transcript 3194957 3196123 0.86 - . g772.t1 4 AUGUSTUS stop_codon 3194957 3194959 . - 0 transcript_id "g772.t1"; gene_id "g772"; 4 AUGUSTUS CDS 3194957 3196123 0.86 - 0 transcript_id "g772.t1"; gene_id "g772"; 4 AUGUSTUS start_codon 3196121 3196123 . - 0 transcript_id "g772.t1"; gene_id "g772"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSASAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g772 ### # start gene g773 4 AUGUSTUS gene 3199812 3200423 0.62 + . g773 4 AUGUSTUS transcript 3199812 3200423 0.62 + . g773.t1 4 AUGUSTUS start_codon 3199812 3199814 . + 0 transcript_id "g773.t1"; gene_id "g773"; 4 AUGUSTUS CDS 3199812 3200423 0.62 + 0 transcript_id "g773.t1"; gene_id "g773"; 4 AUGUSTUS stop_codon 3200421 3200423 . + 0 transcript_id "g773.t1"; gene_id "g773"; # protein sequence = [MGDKLLRNVPTKRPGCVLLLDYYERWVLVWGTKHLFRAQAHNGAWNIQTTDIDEQMTSGTLLGYVKFRSDDESQVLSA # IANLPSQANQFLALQKVIEYLLGKYPVPRRPLPQDLQYQIYDENWCQIFSAMLNPIYETQWPNSPYLKLAPSVSRVDWRSENRNSKGNPYRPFVGTVV # EDEVKKKFDSFEKFNSTLWDACQGEHG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g773 ### # start gene g774 4 AUGUSTUS gene 3201013 3202242 0.6 - . g774 4 AUGUSTUS transcript 3201013 3202242 0.6 - . g774.t1 4 AUGUSTUS stop_codon 3201013 3201015 . - 0 transcript_id "g774.t1"; gene_id "g774"; 4 AUGUSTUS CDS 3201013 3202242 0.6 - 0 transcript_id "g774.t1"; gene_id "g774"; 4 AUGUSTUS start_codon 3202240 3202242 . - 0 transcript_id "g774.t1"; gene_id "g774"; # protein sequence = [MSPAIYPVPAAVDLLFSTSRRWKSAYIACTIEATSPVTLFPKNLGGRNDSKMNYADLEELTLEYDVSGLNEEQFNHGL # GFVGNGHGLRIPSFVRAPKLHALRLVKMKWWPVLDSELDISVQDDDAIGVTDDRDDGEGFERNDGEGRHEMEEGVGHHYLPYSQIRSLTGSASLPTLY # TLLKLCTNLERVEVEQERFPGLALPPPDMSGSDPNGGGGHGEISGGGGGRGGGGLALGVASPHTPPQQNYSPIYHWNSTFHTGHTPNTKINTPCLHTL # HLTLPTDQPSLTNWIHRAPSLRSLSLTGGKLTSKIIHAQVVRDLIAFVRRHRESGFFDSGFGRFDDGFGGPRRCDFNNFTPSAHAESCTSGLESFALS # TVEISPDQLVELFTLMHGLKELNLVHSRGLRGHIWRC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g774 ### # start gene g775 4 AUGUSTUS gene 3217197 3218761 0.4 - . g775 4 AUGUSTUS transcript 3217197 3218761 0.4 - . g775.t1 4 AUGUSTUS stop_codon 3217197 3217199 . - 0 transcript_id "g775.t1"; gene_id "g775"; 4 AUGUSTUS CDS 3217197 3217692 1 - 1 transcript_id "g775.t1"; gene_id "g775"; 4 AUGUSTUS CDS 3217746 3218214 0.95 - 2 transcript_id "g775.t1"; gene_id "g775"; 4 AUGUSTUS CDS 3218350 3218475 0.91 - 2 transcript_id "g775.t1"; gene_id "g775"; 4 AUGUSTUS CDS 3218524 3218761 0.47 - 0 transcript_id "g775.t1"; gene_id "g775"; 4 AUGUSTUS start_codon 3218759 3218761 . - 0 transcript_id "g775.t1"; gene_id "g775"; # protein sequence = [MATDKKPYCKSLVLDAGPLLSLSPLRGIAESYYTVPQVLAELKDKNAKEHLERLGLNFGIKIEVKNPDPASLASGGCV # LLIQWAKKTGDYAVLSHPDLSVLALTHTLQVRAKRDAEIKASIPVESLAIDDTVDGPTAADSDGSVADEGEDTTEREALNVELHSIEESSQPVASVPS # APSPDVPLYDDPSDSDDGEGEWITPANVALHKSRALDLLPSGGQEKKGKGHRKEEVVDVGCMTADFAMQNVLMQMGLNLVGTEGKRIQRVKTWVLRCH # ACFKICKDNSKQFCPSCGNPSLIRASVTIASPNASSDAPAMQIHLKPNFQYKLRGTKYSIPAPKPGSAKHGSGEGLILREDQVEYMRAKKRMEGKQER # EEARMMKGLLERSAKGEGGVAVGSWMDPDWVPEIISASAGGKGRTTRSNGDLPIIGYGRKNPNERRRNKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g775 ### # start gene g776 4 AUGUSTUS gene 3219586 3220293 0.44 + . g776 4 AUGUSTUS transcript 3219586 3220293 0.44 + . g776.t1 4 AUGUSTUS start_codon 3219586 3219588 . + 0 transcript_id "g776.t1"; gene_id "g776"; 4 AUGUSTUS CDS 3219586 3219860 0.44 + 0 transcript_id "g776.t1"; gene_id "g776"; 4 AUGUSTUS CDS 3219915 3220293 0.9 + 1 transcript_id "g776.t1"; gene_id "g776"; 4 AUGUSTUS stop_codon 3220291 3220293 . + 0 transcript_id "g776.t1"; gene_id "g776"; # protein sequence = [MIYSEAEIQRITRVAAQIALSTNPPMEIHSIDKANVLACSRLWRKTVTETLTKEFPQIKFDHQLVDSTAMVMVANPRK # LNGVILTENLFGDILSDQSSVIPGSLGLLPSASLAGAPVETSSADFKPTPGLYEPIHGSAPDIAGKGIANPIGTILSAAMLLRYSLGLDKPASAIEAA # VRKVLDLPSAGGYGLRTADLGGKVATTELGDKVVEALKEIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g776 ### # start gene g777 4 AUGUSTUS gene 3222897 3224480 0.35 - . g777 4 AUGUSTUS transcript 3222897 3224480 0.35 - . g777.t1 4 AUGUSTUS stop_codon 3222897 3222899 . - 0 transcript_id "g777.t1"; gene_id "g777"; 4 AUGUSTUS CDS 3222897 3224480 0.35 - 0 transcript_id "g777.t1"; gene_id "g777"; 4 AUGUSTUS start_codon 3224478 3224480 . - 0 transcript_id "g777.t1"; gene_id "g777"; # protein sequence = [MHPYTNNRSPIVSNTSHQSTGSVHLTSQTAPTFAHRTSNNPSEVMSFADQRRHSVPSISPIAHERPVTSVSMPGQLSQ # SQYNVNAPQSNRVPAQVGIHSQPQPHSQPSTTCLYPSRTITHPQRSASSPHSLSQVQMISQGHSTPFENHSSRSSIPQSHSVPSNIQPTQLRMNAQSH # SASLENQSSRSSVPQNNSVPPHNRLSQSPVIPLEHPASRSSTPHSYPVPSNNQSVRSYVSSNRASPSQNAQNPRFFNNVCQSNPSTVPQSVSHMGPPS # TVVYRTSIPVSSSSGVHISAQVHDAQLDDKKPIQGPAPPTPPQSDKSLSPDQEQYPTLPSPLLIRTPLKRASIDEGIPSSPSKRMRLDGKEAATPVHS # AEAPTVPQSVGSMVQDVAPSPHLDQQVTGNIIVQSPNLEFTGTIVMTTEKDELVSTSHVLASIEPDPENLEIPQSNLMSDDPSDPVISDIGSRQMVNN # AEAEGSEDDEAGRDKENKEEGDEDEDEDEDESSFTEKEALEEVLKLEHSGNICKLCR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g777 ### # start gene g778 4 AUGUSTUS gene 3224607 3224972 0.58 - . g778 4 AUGUSTUS transcript 3224607 3224972 0.58 - . g778.t1 4 AUGUSTUS stop_codon 3224607 3224609 . - 0 transcript_id "g778.t1"; gene_id "g778"; 4 AUGUSTUS CDS 3224607 3224972 0.58 - 0 transcript_id "g778.t1"; gene_id "g778"; 4 AUGUSTUS start_codon 3224970 3224972 . - 0 transcript_id "g778.t1"; gene_id "g778"; # protein sequence = [MENVALRDENTALRAGNAALRNTQSSMETSMKKLWQDNEILDRTLKSIGPERDFFKDRADRYHALFAASPEALPAVCR # DLQQEVERLRRQYAALTSTTERLVNDGLALGVLVKTDNSPDGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g778 ### # start gene g779 4 AUGUSTUS gene 3227483 3228388 0.85 + . g779 4 AUGUSTUS transcript 3227483 3228388 0.85 + . g779.t1 4 AUGUSTUS start_codon 3227483 3227485 . + 0 transcript_id "g779.t1"; gene_id "g779"; 4 AUGUSTUS CDS 3227483 3228388 0.85 + 0 transcript_id "g779.t1"; gene_id "g779"; 4 AUGUSTUS stop_codon 3228386 3228388 . + 0 transcript_id "g779.t1"; gene_id "g779"; # protein sequence = [MAIVVDPAQFSGPPAPDEPPHIRSRTLDAVWTENETEMDRITRGAYVGRLSPTSRVTSNPPENFESRDSSRPVREVTG # LTDAIPSPLIRIHSECFTGETVGSMRCDCGEQLDEAIRLISQPIAIPSQSFSTPSKVLPGRGAVIYLRQEGRGIGLLSKIRAYNLQDLGHDTVTANLM # LGHQADERGYEVACAILRDLGLGNPDGAGENVRVLTNNPDKVEALEKEGIRVVERVPMIPRSWKTRNPQLVDHVMLAPVDDARVAGATLIGGGAVHGE # DLDKYLRTKVLKMGHILPLWLENPEQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g779 ### # start gene g780 4 AUGUSTUS gene 3231563 3233443 0.39 + . g780 4 AUGUSTUS transcript 3231563 3233443 0.39 + . g780.t1 4 AUGUSTUS start_codon 3231563 3231565 . + 0 transcript_id "g780.t1"; gene_id "g780"; 4 AUGUSTUS CDS 3231563 3231581 0.52 + 0 transcript_id "g780.t1"; gene_id "g780"; 4 AUGUSTUS CDS 3231663 3233443 0.63 + 2 transcript_id "g780.t1"; gene_id "g780"; 4 AUGUSTUS stop_codon 3233441 3233443 . + 0 transcript_id "g780.t1"; gene_id "g780"; # protein sequence = [MLNNHDDDIYYTESIAGYNWPPKLVQSSTNCGDPLNDELYPPDFTETLSRIRSGYYPFGLEHSAYSNLLANAQINLDR # CQNKLDRLVDVHETLEAHKQFLRAHITLISSLCSPIRKLPRELLEDIFEYVCCTGVGNHIAPGARYYRDQRRKVRSNVARLPTLDLGQVCHYWNSIIC # SLPVLWSSFGFQEMEKSIVVRSGLELFLRRSSSHPIDLLINEFANQVSEYSLPLLLPEEHSNRWRHVTIRTVRAYSYLKPLINTTTTRGLPLLTSLSL # DGLYDGTECAFLEFPVPCPNLQYLSLTAIALDLAFIRTTITHLAISHVSPGHAWVLISYCPNLKELLLKEIDISLSEDNALPLLYTCNTQKLILEIPE # SAISNLLFSIDLPKVSCLELIDSDKDSRSYSIEPLARMLDRSSANNLTHLSLRYVSFSLDHLLPFFSCTPSITDLEVVEVMGQLRGVYPILKLLICED # GGGEPEDVVFEDQEDIDQVDKAEDFIQPQVRSKACLLPKLENLRLVIRPRNQLLYTLVHSRWRPGTSDLSSQGQPVCLKSFYLRYLLRNLSLLGTRDL # DALRRSLERFKKEGLNVQIGLAPSYNTTSAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g780 ### # start gene g781 4 AUGUSTUS gene 3236628 3238133 0.96 + . g781 4 AUGUSTUS transcript 3236628 3238133 0.96 + . g781.t1 4 AUGUSTUS start_codon 3236628 3236630 . + 0 transcript_id "g781.t1"; gene_id "g781"; 4 AUGUSTUS CDS 3236628 3238133 0.96 + 0 transcript_id "g781.t1"; gene_id "g781"; 4 AUGUSTUS stop_codon 3238131 3238133 . + 0 transcript_id "g781.t1"; gene_id "g781"; # protein sequence = [MNSSTASTIPDPPLGTIVELSSGIGTGVVRFNGYTDFKPGKWVGVELFEKNGKNDGSVGGVRYFSCKGGMGYGVFVRG # SQIKRIVGNEREKEGERKMSVSAARRPTLGHQRTSSIGNGLGTAPSSSASSTLRVSPASASGSNRSTSPAKPSSSRLSPTKKSSLSLSSTTLTRPGHQ # ARRSISLKQAPSPSSPNPPRVSSPLTKTPSPVPTSATVAFVSEPPTSSLSPPTTAPETEPPRPSITLPDTHPQIHALLTKVRVLETNRTLDTLQIQSL # ESKLAESSSFLSLRPKLQAKLQSQQTELTSLKQEINELKAQVKVWEERKEVVEGELEMCMLDKEMAEERAEIAVGELEAVKERLAEVEVEVEVLREEK # ELWELENDGEIKPEGKQKDTNTLAYVQLEKQNERLKEALLRLRDMTQDTDQDQRRRIAEMEKDLTGYEELQAQLSTTTVKLSNAETQIDDLKLQLDDA # LGAEDMLVQLTERNLVLGEVTNCIFLSSYYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g781 ### # start gene g782 4 AUGUSTUS gene 3239838 3241604 0.74 + . g782 4 AUGUSTUS transcript 3239838 3241604 0.74 + . g782.t1 4 AUGUSTUS start_codon 3239838 3239840 . + 0 transcript_id "g782.t1"; gene_id "g782"; 4 AUGUSTUS CDS 3239838 3241604 0.74 + 0 transcript_id "g782.t1"; gene_id "g782"; 4 AUGUSTUS stop_codon 3241602 3241604 . + 0 transcript_id "g782.t1"; gene_id "g782"; # protein sequence = [MAKRLEELASSTPTSTSTSGANAALKPHLLPQMEVLSNTVQELVNFGISLAQQTLPYLADVRAGKTTPFRLTEILGFA # KQQAGGIVVGGGGGTTGATTTTTAVAAKPMLFKPGMLWWEVVGDMITNLIEDSARLLPQTLDPANVLFLSPSTTTTAMTTTTTVTASTNPATPSFPSP # PWISRIQTVQTLLTNSLSSTYNHLISQLQSDLLSLSRTLKAKDQHLAELTVKIQLLERRAEGKGAEVRRMEEMVKEMEVEVGRLRKVEAGYGEAMVQM # QGEVEGLEREVERLRGRGNVVEGGGEHVKGVDQDGVGVGGSGLISAGVTATEGNLDHAQLMDQVKFPIIPYNLFLFYLQYTALRNTVRFLRTENAYLR # GYDLIREIQALPLIPVPRSSRPPTPALAPSGLSDTDTDTEGDEEYNDPASRTTLKKSSSSQPLPLLTETKLVYRSVMKYTSSPRVVDLSEVNARRLEV # SRRRGLRLQKGRKNGQIEMREDGDMEEVAADREKDNGVLEGEGIKDAETGIEKLDPIGSTAPEIPRRPSPSGVWMPRKRMPAHQVLERKIRGERLGER # VRGLMERVERASVVRVGGGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g782 ### # start gene g783 4 AUGUSTUS gene 3246412 3246633 0.9 - . g783 4 AUGUSTUS transcript 3246412 3246633 0.9 - . g783.t1 4 AUGUSTUS stop_codon 3246412 3246414 . - 0 transcript_id "g783.t1"; gene_id "g783"; 4 AUGUSTUS CDS 3246412 3246633 0.9 - 0 transcript_id "g783.t1"; gene_id "g783"; 4 AUGUSTUS start_codon 3246631 3246633 . - 0 transcript_id "g783.t1"; gene_id "g783"; # protein sequence = [MSQPRQEDPANVRLGEGLDNAPPPPSTTNEDRTDEEKKNEAEIAERLSRLIEDANSRVVPLTKMIRKVNRTSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g783 ### # start gene g784 4 AUGUSTUS gene 3248371 3249441 0.38 - . g784 4 AUGUSTUS transcript 3248371 3249441 0.38 - . g784.t1 4 AUGUSTUS stop_codon 3248371 3248373 . - 0 transcript_id "g784.t1"; gene_id "g784"; 4 AUGUSTUS CDS 3248371 3248871 0.49 - 0 transcript_id "g784.t1"; gene_id "g784"; 4 AUGUSTUS CDS 3248938 3249441 0.38 - 0 transcript_id "g784.t1"; gene_id "g784"; 4 AUGUSTUS start_codon 3249439 3249441 . - 0 transcript_id "g784.t1"; gene_id "g784"; # protein sequence = [MALQTQTESSFSSESSTSTSASSSSSSATTTNDNPDSGSFFTPTSSPPLILAFLAIGLLVTAIIAALGWRRAYFVARF # RSDVGRRQMGRGQFHKAEMDIGSKPKLWDLRTTSRISGSGSHVTGIDSAAGRGANGMEMCSSGAGKFWSRLHADQEIEISWENIMVSRYGPISVTPLI # HANDDEDRNSDELVQELLPSPTSWISHIVSQSRTVLVSLSHHLPGRIHHHHRQHWVHEGSDAIEPSLSDPPAETDKGRFEAVVDNISRDQYESLQIAV # AIAMPMPKVARDKELDGNLGEVDERRPEMYEYALGLCRTSCSGAEGHEFVEVTSKPVLPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g784 ### # start gene g785 4 AUGUSTUS gene 3252467 3253836 0.14 + . g785 4 AUGUSTUS transcript 3252467 3253836 0.14 + . g785.t1 4 AUGUSTUS start_codon 3252467 3252469 . + 0 transcript_id "g785.t1"; gene_id "g785"; 4 AUGUSTUS CDS 3252467 3252762 0.27 + 0 transcript_id "g785.t1"; gene_id "g785"; 4 AUGUSTUS CDS 3252820 3253158 0.94 + 1 transcript_id "g785.t1"; gene_id "g785"; 4 AUGUSTUS CDS 3253489 3253536 0.88 + 1 transcript_id "g785.t1"; gene_id "g785"; 4 AUGUSTUS CDS 3253605 3253836 0.82 + 1 transcript_id "g785.t1"; gene_id "g785"; 4 AUGUSTUS stop_codon 3253834 3253836 . + 0 transcript_id "g785.t1"; gene_id "g785"; # protein sequence = [MGKTWEFMMSDPQLRWIGPEKGVIHIATGAVNNALWDMYARSRQKPLWKLVVDFSPEELVRSAAWRYISDAITKEEAL # DMLKKIESTKAEREAKVREIGYPAYVTSAGWLGYSDEKVARLTKEAVAMGFNHFKMKVGADQANDLRRGKIIRSIIDDPQYLPAGTHPRDPNSEDLKG # KNAGPTGSVLMIDANQVWDVPQAIEYVKGLEEIKPWFGVPVCPHAGGVGLCDLIDYIAISGTMERNVLEFVDHLHEHFITPCSINSKGRYNVPTNPLE # GYSIEMFQTSIAEYEWPNGSYWLSAKGKKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g785 ### # start gene g786 4 AUGUSTUS gene 3255227 3256081 0.22 + . g786 4 AUGUSTUS transcript 3255227 3256081 0.22 + . g786.t1 4 AUGUSTUS start_codon 3255227 3255229 . + 0 transcript_id "g786.t1"; gene_id "g786"; 4 AUGUSTUS CDS 3255227 3255733 0.22 + 0 transcript_id "g786.t1"; gene_id "g786"; 4 AUGUSTUS CDS 3255908 3256081 0.89 + 0 transcript_id "g786.t1"; gene_id "g786"; 4 AUGUSTUS stop_codon 3256079 3256081 . + 0 transcript_id "g786.t1"; gene_id "g786"; # protein sequence = [MSHHNLPTYSFTPRFRHTIKAESQTPQDPVFSSNLSAALYELGDYAGCVHAICRAAKKVQALQDDDQEKNLVLLQKLS # SRLPKAFIHGILIESIDASSLGLEDDGEKDVLERLRSVGAGTSSSNPDSDTSRLWEQFQRVRDERSAISEVDVVNARHRLADLPIFKKAVYIGQDEVI # SLVDDWGALPEEQDPIDLASLSSSQRKNLSFLFAGVGDGESYLFYPSLPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g786 ### # start gene g787 4 AUGUSTUS gene 3258310 3258747 0.46 + . g787 4 AUGUSTUS transcript 3258310 3258747 0.46 + . g787.t1 4 AUGUSTUS start_codon 3258310 3258312 . + 0 transcript_id "g787.t1"; gene_id "g787"; 4 AUGUSTUS CDS 3258310 3258747 0.46 + 0 transcript_id "g787.t1"; gene_id "g787"; 4 AUGUSTUS stop_codon 3258745 3258747 . + 0 transcript_id "g787.t1"; gene_id "g787"; # protein sequence = [MLSIAHEALPFPIHVAHDSTSDEICITSQDEIGHYQATVGPSGWCFPTQMMRLNTDQCAVLIFIGPKAQYGADWLAKN # MAEVLEGRATRKGDVYVLTVVDEMNMGSSKISWRMRRSRADKMKKEKWTMVPIRFDAREAGESTPNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g787 ### # start gene g788 4 AUGUSTUS gene 3259256 3259939 0.83 - . g788 4 AUGUSTUS transcript 3259256 3259939 0.83 - . g788.t1 4 AUGUSTUS stop_codon 3259256 3259258 . - 0 transcript_id "g788.t1"; gene_id "g788"; 4 AUGUSTUS CDS 3259256 3259939 0.83 - 0 transcript_id "g788.t1"; gene_id "g788"; 4 AUGUSTUS start_codon 3259937 3259939 . - 0 transcript_id "g788.t1"; gene_id "g788"; # protein sequence = [MSVCLYKSDSNIFTYYEFPTADPNQSTRNMFYTYDMGSPFVESSEGYSSASPSPSSIYGCDDSQSQQGYNSPHTSGTP # MGMHDQAFNLNYLTIPHSYAASSSSHSYSTFGSPALTCRSSVASSSLSPSPAPETMETTRLYSTVHHATPEPELLMGFSLDMGQVALGDPLGTLNLKD # IERDVQLETFLASLNEGVDNHGMGPENSASSPWGIEQGYGINGMSVVGQMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g788 ### # start gene g789 4 AUGUSTUS gene 3264767 3268606 0.58 + . g789 4 AUGUSTUS transcript 3264767 3268606 0.58 + . g789.t1 4 AUGUSTUS start_codon 3264767 3264769 . + 0 transcript_id "g789.t1"; gene_id "g789"; 4 AUGUSTUS CDS 3264767 3266227 0.58 + 0 transcript_id "g789.t1"; gene_id "g789"; 4 AUGUSTUS CDS 3266333 3268606 1 + 0 transcript_id "g789.t1"; gene_id "g789"; 4 AUGUSTUS stop_codon 3268604 3268606 . + 0 transcript_id "g789.t1"; gene_id "g789"; # protein sequence = [MGVELSRSFCTRGTRTEVLDRILAWVTESNLNDNHSGGYWMSGMAGTGKTTITMSLCKELKETHGILAATFFCSRQIP # ECQDYKLVIPTLVYQLAMFFPDFSALVQNVLDGDVHVMHKKSSEQIQKLLIEPWGMQKDLHPSMRMVVVIDALDECNGIESVLGPLVSAIQNKKLTGL # KFFFTSRPEQVIEEGMITKITSTQEILQVDEFVLHQVEYNLVQRDIHTYITDELHDLSLSQEQLKTLTNLSGKLFIYAATVIKSIKGGSGIRRSRTRQ # KERVKSFLRQKNNTPEDLSKLYAGILESAIAKEEPSPSEVLENWKIIHTIISVGEPLTCYAITQLLGMNLEDDDDDNDIVENLIQRLQAVFYISKSTN # LVFTFHASFPDFIMQYDQVIYNASIQHLDLTFSCFTIMEKLRFNICNLHSSLIADSEVKDLNERVAENIGETLKYCCQFWNYHFLKCSQSSYEEVLGK # LELFLKQKGIYWIEAMSEIVTSQQMNTLKALVEHLHSLLIQFASSEVKDMTPHLYLSIIPFWQNNLGCIPYIHKSVKIEHQVGNWHAQDTVTINTSPF # IVRSLNFAPDGTKLVLGCSDSTVRIWDASTGVQIGDSLQGHTRTVNSVAFSSDGTRIVSGSDDETVRVWDARTGAQICEPFKDHGRYINAVAISPNGT # KIVSGSDDNAIQICDAQSGTRIGNPLQGHDLKVSSVAFSPDGGKIVSGSLDRTIRIWDTNSGVQVGNPLLGHSQHVTSVAFSPDGKRIVSASHDKTVR # IWDAITGFQIGSALEGHESYIHTATISPDGTKVVSGSSDSTIRIWDISTGLQIGDPLDFHDKGVAAVVFSPDETNIVSSSYDETVRICNISGGIQLLT # GSSPGLQGHNDAVNSVAFSPDGTTIVSGSHDKTVRIWDAATCVQVMNPLKGHENFVTTVSFSPDGKRIVSGSWDKTVRIWDVRTGTEIGAPLVGHETH # IESVAFSPDGTKVVSASWDIVKIWDSKTGHQLVGDILEGHNNSRVNSVSFSPDGTLIACACKDKTVKIWNASTGVKVAAPLPNYNNGVNSVAFSPDGK # QIASGSDDKTVRIWDASTCVQLGNSLQGHDYIVTSVAFSPDGRRIVSGSLDRTIRIWNANTGAQVGAPLQGHEAGVKAVAFSSDGTKVVSASWDSTIR # VWDVFSDIDRGDTLQHDYMSIVSIAFSQISPANGSHIVYDYSMTEVGNTFHNQTGEFLHLLNDLSLIDQSAYQPLRASNWLLMAGYTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g789 ### # start gene g790 4 AUGUSTUS gene 3269942 3275707 0.41 - . g790 4 AUGUSTUS transcript 3269942 3275707 0.41 - . g790.t1 4 AUGUSTUS stop_codon 3269942 3269944 . - 0 transcript_id "g790.t1"; gene_id "g790"; 4 AUGUSTUS CDS 3269942 3273999 0.47 - 2 transcript_id "g790.t1"; gene_id "g790"; 4 AUGUSTUS CDS 3274531 3275707 0.79 - 0 transcript_id "g790.t1"; gene_id "g790"; 4 AUGUSTUS start_codon 3275705 3275707 . - 0 transcript_id "g790.t1"; gene_id "g790"; # protein sequence = [MIGELPESGGYNAISVFVDHFTKRLRLFATHTTITSEGMARVYRDKVFPIHGMPRKIVHDRGPQYHARFMKELYKLLG # IESNYTTAYHPQTNGQTERINQEIEHYIRLFVNHHQSDWHEWLPMMEFAYNDRVHSATKVSPFYADNGRHPYKGTTPKMTSQNPTAQEFADSMKRIRE # EVGSALKKAAEDMKRQYDKHRNEAIEYKAGDKVWLEGTNITTDRPMKKLEDKRFGPFKVLEKIGSSSYKLDIPRTWKRVHNVFNETHLSPYHEPQFPT # QPRNTEPPPEVVGEEEEYKVEEVVDARKYRNGIQYKVKWRGYGPHEMTWEPAANMTNAKEAVQDFHKKYPNKPRPRTLKRIEIPIAQFPTELFRQIPT # PDIEPVPSTMPSEALVNRLALELATRSIGFSDHLTSNPKDNTEAWEAKKDDDGNLLNAIVGRLSDQIYRRYKNYENVFDLWKNLLSDFDSKSALTEAH # LQQQLHSMHCHEPSKVNEHLDKLLEIRDSLEARKITIPEEMFNNTIIASIPNIFKPTINALVVVAARTSVPLTTRELVSTIRAEASGHTRGQSGKKES # ANYAGGNSNRGRGGFNRNRGNFRGQSRGRGNGNRGGGQSQPNSNNSTCYNCGGKGHFANKCSSPKRQQANEAQDSSQKKEKTQPSGSSSNSWRSKNKE # VGSSATIEEVPESSWAAVEVTTTTSQEIFNFSEIASSYETAFVASHSSGAILFDSGCSSHMTPLQDKLRNTRSVPTRIIQAANAETFTSNTAGNLQID # LPINEDGISKSLTLQNTLLCPNTPNTLVSLGKLDDAGYVMVIKDGTLKIINRQGETIGIVPKTNGLYQIPSAEYAYTGKAARMVSLYEAHCIAGHQNY # AYVKHMFKSNQVHGIKLDPKQMEEPECRTCMLAKAARSPISKIRTSPRAEKFGDVFHMDVWGPASVQMLNHYVYALTVIDEATSWLEEPLMKGKDEAF # AQYVILQTGLQTQYGVMVKKLHSDRGGEFLSGEFTAYLERLGTKRSLTVHDTPEHNGIAERSHRTLLNGVRSLMISSGLLKWLWGFMMGYIVYVWNRT # PKKANGMISPWEKRFVTIPDISNFHIFGSTVYVKREKEPGKLDPQAQEGRWVGIEPESNGYFIYWPDRHTVSTERNVQFSDRQIQPVEGEDQDLGNLE # TSITESEQPIIPVPEEIAEPINPDIITGKRVRKPTKKIQDIINGLGEPNRELRHLTASLGQVTGEIIADPTSVAEAMRRPDWSQWREAMNEEIRRLQQ # RGTYDIVIPPDDANILTSKWVFRTKRDEQGKVTGHRARLVVRGFNQIPDVDYFPDEMFASVTKLAAARAILSTGAEQNMFIHQMDVKSAYLYGKLDDN # EQIYMKAPPGVDIEVKAGQVLKLKLALYGLKQAGRRWYMRFREIMTSVGLTRSNFDHAVFYRTDPFCIIFIHVDDMTMLTKTMAVMDTLKKKIRDQIE # VVDSGEIHWLLGIEIRRSLHTRSIHLSQRAYIDAILSRYGFADVKPLSIPFDPHIHLTKDQMPTTVEDITYMRDKPYREAVGALQYLSVATRPDITYA # VGILAKFLQNPGITHWNAVKHVYAYLKYTRDLWLTFGGAQAEIEGYTDTDGMSQEDRHAISGYVFMLNGGAVSWSSKQQDTISLSTTEAEYIALTHAA # KEAIWFRNLLLELFGPITKPIILNADNQSAIALAKDDHFHARTKHIDIRYHFIRYVIEEGKIRLVYCPTENMTADIFTKALPSLKAKHFAASMGLTKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g790 ### # start gene g791 4 AUGUSTUS gene 3276041 3276988 0.4 - . g791 4 AUGUSTUS transcript 3276041 3276988 0.4 - . g791.t1 4 AUGUSTUS stop_codon 3276041 3276043 . - 0 transcript_id "g791.t1"; gene_id "g791"; 4 AUGUSTUS CDS 3276041 3276988 0.4 - 0 transcript_id "g791.t1"; gene_id "g791"; 4 AUGUSTUS start_codon 3276986 3276988 . - 0 transcript_id "g791.t1"; gene_id "g791"; # protein sequence = [MDDILIFTDNIEEHRIIVRKVLDILKANKLYLKPEKCTFKAREVEYLGIIVGNGQIRMDPKKVEAVRTWQPPQKKREL # QSFLGFCNFFRRFIRDFSKIAKPLTRLTGNATWEWTSLEQDVFNQLKDRIIEDVTLIIPRETGKFRIEADSSDYANGAVLSQNVDGKWRPVAFRSRSL # NEVERNYEIYDKEMMAIMDSLSDWRQYLLGAKEPVEVFTDHQNLQYFRKPQKLNRRQARWVVEIAEYHIELFHKPGKSMGKADALSRMSGLEKGENDN # TDVTLLKPEFSISQVTDQTSAPEDDLLNLIRRKKNQRDKLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g791 ### # start gene g792 4 AUGUSTUS gene 3277270 3278331 0.96 - . g792 4 AUGUSTUS transcript 3277270 3278331 0.96 - . g792.t1 4 AUGUSTUS stop_codon 3277270 3277272 . - 0 transcript_id "g792.t1"; gene_id "g792"; 4 AUGUSTUS CDS 3277270 3278331 0.96 - 0 transcript_id "g792.t1"; gene_id "g792"; 4 AUGUSTUS start_codon 3278329 3278331 . - 0 transcript_id "g792.t1"; gene_id "g792"; # protein sequence = [MTTRAEKKPVRYEPNTPEWVAQRLQMDKLPMAIGILRAWMPESRVREASEETVLAIRNLSHATATEAVTNLKSRKRFV # QGTRGRELKLRTTIENINNGVQIETEALLDSGATGSCINKDFVEQHQLTVKELPVKMPVYNADGTLNKNGSIEGYVQVRMVIGDHAEQIDMAVTNLGK # TDIFLGIDWLRYHNPSIDWKESTLTFERCPDKCGYLPHYESPEDDGTEEKLVDGERIFWFDWDGYLSDQGHIKVQTATTDAATPYLAEYADVFSKKDF # DQMPERRPWDHAIELTPGSKPVDCKIYPLSPPEQKALDEFLEENLRSGRIQPSCSPMASPFFFVKRKMEHYGLYRIIES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g792 ### # start gene g793 4 AUGUSTUS gene 3278457 3280976 0.34 - . g793 4 AUGUSTUS transcript 3278457 3280976 0.34 - . g793.t1 4 AUGUSTUS stop_codon 3278457 3278459 . - 0 transcript_id "g793.t1"; gene_id "g793"; 4 AUGUSTUS CDS 3278457 3279528 0.76 - 1 transcript_id "g793.t1"; gene_id "g793"; 4 AUGUSTUS CDS 3280483 3280976 0.34 - 0 transcript_id "g793.t1"; gene_id "g793"; 4 AUGUSTUS start_codon 3280974 3280976 . - 0 transcript_id "g793.t1"; gene_id "g793"; # protein sequence = [MSLRTNPPRKADNHPTKPTAACAHREHIFDKDDVKDRYHDPDGNKYRVCKDQPCPNRYDKITTGYIPGFARLIDRKQE # DLILGRGAPPEQVALSSSQKPEGTPEAAPAPEPEYPVFPPPPSPVLDRPSSPISSLPRSSPPPPDPEDPDPGAEVSDPESDDDDDNILSVQTDRYRTP # DSSAPSTSSSIERNITSFIPAYIPSNYSMSNPTPAPTTTTSNIHGKSLLREPSIFDGDKAQFKEWRRTLFAYIRDPRNRIVTDSERIDIAVSYMRGPK # VSSWVQNYTDDNFNDDEEEWKVTWKGFKDALNASFLDKGLTENAQEKLEHLRQGPNERAEDFFKEFEVIMRDAGYAKDAPYVIRLIEMNVKPKLIDQV # YGTSNERIEKFDELKQKIISIDDMWWRREEMRRNWSNRYQRNAGQGPSSQRWQPQTTQAPATKAPTPAVPTQDRKDGTGMTFKGAGRPMDIDAAHRNR # ECFHCGKQVHIAKFCPEKAPKPQFVRGMWSRMTQEDQEAMAKELGFVLPQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g793 ### # start gene g794 4 AUGUSTUS gene 3283443 3284084 0.65 + . g794 4 AUGUSTUS transcript 3283443 3284084 0.65 + . g794.t1 4 AUGUSTUS start_codon 3283443 3283445 . + 0 transcript_id "g794.t1"; gene_id "g794"; 4 AUGUSTUS CDS 3283443 3284084 0.65 + 0 transcript_id "g794.t1"; gene_id "g794"; 4 AUGUSTUS stop_codon 3284082 3284084 . + 0 transcript_id "g794.t1"; gene_id "g794"; # protein sequence = [MKTLPLLPMTSINSSLRESGTADNKSRPYGVTWHHTTAALPSNDPIEDAHSHQIIQSDDGKSDLLFFSVFDGHGGRNT # SQLLSRTLINAVALKLSQLAASTTASSSTKSFTDGLWAIWSKSPSNSTPTSWDVPSISSAIENAFVEFDQVLLDAPISILKQTLQEGNLTAKSPVPDL # SSNASGIQTMQAAISGTCYAPSFFFSPTSYDVQVAVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g794 ### # start gene g795 4 AUGUSTUS gene 3285825 3287177 0.47 + . g795 4 AUGUSTUS transcript 3285825 3287177 0.47 + . g795.t1 4 AUGUSTUS start_codon 3285825 3285827 . + 0 transcript_id "g795.t1"; gene_id "g795"; 4 AUGUSTUS CDS 3285825 3287177 0.47 + 0 transcript_id "g795.t1"; gene_id "g795"; 4 AUGUSTUS stop_codon 3287175 3287177 . + 0 transcript_id "g795.t1"; gene_id "g795"; # protein sequence = [MVISMPVLWTSLGIDMFCSLNAAYSFFKRFLGRSSFHPVDFTINYDDAYPYQYPHEAPIFPLLESNCGRWRHVCVRTS # LDLVEALMQPIISSGKELPRLESLSLNPRFYDHSDEGLLDFPVDCPNLRALKLVGPRLDLKFPRPTITSLKLAEMSPSEMARVIANCPNVQALKIKQL # TSLDTSLSPVYTKCNAKKLILCVGNSREGVAPDSMMKFVDLLILPELNHIILSDPRGALESRHVESLCNNMIEHGYPHLTHLTLDRTFLTAEQLLQLF # LSMSSITYLKAWKTAVNLALKLLIAPGYRDQPGQHIGNNEGRKERENVLEGYNSNDDESEDGVDAIEVPEGKCLLPKLQNLELVLPYRLRGTLLLAFL # RSRWKPSPQMEVSSPTLTEDPQGLSDIDQKTCVSLQKLCLRYTYLDEERDLEKLQILQRSLDPFRSEGMDIEVLSEIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g795 ### # start gene g796 4 AUGUSTUS gene 3288957 3290000 0.45 + . g796 4 AUGUSTUS transcript 3288957 3290000 0.45 + . g796.t1 4 AUGUSTUS start_codon 3288957 3288959 . + 0 transcript_id "g796.t1"; gene_id "g796"; 4 AUGUSTUS CDS 3288957 3290000 0.45 + 0 transcript_id "g796.t1"; gene_id "g796"; 4 AUGUSTUS stop_codon 3289998 3290000 . + 0 transcript_id "g796.t1"; gene_id "g796"; # protein sequence = [MFFQRCKKHVNATKQFTIQEAPVVLTVHLKRFSPTGSKIGHMVSYDEQLSLAPYMSEGQYGPNYSLYGVICHAGGGPH # SGHYYAYVKSRDNRWHEMNDESVTTASTPTRNKNSYILFYIKNKGEKLESAVKANTPLTNGSAIQFTPTQVKKPGIAAQMQKKRPREGENGEGGEDQG # VKVNPPFIGPVLPSQESVGEGSSPSQAKRPKLDSEDPQASVIKRKIDSAKAANGKAPLPGLADYGSDNEEEEVGEKTEAPEETSSKVIDRPESSPPRR # PPTPAAALPRFSGPIPTSSFYATPKAKQKPTHGGGSGPSPANRKTSFLDRKNNYNPYAFGKKNKRFGSRPRAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g796 ### # start gene g797 4 AUGUSTUS gene 3293176 3293975 0.35 + . g797 4 AUGUSTUS transcript 3293176 3293975 0.35 + . g797.t1 4 AUGUSTUS start_codon 3293176 3293178 . + 0 transcript_id "g797.t1"; gene_id "g797"; 4 AUGUSTUS CDS 3293176 3293283 0.35 + 0 transcript_id "g797.t1"; gene_id "g797"; 4 AUGUSTUS CDS 3293343 3293528 0.98 + 0 transcript_id "g797.t1"; gene_id "g797"; 4 AUGUSTUS CDS 3293586 3293595 0.98 + 0 transcript_id "g797.t1"; gene_id "g797"; 4 AUGUSTUS CDS 3293674 3293975 1 + 2 transcript_id "g797.t1"; gene_id "g797"; 4 AUGUSTUS stop_codon 3293973 3293975 . + 0 transcript_id "g797.t1"; gene_id "g797"; # protein sequence = [MHSDGTYVGRSAPEIDMFEAQVTDELGYVSQSAQWAPFNDFYVWDNTTDNLIIYNSTASELNSYIGGDTQQASSVVTE # TNQLCYELSKAPCYSIYAFEYKPGFDDAVSELSSIVRYTTQMSSPQYITWYSSGTPAWTLNVAGMGADTATEISARPVPQEPMYLIINLGMSENFGTV # DLEHLTFPNHLRVDCEFLLYTKFEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g797 ### # start gene g798 4 AUGUSTUS gene 3295607 3297133 0.37 - . g798 4 AUGUSTUS transcript 3295607 3297133 0.37 - . g798.t1 4 AUGUSTUS stop_codon 3295607 3295609 . - 0 transcript_id "g798.t1"; gene_id "g798"; 4 AUGUSTUS CDS 3295607 3297133 0.37 - 0 transcript_id "g798.t1"; gene_id "g798"; 4 AUGUSTUS start_codon 3297131 3297133 . - 0 transcript_id "g798.t1"; gene_id "g798"; # protein sequence = [MLGTRTKQINSYGKRSQRIVSVFQSESGSKASIFDDLPPTKLAPVASRMKKKRSENAADIRPKLASPKHRQVQKKKQS # PLAQPLRQKLMRAQMGRKVSNTKTAVENTPTRTPLAMYPLNTPGSPAIPSGLLRKKARPSSAIRTPLMKTRSDLVEVDIIILDDQGKTISRERRVSKG # KNVEPGNSSFERSDNDEGPIRPRKRLRNFVITSEDESSSDDEDVVPSPVVNPKLQVVKLPLHPPLPVPSRSLPYVLVPSPSPELAAILKATNTTDLTS # PPLAPLPLIDYDLPHIVKPRKLTPIKGRGRGFLRPPSPPSPLSDSDLEISFSDLDLGVDIGPVDTSLELPPVIPEYLRPLLEECQQSMTGLHEFSAFI # DTFAFDPAVRGILPAKNLRFRKVGEASFSEVFGIGDVVLKVIPLRDESGTSLSGSQKARMSDCADLPAPTDAKDVLKEVIVTRAMGEVCERFVKLVKA # YVVRGRYPEVLLELWDRYAEELGSESVRPGRCNLNKLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g798 ### # start gene g799 4 AUGUSTUS gene 3301306 3302535 0.99 + . g799 4 AUGUSTUS transcript 3301306 3302535 0.99 + . g799.t1 4 AUGUSTUS start_codon 3301306 3301308 . + 0 transcript_id "g799.t1"; gene_id "g799"; 4 AUGUSTUS CDS 3301306 3302535 0.99 + 0 transcript_id "g799.t1"; gene_id "g799"; 4 AUGUSTUS stop_codon 3302533 3302535 . + 0 transcript_id "g799.t1"; gene_id "g799"; # protein sequence = [MALFSAAGFDLYSDNFNSNSIISPPPSPLLDYNAGSDAISGAVLTRTRTSTDSLSSLSAVTSSDSGSQTPSRTKSHSP # ASGDVQILTPDLTCVGLSDEHVDHWSLKIIKLIAFPDLIPSSGKISSKFTVQNQHPYHPLFDALASTSIRLPPRARSSSNDSSLKYGSSSSSSVNEYD # DEEGYFSHSPTGLSANQSTSSLITSATSSMSDSKSPESTAPHSVSIQPPLASPSSHRPPSKHLMGPLSPLSPITTTPIIPDGVKFSSLASFTSEPRTH # SISSGSHSAAGKSSSKVLSSRVPFFNITRTTEGTSFTTDVDLLARLFPPHERYMVVCGVELDAADERIARQEATGGFSVDESVDHGDELVFPQDAEVN # SGGEDFDESGLLKCLQIDLRKFGLGTEAFSTLATFLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g799 ### # start gene g800 4 AUGUSTUS gene 3309102 3309676 0.16 + . g800 4 AUGUSTUS transcript 3309102 3309676 0.16 + . g800.t1 4 AUGUSTUS start_codon 3309102 3309104 . + 0 transcript_id "g800.t1"; gene_id "g800"; 4 AUGUSTUS CDS 3309102 3309124 0.19 + 0 transcript_id "g800.t1"; gene_id "g800"; 4 AUGUSTUS CDS 3309211 3309676 0.64 + 1 transcript_id "g800.t1"; gene_id "g800"; 4 AUGUSTUS stop_codon 3309674 3309676 . + 0 transcript_id "g800.t1"; gene_id "g800"; # protein sequence = [MVLVGTLLFDENEEEENGGWADPVTENEEDYDGIRSYNDTLECYTSFEELPELDTESLTSVESPFAETPDPLDDDADY # RSAYERDLEKRMVSSVNISSVNSCAPLYMDGCPLDRSMVDALNVNDEDESSPYSWADEEDDLPPLEDEWYQSVIRRTQDVFADA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g800 ### # start gene g801 4 AUGUSTUS gene 3310998 3312676 0.63 + . g801 4 AUGUSTUS transcript 3310998 3312676 0.63 + . g801.t1 4 AUGUSTUS start_codon 3310998 3311000 . + 0 transcript_id "g801.t1"; gene_id "g801"; 4 AUGUSTUS CDS 3310998 3311286 0.63 + 0 transcript_id "g801.t1"; gene_id "g801"; 4 AUGUSTUS CDS 3311406 3312676 0.85 + 2 transcript_id "g801.t1"; gene_id "g801"; 4 AUGUSTUS stop_codon 3312674 3312676 . + 0 transcript_id "g801.t1"; gene_id "g801"; # protein sequence = [MIKERNGGYIVVDAMDECTEVSKVLDWLSAFSDKLWILVTSRIQADGVGKSVLQFTLGGKDSHIGKDIEMYLESEIDI # HSKFEGEVQGNIKETLKRGRSVRKILNKLPRDLEKTYEQALKKCQEEEENAEEAQHLLLWLLYAYEPLTTKQLNAIMAVDLQEQVVDHPHMEVQVEKV # IDSTLVTVGQNNIVQLAHASVKEYLIIYSEAKQTKDLFELNAQLAHDIMTQTTIIYLMQKENLSTDHSSFAHYGVKNWLSHASKVEEYKLKGKAQSLI # EKMLDNNNLYFARWEEMYRHLVNDWEKIEATPLYYGALNGLCEAVQKLISKLDLKTDINISGGRYGTSLQAASFKGYETIVSLLLEMGADVNAQGGVY # GNALQAASAQGYKNIAKLLLEMEADANAQGGWYGNALQAASSGGYEHIVKLLLEMGADVNAQGGVYGNALQAASAEGYEHIAKLLLEMGADANAQGGW # YGNALQAASSGGYKHIVKLLLEMGADVNAQGGYMGMHSTLLHYREMNTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g801 ### # start gene g802 4 AUGUSTUS gene 3313349 3315040 1 + . g802 4 AUGUSTUS transcript 3313349 3315040 1 + . g802.t1 4 AUGUSTUS start_codon 3313349 3313351 . + 0 transcript_id "g802.t1"; gene_id "g802"; 4 AUGUSTUS CDS 3313349 3315040 1 + 0 transcript_id "g802.t1"; gene_id "g802"; 4 AUGUSTUS stop_codon 3315038 3315040 . + 0 transcript_id "g802.t1"; gene_id "g802"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTARIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPDGPRSPNSPDIPNEQRAMLDLLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPLAPKPKPFS # GGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKDNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g802 ### # start gene g803 4 AUGUSTUS gene 3315855 3317366 0.47 + . g803 4 AUGUSTUS transcript 3315855 3317366 0.47 + . g803.t1 4 AUGUSTUS start_codon 3315855 3315857 . + 0 transcript_id "g803.t1"; gene_id "g803"; 4 AUGUSTUS CDS 3315855 3317366 0.47 + 0 transcript_id "g803.t1"; gene_id "g803"; 4 AUGUSTUS stop_codon 3317364 3317366 . + 0 transcript_id "g803.t1"; gene_id "g803"; # protein sequence = [MEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYP # LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLNLAHAYHLVRIAEGDE # WKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRHHRLYANPEKCEFNMDTVEYLGYIL # SPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETD # ASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNM # VIRFRPGKLGEKPDSITRRWDVYPKEGDIATPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g803 ### # start gene g804 4 AUGUSTUS gene 3317465 3318697 0.95 + . g804 4 AUGUSTUS transcript 3317465 3318697 0.95 + . g804.t1 4 AUGUSTUS start_codon 3317465 3317467 . + 0 transcript_id "g804.t1"; gene_id "g804"; 4 AUGUSTUS CDS 3317465 3318697 0.95 + 0 transcript_id "g804.t1"; gene_id "g804"; 4 AUGUSTUS stop_codon 3318695 3318697 . + 0 transcript_id "g804.t1"; gene_id "g804"; # protein sequence = [MDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNR # TLEAIRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGFTAILVVVDRSSKQAIFIPTHDTITSEQLA # ELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGI # TPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVV # SRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g804 ### # start gene g805 4 AUGUSTUS gene 3321362 3322072 0.53 + . g805 4 AUGUSTUS transcript 3321362 3322072 0.53 + . g805.t1 4 AUGUSTUS start_codon 3321362 3321364 . + 0 transcript_id "g805.t1"; gene_id "g805"; 4 AUGUSTUS CDS 3321362 3322072 0.53 + 0 transcript_id "g805.t1"; gene_id "g805"; 4 AUGUSTUS stop_codon 3322070 3322072 . + 0 transcript_id "g805.t1"; gene_id "g805"; # protein sequence = [MGADVNAQGGEYGNALHTASLQGNEHIVRLLLEMGADVNAQGGKYGNALQAALSKGHEHIVKLLLEMGADVNAQGGEY # GNALQAALSKGHEHIVMLLLEMGADVNAQGGEYGNALQVASLQGSEHIVRLMLEMGADVNAQGGEYENALHIASLKGYEDIVKLLIEMGADVNAQGGV # YGNALQAASAEGYEHIAKLLLEKGADANAQGGWYGNALQAASSKGHANIVKILLEKGAVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g805 ### # start gene g806 4 AUGUSTUS gene 3323689 3324855 0.84 + . g806 4 AUGUSTUS transcript 3323689 3324855 0.84 + . g806.t1 4 AUGUSTUS start_codon 3323689 3323691 . + 0 transcript_id "g806.t1"; gene_id "g806"; 4 AUGUSTUS CDS 3323689 3324855 0.84 + 0 transcript_id "g806.t1"; gene_id "g806"; 4 AUGUSTUS stop_codon 3324853 3324855 . + 0 transcript_id "g806.t1"; gene_id "g806"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARHFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCCYCGRRGHLEAVCQDKFMGLGRDRGRHQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g806 ### # start gene g807 4 AUGUSTUS gene 3324906 3329608 0.62 + . g807 4 AUGUSTUS transcript 3324906 3329608 0.62 + . g807.t1 4 AUGUSTUS start_codon 3324906 3324908 . + 0 transcript_id "g807.t1"; gene_id "g807"; 4 AUGUSTUS CDS 3324906 3328560 0.65 + 0 transcript_id "g807.t1"; gene_id "g807"; 4 AUGUSTUS CDS 3329223 3329608 0.78 + 2 transcript_id "g807.t1"; gene_id "g807"; 4 AUGUSTUS stop_codon 3329606 3329608 . + 0 transcript_id "g807.t1"; gene_id "g807"; # protein sequence = [MFAISSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDKEILYSHLAATHTETPNLELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTQLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DIRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGIADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSKDLICILDLSLLPSNSPADTAFICESSTDSSRSFY # AIPLETMTNIADTLSQFEAPIGPHLLHYAHSESSALQPAFVLNPSSHPGPFLSNSSSPVHSGSQFLSPGSPPVFIKEYNVENTWGIDTADDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g807 ### # start gene g808 4 AUGUSTUS gene 3342818 3346381 0.64 - . g808 4 AUGUSTUS transcript 3342818 3346381 0.64 - . g808.t1 4 AUGUSTUS stop_codon 3342818 3342820 . - 0 transcript_id "g808.t1"; gene_id "g808"; 4 AUGUSTUS CDS 3342818 3346381 0.64 - 0 transcript_id "g808.t1"; gene_id "g808"; 4 AUGUSTUS start_codon 3346379 3346381 . - 0 transcript_id "g808.t1"; gene_id "g808"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHFDSPQTSVPSAINPVVAKVAV # PLPEPSPSVSPTILETPPGDSPRSRSRSRSRTLWAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDSKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASVYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRLGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNKQLTASLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPELPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPHKPGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g808 ### # start gene g809 4 AUGUSTUS gene 3346714 3347361 0.77 - . g809 4 AUGUSTUS transcript 3346714 3347361 0.77 - . g809.t1 4 AUGUSTUS stop_codon 3346714 3346716 . - 0 transcript_id "g809.t1"; gene_id "g809"; 4 AUGUSTUS CDS 3346714 3347361 0.77 - 0 transcript_id "g809.t1"; gene_id "g809"; 4 AUGUSTUS start_codon 3347359 3347361 . - 0 transcript_id "g809.t1"; gene_id "g809"; # protein sequence = [MKETENIRKYNIQFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKCEETRKREA # GKPFVARNPKKGSSDFKTGSTNQQNNSQLSGSSALFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGG # KHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g809 ### # start gene g810 4 AUGUSTUS gene 3347506 3348405 0.88 - . g810 4 AUGUSTUS transcript 3347506 3348405 0.88 - . g810.t1 4 AUGUSTUS stop_codon 3347506 3347508 . - 0 transcript_id "g810.t1"; gene_id "g810"; 4 AUGUSTUS CDS 3347506 3348405 0.88 - 0 transcript_id "g810.t1"; gene_id "g810"; 4 AUGUSTUS start_codon 3348403 3348405 . - 0 transcript_id "g810.t1"; gene_id "g810"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNHGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRHGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g810 ### # start gene g811 4 AUGUSTUS gene 3530089 3531222 0.69 - . g811 4 AUGUSTUS transcript 3530089 3531222 0.69 - . g811.t1 4 AUGUSTUS stop_codon 3530089 3530091 . - 0 transcript_id "g811.t1"; gene_id "g811"; 4 AUGUSTUS CDS 3530089 3531222 0.69 - 0 transcript_id "g811.t1"; gene_id "g811"; 4 AUGUSTUS start_codon 3531220 3531222 . - 0 transcript_id "g811.t1"; gene_id "g811"; # protein sequence = [MCSSCLQLVELTANSKVKDQHIQYLKRALEAVWSRFKSREEERDTAEIDPEQMAARSIQSLELKDNQIASLIVEVADL # KAQLTAKPKTEKEFKMRSPPPPPPPSKPRHNSTPVSDLSLRSLSPSPAPPPPHNHGMSAPSLLSVSPIVSSTDSTTLSPLPPPPPPPPPHTVSSASST # IIAALPSPPPPPPPPPPQPPSLGRSQPPSPPPPPPPPSRGLSGLPPLPPPPPPAPGGAPPPPPPPPTPVSGRGPPPPPPPPPTAFRMPARKPSKPVKR # LKPFFWTKLASSALESSIWQETTSESQFDLTDLEATFAIDNTPGAGTGTASQIPLSPSKKQAVTTLLDITRANNIGESFLVSFMKYYNIHDPVGQLSC # YHESN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g811 ### # start gene g812 4 AUGUSTUS gene 3532055 3532700 0.4 - . g812 4 AUGUSTUS transcript 3532055 3532700 0.4 - . g812.t1 4 AUGUSTUS stop_codon 3532055 3532057 . - 0 transcript_id "g812.t1"; gene_id "g812"; 4 AUGUSTUS CDS 3532055 3532288 0.91 - 0 transcript_id "g812.t1"; gene_id "g812"; 4 AUGUSTUS CDS 3532422 3532700 0.4 - 0 transcript_id "g812.t1"; gene_id "g812"; 4 AUGUSTUS start_codon 3532698 3532700 . - 0 transcript_id "g812.t1"; gene_id "g812"; # protein sequence = [MSSLAEYRIAFGEEFRFEMIISTLKLPELNNAVVGDASPADGFGYGYEESDIWEARNAAMLLLNAIATATGSVEDRIM # LREEYGRRGLNEAIVFEDEETMRERVQRVLSRLADSNLEQSRLGSRSGTSESSLSDLLEDIIRLAKQHGELYPIMVDVLNHYGQLLVRDIGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g812 ### # start gene g813 4 AUGUSTUS gene 3532871 3534535 0.79 - . g813 4 AUGUSTUS transcript 3532871 3534535 0.79 - . g813.t1 4 AUGUSTUS stop_codon 3532871 3532873 . - 0 transcript_id "g813.t1"; gene_id "g813"; 4 AUGUSTUS CDS 3532871 3534535 0.79 - 0 transcript_id "g813.t1"; gene_id "g813"; 4 AUGUSTUS start_codon 3534533 3534535 . - 0 transcript_id "g813.t1"; gene_id "g813"; # protein sequence = [MRTFSTFPMTGHMQQPVLRLVSLNSNLTLNLSFLRLPEIHDSFAYKLFISRQTLVSTVITQVIDELGLALSIPIPGGG # PLEYIMEEVWTDGSSESAFCLFPLDLYLIRGQESSRLPGDSLIYSTVEFSYIPNPFPPSATRAFRICIPDEWFRRTKTRTASMTSLEPSQSTIRRLAS # LQEFEEEDEDEDEREEEGEGTAKVNNIASPENKSSSSDWTSTNRLSTLFTGWLSPSTEGPNRSTVVAFPDKRKSVVSEPRLFEQHTGGNHKESSASST # EDESDFDENGFNDMLVSGSFYIECNLLVNIIPLPQDKLGFTGDKRANIQALSQEKKKFLAKQNQHLISSSPKSSPTRNQTFGPSSGGGLMPRLVPHLT # GDSVMRRLSLTSWNNPSEETADQSSVTDSPQTQTATVIAPDPDPQPVASQSTGSLWSSLWILSGGDKSDKYSSDNDKKKTKPAKWYVDQLKSGRLKGD # RLQALVLGLRVQLSTVNLVWIQEFIEVEKGMDQLDVLLVDLVGKGPKSKVLSETNASTLLETAKCFRALLNTDVSLFVIGKFNY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g813 ### # start gene g814 4 AUGUSTUS gene 3535973 3538735 0.05 - . g814 4 AUGUSTUS transcript 3535973 3538735 0.05 - . g814.t1 4 AUGUSTUS stop_codon 3535973 3535975 . - 0 transcript_id "g814.t1"; gene_id "g814"; 4 AUGUSTUS CDS 3535973 3536653 0.69 - 0 transcript_id "g814.t1"; gene_id "g814"; 4 AUGUSTUS CDS 3536848 3537335 0.77 - 2 transcript_id "g814.t1"; gene_id "g814"; 4 AUGUSTUS CDS 3537514 3537736 0.67 - 0 transcript_id "g814.t1"; gene_id "g814"; 4 AUGUSTUS CDS 3537814 3538104 0.16 - 0 transcript_id "g814.t1"; gene_id "g814"; 4 AUGUSTUS CDS 3538253 3538735 0.33 - 0 transcript_id "g814.t1"; gene_id "g814"; 4 AUGUSTUS start_codon 3538733 3538735 . - 0 transcript_id "g814.t1"; gene_id "g814"; # protein sequence = [MSDGDLPDGSEGELVYVEQIHTMRAYELTTLYVDYGHILAKDDVLATAIQTQYYRFLPYLRRALHNLVAEFEPEYLKI # NPTAATTDSANLQSREFNIAFYHLPLVSGIRELRTHKIGTLMSISGTVTRTSEVRPELLFGSFVCEVCKGLVNDIEQQFKYTEENPSEIPTGSMPRSL # DVILRSELVERAKAGDKCVFTGTFIVVPDVSQLGLPGGENAQLQREANRGNSTSAGIGGGVTGLKSLGVRDLQYKTAFLACMGGTNIRGEEEVGEESG # QSFIQSLTEPEFDELKAMIDSDNIYQRLVESIAPTVYGHEIVKKGLLLQLMSGVHKQTASSAAGLTAAVVKDEETGDFTIEAGALMLADNGICAIDEF # DKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPIGGRYDRKKTLRANLQMSAPIMSRFDLFFVVLDECNEKTDRNIAEHIVNVHRYQD # EAINPEFSTETLQRYIRYARTFNPKNQLYFRGRVDSDLHTGTSMNSNTNLQITPAYVREAYTLLRQSIIHVEQDDVDFDEEELDGKRERLVAQDPSTE # AAEESQDVEMSGVDQSEESQQIDGGETSTVVNQTSSTAVAGQSSHADQVQQAAAATSSKRRMVISHDKYITLKSLIVYHLSEVERETLQGLDRDDLID # WYLETKEEEMQDIEDIEYEKELITKMLRKLVKVSDMDILSLDQTSLRYLSGKLPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g814 ### # start gene g815 4 AUGUSTUS gene 3539249 3539653 0.37 + . g815 4 AUGUSTUS transcript 3539249 3539653 0.37 + . g815.t1 4 AUGUSTUS start_codon 3539249 3539251 . + 0 transcript_id "g815.t1"; gene_id "g815"; 4 AUGUSTUS CDS 3539249 3539653 0.37 + 0 transcript_id "g815.t1"; gene_id "g815"; 4 AUGUSTUS stop_codon 3539651 3539653 . + 0 transcript_id "g815.t1"; gene_id "g815"; # protein sequence = [MKDLEPLDPSYVQEVLSQPPFTSIPGVINVRDLGGYPSMTHPGKSTKPGFMYRSAEVASITDEGDLILRIFFATLLNC # VGKEQVRRLGIKTVFDLRSDTEIKKYNAPLPTIEDVELLHVPVFQIEDYSPEMMAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g815 ### # start gene g816 4 AUGUSTUS gene 3542604 3545278 0.33 - . g816 4 AUGUSTUS transcript 3542604 3545278 0.33 - . g816.t1 4 AUGUSTUS stop_codon 3542604 3542606 . - 0 transcript_id "g816.t1"; gene_id "g816"; 4 AUGUSTUS CDS 3542604 3543652 0.97 - 2 transcript_id "g816.t1"; gene_id "g816"; 4 AUGUSTUS CDS 3543828 3544129 0.86 - 1 transcript_id "g816.t1"; gene_id "g816"; 4 AUGUSTUS CDS 3544182 3544522 0.92 - 0 transcript_id "g816.t1"; gene_id "g816"; 4 AUGUSTUS CDS 3544584 3544905 0.64 - 1 transcript_id "g816.t1"; gene_id "g816"; 4 AUGUSTUS CDS 3545085 3545278 0.44 - 0 transcript_id "g816.t1"; gene_id "g816"; 4 AUGUSTUS start_codon 3545276 3545278 . - 0 transcript_id "g816.t1"; gene_id "g816"; # protein sequence = [MNLEPNKEEASAATLKEIKRQYFGRTNSEQASRDCYSQSTITYVTPCHPCSPCALDKLYVAPFYGQIRECHQQGDDRR # ISLIIDQLVDMFSNPNNALHVRNGGLIGLAGTAIALGVDVAPYMDKFVYPVLDCFVDPENRIRYFSAECLYNIAKVSKGEVLIYFNEIFDALSKLAAD # SELSVKNGAELLDRLLKDIVAESASVYIPIHAESEKPYNESQGVLVPHPVDPYSAKKAFSLAHFIPLLRERIYVVSPFTRSYLVSWITVLDSVPELEL # ISYLPEFLEGLLKYLSDPTEDVRVATEVLLADFLREIRDVTVVRRRSEKLAKSTHTVGDTESIVPSEGGQTEHSITDSPERAVFLADHDDAQYPDSEY # KEDRASDFDVRDAGYDEIQQSTALRWLAEFINFASEVMIPFTPRLIPAILPNLAHHASMIQTIAVRTNKLLLSVIQNLPSPPEVPARSQEKPPSTRVQ # ASPTPTAVPAPTSSNSRQPTMAKDPSASLRDAASPETTGDTVSPPPMNANSSSASGVSLVRPRGSGVDLSMTPRAIVAETLPQPSTSRPQSPVSVLSH # SNQNLQASITEEPDVFDYQATVNELTIQFLSEFEETRVAALKWLIMLHQKAPRKILAMDDGTFPALLKTLSDSSEEVIKHDLQLLAQISSSSEENYFK # AFMMNLLELFSTDRRLLETRGSLIIRQLCLNLNTERIYKAFAEILEKEDVSVNLFNEVRLLMFTLSIGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g816 ### # start gene g817 4 AUGUSTUS gene 3550206 3550802 0.69 + . g817 4 AUGUSTUS transcript 3550206 3550802 0.69 + . g817.t1 4 AUGUSTUS start_codon 3550206 3550208 . + 0 transcript_id "g817.t1"; gene_id "g817"; 4 AUGUSTUS CDS 3550206 3550802 0.69 + 0 transcript_id "g817.t1"; gene_id "g817"; 4 AUGUSTUS stop_codon 3550800 3550802 . + 0 transcript_id "g817.t1"; gene_id "g817"; # protein sequence = [MVLTIHKRRGFFTNSVIPAGHNDLGLLFPSLCTGTRGFEPKRPRLQESPKMTAHILNRHRLVLQGDKPATYTYRIVQR # KPMLSRQAPIARGKTNLKTSLSGVYSKLWHYAPQDLPSNPSTTKYDTTRQSSSSNKPLREPHYDRSIQDSRSKSKDDSLKENQLPYLDNHINNLWQVH # RSNELSDSTRKTRYRECCYTDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g817 ### # start gene g818 4 AUGUSTUS gene 3553620 3554186 0.54 + . g818 4 AUGUSTUS transcript 3553620 3554186 0.54 + . g818.t1 4 AUGUSTUS start_codon 3553620 3553622 . + 0 transcript_id "g818.t1"; gene_id "g818"; 4 AUGUSTUS CDS 3553620 3554186 0.54 + 0 transcript_id "g818.t1"; gene_id "g818"; 4 AUGUSTUS stop_codon 3554184 3554186 . + 0 transcript_id "g818.t1"; gene_id "g818"; # protein sequence = [MSSAKESTGPSSSSSDEKHDAKHHHVVPTVVAEKEGAKLMEVKNADLAVALTSTQLDPLSRASIQLYLILVVAFMGSM # SNGFDGQVRTPLIFIKDSKLISGYPLEGHGCCEWHEVCVLVWGRKFCTDPTLLSANIWIISESLEPMRAEESGQVNLYRYYYHDLVADSDDLCKFLAT # ALIFGIVSVIDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g818 ### # start gene g819 4 AUGUSTUS gene 3557401 3558114 0.32 + . g819 4 AUGUSTUS transcript 3557401 3558114 0.32 + . g819.t1 4 AUGUSTUS start_codon 3557401 3557403 . + 0 transcript_id "g819.t1"; gene_id "g819"; 4 AUGUSTUS CDS 3557401 3557486 0.35 + 0 transcript_id "g819.t1"; gene_id "g819"; 4 AUGUSTUS CDS 3557538 3558114 0.42 + 1 transcript_id "g819.t1"; gene_id "g819"; 4 AUGUSTUS stop_codon 3558112 3558114 . + 0 transcript_id "g819.t1"; gene_id "g819"; # protein sequence = [MGSAENRTQFVKAITDFATNYSLDGINFDWEYPNKQGIGCNIVNANDTDNFLAFLQELRTDPVGANLTLSAATAITPF # FDSKGNALTNVSAFADVFDFVTVMNYDVWGSWSTDVGPNAPLNDSCAAKPNQQGSAVSAVAAWYTAGMPVEKIVLGVPSYGHSFSVNQTSAFVSSTEL # AAYPPFNATAFPLGDSWDTGATEPDACGVLESNGGTQDCGGRFM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g819 ### # start gene g820 4 AUGUSTUS gene 3558169 3558483 0.54 + . g820 4 AUGUSTUS transcript 3558169 3558483 0.54 + . g820.t1 4 AUGUSTUS start_codon 3558169 3558171 . + 0 transcript_id "g820.t1"; gene_id "g820"; 4 AUGUSTUS CDS 3558169 3558483 0.54 + 0 transcript_id "g820.t1"; gene_id "g820"; 4 AUGUSTUS stop_codon 3558481 3558483 . + 0 transcript_id "g820.t1"; gene_id "g820"; # protein sequence = [MDILIPKETLLLNFLIDLMNAVKRYVAVDTRGFDSWIADITFQPYLYVEDAELMISFDNAESFTAKGNFIAEYGLAGF # AMWEAGGDFNDILLDAIRAAVGLDDC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g820 ### # start gene g821 4 AUGUSTUS gene 3559591 3560567 0.55 - . g821 4 AUGUSTUS transcript 3559591 3560567 0.55 - . g821.t1 4 AUGUSTUS stop_codon 3559591 3559593 . - 0 transcript_id "g821.t1"; gene_id "g821"; 4 AUGUSTUS CDS 3559591 3560352 0.7 - 0 transcript_id "g821.t1"; gene_id "g821"; 4 AUGUSTUS CDS 3560517 3560567 0.55 - 0 transcript_id "g821.t1"; gene_id "g821"; 4 AUGUSTUS start_codon 3560565 3560567 . - 0 transcript_id "g821.t1"; gene_id "g821"; # protein sequence = [MAEHEYPEYRFVKYAGCDSCLSGKFLGNYRDGSNINSVLITNEECISSWTSQTQSLSASFAPAAQGFRQLVWIEEEAV # DSSLKTVIAEDEFKQFLERLSSPPAMPFEETFLESKQNIFVGTYQDASYEIFYQTPTAALLSVNSRVAIHLDAVLPRYWKSTPVPSFPVEYIPVPPSS # VDPVKSVLANLAYDSTVATLVDGISIPQMRNDIRFLTGEDGQSGIVSRHSFSQGARVAAAWLKQRFEETGATCQLMPFMQGFAPNVIWQVLCPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g821 ### # start gene g822 4 AUGUSTUS gene 3561630 3561971 0.29 + . g822 4 AUGUSTUS transcript 3561630 3561971 0.29 + . g822.t1 4 AUGUSTUS start_codon 3561630 3561632 . + 0 transcript_id "g822.t1"; gene_id "g822"; 4 AUGUSTUS CDS 3561630 3561971 0.29 + 0 transcript_id "g822.t1"; gene_id "g822"; 4 AUGUSTUS stop_codon 3561969 3561971 . + 0 transcript_id "g822.t1"; gene_id "g822"; # protein sequence = [MLNKANHANAELRASLFDLKNRSNRLVQSLGFSDLMEAQVHVDAGNSANRQMKYRDCLKTVGNLEDELKQAKILIVKM # ENRERELEEEYTTLRKAKDERYDSRISPFKSDLNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g822 ### # start gene g823 4 AUGUSTUS gene 3563297 3563968 0.35 + . g823 4 AUGUSTUS transcript 3563297 3563968 0.35 + . g823.t1 4 AUGUSTUS start_codon 3563297 3563299 . + 0 transcript_id "g823.t1"; gene_id "g823"; 4 AUGUSTUS CDS 3563297 3563968 0.35 + 0 transcript_id "g823.t1"; gene_id "g823"; 4 AUGUSTUS stop_codon 3563966 3563968 . + 0 transcript_id "g823.t1"; gene_id "g823"; # protein sequence = [MLASIRRNANAKASSSSSHAKSSPPAQRSPLSPLSPTPVSRVRRAISPILPELENEDRFDEQGPELPPVKYRKLTAGR # RIPSGSDIAAGKDDDRFRRKSAPSALTFEENEHTNSSPSTMRHALVSRDKSQSRSRPIKGKEERDHDNYKENESTATVDNKLLPSHSERRKSAGDRTT # SGLVRAKARTGEVNGVASTSKSTPKGPLDDYLMYKGRGRYGKNEIRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g823 ### # start gene g824 4 AUGUSTUS gene 3564831 3567590 0.34 - . g824 4 AUGUSTUS transcript 3564831 3567590 0.34 - . g824.t1 4 AUGUSTUS stop_codon 3564831 3564833 . - 0 transcript_id "g824.t1"; gene_id "g824"; 4 AUGUSTUS CDS 3564831 3565227 0.56 - 1 transcript_id "g824.t1"; gene_id "g824"; 4 AUGUSTUS CDS 3565303 3565318 0.36 - 2 transcript_id "g824.t1"; gene_id "g824"; 4 AUGUSTUS CDS 3566282 3567590 0.63 - 0 transcript_id "g824.t1"; gene_id "g824"; 4 AUGUSTUS start_codon 3567588 3567590 . - 0 transcript_id "g824.t1"; gene_id "g824"; # protein sequence = [MESFSFPEYPELDGSINTKYQPPLHLPSLTKLTLTLSDPILSKSHKGSTGYTYSTPPNTLLALLAEWDLPSLRILTMN # TPYTLHHSNDGRGQNPQQHHDANDAADERLGYKLGDGFWRFFKSHGSRIVVLEFGRISAGSQISPRQTLSPLSRLASRASHIAREGYAEGSEAPGYGY # EYSYIRDVQEMEDRWIEAQVRDANREQVEAERLAEVEREREEFESWTKPFPPSAGAAAASSPMSSSFSSMSASSQNLASLTPNLRTFICSASLSSSHD # QDLTFNGLDAFDDAADAFDALEWDWTHPDWVAPHPLLPSHSNVRMIGIREIGERVRADWDEREEGVIWDQSELGSENGMGDHNNPFFMLYLQLSSLLL # PSVDDAEHPDEVPGSSIRRERQKVPFPSLKYIRDLDPDSDLLRRGVRHLERTSIPSVMGPMQGALVPPLPSVVMPKLSILAHLDHSSIWAICIGRGCF # QAQPSSRSSPTIESIIGPDEYQNRKKSKLWVIGTLKFSDHKSMEMIVDEMETLQIPDGPGRVDVRYINRAYSWLVNEKKVLVVTEESSRSWGSWSTSE # SSMKW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g824 ### # start gene g825 4 AUGUSTUS gene 3570174 3571761 0.23 - . g825 4 AUGUSTUS transcript 3570174 3571761 0.23 - . g825.t1 4 AUGUSTUS stop_codon 3570174 3570176 . - 0 transcript_id "g825.t1"; gene_id "g825"; 4 AUGUSTUS CDS 3570174 3570689 0.91 - 0 transcript_id "g825.t1"; gene_id "g825"; 4 AUGUSTUS CDS 3570745 3571761 0.23 - 0 transcript_id "g825.t1"; gene_id "g825"; 4 AUGUSTUS start_codon 3571759 3571761 . - 0 transcript_id "g825.t1"; gene_id "g825"; # protein sequence = [MDDDGGLAGRIDHLPPNHEHLREMVKKLDSILSLVFEHYEAYASIVRKSNEEDTPSPSSSLPELLPLPPISTAVNPFF # DASRSSPMMNYSSFNQPPPSNQAQLAQLNQLASSSRPSTPTSITPGSPAWLLPNQPPLPAPTRKMLHTRFHALLSIFDRTILRTFKSRYTQFLIFWYT # SLDPEFADIFQGMLVDRALFQPADNGGNSAQTPIVTRAAAASYIGSFVSRAKFVDREGARRVVGVLCEFLKAHLDSVESILKNSTSLSNNTRSLNTEA # LNVTGDQNTVFYAVAQALFLIFCFRWRDLLEDDEEPDDMVSLRLQGTKTAAAGKKWMKQLDVVQRWFFADDYPKVCSPNVANQFARVAHATDFIYCYT # ILEFNRRSDASSGDGSVLHTLTHGHHLTAELNTFFPFDPYKLPKSGVYIQEVYRDWTSVAIDEESDDDETSDSDEDTDQEPAHFSSDFGMPISISVAG # DEAHENTDETAPGLGASFDAMSISPAKDGMNAAEQVLALA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g825 ### # start gene g826 4 AUGUSTUS gene 3572646 3572987 0.9 - . g826 4 AUGUSTUS transcript 3572646 3572987 0.9 - . g826.t1 4 AUGUSTUS stop_codon 3572646 3572648 . - 0 transcript_id "g826.t1"; gene_id "g826"; 4 AUGUSTUS CDS 3572646 3572987 0.9 - 0 transcript_id "g826.t1"; gene_id "g826"; 4 AUGUSTUS start_codon 3572985 3572987 . - 0 transcript_id "g826.t1"; gene_id "g826"; # protein sequence = [MDPHSRFSHFDNKRNPKAGPQSLSQKPRFMDNPIKPNLEDFASAKQQNRKSSAARESSASILVRRPFVTNSRVKQDEK # SRKDMYLAFVNNALQEKANVSSSNHQSSPWLDASI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g826 ### # start gene g827 4 AUGUSTUS gene 3575691 3576341 0.57 + . g827 4 AUGUSTUS transcript 3575691 3576341 0.57 + . g827.t1 4 AUGUSTUS start_codon 3575691 3575693 . + 0 transcript_id "g827.t1"; gene_id "g827"; 4 AUGUSTUS CDS 3575691 3576341 0.57 + 0 transcript_id "g827.t1"; gene_id "g827"; 4 AUGUSTUS stop_codon 3576339 3576341 . + 0 transcript_id "g827.t1"; gene_id "g827"; # protein sequence = [MSVDFHSSSDNHSPYFSPTVSYQASNSTGHQYLNSNMKPVPRLDIGIVDDMGHRYNSLSASTTSWSPSPSSMSIDTEA # LYLRSQQYGSPQSSTRSESSFINGFPCHCGTGPDDNDGRHLSGSDALYLDAMVHSDPNALTCTTVSPQILGLSFEQELTPLNFFNDPVLIPQGKTQVA # TERVLAASRRRRGQLKPGAKLLHCHMCQATFTAKHNLTSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g827 ### # start gene g828 4 AUGUSTUS gene 3578375 3578809 0.74 + . g828 4 AUGUSTUS transcript 3578375 3578809 0.74 + . g828.t1 4 AUGUSTUS start_codon 3578375 3578377 . + 0 transcript_id "g828.t1"; gene_id "g828"; 4 AUGUSTUS CDS 3578375 3578809 0.74 + 0 transcript_id "g828.t1"; gene_id "g828"; 4 AUGUSTUS stop_codon 3578807 3578809 . + 0 transcript_id "g828.t1"; gene_id "g828"; # protein sequence = [MPATYGLEYHFDWDSDTGNQTSTPPGPALFEDVPVFDFVSHPSTALVPDLTGCVANFDEQEPWPLPNINAVSVPASPS # GFIASQISGPSSSMLEGGHRECHSGVHVNLSKMDCTDLMSSREFEPIVAVCHNPNAWWLQQLIYQH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g828 ### # start gene g829 4 AUGUSTUS gene 3586282 3586584 0.9 + . g829 4 AUGUSTUS transcript 3586282 3586584 0.9 + . g829.t1 4 AUGUSTUS start_codon 3586282 3586284 . + 0 transcript_id "g829.t1"; gene_id "g829"; 4 AUGUSTUS CDS 3586282 3586584 0.9 + 0 transcript_id "g829.t1"; gene_id "g829"; 4 AUGUSTUS stop_codon 3586582 3586584 . + 0 transcript_id "g829.t1"; gene_id "g829"; # protein sequence = [MEPESPRDSSIQDSQDAPPAPPQDLWSSILDSVSSSRSIPSKNILILGQPSSGKSTVCEALLGRTKVNSNNDNEESKS # DFAMGYDWADVRDDADEGAYNY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g829 ### # start gene g830 4 AUGUSTUS gene 3589477 3590343 0.64 - . g830 4 AUGUSTUS transcript 3589477 3590343 0.64 - . g830.t1 4 AUGUSTUS stop_codon 3589477 3589479 . - 0 transcript_id "g830.t1"; gene_id "g830"; 4 AUGUSTUS CDS 3589477 3590343 0.64 - 0 transcript_id "g830.t1"; gene_id "g830"; 4 AUGUSTUS start_codon 3590341 3590343 . - 0 transcript_id "g830.t1"; gene_id "g830"; # protein sequence = [MMETAGASSVLPSFATRSSSPAPIAPTDEVSAYSRSWVPPRSYLQSGSSLSRSSSLRRPTRSRTVDFNDFTSRRRSTI # RNTTSGATSSVNTDATSNTASESRDRDSNSWLSPGATRRFFGLSRPRRSNPELNLWSDLPDGDDGLTIGDNTTVPYLPASSSSHGVILPPLSEAEISG # ERSTTSIPGSNSNPTFPRLRRGSLRRPESLLSRQASPAETVVLPDDYDSSRRAPSPPDISEYIIESFDRPRFGRGTFSSLPILIPEGGSEGGATYGTI # ETAAYPTPGSTVDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g830 ### # start gene g831 4 AUGUSTUS gene 3598832 3600533 0.55 + . g831 4 AUGUSTUS transcript 3598832 3600533 0.55 + . g831.t1 4 AUGUSTUS start_codon 3598832 3598834 . + 0 transcript_id "g831.t1"; gene_id "g831"; 4 AUGUSTUS CDS 3598832 3599785 0.55 + 0 transcript_id "g831.t1"; gene_id "g831"; 4 AUGUSTUS CDS 3599943 3600533 1 + 0 transcript_id "g831.t1"; gene_id "g831"; 4 AUGUSTUS stop_codon 3600531 3600533 . + 0 transcript_id "g831.t1"; gene_id "g831"; # protein sequence = [MYLRRFSDEVSSPVSPVQSQDAPFIHELGPPNAPFMSESGHGHGNGHGQNSSPSNSVYNGSVGAHLASKGSNNDLSRS # RNNSLTFRAPFLSPASRPTSNIASNTWNPPTYPQTRPGSPTASSTALAFTQRHSGKQPFQSALLSEKIPKEDKPWLAKPAPRQRASYWLTLFGVFLGL # AGAALLCFFELRSLNLLDESQLCTVFFDDFTSGSLDTSIWSRTVELGGFGNGEFEIMTNKDENLKIENSQLYLIPTLTSASIGNTSAIFNGYTYDLGD # DCTTSNETACSVTSDSSTKTVIPPVQSARISTNGTYSLKYGRIQIMESRGNSITYPDQGVNYVRSSLNYAPLASLLSQSTMYGWWFTKRLDSSSWNTG # FHTYTLEWTDQWMRMYVDSRLQAMLDISLKSSKESFFNRAGYPSTAINSSSGDTVAVENIYDEAGGGWNAPFDQEFYLIIQLAVGGTSGWFPDGAGGK # MWTDGSTEAMYDFAEAQDEWYASWPTSEDDKALRVDWVKMWNMC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g831 ### # start gene g832 4 AUGUSTUS gene 3603180 3604158 0.34 + . g832 4 AUGUSTUS transcript 3603180 3604158 0.34 + . g832.t1 4 AUGUSTUS start_codon 3603180 3603182 . + 0 transcript_id "g832.t1"; gene_id "g832"; 4 AUGUSTUS CDS 3603180 3603257 0.35 + 0 transcript_id "g832.t1"; gene_id "g832"; 4 AUGUSTUS CDS 3603337 3604158 0.5 + 0 transcript_id "g832.t1"; gene_id "g832"; 4 AUGUSTUS stop_codon 3604156 3604158 . + 0 transcript_id "g832.t1"; gene_id "g832"; # protein sequence = [MKCSSAASALILASLSISAFETYAAPCNEYNSYFRTDARHLSLILLDLAFLTRFLPREEHTNSAHTLAVDTSTPLALE # IHHFPNRERYPRADDADSGDVVDKPPRSSRKSSKKTTEGPPEDPAKFVVTDPQAKKSSRKSSKDANERKSTNTHRHKKTHKSDPPVDAETIQSPIENS # LDIQSQLSSPAPVIRKRPKKSKHSAQNVDESLTTNESFEKSSTKPSSLTLSATSQRTHRKPKPKPIPPKPKKPNSDGYFYAQNTTAAFNSASSSSATN # ANAFAVNDGNFGGGNVAGIGKPPGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g832 ### # start gene g833 4 AUGUSTUS gene 3604825 3605385 0.89 + . g833 4 AUGUSTUS transcript 3604825 3605385 0.89 + . g833.t1 4 AUGUSTUS start_codon 3604825 3604827 . + 0 transcript_id "g833.t1"; gene_id "g833"; 4 AUGUSTUS CDS 3604825 3605385 0.89 + 0 transcript_id "g833.t1"; gene_id "g833"; 4 AUGUSTUS stop_codon 3605383 3605385 . + 0 transcript_id "g833.t1"; gene_id "g833"; # protein sequence = [MKIGEAGEAFFIFETEDDVPEDLITSPLLRPSSPTNENTRGSIDVETTRFGTKKGGDQNSDAGEPEPLDLNALPSPPE # EDVQFSTGVDGDNNANTSSGRIHTPTTHKPSASTSTFTIPSVSVEPHHIRRRASTVSVSIRHASSLPSPPPSPTRTPAEKAQDARADAALKQSVAEIQ # APEIRYQDGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g833 ### # start gene g834 4 AUGUSTUS gene 3605567 3606818 0.36 + . g834 4 AUGUSTUS transcript 3605567 3606818 0.36 + . g834.t1 4 AUGUSTUS start_codon 3605567 3605569 . + 0 transcript_id "g834.t1"; gene_id "g834"; 4 AUGUSTUS CDS 3605567 3605620 0.36 + 0 transcript_id "g834.t1"; gene_id "g834"; 4 AUGUSTUS CDS 3605715 3606818 0.95 + 0 transcript_id "g834.t1"; gene_id "g834"; 4 AUGUSTUS stop_codon 3606816 3606818 . + 0 transcript_id "g834.t1"; gene_id "g834"; # protein sequence = [MSTTRLYMPFLVTRRVNLPHVIDDAPDSESDVHQDDTLPGGEHGYRTAHSNSQSKSLTLPFPSRAITEPPPDLPFPSP # SSSAPNSASPVSLTLKRFPGPGKLNVLSPVQEYSWEWGAFPTPSPMKSTFGKGGRFESGLGTIGPEEEHDSFASSEPHNGNFTSSRGRSGIRDSKGKS # MLSGLSSVNPGDEVDNVHGRSMSVPPGFDESPTRERQRESLFAKYNDADAAAEFTVGQEDKLDAAGGFGSSGKLSVSKSDPTVFKLSIEGKKVEFELS # LVEYLENERNGHDSSDVEGESDDHEEPSRGRQSRNLRPFSDNMRNRNHFRVFSPDGIWPGIDEFETARLFEKGKISFEDFIQNDQLVRDPRLVLKWTR # QQCASNFSNPSTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g834 ### # start gene g835 4 AUGUSTUS gene 3608335 3609054 0.55 + . g835 4 AUGUSTUS transcript 3608335 3609054 0.55 + . g835.t1 4 AUGUSTUS start_codon 3608335 3608337 . + 0 transcript_id "g835.t1"; gene_id "g835"; 4 AUGUSTUS CDS 3608335 3609054 0.55 + 0 transcript_id "g835.t1"; gene_id "g835"; 4 AUGUSTUS stop_codon 3609052 3609054 . + 0 transcript_id "g835.t1"; gene_id "g835"; # protein sequence = [MTCRYIHMTDLVDQMFPPIHRKWAPEFTDFNFWKPPMQEFPLPDFSPPSPALSARSDSSTFARIRNFSLVGTRQNNIP # KVAAAVAAASSRALDDEQPLRNMKLQQMSSFERLSSTLGFSGNGSSSSVLKDRRSDSPDTRSYSSSSYAGSEDEDDDDGWNGGRRERRRSTTSMPGSL # EDMNFGNDDDEEYVHDDPNDDYNEEYDPHGEDEVDEVAADDAFDEDLLAAGEMKNVPFYNTVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g835 ### # start gene g836 4 AUGUSTUS gene 3609300 3610367 0.34 - . g836 4 AUGUSTUS transcript 3609300 3610367 0.34 - . g836.t1 4 AUGUSTUS stop_codon 3609300 3609302 . - 0 transcript_id "g836.t1"; gene_id "g836"; 4 AUGUSTUS CDS 3609300 3610044 0.97 - 1 transcript_id "g836.t1"; gene_id "g836"; 4 AUGUSTUS CDS 3610124 3610264 0.44 - 1 transcript_id "g836.t1"; gene_id "g836"; 4 AUGUSTUS CDS 3610315 3610367 0.37 - 0 transcript_id "g836.t1"; gene_id "g836"; 4 AUGUSTUS start_codon 3610365 3610367 . - 0 transcript_id "g836.t1"; gene_id "g836"; # protein sequence = [MTAGVIQVSLQWAMFSLILVLYMIYYPPHLKYVNLGFEYDESLPLRLSKSTEKTKEWKTSIVVSCFIISITTGFLLAT # FPTSPSSSPSPSPDPIPIPSPDDSTIAHSVTQWATFLGVSSAILAAIQYIPQIAHTFRHKVVGALSIPMMCIQTPGAVLMVLSIALRPGTNWTSWATF # AVAGIMQGTLLVMCICWKIRQKRLGLDDFGHNIVEDTLSESYLSTTSSLANSGHRHPAADVDVPGLVVEDEDAVAVRVALANALESAVEGDVRSGGVR # EVREIPIHAYHEQDDENTPLLNNGKQSSAPAPRRWFGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g836 ### # start gene g837 4 AUGUSTUS gene 3613050 3613541 0.82 - . g837 4 AUGUSTUS transcript 3613050 3613541 0.82 - . g837.t1 4 AUGUSTUS stop_codon 3613050 3613052 . - 0 transcript_id "g837.t1"; gene_id "g837"; 4 AUGUSTUS CDS 3613050 3613541 0.82 - 0 transcript_id "g837.t1"; gene_id "g837"; 4 AUGUSTUS start_codon 3613539 3613541 . - 0 transcript_id "g837.t1"; gene_id "g837"; # protein sequence = [MGTSTTVQTLFDSADRLQHIYRAFELWDRMEQFALGLVNVVPGPNFQQGTRQGLLRAFPMPNLGPHLQPHPQELPTWP # SQHDIQTQVDPNLPPVDSAWTLRPGDSLPSLRTQLKHATFLRAWFEAHLQKPSVIMVSSEPAVQDQFFSQFLEPINAILKVSNIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g837 ### # start gene g838 4 AUGUSTUS gene 3615941 3619707 0.89 - . g838 4 AUGUSTUS transcript 3615941 3619707 0.89 - . g838.t1 4 AUGUSTUS stop_codon 3615941 3615943 . - 0 transcript_id "g838.t1"; gene_id "g838"; 4 AUGUSTUS CDS 3615941 3618987 1 - 2 transcript_id "g838.t1"; gene_id "g838"; 4 AUGUSTUS CDS 3619074 3619707 0.89 - 0 transcript_id "g838.t1"; gene_id "g838"; 4 AUGUSTUS start_codon 3619705 3619707 . - 0 transcript_id "g838.t1"; gene_id "g838"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGSGGPGGPRSPISPDIPNEQQVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLG # RIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIA # EGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLNVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYL # GYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLI # VETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLH # QFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPANPSSVVGLELA # KDPSNERWSLGSDKLLCLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPV # PVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGY # HPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEIVLA # QSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHLVFHVSQLEPVTPNPFPNRTQSPPPPI # EVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g838 ### # start gene g839 4 AUGUSTUS gene 3620479 3620994 0.99 + . g839 4 AUGUSTUS transcript 3620479 3620994 0.99 + . g839.t1 4 AUGUSTUS start_codon 3620479 3620481 . + 0 transcript_id "g839.t1"; gene_id "g839"; 4 AUGUSTUS CDS 3620479 3620994 0.99 + 0 transcript_id "g839.t1"; gene_id "g839"; 4 AUGUSTUS stop_codon 3620992 3620994 . + 0 transcript_id "g839.t1"; gene_id "g839"; # protein sequence = [MLALSSPLPHSDGAGRWDDIVPALPSIDQLTADWEQLMLEYIHHITDTPLPGPNPPAPVSAVDRVTEPSQEVVVEQSP # EVPVAPVSSSSIGSQPQVPLFLPEQESPTSPSPPPPSPTLPPLFGSVINLAIDLTGDNDELYKTEESRVARVSMTGEVVDLAPGQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g839 ### # start gene g840 4 AUGUSTUS gene 3621653 3623497 0.48 - . g840 4 AUGUSTUS transcript 3621653 3623497 0.48 - . g840.t1 4 AUGUSTUS stop_codon 3621653 3621655 . - 0 transcript_id "g840.t1"; gene_id "g840"; 4 AUGUSTUS CDS 3621653 3623497 0.48 - 0 transcript_id "g840.t1"; gene_id "g840"; 4 AUGUSTUS start_codon 3623495 3623497 . - 0 transcript_id "g840.t1"; gene_id "g840"; # protein sequence = [MDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLQKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLLV # VLECDVSDLAIAGILSQLDPEMGEIHPIAFHARSMISAELNYDIYNKELLAIVDCFKQWRAYCKGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAEL # LSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALRRIARNEEESLVWEDGL # IKRGGRIYVPDVGTLRREVLQPYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKNVNYYVRSCHSCLRAKASCSKPYGNLRPLPIGQRPWSSISLDHITQ # LPATAGPEKYDAILVVVCRLTKQAIYVPCHTTDNAEDFANLFITYVFSKHGMPSDITSDRGSLFVSQFWREICRALGIESRLSTAYHPQTDGQTERVN # QSMEAYLRIYCSYDQDDWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKVYAKYADQKRQ # EAPDWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTILSKVGSHAY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g840 ### # start gene g841 4 AUGUSTUS gene 3624554 3625507 0.99 - . g841 4 AUGUSTUS transcript 3624554 3625507 0.99 - . g841.t1 4 AUGUSTUS stop_codon 3624554 3624556 . - 0 transcript_id "g841.t1"; gene_id "g841"; 4 AUGUSTUS CDS 3624554 3625507 0.99 - 0 transcript_id "g841.t1"; gene_id "g841"; 4 AUGUSTUS start_codon 3625505 3625507 . - 0 transcript_id "g841.t1"; gene_id "g841"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGTEGGTEELGRGVNGEEIHEGTLQPPPEAPQQPPEAPRPPPEVPQQSLEAPLRAPRMGVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFTSESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSRDMEQSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g841 ### # start gene g842 4 AUGUSTUS gene 3625720 3626643 0.44 - . g842 4 AUGUSTUS transcript 3625720 3626643 0.44 - . g842.t1 4 AUGUSTUS stop_codon 3625720 3625722 . - 0 transcript_id "g842.t1"; gene_id "g842"; 4 AUGUSTUS CDS 3625720 3626643 0.44 - 0 transcript_id "g842.t1"; gene_id "g842"; 4 AUGUSTUS start_codon 3626641 3626643 . - 0 transcript_id "g842.t1"; gene_id "g842"; # protein sequence = [MLEESFANFFIHFNEYTPLTGFNNEALITYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLH # GKKPLQGWLSRFPGLELAPEAPYKSPLRREREPADVWTSNPKPAATGRFQNRSNWKEGRQRASAAWGEGESYDSENREEDEDCCHCRDGGEWTEAVLR # AGVTDTGRKWTPEERAEKWRRRRQELCMRCGRKEHWAKDCPNPESLERPAEDQESSERASKADSTRGRGTANQGGGHKDDSTRPLERIRAGIVVEEWE # GMDDLWNVHILDSPKGGEQELLDEVGNGQGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g842 ### # start gene g843 4 AUGUSTUS gene 3631171 3631602 0.99 - . g843 4 AUGUSTUS transcript 3631171 3631602 0.99 - . g843.t1 4 AUGUSTUS stop_codon 3631171 3631173 . - 0 transcript_id "g843.t1"; gene_id "g843"; 4 AUGUSTUS CDS 3631171 3631602 0.99 - 0 transcript_id "g843.t1"; gene_id "g843"; 4 AUGUSTUS start_codon 3631600 3631602 . - 0 transcript_id "g843.t1"; gene_id "g843"; # protein sequence = [MSATSTERPSSSKTESKKQKSTLSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQLFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRYTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPVPQLDMESASNAGGRVSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g843 ### # start gene g844 4 AUGUSTUS gene 3640270 3640749 0.55 + . g844 4 AUGUSTUS transcript 3640270 3640749 0.55 + . g844.t1 4 AUGUSTUS start_codon 3640270 3640272 . + 0 transcript_id "g844.t1"; gene_id "g844"; 4 AUGUSTUS CDS 3640270 3640749 0.55 + 0 transcript_id "g844.t1"; gene_id "g844"; 4 AUGUSTUS stop_codon 3640747 3640749 . + 0 transcript_id "g844.t1"; gene_id "g844"; # protein sequence = [MLKSFFATQNLATSKLVLWSNGDMRGNPILREYLRRYGAVEGDQGDIVGSERGSFDVRVADIALLARGTELDPEYHAH # ENEAEFERNIFPSAHRLLLSDSKAWLDGDLIRLLLLWNFGGVWVDMDFLLTRDLEPLLEHEFVTQWDCYGELQSSFKLLHC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g844 ### # start gene g845 4 AUGUSTUS gene 3641162 3641692 0.51 + . g845 4 AUGUSTUS transcript 3641162 3641692 0.51 + . g845.t1 4 AUGUSTUS start_codon 3641162 3641164 . + 0 transcript_id "g845.t1"; gene_id "g845"; 4 AUGUSTUS CDS 3641162 3641692 0.51 + 0 transcript_id "g845.t1"; gene_id "g845"; 4 AUGUSTUS stop_codon 3641690 3641692 . + 0 transcript_id "g845.t1"; gene_id "g845"; # protein sequence = [MPWSKIKPGTNGVFVVGNPTTKKPQLSGIDKGVAPSMGLGMGTETAYTGNPPALARALSQIFGIHLHNQWEKNFPEKG # WVERLLLQRYEAVLEAERIPALGTVTGHGGGNLEYRLQGLQGRDVDDLAREPVELDIGSKSRGQEQEQEQERDAGMTKRDIDEQGDGDMTAMVRTADT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g845 ### # start gene g846 4 AUGUSTUS gene 3645013 3647363 0.97 + . g846 4 AUGUSTUS transcript 3645013 3647363 0.97 + . g846.t1 4 AUGUSTUS start_codon 3645013 3645015 . + 0 transcript_id "g846.t1"; gene_id "g846"; 4 AUGUSTUS CDS 3645013 3646208 1 + 0 transcript_id "g846.t1"; gene_id "g846"; 4 AUGUSTUS CDS 3646256 3647363 0.97 + 1 transcript_id "g846.t1"; gene_id "g846"; 4 AUGUSTUS stop_codon 3647361 3647363 . + 0 transcript_id "g846.t1"; gene_id "g846"; # protein sequence = [MSSPILALNILFRSPIPIPSGLFDSPDDLPTNLLRGATPNSDTVKWSYEYKRSASVTVVEGRRSGDVWLTNGDAADGK # SKVSRALGMMSPMPKLSVLPPEENADEPTTPPLPIQDGDSSMPVNLHSRSYSETSAQFGRIRKDSKASSYFSGADESLAFASKIMIAQKHYSALAQTI # QVSGSPEKGPSAGAELFLNGPIATTSAVDIPVSGSNRASQHLRTRSVTSVGPETPTSISFNASPSPPPAFPLPPTPPNVRAARLAKHKKSYSSISAGK # FSFGPVDDMNEIDALTAGVLPLLVPGLKVGDNMKIRDSPPATWRKRAMAELEISRERSRSRSTSRTRGEGRSARLLKALNEFGEDFSSPEIHSTPART # RAGATKAREARGRKISAHKRNHFSLPSLGLGKDGVQSLSYWSTELGRAIENRFGPYTAVPSNVEFRRNTVFGADSIPNDLSNLRAGPEEIVSQTNSRG # APLGRAMSTRSLGLRAEVPHGIDTARSSIQSMHNIVPPSAASTVTLFEDFVNGLESGPQAESTPHNNIAHKRGSEDIVPPLPSSSQFRTSTASHQYRN # PTNKNRSSSASSRRSSIVYIKSDENTTITPPNATSTSSTSAMSSLAQWSSRAVRPLMPKSSKLQRKASKASPPTQNTSKPESPRGGLRPLSLLQERDT # NSAVGTGVQAANSQGTRPLVLAKKEGAAISKKAKAMPADENASPDAPRSRRNKHNLKPLNLARSDTNKMRAILRQDELLPDVVVRPPSTTEHQVYAYS # FRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g846 ### # start gene g847 4 AUGUSTUS gene 3652935 3655319 0.85 + . g847 4 AUGUSTUS transcript 3652935 3655319 0.85 + . g847.t1 4 AUGUSTUS start_codon 3652935 3652937 . + 0 transcript_id "g847.t1"; gene_id "g847"; 4 AUGUSTUS CDS 3652935 3655319 0.85 + 0 transcript_id "g847.t1"; gene_id "g847"; 4 AUGUSTUS stop_codon 3655317 3655319 . + 0 transcript_id "g847.t1"; gene_id "g847"; # protein sequence = [MSAQVASSTSATARNMADNDSTSRTGGSQGKRRRFIRRRGRKPSLDSDDEVEREVRTDSESEDDLSSSDSTSDSDTEP # ASEDVQPNEQPRVLTPSTSQSPEGASHLLVNGHSQPFFGSSGNWSEMVANEAEHGPENLPVIDFTELDSQVLPLPNQSRKSKKNQKHINNRSSVPSLL # TSPAQPQTADELEESQESRAPSSHFTPRRPPGQSARQAYQQRLEADPSYVPTVGEFWGHDDRLLDKNLRSLSGWWRGRWQGGMRGRVGFSRGSFRGRG # GFLGSPFAGNSTAEQDTEEDGAQPVDQAWTHDGFEELKRNEQEHSSSSHQQAQTQTPPSRGFDTALGRGGSFIGRGGRGGRGAFSPPFRSRQTHAPDP # ARVWFLKKPEHMWTKQAEAFLFSDFSWKPRAGHPASIRVKLPSQKTASVRVPIQSVPRASTSKHPNTSPESDSGDKVLVVRLPKSVPTGQPVVAETIS # HPPRIDEPSIEEVFTVRPQLVSPKLIPLPEQQPAIKEASVTLPNGAHTVSSSISSVDPAIQQKLEQLSLEPQKTDPTRWVQTEEAVMRNPTGTVPEEQ # QEQPPLSSMQHTFSPSDQVSPGYGSPYQYAPHLPPGLAINSAGMAYEVATGRPVYLQAPANMYAAPMMQPVPFVPSHVHHHSAVSSSEFIPAGTPPIN # GGYMEYTPTPSIFSFPRQSSRVQIRAPDEPKQNARSTSTSEAVDLAAGQQSSTELRSDAVAFEPAEQYYSEGDGLTAVSHQHQVQDPMMGYYNPYYYP # DPSYGYNPYLDMSQVAPYEMFPPQGTVYYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g847 ### # start gene g848 4 AUGUSTUS gene 3655810 3656070 0.43 - . g848 4 AUGUSTUS transcript 3655810 3656070 0.43 - . g848.t1 4 AUGUSTUS stop_codon 3655810 3655812 . - 0 transcript_id "g848.t1"; gene_id "g848"; 4 AUGUSTUS CDS 3655810 3656070 0.43 - 0 transcript_id "g848.t1"; gene_id "g848"; 4 AUGUSTUS start_codon 3656068 3656070 . - 0 transcript_id "g848.t1"; gene_id "g848"; # protein sequence = [MNPSPQTSDSEREGDEDEEDYSYSVSINASTFAEGDDLFTKINKMSTDLDGLIRFIRRGVETLAGGTGDASTTFGILA # FSLEDWDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g848 ### # start gene g849 4 AUGUSTUS gene 3657050 3658234 0.94 - . g849 4 AUGUSTUS transcript 3657050 3658234 0.94 - . g849.t1 4 AUGUSTUS stop_codon 3657050 3657052 . - 0 transcript_id "g849.t1"; gene_id "g849"; 4 AUGUSTUS CDS 3657050 3658234 0.94 - 0 transcript_id "g849.t1"; gene_id "g849"; 4 AUGUSTUS start_codon 3658232 3658234 . - 0 transcript_id "g849.t1"; gene_id "g849"; # protein sequence = [MRHSSDARSNGRQTLSALDRIRATRVGKITRTLEAFADAIDTEIRMLEVWCSDKEEAWLRALGGLTPFLEFGKPNKGL # VVSLLGTEKAFRDQFEDSFNVMLDVVIQIVGEPESEGWALPTRSPSLTTTLLLDTLFSTVQQRLERGDKITADTLMRVCVRSAEPVWNMIGKWIGTGF # DMNRGHDQGQYQVGGELEEEFFIESNGLGIELGVLGLLDPDFWQDGYCLRDGAFLGSTSTSQENEEPTSTQTQRCIPSFLQHVAVPVLESGKVIGLLK # ALGADVQDLIDEEAQFLRDWQWTSFQNVVAGDPTSSSQNDTDGRALFSVSVDQLSRLIYDKLTPYAQAAGSLLAKVIFEKCDFWSHLRSIESLYMMRR # GDIISDFTDILFAKVEGQFRLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g849 ### # start gene g850 4 AUGUSTUS gene 3658619 3659603 0.46 - . g850 4 AUGUSTUS transcript 3658619 3659603 0.46 - . g850.t1 4 AUGUSTUS stop_codon 3658619 3658621 . - 0 transcript_id "g850.t1"; gene_id "g850"; 4 AUGUSTUS CDS 3658619 3659012 0.97 - 1 transcript_id "g850.t1"; gene_id "g850"; 4 AUGUSTUS CDS 3659509 3659603 0.46 - 0 transcript_id "g850.t1"; gene_id "g850"; 4 AUGUSTUS start_codon 3659601 3659603 . - 0 transcript_id "g850.t1"; gene_id "g850"; # protein sequence = [MVDWSIKQLGMEGSTKAALVLDMESINKMVRGPSAYTFEDDGDKSPDDLDISPSLSPLNSDDLSLDDTDSEYEAFPLP # DKSPNTVGLVTPVTNASYRPLYATHAYRRELEDLKFRQYWQPDWRMNSEADLQRRGTFDIGDASTLGLDLTETFITTWTDELTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g850 ### # start gene g851 4 AUGUSTUS gene 3663080 3663406 0.62 - . g851 4 AUGUSTUS transcript 3663080 3663406 0.62 - . g851.t1 4 AUGUSTUS stop_codon 3663080 3663082 . - 0 transcript_id "g851.t1"; gene_id "g851"; 4 AUGUSTUS CDS 3663080 3663406 0.62 - 0 transcript_id "g851.t1"; gene_id "g851"; 4 AUGUSTUS start_codon 3663404 3663406 . - 0 transcript_id "g851.t1"; gene_id "g851"; # protein sequence = [MSTSLSGKGLLLKADLIAAAFRDEVERSLAECSRSPKLVGILSTSSGPSRTYAEFTRKQCESLGFEFVLKETGAALMN # GGLGEGEGVEEAIMEANEDDSVDGVMVSPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g851 ### # start gene g852 4 AUGUSTUS gene 3664174 3664743 0.67 + . g852 4 AUGUSTUS transcript 3664174 3664743 0.67 + . g852.t1 4 AUGUSTUS start_codon 3664174 3664176 . + 0 transcript_id "g852.t1"; gene_id "g852"; 4 AUGUSTUS CDS 3664174 3664743 0.67 + 0 transcript_id "g852.t1"; gene_id "g852"; 4 AUGUSTUS stop_codon 3664741 3664743 . + 0 transcript_id "g852.t1"; gene_id "g852"; # protein sequence = [MDFQQGEHVLVKGEFALTVRHDNTGKLQPGTVGASALQRAWIGLSVQGDSVTVEPLPAPPNPSAPAFLQSIDVEVGFL # RRGHEIAEQFSADDMVKHFLKLFNGNLRSVGETIVFEYHGQNLKGFVRAVSVLELAEEQRRGGGGGGGRAPQHMGILMDKTDVTFMKAPDSAIKIKSS # AKKYVTSSHLFES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g852 ### # start gene g853 4 AUGUSTUS gene 3666025 3666618 0.94 + . g853 4 AUGUSTUS transcript 3666025 3666618 0.94 + . g853.t1 4 AUGUSTUS start_codon 3666025 3666027 . + 0 transcript_id "g853.t1"; gene_id "g853"; 4 AUGUSTUS CDS 3666025 3666618 0.94 + 0 transcript_id "g853.t1"; gene_id "g853"; 4 AUGUSTUS stop_codon 3666616 3666618 . + 0 transcript_id "g853.t1"; gene_id "g853"; # protein sequence = [MVGFSESQKVTAINKIFADSYKSPLSVIVVDNLERLLGSLLFEFLIHRKLTPSYLPEWTPIGPRFSNAVLQTLLVLFA # RRPPKGRRLLVIATSSLRPVLTEIGLSEVFDSELRVPPISNLVALEYVIQEVELFSSSQERREAIRMLEDAGFASTEGDETSGRLHIGIKKLLSMIEM # ARQEPDNVAQRLTGALMGLGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g853 ### # start gene g854 4 AUGUSTUS gene 3673208 3673780 0.99 + . g854 4 AUGUSTUS transcript 3673208 3673780 0.99 + . g854.t1 4 AUGUSTUS start_codon 3673208 3673210 . + 0 transcript_id "g854.t1"; gene_id "g854"; 4 AUGUSTUS CDS 3673208 3673780 0.99 + 0 transcript_id "g854.t1"; gene_id "g854"; 4 AUGUSTUS stop_codon 3673778 3673780 . + 0 transcript_id "g854.t1"; gene_id "g854"; # protein sequence = [MGIFPIIMNILQFWLIDSIVKASSSPVALGADLDAPDPGNPDREPLFGVPSDDEDDDNLRPRHGAEHQRPRSRSRSSP # NSRSHSRDKSITFSDNPYESKSSGSGSRTEVADTHSYPPSLSSSLTSTSSTSSMREASKLNKKRRPPPAPLNLSPAPQPLSIPSKPATRPTNDRPIVV # DPSRDEWADTWHDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g854 ### # start gene g855 4 AUGUSTUS gene 3674171 3675003 0.28 - . g855 4 AUGUSTUS transcript 3674171 3675003 0.28 - . g855.t1 4 AUGUSTUS stop_codon 3674171 3674173 . - 0 transcript_id "g855.t1"; gene_id "g855"; 4 AUGUSTUS CDS 3674171 3674627 1 - 1 transcript_id "g855.t1"; gene_id "g855"; 4 AUGUSTUS CDS 3674687 3675003 0.28 - 0 transcript_id "g855.t1"; gene_id "g855"; 4 AUGUSTUS start_codon 3675001 3675003 . - 0 transcript_id "g855.t1"; gene_id "g855"; # protein sequence = [MVSLKTSTRSCIVHIGGWTFGTIGSEATFATNMSVRESSFISCFGHYRFPAGAKCIVISVNYRLAPEYKYPIAVEDAV # ESLQWVLRNGKTELNIDTAKIAVGGSSSGGNLAAILALKAAEPSFTPPLPSPLVFQLLVVPVTDNTATDGPGGLWEENKHTPWLSPARMNWFKDNYLP # NKEDWTKWTASPIFAPAELLAKTPNAWIGLGELDILKGEGVKYGEKLKEVGVKEVEIVIYKGGPHPIMAMDGALFLLRVDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g855 ### # start gene g856 4 AUGUSTUS gene 3676548 3678129 0.78 + . g856 4 AUGUSTUS transcript 3676548 3678129 0.78 + . g856.t1 4 AUGUSTUS start_codon 3676548 3676550 . + 0 transcript_id "g856.t1"; gene_id "g856"; 4 AUGUSTUS CDS 3676548 3676602 0.78 + 0 transcript_id "g856.t1"; gene_id "g856"; 4 AUGUSTUS CDS 3676664 3678129 0.98 + 2 transcript_id "g856.t1"; gene_id "g856"; 4 AUGUSTUS stop_codon 3678127 3678129 . + 0 transcript_id "g856.t1"; gene_id "g856"; # protein sequence = [MDYDRWDALLHHIFKQTQGDAWFRPAEENLSSGVAIRVADDPVPEYRVFPYENVSLEPFEAAVKKLGPVVAVKVRSAA # VHAAIAEAPPDDNSLYVDVNTRIQIIDTMLQLPFADKEQCAAFIRDERVLVVWSNSLDTIIPVCQDFDASLIKLLWRSRPTGTATSSSLHSQSFLGAG # SVSGHDSASVSVHSQGLITAAESGRPVETKTIRTWYGRKRTVPVAPSITGPEPPRKLALYAPLYNGLAAGLALVFIGNGVRVLIREFLLTAPVPDTPN # PEPTSMQRYLRFVLAVTLPFLYCVSLFFTLQILQNVTMAIGPIAHYHQNSRYYSAVPPKAPQSSTEEDKPEVLPHITIQMPVYRESLETVLAPSIASL # KRAMQTYARQGGTSSIFVCDDGMRTSGMSKADRDERIRYYRSEGIGWVARPRDGCPAGGLDSIEEALDATADPEKGFGAKKKKSKSDSSHRGIPVFVR # AGRFKKASNMNYGLSLSLCMERHLMGLVEAKKANAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g856 ### # start gene g857 4 AUGUSTUS gene 3678427 3678927 0.7 + . g857 4 AUGUSTUS transcript 3678427 3678927 0.7 + . g857.t1 4 AUGUSTUS start_codon 3678427 3678429 . + 0 transcript_id "g857.t1"; gene_id "g857"; 4 AUGUSTUS CDS 3678427 3678927 0.7 + 0 transcript_id "g857.t1"; gene_id "g857"; 4 AUGUSTUS stop_codon 3678925 3678927 . + 0 transcript_id "g857.t1"; gene_id "g857"; # protein sequence = [MQYLNRDGDDMRVGGLAGNGNDPPPAMGSGNGIIVPTPTSGAFPSQTSPLMRNDPLGPGFANAVPGTPGPAAAEAYYE # LGMDPLGDLYGDEMIEDLEEEALDLAIEEVLLKSWSPSDVLQTFRLLLDVGRIAFSNQLRWLETMGSKREGNTGRRNYSSSRFRYRRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g857 ### # start gene g858 4 AUGUSTUS gene 3682183 3682951 0.29 + . g858 4 AUGUSTUS transcript 3682183 3682951 0.29 + . g858.t1 4 AUGUSTUS start_codon 3682183 3682185 . + 0 transcript_id "g858.t1"; gene_id "g858"; 4 AUGUSTUS CDS 3682183 3682486 0.29 + 0 transcript_id "g858.t1"; gene_id "g858"; 4 AUGUSTUS CDS 3682581 3682951 1 + 2 transcript_id "g858.t1"; gene_id "g858"; 4 AUGUSTUS stop_codon 3682949 3682951 . + 0 transcript_id "g858.t1"; gene_id "g858"; # protein sequence = [MLLCSMMMERRSPGQKDTSTYDRLWSTYHHLNGVVSYRYFGRAKDLPGVRELFQSRKVDEDEDNQTLAYYKKFMNQGP # AYYGDLDEEDESLLESERLAEEEGLLEEDAIPQMVRPKPPSASSDPSTVQSKPKAGTADSVGDNSEPSPSDRQPKTPASNATIPADQSQQASLHAQTA # ASFIPFLSAENLLPPKMPTRVEMEQVLLDLKKKALVEEYFGDEKMTET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g858 ### # start gene g859 4 AUGUSTUS gene 3689023 3689475 0.81 - . g859 4 AUGUSTUS transcript 3689023 3689475 0.81 - . g859.t1 4 AUGUSTUS stop_codon 3689023 3689025 . - 0 transcript_id "g859.t1"; gene_id "g859"; 4 AUGUSTUS CDS 3689023 3689475 0.81 - 0 transcript_id "g859.t1"; gene_id "g859"; 4 AUGUSTUS start_codon 3689473 3689475 . - 0 transcript_id "g859.t1"; gene_id "g859"; # protein sequence = [MSYVGTGFLTRNRNEQDVEDEIDIDGDDAEIFGSAQFHEGDILDVDVPPTTAARTQPTSGRFQTGGVDDTFSEGDQPA # KILRDLIADSKARQSSNPQEVAVIPEIDKADVAILMAKSRGTQAALVVALENKIKLLVGFLSAVLLWNRYSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g859 ### # start gene g860 4 AUGUSTUS gene 3691420 3692355 0.14 - . g860 4 AUGUSTUS transcript 3691420 3692355 0.14 - . g860.t1 4 AUGUSTUS stop_codon 3691420 3691422 . - 0 transcript_id "g860.t1"; gene_id "g860"; 4 AUGUSTUS CDS 3691420 3692165 0.3 - 2 transcript_id "g860.t1"; gene_id "g860"; 4 AUGUSTUS CDS 3692328 3692355 0.21 - 0 transcript_id "g860.t1"; gene_id "g860"; 4 AUGUSTUS start_codon 3692353 3692355 . - 0 transcript_id "g860.t1"; gene_id "g860"; # protein sequence = [MVNTSSSLVYTGFKSLEGAGLNTTYLWKWDILRITFDTMLYTSPPSSSASHIPFMNEILSKPPQSFVEDMYTRSLNLF # QQSENNTTAALPAHVLSTLVYSSLKVDAPDIGRRMIEDWLASRGDTTDLSSSWTSTSTSLTENSMSDGYDADGSINGDSPVDVGLGKGSDSYAKILEL # YCLQVLPKLGQWEYAMEFLEYESELELEPRDVTSYLYCFVARTLTCNTPRILHDPCNLCMLKPLLHVCLLHRVRNTHRRPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g860 ### # start gene g861 4 AUGUSTUS gene 3697912 3698991 1 - . g861 4 AUGUSTUS transcript 3697912 3698991 1 - . g861.t1 4 AUGUSTUS stop_codon 3697912 3697914 . - 0 transcript_id "g861.t1"; gene_id "g861"; 4 AUGUSTUS CDS 3697912 3698991 1 - 0 transcript_id "g861.t1"; gene_id "g861"; 4 AUGUSTUS start_codon 3698989 3698991 . - 0 transcript_id "g861.t1"; gene_id "g861"; # protein sequence = [MSRLVFKRYSSTITVKSTPSKAHHHQPIPVSSFPSGYLLTGVHAGVKKKAGALDVGVILSTSERPTSAAACFTRNAFK # AAPVIISEKILGENVGRARAVVVNSGCANAVTGAQGIEDAWAMAKETDALLPSNSSASPSTTSQTLVMSTGVIGQNLPISKILSAIRSQRDGSQQTLG # NDFNAWERAAKAFMTTDTFPKLRARKFNINGVEYRMAGMDKGAGMIHPDMGPPALGPLHATLLGCIMTDAAISPRSLQRALTYAVERSFNSISVDGDM # STNDTILLLANGAAAEKDGVKLKEIDEGTDREAFEVFKRELTDFTIDLAKLVVRDGEGATKFVTVTVKVCNLPSLLTIRRLTGCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g861 ### # start gene g862 4 AUGUSTUS gene 3702312 3702854 0.68 - . g862 4 AUGUSTUS transcript 3702312 3702854 0.68 - . g862.t1 4 AUGUSTUS stop_codon 3702312 3702314 . - 0 transcript_id "g862.t1"; gene_id "g862"; 4 AUGUSTUS CDS 3702312 3702854 0.68 - 0 transcript_id "g862.t1"; gene_id "g862"; 4 AUGUSTUS start_codon 3702852 3702854 . - 0 transcript_id "g862.t1"; gene_id "g862"; # protein sequence = [MDTVEDDDGDEDWEPIASAQPSGAQPAMGSTVGEWFVDRSRFIPLRLTLGERKFLRLLEAALSVSEYTDKIDTLSFGQ # SKAKRIVAQIKELCAIMSGLLLSADYKAGQELFQDRDFQANEDFYQTVFELGRRHKIMNPDKMRTTYGKLIYILQVWHLKSPLSFLALICSRTAKHPR # SRIY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g862 ### # start gene g863 4 AUGUSTUS gene 3706523 3707158 0.3 + . g863 4 AUGUSTUS transcript 3706523 3707158 0.3 + . g863.t1 4 AUGUSTUS start_codon 3706523 3706525 . + 0 transcript_id "g863.t1"; gene_id "g863"; 4 AUGUSTUS CDS 3706523 3706634 0.41 + 0 transcript_id "g863.t1"; gene_id "g863"; 4 AUGUSTUS CDS 3706711 3706743 0.46 + 2 transcript_id "g863.t1"; gene_id "g863"; 4 AUGUSTUS CDS 3706869 3707158 0.72 + 2 transcript_id "g863.t1"; gene_id "g863"; 4 AUGUSTUS stop_codon 3707156 3707158 . + 0 transcript_id "g863.t1"; gene_id "g863"; # protein sequence = [MFARLSNMKTTLYMTKNNIALGSSHAKELTLITPSSDKLIREIPLDLPVADLTDHHPGGFNNQSAQEAGDEANLDVQF # ALGLSYPTPGVFYSTGGEPPFDPDQGTESNTNEPYAKVGLLVGFDGVNAHAVLSGSTTSSLKTTLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g863 ### # start gene g864 4 AUGUSTUS gene 3710576 3712445 0.94 - . g864 4 AUGUSTUS transcript 3710576 3712445 0.94 - . g864.t1 4 AUGUSTUS stop_codon 3710576 3710578 . - 0 transcript_id "g864.t1"; gene_id "g864"; 4 AUGUSTUS CDS 3710576 3711664 0.95 - 0 transcript_id "g864.t1"; gene_id "g864"; 4 AUGUSTUS CDS 3711795 3712445 0.99 - 0 transcript_id "g864.t1"; gene_id "g864"; 4 AUGUSTUS start_codon 3712443 3712445 . - 0 transcript_id "g864.t1"; gene_id "g864"; # protein sequence = [MEVQAAQDKTISLENEVLPKLETELENFKREKDYWDEERDAYQAEKMRWENERAMLQQMQQAKGGADAMLAEVRQNLL # DMQQQLDAKEGELRQLQTQLSQSQSQLSQTQLQLSQLEQSHAEVTEDLDSGRAFVQTLVQTHAIVLFSRDPSLKGLLSAIGTHLEGLSNKLLSTEQTS # AQRDAELRQRESEWEAQKRRLEEDVRMGLDKREELSRELDIDSVTLRSPTSPSRQLFSPATSFTSIAPSPPTLSISTLPGDNIEYASPEALSVLSALK # PLWAVLPSPEARAAKFASSRERAFRTGSGPSSPTMTNRPSSPAGNTPKSISDLDVRSLKSLYDSTKNPSSISSPQSEFTLSSFISRVQSLLTDDRLLI # ERLLRFAQAHDLLKKNADRAQKLASEANSGLETYSRQVRILEGRNADLVRRCGELQGELTELQGLQEVVDRISAAKSDIEIQAAEQAETCRQLTEANN # MLSARALALAEEAAQAPEMVRRQMQKELDDVKAAAARATTLSGVATSFGEHEALQAELVKVKKELKEALEEMEAMQTSSQAQNVMLMDELMVTQSENA # DLKNQLRGLKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g864 ### # start gene g865 4 AUGUSTUS gene 3712979 3713554 0.83 - . g865 4 AUGUSTUS transcript 3712979 3713554 0.83 - . g865.t1 4 AUGUSTUS stop_codon 3712979 3712981 . - 0 transcript_id "g865.t1"; gene_id "g865"; 4 AUGUSTUS CDS 3712979 3713554 0.83 - 0 transcript_id "g865.t1"; gene_id "g865"; 4 AUGUSTUS start_codon 3713552 3713554 . - 0 transcript_id "g865.t1"; gene_id "g865"; # protein sequence = [MNGVRRFLGGGFNDTQSPGPPASLELGSPPSSALPLASASTASAYSNYSDSPSPSIQPKSPTTITAALFLKKKDKSRP # SLGGSQASLDEIRASTSTRARSNTTSSSSSSVNGLARKSLSSTRPIQRNTRDDLLLSLLASEAVVESRDFAILSSEEIDELKKVSFHRIIYSDSFGSS # SVLDAYRRKFVFHHD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g865 ### # start gene g866 4 AUGUSTUS gene 3714079 3715356 0.52 + . g866 4 AUGUSTUS transcript 3714079 3715356 0.52 + . g866.t1 4 AUGUSTUS start_codon 3714079 3714081 . + 0 transcript_id "g866.t1"; gene_id "g866"; 4 AUGUSTUS CDS 3714079 3715356 0.52 + 0 transcript_id "g866.t1"; gene_id "g866"; 4 AUGUSTUS stop_codon 3715354 3715356 . + 0 transcript_id "g866.t1"; gene_id "g866"; # protein sequence = [MDMAMQLSKARRDTITTSPTTTHQEIQAESQDVVAQAGLSPREQRDIDIAQGPSMEEIDDLESIITKRQPSPVDLRDL # LPQSHDPSLLVSLNGAVHPSADRDDPSTSAYGVLPTYQANMSQSAFNFAPMEVFAASERLKLGITSPSNNTTKFNLPPPRNRQNTDDVFFPRQAPPLP # SFADVAGPASTDVPITSGETIDSALSDSAAASSSTPIRQRKLSQSNPHPRSHRKGIGGKLALFENTHGGSSGPNRIPFSLGPGGNASAIGVPIANDLP # SFDNGSPSLFRPATIPATQYPSVPGLNAGHDRPYRFSFYSNALPSTIHARSLSEIPAEGQTFEDLFAGINRDRNDPNAKDKDKRPTSAGPKGYFPGNV # KPTYRSRPGFGGGLGFSSYEGADPESCTWWLDVLSPTDEEMTMLSKVSSVCDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g866 ### # start gene g867 4 AUGUSTUS gene 3717860 3719364 0.83 + . g867 4 AUGUSTUS transcript 3717860 3719364 0.83 + . g867.t1 4 AUGUSTUS start_codon 3717860 3717862 . + 0 transcript_id "g867.t1"; gene_id "g867"; 4 AUGUSTUS CDS 3717860 3719030 0.89 + 0 transcript_id "g867.t1"; gene_id "g867"; 4 AUGUSTUS CDS 3719081 3719364 0.84 + 2 transcript_id "g867.t1"; gene_id "g867"; 4 AUGUSTUS stop_codon 3719362 3719364 . + 0 transcript_id "g867.t1"; gene_id "g867"; # protein sequence = [MAAPSGITYKAKRSNREVLRERLQNNSALRDHFQSSRDVHHYKKLTRPTIRNHDIVKSHYRDFAAYTQECFEEGRSEK # QAQPAEIVIGTPLPPLGPSTSDCMQSSHSCFTEYVKDFVCYLASALLGRDASTFIRLETLRGYMYTFLALWPRYANVHPTLEMRYQVRSYLLSEELQA # SVKLSTKIRTLKHIEPQCLQIIMETLHSSTNIFRSNRTRLQMAFLILFSAASAARPGSVIESACYRGSNEALTWGDIDFYLIPDDEDPAHPSLVVDIQ # LNLVKGYRNVDHRYQKLLFTLELRKEHRMTCIVLPLLGLAFHDSVFAHFHSIESLLCPEKPPTTRVKIFLRNEVLTLPVLRKEEKGGGGKVSRTDAFH # YDGLNRCLKLLSIAAGFPESITPYDFRASQGNKADVDLGETARKTLMLHDPNSKVYFASKFIPSLDLDADQKCQNKYKSKTMTADLSAVSNRRGQDEN # RITLFRVGFDFTFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g867 ### # start gene g868 4 AUGUSTUS gene 3727907 3728791 0.99 - . g868 4 AUGUSTUS transcript 3727907 3728791 0.99 - . g868.t1 4 AUGUSTUS stop_codon 3727907 3727909 . - 0 transcript_id "g868.t1"; gene_id "g868"; 4 AUGUSTUS CDS 3727907 3728791 0.99 - 0 transcript_id "g868.t1"; gene_id "g868"; 4 AUGUSTUS start_codon 3728789 3728791 . - 0 transcript_id "g868.t1"; gene_id "g868"; # protein sequence = [MLAIIEALKDWRHFLEGLPNPFEIVTDHQNLEYWQTAQDLSQRQARWALWLSRFDFTLTHRAGKANAQADALSRVSQL # KVTDADDNQQQIVLRPQHFLRAATAILFQNPLEERIQKASEWESEVLEGLCKLKTHGPHKLVNGLAEWEEKEGIVYYKGRVYVPPNPQLRRDVIAQCH # DALTAGHPGKHRTLELVSQQFWWPTVRSFVDKYVEGCDNCQQRCVRPQPQSSLEPLPVPGGPWQDIGVDLIGELPMTQDGHNAAITFTDHYFKMIHCF # PTTTELTAEGVADFYYKEIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g868 ### # start gene g869 4 AUGUSTUS gene 3749937 3750721 0.77 + . g869 4 AUGUSTUS transcript 3749937 3750721 0.77 + . g869.t1 4 AUGUSTUS start_codon 3749937 3749939 . + 0 transcript_id "g869.t1"; gene_id "g869"; 4 AUGUSTUS CDS 3749937 3750208 0.81 + 0 transcript_id "g869.t1"; gene_id "g869"; 4 AUGUSTUS CDS 3750316 3750721 0.87 + 1 transcript_id "g869.t1"; gene_id "g869"; 4 AUGUSTUS stop_codon 3750719 3750721 . + 0 transcript_id "g869.t1"; gene_id "g869"; # protein sequence = [MVGIFSSDPGSSNGWSICRCPYFRLSSLDSGLPQSENSPDAVLGFYQYWSIPTTLDHLICTPNSSIINTLISEQRPYP # PPPLLQKDIYRAKLKVIASESPTERQSRLQREENARKDRPPGRKGARVYYWDLVEGTRVRTAVGRSNYEDIWERYGSHQRRYDSVADEWEVCTDFDPN # DAPDDYGPDSDDDSDCFITVRAHIDEETHHMMEPCPPKLILLAFNPRIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g869 ### # start gene g870 4 AUGUSTUS gene 3754065 3754802 0.43 - . g870 4 AUGUSTUS transcript 3754065 3754802 0.43 - . g870.t1 4 AUGUSTUS stop_codon 3754065 3754067 . - 0 transcript_id "g870.t1"; gene_id "g870"; 4 AUGUSTUS CDS 3754065 3754802 0.43 - 0 transcript_id "g870.t1"; gene_id "g870"; 4 AUGUSTUS start_codon 3754800 3754802 . - 0 transcript_id "g870.t1"; gene_id "g870"; # protein sequence = [MPKRCMSICIGVLSHPDTETETETREGGQERPHPRREPSNNETRSMLVQVFQSFSTKRPVLTTFLRAGSATAAEVRGA # TPVTFKFSAPAPKYFLKESKRASSIVGDTYGPTKLQTTPFRSHASEGETAWYYSQSPADLDGPLPETPIPRMLGTIYIHRSIKDRGYQIWVWFNRDGT # GLGWQSVDLSNEQVAHPRVADRSLKLTAAGKPSWILNSTLTTYRSRSLKRSVSRSIEEAGAAESASSGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g870 ### # start gene g871 4 AUGUSTUS gene 3756226 3758166 0.53 + . g871 4 AUGUSTUS transcript 3756226 3758166 0.53 + . g871.t1 4 AUGUSTUS start_codon 3756226 3756228 . + 0 transcript_id "g871.t1"; gene_id "g871"; 4 AUGUSTUS CDS 3756226 3757608 0.95 + 0 transcript_id "g871.t1"; gene_id "g871"; 4 AUGUSTUS CDS 3757703 3757846 0.54 + 0 transcript_id "g871.t1"; gene_id "g871"; 4 AUGUSTUS CDS 3757942 3758166 0.56 + 0 transcript_id "g871.t1"; gene_id "g871"; 4 AUGUSTUS stop_codon 3758164 3758166 . + 0 transcript_id "g871.t1"; gene_id "g871"; # protein sequence = [MRVILALLRCIVRVLKRNSEVDSHIPSQIPKDVHTIVDCYDIDPTLHAFVACPTCYALYPLTDEALKNAESVYQANKP # LPVCDERSHPDSAPCGTTLWKTRRIDRRTFVTPIRKQIFQDLKEWIGRIVATPGFEDAIAQHQQSPPPADGDPERDFVDSTTFCQFKGADGESYAIPK # VGPSGSPDLRLMTSLGFDAFNPFHSKTAHAIVQSTALYMVILSLPEHLRYRPENMYLLTVMTGKPSQHHINFTLRKLVKQLLPFWEGVFYVRTARYFL # GRRVFIALIPAVCDTEGAHQLSGFASHSHTYFCRRCLLQIGDIHNLVPQTWIMRDPAQHRQLALKWKEASTEEERQKIYDEFGIRWSELLELPYWDPV # LFTIIDNMHFAQLGLFETHLRDVWQIDHEKSGGDGLYPEVKDQQKLSKASLRNLLNEIRENQTSLQKRLQEQKKKTLWYICFKLGLRTGRSSFGPANV # PQVPPLNYNDIPDAWEGDVLMDNVKYLLSACYLNTLPWNSFGSRASSAPLVMRPAPSFAFNRDSAFKKLKSKTLDFAGKPPSLSKPNLRTLKALCQDL # GIHYNSVDSKRILAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g871 ### # start gene g872 4 AUGUSTUS gene 3766037 3766543 0.8 + . g872 4 AUGUSTUS transcript 3766037 3766543 0.8 + . g872.t1 4 AUGUSTUS start_codon 3766037 3766039 . + 0 transcript_id "g872.t1"; gene_id "g872"; 4 AUGUSTUS CDS 3766037 3766543 0.8 + 0 transcript_id "g872.t1"; gene_id "g872"; 4 AUGUSTUS stop_codon 3766541 3766543 . + 0 transcript_id "g872.t1"; gene_id "g872"; # protein sequence = [MLKSKASLTQLIDAELAAGLAPNRIILGGFSQGAAMSLLTGLSLDKQLAGIVCLSGWVPIKDTLQKVRASFLLQSLLL # LISGVISQMLAPHSKQMPIFWGHGSSDPLVKPIFAEESVEFLKSVGISNAKPGELSGLSYNVYPGVGHSTNMQELEDLKVWIAKVIPEQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g872 ### # start gene g873 4 AUGUSTUS gene 3768236 3768958 0.68 + . g873 4 AUGUSTUS transcript 3768236 3768958 0.68 + . g873.t1 4 AUGUSTUS start_codon 3768236 3768238 . + 0 transcript_id "g873.t1"; gene_id "g873"; 4 AUGUSTUS CDS 3768236 3768958 0.68 + 0 transcript_id "g873.t1"; gene_id "g873"; 4 AUGUSTUS stop_codon 3768956 3768958 . + 0 transcript_id "g873.t1"; gene_id "g873"; # protein sequence = [MRITPSSTTAPAIPFISSPRVSRPSPLINGSLPRISALSASLATSSFHHPRAGNAISDGASIPPINPSRTTTDADSLH # SLRSASSATLTVPQDLTNVFQYPRLIDDQVNTAASFRYFQLEDEMMRRKLEAERDKKARDGLPATTSADPSRISAPSASSSRINGAVSKTEQGHRNDK # ATAVEPQEKLKEPELQDQSQASPKSKGKRKVTFDVQLDPPSNPVEDGTNNLSEGSITSLYTFHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g873 ### # start gene g874 4 AUGUSTUS gene 3769038 3769523 0.67 + . g874 4 AUGUSTUS transcript 3769038 3769523 0.67 + . g874.t1 4 AUGUSTUS start_codon 3769038 3769040 . + 0 transcript_id "g874.t1"; gene_id "g874"; 4 AUGUSTUS CDS 3769038 3769523 0.67 + 0 transcript_id "g874.t1"; gene_id "g874"; 4 AUGUSTUS stop_codon 3769521 3769523 . + 0 transcript_id "g874.t1"; gene_id "g874"; # protein sequence = [MSESVSQQGAVSRLHDRNSSGGGSPVSFTTPISASLPASSHIPLPIPSRIPPRTIAAAQNGSDKGNHTEANHNQTDSA # SDIAFDFTTTNFDAPSAARALKRDRHTQILNLLAASLPSHRAAWAGKNYEAFVRGAYAKTNEDFDDDEFDDGGDDVKTEECKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g874 ### # start gene g875 4 AUGUSTUS gene 3769694 3770062 0.6 + . g875 4 AUGUSTUS transcript 3769694 3770062 0.6 + . g875.t1 4 AUGUSTUS start_codon 3769694 3769696 . + 0 transcript_id "g875.t1"; gene_id "g875"; 4 AUGUSTUS CDS 3769694 3770062 0.6 + 0 transcript_id "g875.t1"; gene_id "g875"; 4 AUGUSTUS stop_codon 3770060 3770062 . + 0 transcript_id "g875.t1"; gene_id "g875"; # protein sequence = [MDNNRPSQADVMYKKRASAAALRRASYAERDIERGVDPGMFDYLLAVHHEEDEEDEDQLDGYQDSEHGENGESATNRA # NSEDASGSSRGPTGNRKGRDRAHKILEAQAKSGVPDDEMWRSLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g875 ### # start gene g876 4 AUGUSTUS gene 3775086 3776148 0.69 - . g876 4 AUGUSTUS transcript 3775086 3776148 0.69 - . g876.t1 4 AUGUSTUS stop_codon 3775086 3775088 . - 0 transcript_id "g876.t1"; gene_id "g876"; 4 AUGUSTUS CDS 3775086 3775765 0.83 - 2 transcript_id "g876.t1"; gene_id "g876"; 4 AUGUSTUS CDS 3775908 3776148 0.82 - 0 transcript_id "g876.t1"; gene_id "g876"; 4 AUGUSTUS start_codon 3776146 3776148 . - 0 transcript_id "g876.t1"; gene_id "g876"; # protein sequence = [MNLSNREVRTKCSAEFLVGFESEFILLKSTNPVVSMNVHGWSASAGMLNGSIETEIMEEIADSLQASGITVELFHPEA # APAKHGVHATFAPRPFMYSAGTSTHAHISVHDIANRPEFRKAPGELSLLEKAFLAGVLSHLPAIAAITLPIPASYKRAVDGAWSGGTYVSWGTENREA # PIRLTNVASPNSRRYECRFIDATANPHLALAAVLGSALAEMGAVSDGSGDVQLEVQDAGTKPAAVMTEEERKTHGITKRMPASSGEARSYLRGDGQLC # EVLGKELIEAFLSVNKVGDSSIFCMNLRLMFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g876 ### # start gene g877 4 AUGUSTUS gene 3778973 3779578 0.6 + . g877 4 AUGUSTUS transcript 3778973 3779578 0.6 + . g877.t1 4 AUGUSTUS start_codon 3778973 3778975 . + 0 transcript_id "g877.t1"; gene_id "g877"; 4 AUGUSTUS CDS 3778973 3779578 0.6 + 0 transcript_id "g877.t1"; gene_id "g877"; 4 AUGUSTUS stop_codon 3779576 3779578 . + 0 transcript_id "g877.t1"; gene_id "g877"; # protein sequence = [MRQQPHRPDSPSEQFAMYTELEPEQRSALNGYHRSSFTAIPNATRPSKHHATPSSTMPSTNPTIYRDAGAPVYQYEVY # GLSSPTQSHMQPSLVDRPKYAGSFGLAEPYVNYNKLSHPSQPHLLPSTVNPHPMPMSSQTPYGPHLATNNVSTGVNSGHGGVGGNVPSGGNNMQEDIS # TIFVVGFPDDMQVYLVCQIVENYSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g877 ### # start gene g878 4 AUGUSTUS gene 3779611 3782339 0.89 + . g878 4 AUGUSTUS transcript 3779611 3782339 0.89 + . g878.t1 4 AUGUSTUS start_codon 3779611 3779613 . + 0 transcript_id "g878.t1"; gene_id "g878"; 4 AUGUSTUS CDS 3779611 3781620 0.91 + 0 transcript_id "g878.t1"; gene_id "g878"; 4 AUGUSTUS CDS 3781680 3782339 0.97 + 0 transcript_id "g878.t1"; gene_id "g878"; 4 AUGUSTUS stop_codon 3782337 3782339 . + 0 transcript_id "g878.t1"; gene_id "g878"; # protein sequence = [MFTFSSGFEAATLKIPNKEYTAYGVSGSTNNPGAAPPGLPGLTPSLASLVRAQAAINDPYNLVTMNQGGVVVDGGRDG # TMSSWPTASIDDSYYPPGLGIGNLGGMIPSVGGPGITLGPNPNPNASGTTSVGNGPVPPRKQIIGFAKFRTREEALEARDVLQSRRVDIEKGSILKAE # MAKKNLHTKRGVTANGGAGTNVGSVNGNPLGATLTSASHLGPAPPAAVNGISYPGHAPMSKYDLFSGSANLAEPGSGNISARDRELGALGAMGFTMAG # SSNNGHFSGTNNVTALSSLTTLWDEDNRERERMVYDAMGLGISSGDESSGPISAKEGGRRQMETWRDGRERDRDERQPLRLRSGSAFDAFHSIPASLP # QNSLVSPPSQKAKPLPLSSLTHDDGVPGPWDHFSKSSAGSNVPNSASSKVSHSSSNGTKGSNGRSRSSRSSSVAAGSTHSRGSARDMNGHEDDDDVHT # NPEMELEDSNTTVKEIDVAQIARAVGSLAVTTNKHVSHAGSTGANTVNGAHSLGHTSPQLPSPSSGSGTSISALSAGGASGISASAPMSSSSSSSSMR # HAPPPNQHCPAPNFTTQHSVSNPNLSHLSSMLSSTLPGLVSGVDQNPPINTLYVGNLPISPPPLGYPPDILEESLRELFRTRPGYKRLSFKQKSTGPM # CFVEFEDVDAATKTINELYGNNLNGLVKGGGIRLSYSKNPLGIRTPTSANGPGPGFQQQHFQQQAHVGRDGDRERGDRYGYGGTQALSPTPHHHSVSY # RPSHTHEFMISPPPPRFAGNSSGANPLSNISFGNFSSTSFSGVNSQLVGSGSNSMFGATNSFQGGTGPGVGYHLLPSDSYGDAQGQGLNTSFSPFDGS # HLDHPQMPPMSSLPMQHGPNPSQNQNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g878 ### # start gene g879 4 AUGUSTUS gene 3783597 3787046 0.27 - . g879 4 AUGUSTUS transcript 3783597 3787046 0.27 - . g879.t1 4 AUGUSTUS stop_codon 3783597 3783599 . - 0 transcript_id "g879.t1"; gene_id "g879"; 4 AUGUSTUS CDS 3783597 3786906 0.9 - 1 transcript_id "g879.t1"; gene_id "g879"; 4 AUGUSTUS CDS 3786991 3787046 0.27 - 0 transcript_id "g879.t1"; gene_id "g879"; 4 AUGUSTUS start_codon 3787044 3787046 . - 0 transcript_id "g879.t1"; gene_id "g879"; # protein sequence = [MAKVQEQPRGCSRLTALSLKDILIEIPAVVVHPSALPELPLPEEQDPGYTYYDQQQVYQPALIPYTIQSPSTPFPSQS # PYPEQAQVQGAYVLYPALPMSPGPPGPALATGSYVDPNQNLVWLPPSIPFTPTVTPQPYVYPQSPNHLHAEYAMSLEMPASYPRDDDIFLRSPPQPSN # PGLLSSSTTTVAALLSPPLPELPGLPPPSTHQDLTSMFNYSTEPILMHSQMRAPLSPTNVVPSSSSRVVPGMYGSATGFGDATPQTGIDGEQGMTHHT # SARTLRVTSQTQRRGRSTSPIGGQSHSLNGGNDEPTSAGVSHPILAPLPPLNLNLRPTTLRTPLHSPRPVLSPKRSFTKVTEVSNAGEMVSKSVPKSE # RVEELERMADEVETRVRDLSSDLPPSSDQKQLDGWAEEPPLVPTITDKARLLLTKSRENDYFSIAPAPNQSALNAHGSPKKDLTNGNLAAPSSSASSR # PRSRSRTPPTPATPTLTAVVTPRKSLATGYINGYSTKAVKAVKGKIGNDQSLLGLGFGVEGRAESGLDALERKLLAEVGTRKIVDEKRPDVWSVLRSG # KEKNLSPNDTSNPAPGFGRDSGVGAEKTEKPSPIEIPRRNSDRDPFNDSAISSLTLPDCGDIEPAVSNSNAQPDVANAWKSTAAMDKVHGNSNLELDR # DRDSDEKTHKGGLRSKNNKRKKHSSRGTLKDGQDGKEDDEGETREAKKKDSEKKGGKKKGKDRSSASKGRVAAWLGGVGAEPPLDDVISASPSPQPSR # IVELPSDIEVLDKPHADLQSESRDTDSSKEKEKEHRKDSDTAILPPSPDPRSSGFVPIGTLKRDIYQRTLVPKDSPMASTSPSEDAKRITDIWNHRDT # ARHAGPSPKSNSSLNDLAKNPWQSVVGKGRLSVLPPERSDPEVKYDIRSARGGKGGRVTAVAAIWASGSVGASGKKPTATSPLSTPHPPGKSSKAIGK # VTSPFSVPKFPVSVSSSSSSASGDGISGQRTTPTRRNVGVGVGVKVASTPVPAVISSSYAKPALSTTASLSRPTTAASRASPVKVPPTISEFPSEVRL # ESKSSDPTSNVKMTRTGLGLGAGKAANNLRAVTNSESKKTYTHGEHLAFGQARLRDLIKKYQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g879 ### # start gene g880 4 AUGUSTUS gene 3789029 3792597 0.43 + . g880 4 AUGUSTUS transcript 3789029 3792597 0.43 + . g880.t1 4 AUGUSTUS start_codon 3789029 3789031 . + 0 transcript_id "g880.t1"; gene_id "g880"; 4 AUGUSTUS CDS 3789029 3792199 0.53 + 0 transcript_id "g880.t1"; gene_id "g880"; 4 AUGUSTUS CDS 3792322 3792597 0.44 + 0 transcript_id "g880.t1"; gene_id "g880"; 4 AUGUSTUS stop_codon 3792595 3792597 . + 0 transcript_id "g880.t1"; gene_id "g880"; # protein sequence = [MSSTASSLSIPRFPESSQLSGENTWRVFKDQVLAHIEVRELEGYLDGSIIRPPISDYVSTSTLYPPASTSTPAYSPTP # FPHEWRQRDRMAASIIYLNIVDPVGLGVEREKPAYHIWAELKKKYERRDEMRVHQADTKLRSARFDPSVTTIEEHEKTMKNHLKELRNLGGSCLDSQF # RLIVIASMPKSWRDLLINVKGISSDDAFIHLRQVYDNKKEDEEDARQRSQVRALIAQEMASFHSANTASAPKKDHPTCTNPNCPPRRRRTHTIEKCWA # PGGGNEGGGPKKAETAVTQTANYASDGGNHTIMELFDLCTSLPTPISSIQLPNAHTCRNCMSVSRGYEANEEVTHNIDVLNSSVPHQSSDVDECIACS # AHNKNNLLYAASKPRVPQTFLDSAASDHFWVRRDDFIKYENLYRKAGKSAIARKAGEFEIHGKGTVEFETAVDGIRRRCRLNDVYHTPSFHHNLISLR # TLDAKGMKGEWGRGSLTVRTVNGSIVMQGEGKGTMYEVQAYFLPSFANFARSLNKPVDIQTWHRRLGHPAIDRILLMHRHNLVDGLQITSKKVAGKCE # PCILGKSTHRPFDEKLTHETKVLERIHLDLFGPTRTQSIGGATWMFLATDGCSSVKAPTFLTNKQKETVLTAIHDWRTMAEQQTGLKVLIFRIDGGGE # FDNGWFRDYCREHGIVIEMIPPRSSSANGVAERANRTVLDGVRTFLVDAGFPPSMWAEAALTFCYVNAFIPSSRFPDEIPIEIYTKKRHDVSHLRPFG # CKCWATLDAIQTDGKLGVRAVEGRFIGYIGRRGYRIWLPQTRSFHESRSVEFEEGDPRRSAPAVPDEVNGEVFVDVDVGSAPDAVPGYPANKNQIDHS # TASIPSISTTPSTPNYEGLAELFANQALPQSLPVPTPDPDTGPRRSTRIRQPSTRQIQFEESAERERSAFERDLAWAKDTGGIDELGENPLAMVARSP # FAFAAESSNKWVPNTYKQAMRRPELWRAPMQAEYDTLIEKNCWTLVDLPPNANVTGGFMQLNGQKRARLRNAKLDTLHKVSLRLKASIMTKPMVQLHP # EGFVKEGEEHKVCKLNKSIYGTMQGSHDWQDTLGKGYEEDGYIASRADPCVRYRRIGDEYTLSTTYGDDVNGASSSEIGRKRAIADLGKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g880 ### # start gene g881 4 AUGUSTUS gene 3792634 3792999 0.44 + . g881 4 AUGUSTUS transcript 3792634 3792999 0.44 + . g881.t1 4 AUGUSTUS start_codon 3792634 3792636 . + 0 transcript_id "g881.t1"; gene_id "g881"; 4 AUGUSTUS CDS 3792634 3792999 0.44 + 0 transcript_id "g881.t1"; gene_id "g881"; 4 AUGUSTUS stop_codon 3792997 3792999 . + 0 transcript_id "g881.t1"; gene_id "g881"; # protein sequence = [MTIFQDPDSKSITISQKSYFEHMLEHFGLENVRIRRTPLDPKAKITESPNPIPEIDRKFMSNKPYRSFIGSVLWGACS # TRPDIAFASNFLARFQLNPGITHWNACEWLAGYIRGTINYSII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g881 ### # start gene g882 4 AUGUSTUS gene 3794051 3795157 0.74 + . g882 4 AUGUSTUS transcript 3794051 3795157 0.74 + . g882.t1 4 AUGUSTUS start_codon 3794051 3794053 . + 0 transcript_id "g882.t1"; gene_id "g882"; 4 AUGUSTUS CDS 3794051 3795157 0.74 + 0 transcript_id "g882.t1"; gene_id "g882"; 4 AUGUSTUS stop_codon 3795155 3795157 . + 0 transcript_id "g882.t1"; gene_id "g882"; # protein sequence = [MSSAQDVRDAITELTKNQAKLQDVVSELVSGLSTTKSVGKPQNYNGKRGEDARRFLAAFELWANSIPALSTDRKKKIT # SAITYLEGDAAIWATPISETINRSSITGSGVPFPYDTWEEFVTAFKTRFETTDASADAKQLLKRLYQNRTTVGTYASTFQQYADRTGYSDKDLRDRFY # DHLADRVKDGLVFTTRPTGSLQELIEAAIDVDNRQITRAWEQGKKLVDDGILTNFRPTTVATPFTAPTRDPNAMDIDATTTRSPDAFRRFMIGRCYGC # GSKEHRKADGHHERDICRHCGLNGHVEAVCRRKFLGLPGRKATTISATSIPDTTQSAAPGTIIAATPDLAALLKELAANQQVLAGQIAELHKNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g882 ### # start gene g883 4 AUGUSTUS gene 3795334 3797157 0.3 + . g883 4 AUGUSTUS transcript 3795334 3797157 0.3 + . g883.t1 4 AUGUSTUS start_codon 3795334 3795336 . + 0 transcript_id "g883.t1"; gene_id "g883"; 4 AUGUSTUS CDS 3795334 3796398 0.3 + 0 transcript_id "g883.t1"; gene_id "g883"; 4 AUGUSTUS CDS 3796624 3797157 0.3 + 0 transcript_id "g883.t1"; gene_id "g883"; 4 AUGUSTUS stop_codon 3797155 3797157 . + 0 transcript_id "g883.t1"; gene_id "g883"; # protein sequence = [MIDSGATGLFLHQKFVNKHHIYVRSLPRPIELYNIDGTANLAGRITHSARLLARVDQNQPQILEFLVTNIGSEDVILG # LPWLRKVNPDINWRDGQIQIPAKPKIQHHVAIEEIPEPKEPNVGGNTEQILEPNRAESNGLPHIVPKTELGPETAETGTSLEDELVFEESGSPLYRLT # GNRKRRRAWLRAGFIQEVTEELWCAAGYTYSQQLAEAANKDKPQKTFEEMVPEPYRRHAKVFSEKESERLPEHKPWDHAIDLKPDAPETLRTKIYPMS # VNEQKELDRFLEDNLRKGYIRPSKSPLSSPVFFVKKKDGKLRFIQDYRRLNEYTVKNRYPLPLVADIINCLRQAKYFTKFDEHRKIVHEVLERLAKND # LYLRPEKCEFEQTSIEYLGLIISEGEVRMDPVKVEAVKNWPAPTCLRDVRGFLGFANFYRRFIDGFAKKARALNDLTKKGVGWSWGTNEQVAFEALKE # AFTTAPILVLWDPDKPTRIEVDASGFATGGALLQQQRDGLWHPVAFRSASMDPAERNYEIYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g883 ### # start gene g884 4 AUGUSTUS gene 3797401 3799014 0.64 + . g884 4 AUGUSTUS transcript 3797401 3799014 0.64 + . g884.t1 4 AUGUSTUS start_codon 3797401 3797403 . + 0 transcript_id "g884.t1"; gene_id "g884"; 4 AUGUSTUS CDS 3797401 3799014 0.64 + 0 transcript_id "g884.t1"; gene_id "g884"; 4 AUGUSTUS stop_codon 3799012 3799014 . + 0 transcript_id "g884.t1"; gene_id "g884"; # protein sequence = [MDADDNQQQIVLRPEHFLRAATAVLFQNPLEERIRKASERESEVLEGLRKLKTHGPHKLVNGLAEWEEKEGIVYYKGR # VYVPPDPQLRRDVVAQCHDALTAGHPGKHRTLELVSRQFWWPTVRSFVDKYVEGCDNCQRRRVRPQPQSSLEPLPVPGGPWQDIGVDLIGELPMTQDG # HNAAITFTDHYSKMIHCFPTTTELTAEGVADFYYKEIFRLHGLPRRFISDRGPQFAADIMKALLKRLGIESALTTSYHPETNGQTERANQEIERYIWM # YVSRRQDDWDRLLPTAEFVINSRVHFAHDKAPFEVLYGYTPEFSIPIGSWKEYPSITDRLDALRYAREDAEAALRMSKQRIADTIAEHPNQPSFEVGQ # PVWLSVNNLKIRRKSEKLGSRRLGPFEVIEKTGAHTYRLALPTWMKIHDNINVKRLAPWKGNEVNGILPAPPEPEVIDGEEFYDVDRILDSRIHGRWK # KLQYLVRWKGYDEGHDTWENEENVVGSSDEAINEFYAAHPNAPRKISATIFHSLPWQPMVNFTEVNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g884 ### # start gene g885 4 AUGUSTUS gene 3800010 3801116 1 + . g885 4 AUGUSTUS transcript 3800010 3801116 1 + . g885.t1 4 AUGUSTUS start_codon 3800010 3800012 . + 0 transcript_id "g885.t1"; gene_id "g885"; 4 AUGUSTUS CDS 3800010 3801116 1 + 0 transcript_id "g885.t1"; gene_id "g885"; 4 AUGUSTUS stop_codon 3801114 3801116 . + 0 transcript_id "g885.t1"; gene_id "g885"; # protein sequence = [MSSAQDVRDAITELTKNQAKLQDVVSELVSGLSTTKSVGKPQNYNGKRGEDARRFLAAFELWANSIPALSTDRKKKIT # SAITYLEGDAAIWATPISETINRSSITGSGVPFPYDTWEEFVTAFKTRFETTDASADAKQLLKRLYQNRTTVGTYASTFQQYADRTGYSDKDLRDRFY # DHLADRVKDGLVFTTRPTGSLQELIEAAIDVDNRQITRAWEQGKKLVDDGILTNFRPTTVATPFTAPTRDPNAMDIDATTTRSPDAFRRFMIGRCYGC # GSKEHRKADGHHERDICRHCGLNGHVEAVCRRKFLGLPGRKATTISATSIPDTTQSAAPGTIIAATPDLAALLKELAANQQVLAGQIAELHKNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g885 ### # start gene g886 4 AUGUSTUS gene 3801293 3802116 0.81 + . g886 4 AUGUSTUS transcript 3801293 3802116 0.81 + . g886.t1 4 AUGUSTUS start_codon 3801293 3801295 . + 0 transcript_id "g886.t1"; gene_id "g886"; 4 AUGUSTUS CDS 3801293 3801314 0.82 + 0 transcript_id "g886.t1"; gene_id "g886"; 4 AUGUSTUS CDS 3801416 3802116 0.99 + 2 transcript_id "g886.t1"; gene_id "g886"; 4 AUGUSTUS stop_codon 3802114 3802116 . + 0 transcript_id "g886.t1"; gene_id "g886"; # protein sequence = [MIDSGATAGRITHSARLLARVDQNQPQILEFLVTNIGSEDVILGLPWLRKVNPDINWRDGQIQIPAKPKIQHHVAIEE # IPEPKEPNVGGNTEQILEPNRAESNGLPHIVPKTELGPETAETGTSLEDELVFEESGSPLYRLTGNRKRRRAWLRAGFIQEVTEELWCAAGYTYSQQL # AEAANKDKPQKTFEEMVPEPYRRHAKVFSEKESERLPEHKPWDHAIDLKPDAPETLRTKIYPCQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g886 ### # start gene g887 4 AUGUSTUS gene 3802494 3803114 0.45 + . g887 4 AUGUSTUS transcript 3802494 3803114 0.45 + . g887.t1 4 AUGUSTUS start_codon 3802494 3802496 . + 0 transcript_id "g887.t1"; gene_id "g887"; 4 AUGUSTUS CDS 3802494 3803114 0.45 + 0 transcript_id "g887.t1"; gene_id "g887"; 4 AUGUSTUS stop_codon 3803112 3803114 . + 0 transcript_id "g887.t1"; gene_id "g887"; # protein sequence = [MNSIFADLIAAGKVAVYLDDILIFSASLQEHRKIVHEVLERLAKNDLYLRPEKCEFEQTSIEYLGLIISEGEVRMDPV # KVEAVKNWPAPTCLRDVRGFLGFANFYRRFIDGFAKKARALNDLTKKGVGWSWGTNEQVAFEALKEAFTTAPILVLWDPDKPTRIEVDASGFATGGAL # LQQQRDGLWHPVAFRSASMDPAERNYEIYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g887 ### # start gene g888 4 AUGUSTUS gene 3803358 3804971 0.59 + . g888 4 AUGUSTUS transcript 3803358 3804971 0.59 + . g888.t1 4 AUGUSTUS start_codon 3803358 3803360 . + 0 transcript_id "g888.t1"; gene_id "g888"; 4 AUGUSTUS CDS 3803358 3804971 0.59 + 0 transcript_id "g888.t1"; gene_id "g888"; 4 AUGUSTUS stop_codon 3804969 3804971 . + 0 transcript_id "g888.t1"; gene_id "g888"; # protein sequence = [MDADDNQQQIVLRPEHFLRAATAVLFQNPLEERIRKASERESEVLEGLRKLKTHGPHKLVNGLAEWEEKEGIVYYKGR # VYVPPDPQLRRDVVAQCHDALTAGHPGKHRTLELVSRQFWWPTVRSFVDKYVEGCDNCQRRRVRPQPQSSLEPLPVPGGPWQDIGVDLIGELPMTQDG # HNAAITFTDHYSKMIHCFPTTTELTAEGVADFYYKEIFRLHGLPRRFISDRGPQFAADIMKALLKRLGIESALTTSYHPETNGQTERANQEIERYIWM # YVSRRQDDWDRLLPTAEFVINSRVHFAHDKAPFEVLYGYTPEFSIPIGSWKEYPSITDRLDALRYAREDAEAALRMSKQRIADTIAEHPNQPSFEVGQ # PVWLSVNNLKIRRKSEKLGSRRLGPFEVIEKTGAHTYRLALPTWMKIHDNINVKRLAPWKGNEVNGILPAPPEPEVIDGEEFYDVDRILDSRIHGRWK # KLQYLVRWKGYDEGHDTWENEENVVGSSDEAINEFYAAHPNAPRKISATIFHSLPWQPMVNFTEVNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g888 ### # start gene g889 4 AUGUSTUS gene 3805967 3807073 1 + . g889 4 AUGUSTUS transcript 3805967 3807073 1 + . g889.t1 4 AUGUSTUS start_codon 3805967 3805969 . + 0 transcript_id "g889.t1"; gene_id "g889"; 4 AUGUSTUS CDS 3805967 3807073 1 + 0 transcript_id "g889.t1"; gene_id "g889"; 4 AUGUSTUS stop_codon 3807071 3807073 . + 0 transcript_id "g889.t1"; gene_id "g889"; # protein sequence = [MSSAQDVRDAITELTKNQAKLQDVVSELVSGLSTTKSVGKPQNYNGKRGEDARRFLAAFELWANSIPALSTDRKKKIT # SAITYLEGDAAIWATPISETINRSSITGSGVPFPYDTWEEFVTAFKTRFETTDASADAKQLLKRLYQNRTTVGTYASTFQQYADRTGYSDKDLRDRFY # DHLADRVKDGLVFTTRPTGSLQELIEAAIDVDNRQITRAWEQGKKLVDDGILTNFRPTTVATPFTAPTRDPNAMDIDATTTRSPDAFRRFMIGRCYGC # GSKEHRKADGHHERDICRHCGLNGHVEAVCRRKFLGLPGRKATTISATSIPDTTQSAAPGTIIAATPDLAALLKELAANQQVLAGQIAELHKNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g889 ### # start gene g890 4 AUGUSTUS gene 3807250 3809073 0.36 + . g890 4 AUGUSTUS transcript 3807250 3809073 0.36 + . g890.t1 4 AUGUSTUS start_codon 3807250 3807252 . + 0 transcript_id "g890.t1"; gene_id "g890"; 4 AUGUSTUS CDS 3807250 3808314 0.36 + 0 transcript_id "g890.t1"; gene_id "g890"; 4 AUGUSTUS CDS 3808540 3809073 0.36 + 0 transcript_id "g890.t1"; gene_id "g890"; 4 AUGUSTUS stop_codon 3809071 3809073 . + 0 transcript_id "g890.t1"; gene_id "g890"; # protein sequence = [MIDSGATGLFLHQKFVNKHHIYVRSLPRPIELYNIDGTANLAGRITHSARLLARVDQNQPQILEFLVTNIGSEDVILG # LPWLRKVNPDINWRDGQIQIPAKPKIQHHVAIEEIPEPKEPNVGGNTEQILEPNRAESNGLPHIVPKTELGPETAETGTSLEDELVFEESGSPLYRLT # GNRKRRRAWLRAGFIQEVTEELWCAAGYTYSQQLAEAANKDKPQKTFEEMVPEPYRRHAKVFSEKESERLPEHKPWDHAIDLKPDAPETLRTKIYPMS # VNEQKELDRFLEDNLRKGYIRPSKSPLSSPVFFVKKKDGKLRFIQDYRRLNEYTVKNRYPLPLVADIINCLRQAKYFTKFDEHRKIVHEVLERLAKND # LYLRPEKCEFEQTSIEYLGLIISEGEVRMDPVKVEAVKNWPAPTCLRDVRGFLGFANFYRRFIDGFAKKARALNDLTKKGVGWSWGTNEQVAFEALKE # AFTTAPILVLWDPDKPTRIEVDASGFATGGALLQQQRDGLWHPVAFRSASMDPAERNYEIYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g890 ### # start gene g891 4 AUGUSTUS gene 3809317 3810930 0.66 + . g891 4 AUGUSTUS transcript 3809317 3810930 0.66 + . g891.t1 4 AUGUSTUS start_codon 3809317 3809319 . + 0 transcript_id "g891.t1"; gene_id "g891"; 4 AUGUSTUS CDS 3809317 3810930 0.66 + 0 transcript_id "g891.t1"; gene_id "g891"; 4 AUGUSTUS stop_codon 3810928 3810930 . + 0 transcript_id "g891.t1"; gene_id "g891"; # protein sequence = [MDADDNQQQIVLRPEHFLRAATAVLFQNPLEERIRKASERESEVLEGLRKLKTHGPHKLVNGLAEWEEKEGIVYYKGR # VYVPPDPQLRRDVVAQCHDALTAGHPGKHRTLELVSRQFWWPTVRSFVDKYVEGCDNCQRRRVRPQPQSSLEPLPVPGGPWQDIGVDLIGELPMTQDG # HNAAITFTDHYSKMIHCFPTTTELTAEGVADFYYKEIFRLHGLPRRFISDRGPQFAADIMKALLKRLGIESALTTSYHPETNGQTERANQEIERYIWM # YVSRRQDDWDRLLPTAEFVINSRVHFAHDKAPFEVLYGYTPEFSIPIGSWKEYPSITDRLDALRYAREDAEAALRMSKQRIADTIAEHPNQPSFEVGQ # PVWLSVNNLKIRRKSEKLGSRRLGPFEVIEKTGAHTYRLALPTWMKIHDNINVKRLAPWKGNEVNGILPAPPEPEVIDGEEFYDVDRILDSRIHGRWK # KLQYLVRWKGYDEGHDTWENEENVVGSSDEAINEFYAAHPNAPRKISATIFHSLPWQPMVNFTEVNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g891 ### # start gene g892 4 AUGUSTUS gene 3811926 3813032 0.99 + . g892 4 AUGUSTUS transcript 3811926 3813032 0.99 + . g892.t1 4 AUGUSTUS start_codon 3811926 3811928 . + 0 transcript_id "g892.t1"; gene_id "g892"; 4 AUGUSTUS CDS 3811926 3813032 0.99 + 0 transcript_id "g892.t1"; gene_id "g892"; 4 AUGUSTUS stop_codon 3813030 3813032 . + 0 transcript_id "g892.t1"; gene_id "g892"; # protein sequence = [MSSAQDVRDAITELTKNQAKLQDVVSELVSGLSTTKSVGKPQNYNGKRGEDARRFLAAFELWANSIPALSTDRKKKIT # SAITYLEGDAAIWATPISETINRSSITGSGVPFPYDTWEEFVTAFKTRFETTDASADAKQLLKRLYQNRTTVGTYASTFQQYADRTGYSDKDLRDRFY # DHLADRVKDGLVFTTRPTGSLQELIEAAIDVDNRQITRAWEQGKKLVDDGILTNFRPTTVATPFTAPTRDPNAMDIDATTTRSPDAFRRFMIGRCYGC # GSKEHRKADGHHERDICRHCGLNGHVEAVCRRKFLGLPGRKATTISATSIPDTTQSAAPGTIIAATPDLAALLKELAANQQVLAGQIAELHKNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g892 ### # start gene g893 4 AUGUSTUS gene 3813209 3815032 0.31 + . g893 4 AUGUSTUS transcript 3813209 3815032 0.31 + . g893.t1 4 AUGUSTUS start_codon 3813209 3813211 . + 0 transcript_id "g893.t1"; gene_id "g893"; 4 AUGUSTUS CDS 3813209 3814273 0.32 + 0 transcript_id "g893.t1"; gene_id "g893"; 4 AUGUSTUS CDS 3814499 3815032 0.32 + 0 transcript_id "g893.t1"; gene_id "g893"; 4 AUGUSTUS stop_codon 3815030 3815032 . + 0 transcript_id "g893.t1"; gene_id "g893"; # protein sequence = [MIDSGATGLFLHQKFVNKHHIYVRSLPRPIELYNIDGTANLAGRITHSARLLARVDQNQPQILEFLVTNIGSEDVILG # LPWLRKVNPDINWRDGQIQIPAKPKIQHHVAIEEIPEPKEPNVGGNTEQILEPNRAESNGLPHIVPKTELGPETAETGTSLEDELVFEESGSPLYRLT # GNRKRRRAWLRAGFIQEVTEELWCAAGYTYSQQLAEAANKDKPQKTFEEMVPEPYRRHAKVFSEKESERLPEHKPWDHAIDLKPDAPETLRTKIYPMS # VNEQKELDRFLEDNLRKGYIRPSKSPLSSPVFFVKKKDGKLRFIQDYRRLNEYTVKNRYPLPLVADIINCLRQAKYFTKFDEHRKIVHEVLERLAKND # LYLRPEKCEFEQTSIEYLGLIISEGEVRMDPVKVEAVKNWPAPTCLRDVRGFLGFANFYRRFIDGFAKKARALNDLTKKGVGWSWGTNEQVAFEALKE # AFTTAPILVLWDPDKPTRIEVDASGFATGGALLQQQRDGLWHPVAFRSASMDPAERNYEIYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g893 ### # start gene g894 4 AUGUSTUS gene 3815276 3816760 0.63 + . g894 4 AUGUSTUS transcript 3815276 3816760 0.63 + . g894.t1 4 AUGUSTUS start_codon 3815276 3815278 . + 0 transcript_id "g894.t1"; gene_id "g894"; 4 AUGUSTUS CDS 3815276 3816760 0.63 + 0 transcript_id "g894.t1"; gene_id "g894"; 4 AUGUSTUS stop_codon 3816758 3816760 . + 0 transcript_id "g894.t1"; gene_id "g894"; # protein sequence = [MDADDNQQQIVLRPEHFLRAATAVLFQNPLEERIRKASERESEVLEGLRKLKTHGPHKLVNGLAEWEEKEGIVYYKGR # VYVPPDPQLRRDVVAQCHDALTAGHPGKHRTLELVSRQFWWPTVRSFVDKYVEGCDNCQRRRVRPQPQSSLEPLPVPGGPWQDIGVDLIGELPMTQDG # HNAAITFTDHYSKMIHCFPTTTELTAEGVADFYYKEIFRLHGLPRRFISDRGPQFAADIMKALLKRLGIESALTTSYHPETNGQTERANQEIERYIWM # YVSRRQDDWDRLLPTAEFVINSRVHFAHDKAPFEVLYGYTPEFSIPIGSWKEYPSITDRLDALRYAREDAEAALRMSKQRIADTIAEHPNQPSFEVGQ # PVWLSVNNLKIRRKSEKLGSRRLGPFEVIEKTGAHTYRLALPTWMKIHDNINVKRLAPWKGNEVNGILPAPPEPEVIDGEEFYDVDRILDSRIHGRWK # KLQYLVRWKGYDEGHDTWKMRKMW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g894 ### # start gene g895 4 AUGUSTUS gene 3817883 3818988 0.6 + . g895 4 AUGUSTUS transcript 3817883 3818988 0.6 + . g895.t1 4 AUGUSTUS start_codon 3817883 3817885 . + 0 transcript_id "g895.t1"; gene_id "g895"; 4 AUGUSTUS CDS 3817883 3818438 0.62 + 0 transcript_id "g895.t1"; gene_id "g895"; 4 AUGUSTUS CDS 3818492 3818988 0.6 + 2 transcript_id "g895.t1"; gene_id "g895"; 4 AUGUSTUS stop_codon 3818986 3818988 . + 0 transcript_id "g895.t1"; gene_id "g895"; # protein sequence = [MSSAQDVRDAITELTKNQAKLQDVVSELVSGLSTTKSVGKPQNYNGKRGEDARRFLAAFELWANSIPALSTDRKKKIT # SAITYLEGDAAIWATPISETINRSSITGSGVPFPYDTWEEFVTAFKTRFETTDASADAKQLLKRLYQNRTTVGTYASTFQQYADRTGYSDKDLRDRFY # DHLADRVKDAIDVDNRQITRAWEQGKKLVDDGILTNFRPTTVATPFTAPTRDPNAMDIDATTTRSPDAFRRFMIGRCYGCGSKEHRKADGHHERDICR # HCGLNGHVEAVCRRKFLGLPGRKATTISATSIPDTTQSAAPGTIIAATPDLAALLKELAANQQVLAGQIAELHKNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g895 ### # start gene g896 4 AUGUSTUS gene 3819165 3820235 0.9 + . g896 4 AUGUSTUS transcript 3819165 3820235 0.9 + . g896.t1 4 AUGUSTUS start_codon 3819165 3819167 . + 0 transcript_id "g896.t1"; gene_id "g896"; 4 AUGUSTUS CDS 3819165 3820235 0.9 + 0 transcript_id "g896.t1"; gene_id "g896"; 4 AUGUSTUS stop_codon 3820233 3820235 . + 0 transcript_id "g896.t1"; gene_id "g896"; # protein sequence = [MIDSGATGLFLHQKFVNKHHIYVRSLPRPIELYNIDGTANLAGRITHSARLLARVDQNQPQILEFLVTNIGSEDVILG # LPWLRKVNPDINWRDGQIQIPAKPKIQHHVAIEEIPEPKEPNVGGNTEQILEPNRAESNGLPHIVPKTELGPETAETGTSLEDELVFEESGSPLYRLT # GNRKRRRAWLRAGFIQEVTEELWCAAGYTYSQQLAEAANKDKPQKTLEEMVPEPYRRHAKVFSEKESERLPEHKPWDHAIDLKPDAPETLRTKIYPMS # VNEQKELDRFLEDNLRKGYIRPSKSPLSSPVFFVKKKDGKLRFIQDYRRLNEYTVKNRYPLPLVADIINCLRQAKYFTKFDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g896 ### # start gene g897 4 AUGUSTUS gene 3820991 3822844 0.94 + . g897 4 AUGUSTUS transcript 3820991 3822844 0.94 + . g897.t1 4 AUGUSTUS start_codon 3820991 3820993 . + 0 transcript_id "g897.t1"; gene_id "g897"; 4 AUGUSTUS CDS 3820991 3822844 0.94 + 0 transcript_id "g897.t1"; gene_id "g897"; 4 AUGUSTUS stop_codon 3822842 3822844 . + 0 transcript_id "g897.t1"; gene_id "g897"; # protein sequence = [MLAIIEALKDWRHFLEGLPNPFEIVTDHRNLEYWRTAQDLSRRQARWALWLSRFDFTLTHRAGKANAQADALSRVSQL # EVMDADDNQQQIVLRPEHFLRAATAVLFQNPLEERIRKASERESEVLEGLRKLKTHGPHKLVNGLAEWEEKEGIVYYKGRVYVPPDPQLRRDVVAQCH # DALTAGHPGKHRTLELVSRQFWWPTVRSFVDKYVEGCDNCQRRRVRPQPQSSLEPLPVPGGPWQDIGVDLIGELPMTQDGHNAAITFTDHYSKMIHCF # PTTTELTAEGVADFYYKEIFRLHGLPRRFISDRGPQFAADIMKALLKRLGIESALTTSYHPETNGQTERANQEIERYIWMYVSRRQDDWDRLLPTAEF # VINSRVHFAHDKAPFEVLYGYTPEFSIPIGSWKEYPSITDRLDALRYAREDAEAALRMSKQRIADTIAEHPNQPSFEVGQPVWLSVNNLKIRRKSEKL # GSRRLGPFEVIEKTGAHTYRLALPTWMKIHDNINVKRLAPWKGNEVNGILPAPPEPEVIDGEEFYDVDRILDSRIHGRWKKLQYLVRWKGYDEGHDTW # ENEENVVGSSDEAINEFYAAHPNAPRKISATIFHSLPWQPMVNFTEVNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g897 ### # start gene g898 4 AUGUSTUS gene 3824730 3825062 0.78 - . g898 4 AUGUSTUS transcript 3824730 3825062 0.78 - . g898.t1 4 AUGUSTUS stop_codon 3824730 3824732 . - 0 transcript_id "g898.t1"; gene_id "g898"; 4 AUGUSTUS CDS 3824730 3825062 0.78 - 0 transcript_id "g898.t1"; gene_id "g898"; 4 AUGUSTUS start_codon 3825060 3825062 . - 0 transcript_id "g898.t1"; gene_id "g898"; # protein sequence = [MQTVQGNVSFVTNFEENLITKIVFGVTVDEVEDDLGFRTDYSSDREYASNLFEKPTSSTPQVNTSAATASTSQASTST # SNPSNSMAAFLTYYKPPLSDKSRERLDPWKQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g898 ### # start gene g899 4 AUGUSTUS gene 3825399 3825994 0.25 - . g899 4 AUGUSTUS transcript 3825399 3825994 0.25 - . g899.t1 4 AUGUSTUS stop_codon 3825399 3825401 . - 0 transcript_id "g899.t1"; gene_id "g899"; 4 AUGUSTUS CDS 3825399 3825733 0.51 - 2 transcript_id "g899.t1"; gene_id "g899"; 4 AUGUSTUS CDS 3825796 3825994 0.29 - 0 transcript_id "g899.t1"; gene_id "g899"; 4 AUGUSTUS start_codon 3825992 3825994 . - 0 transcript_id "g899.t1"; gene_id "g899"; # protein sequence = [MYRKKSNPEYPKHDSDPAHAYLPEIILCKKDRTHGMLPLTGPSAFFPDGEMLWRIATKHGSANTNALTREPISKGRLS # LFQEAIQKGKQMNVTPITAFYTLEENTELSATEDDEEEEEGRVVDCGSGSEEVEENTSDEDQKDYQEGKETEVDEEEIVNTGAVSGNSEEEEELVEGM # Q] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g899 ### # start gene g900 4 AUGUSTUS gene 3832641 3834050 0.68 + . g900 4 AUGUSTUS transcript 3832641 3834050 0.68 + . g900.t1 4 AUGUSTUS start_codon 3832641 3832643 . + 0 transcript_id "g900.t1"; gene_id "g900"; 4 AUGUSTUS CDS 3832641 3834050 0.68 + 0 transcript_id "g900.t1"; gene_id "g900"; 4 AUGUSTUS stop_codon 3834048 3834050 . + 0 transcript_id "g900.t1"; gene_id "g900"; # protein sequence = [MGRGRRISITTLAKCLGIHRHTLRRELKKHGIDYKFTSLTDKQLDEITRVFKQTKPNSGFRYLMGFLGEHGLKIQRRR # AIGSLQRVDRLGRALRKKNLISRQEYKVKRPNALWHGDGYHKLILWGYVIHAFVDGFSRTVRIFFFSNFFTKLKLFMKITAMRASTNNRASTVLDLFQ # VAVEKYGLPSRVRLDRGGENVEVATFMILTRGPNRASAMWGASTGNTRAERTWPEVGSQFARAWRAFFFRLERVHGLQRNNPNHLWLLHTLFLPSINE # DCDSFVRSWNSHPISGKGHNKTPNVRINFLTPKLSNFKFQDIRLLGQLEHGIYPDINGGVHPEVLQYYRVEEMEDKEEAERVVIANIREEQHSQYYHE # PVAVPKHSSPFEENGKEVKMFARLLQELESSDFIPSNYRLTPGEWETGIYPIFETIPFGKRGNRRLEVPLPPHIWLKRAIQWVRCLVIMDSIMDSRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g900 ### # start gene g901 4 AUGUSTUS gene 3841440 3841790 0.53 + . g901 4 AUGUSTUS transcript 3841440 3841790 0.53 + . g901.t1 4 AUGUSTUS start_codon 3841440 3841442 . + 0 transcript_id "g901.t1"; gene_id "g901"; 4 AUGUSTUS CDS 3841440 3841790 0.53 + 0 transcript_id "g901.t1"; gene_id "g901"; 4 AUGUSTUS stop_codon 3841788 3841790 . + 0 transcript_id "g901.t1"; gene_id "g901"; # protein sequence = [MVENMKRVASSDQELTVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKGNEAQVSMIKGYREKIETELAKICEDI # LDVLDKHLIPSAASGESKVFYHKMYVVSVGVVFSVLYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g901 ### # start gene g902 4 AUGUSTUS gene 3843036 3844250 1 + . g902 4 AUGUSTUS transcript 3843036 3844250 1 + . g902.t1 4 AUGUSTUS start_codon 3843036 3843038 . + 0 transcript_id "g902.t1"; gene_id "g902"; 4 AUGUSTUS CDS 3843036 3844250 1 + 0 transcript_id "g902.t1"; gene_id "g902"; 4 AUGUSTUS stop_codon 3844248 3844250 . + 0 transcript_id "g902.t1"; gene_id "g902"; # protein sequence = [MVAKHESLGLFCGLASMLPFVRVRADSLDLADFNEDLSAFHGPTLKAQIEYCARAISYILSLYPPNTSIIIMGHSMGG # IVATSLLPSKDISSIITMSTPHTLPPARFDQRVDEIYARNREIMLHDSTPILSLCGGAMDMMIPSESCILPPLVEGLPVPYRRTVFSSALEGAWTGVG # HREMVWCHQVRWRVARAAMELSMAPSLAERGLILDKWFRDGHTLPPAENTEAFESFPLSEDQSRVLSSGERLVLAQPEGSQTYLFPISKQNTTDRRFV # LFVSQGSVPPVSPQKPNSLRISVARCFGLTASLHCKTLHPLVHKLIPNPIPGHTFPVPQQGTDESEGVVVFEADVIPERNSDAQWIAVNIERAAGEGW # LVGGFVSADQVFDDVSMTSNVFPSLHIEYIFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g902 ### # start gene g903 4 AUGUSTUS gene 3846747 3847397 0.93 + . g903 4 AUGUSTUS transcript 3846747 3847397 0.93 + . g903.t1 4 AUGUSTUS start_codon 3846747 3846749 . + 0 transcript_id "g903.t1"; gene_id "g903"; 4 AUGUSTUS CDS 3846747 3847397 0.93 + 0 transcript_id "g903.t1"; gene_id "g903"; 4 AUGUSTUS stop_codon 3847395 3847397 . + 0 transcript_id "g903.t1"; gene_id "g903"; # protein sequence = [MHSNSAANSPRGTPSRRGKSPKSSTTPSPAQSSSVSFHPEAANNSTSSFFSCISIPVEGAVPIGNVSSQEKLPTPDLE # TSPSSESKRAPRKSKTFALAALNSHVRDDLVDVDETTTLSALEEKYRQSAPIPVTPTLDLSTVKRTSPRHFSHPRTIQRPFGLQDCPEYFPSAEEFQD # PMAYIKSISAEAKEFGICKIVPPEGWKMPFVTDTEVRFFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g903 ### # start gene g904 4 AUGUSTUS gene 3848555 3849389 0.84 + . g904 4 AUGUSTUS transcript 3848555 3849389 0.84 + . g904.t1 4 AUGUSTUS start_codon 3848555 3848557 . + 0 transcript_id "g904.t1"; gene_id "g904"; 4 AUGUSTUS CDS 3848555 3848745 0.9 + 0 transcript_id "g904.t1"; gene_id "g904"; 4 AUGUSTUS CDS 3848911 3848946 0.85 + 1 transcript_id "g904.t1"; gene_id "g904"; 4 AUGUSTUS CDS 3849059 3849389 0.92 + 1 transcript_id "g904.t1"; gene_id "g904"; 4 AUGUSTUS stop_codon 3849387 3849389 . + 0 transcript_id "g904.t1"; gene_id "g904"; # protein sequence = [MWFKSHPPPPQPAAMKDDPTALRFGDITVSEYDIENEFWRLVQSTNETVETEYGADIHSTTHGRYFWDDGALDLRCVN # FSKFGAYLHDSTSIIFEKVHWGETKTWYGIPGADAEKFEAAIKYEAPDLFETQPDLLFQLVTLMNPKRLTEVGVRVYACNQRAGEFVLTFPKAYHAGF # NHGVSAMFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g904 ### # start gene g905 4 AUGUSTUS gene 3849662 3853187 0.25 + . g905 4 AUGUSTUS transcript 3849662 3853187 0.25 + . g905.t1 4 AUGUSTUS start_codon 3849662 3849664 . + 0 transcript_id "g905.t1"; gene_id "g905"; 4 AUGUSTUS CDS 3849662 3851641 0.28 + 0 transcript_id "g905.t1"; gene_id "g905"; 4 AUGUSTUS CDS 3851754 3853187 0.39 + 0 transcript_id "g905.t1"; gene_id "g905"; 4 AUGUSTUS stop_codon 3853185 3853187 . + 0 transcript_id "g905.t1"; gene_id "g905"; # protein sequence = [MTDREIANRGRARALGYVDSLEEQDRPEDQYQCTVCKAFCYLSQICCPHQSNVVCADHAELLCAKCNDSNSLTLRTRF # PDNEIIDIQNKVAERAAIPAAWKAKLDKLLLESARPSLRQLRSLLAEGERIHVNYFLEEIYMLRKCVTRANEWVDSANTFIVRKQSRKRPRRSKGRSA # QEGDESHEKPEKTLADLYDLFREVEILGFDCTEIATLRTLAEQAEELKTVGTAILQSPPVNRNREDYMQQCQKLVLDASSLNVLIDEVAEVEKIVDKE # QLLAELEEKMVDGFTLTLEEVRQLLSRSRACQFPPDNKYIRLLEIRLREGTSWEDRAQEVLQQPIKTLEDLDQFADLDPSVPIDPSVLDRLMSARDKA # RDFEKTAQGWLEPGTATKPRPSDVIKLAKRAEKEFSLPTLLEVKGMANIANELEDRAEQILKSSYVRSNEDVFRSVQDWKDYANQHLKIFSLPKFEKV # HVQVAAHEKWVSDLPWYCRRHNGAYTHGKEVLDDVIECTRPDDDQPPNDEYLTCICNVPVRPPPPGVPSDAVQCDHCFARFHEECAKNGGSCPFCDHS # HWTGDIPKARSWHFCFLPNLLINAPEISKKYSEEWKQLEVIVHRVDRLSAVIGQFLAYTSQPANQHPTYIHQVRHYMRKLYKLQFAVSPNPKMEHGVS # VEAAHPTYLVIPLLIVNNATDAIMLGVFSIMLNNVQRSEIGLGHIYVLYVACGGIKPILTQKYGSSPHVRFLSSPILSLYAHIVVAEDTAHADYYVDT # KEMLDTFSKTIIYKAMGQPYTQTLFVELLKFTPGQPDTHAGGSAQPPSSSGPRASSIEVPGQHLVPPPTHAPVALPPPVSVSALNAVTNVAVQNVPPP # PWSRWSTVATPSRPPSISRRHELPPVSLLSQEHQDTRKRKHVEDSTREDLLPPMSSLTEPAAKRRIILPPVHHQNPLPPIQSHPPRTSHPPQTRTPVL # PPPTPQNQSLSPSLARLMSPVDQSPRSQFSHAHSSNGMSTRLETRHDSPLMRPGGVDILNSPPMRGLDRDVPRSIRSNDPTTLPGPSTSRNRHTSPLI # ERDMRGSPPLGALSIVNGRHKLLASPLIERDGTRGGPNGHDKVHRSPVVRNGYANPQTSLATGIDAPPIRKLMMSPGKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g905 ### # start gene g906 4 AUGUSTUS gene 3855511 3855792 0.41 + . g906 4 AUGUSTUS transcript 3855511 3855792 0.41 + . g906.t1 4 AUGUSTUS start_codon 3855511 3855513 . + 0 transcript_id "g906.t1"; gene_id "g906"; 4 AUGUSTUS CDS 3855511 3855792 0.41 + 0 transcript_id "g906.t1"; gene_id "g906"; 4 AUGUSTUS stop_codon 3855790 3855792 . + 0 transcript_id "g906.t1"; gene_id "g906"; # protein sequence = [METGQIVEQSNTPIVSASGISVDPSCNTTVTVTCLKQLYNATDITPSANINNSFGITGYLDQFANFQDLQSFFAVQVP # EAVNSSFTVLSVAGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g906 ### # start gene g907 4 AUGUSTUS gene 3864000 3865910 0.79 + . g907 4 AUGUSTUS transcript 3864000 3865910 0.79 + . g907.t1 4 AUGUSTUS start_codon 3864000 3864002 . + 0 transcript_id "g907.t1"; gene_id "g907"; 4 AUGUSTUS CDS 3864000 3865910 0.79 + 0 transcript_id "g907.t1"; gene_id "g907"; 4 AUGUSTUS stop_codon 3865908 3865910 . + 0 transcript_id "g907.t1"; gene_id "g907"; # protein sequence = [MAGTKGMLAARQPLVVPMLLRLSHFKLRSIIVLVVSKQKGITLVFKTDPLQNVDINSTFDSIAVIQKFIQREIEGQLR # QMFREDLPGIIHRLSQQWIKAKVEAPYISKRPSAPPAPPAPSPILNSSPIPAPLSFDNVAGLSSPHTMPYTRVPHSTRASSVHRSRSTYSGVTGTTRR # PVTRKNTTPPSPPDDMQSTFPDLENYDPTYGLRPEGLPTKSVFKGFRNLFTPNRGLADLNEDPSEPDTDSEPSYDHEHEDSSTYDMVDWDGVPGLASP # GSQSDFTYTPEDHGMEYETIPAVGGGSVIRPRVVHSQSMIQDAAPQSPSPASRRMGRRPTDSAFSPLRAGMVLSPSSARLPGYNPYFSDSATGLASAS # SSKSVNSAFSLRSAPPFLPRPHFGRSITPDSLETPPSYSTEDNTQSLLTPPEKDSVPIPFTAPTSRSRRPSVSSNPSNFFPSSPTNHNTLYDMEDETP # KIVLRPSPLNNTLHQLSTLSHSNHTLSPYTRSLEHFTVRSVPPRYAGGNFGPSSSIDRQPVKAKRKRTYHLGGQKANSSMSLPLPSQVPSGPSDDRNL # YPPAMEPNGVPESDIDVSDMDRYFPVNDVDQKNQNSLPPSSGVGLDPFSPPNIHPHHFRLRSSYVHPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g907 ### # start gene g908 4 AUGUSTUS gene 3866203 3869859 0.23 - . g908 4 AUGUSTUS transcript 3866203 3869859 0.23 - . g908.t1 4 AUGUSTUS stop_codon 3866203 3866205 . - 0 transcript_id "g908.t1"; gene_id "g908"; 4 AUGUSTUS CDS 3866203 3868087 0.93 - 1 transcript_id "g908.t1"; gene_id "g908"; 4 AUGUSTUS CDS 3868647 3869175 0.33 - 2 transcript_id "g908.t1"; gene_id "g908"; 4 AUGUSTUS CDS 3869262 3869859 0.54 - 0 transcript_id "g908.t1"; gene_id "g908"; 4 AUGUSTUS start_codon 3869857 3869859 . - 0 transcript_id "g908.t1"; gene_id "g908"; # protein sequence = [MDLQYATRLMIVKGQFEALSLAIYGEVVSETIIPPLSVEEIISSVPKPISSAEIRTRTLSSSIDPANSSDPMFLARNL # LSLLDDPPPLSLLSKLMFCLKPDNDDWDDSNFPFLFVDFDRDIFQTASKMEDDDAETVNSGEDQMNFDLEATLDAMSKAVSDAVAEDTLTKFAQVVAD # NIGPRTNNQAFHIAKLFKLSASQPIDISTVVDAQSLDEDTLLHLLDASANADIARYLHTDYFLDVLADFQNSAINVTQTRTSKQAAERLAKRIQAWEV # FEDALSNTQADFAAATAFLRDIGTGEQSLGIWLASMTGHIDLFTKLAENPIVPNSSGVYPKLFVRNGIIGSMSVGAAISHDEFIAFVRAFIGVSGVLA # VWACVDPRLAELLAETSRDLNGNFRITSPFPIPHQIQPQTSTAIPLPQVLSQLFRLAEDLLALVLYLVLVPESYPSTTPAPLSFSLSAYTLRSIVLSV # VDVFVCTDAADTIYAQGTPACVSAQSARQACLEFVRRASNSGPGGIIVEPEGGKSGAEIVMSMLLKHGVGSSGKDPAYHLLQMFALVDYVLPDPNFTA # AVGGSLELDIEYEEKKQEWVLQVLPNVLDEIQEFFRQLDVENKIHLLRRLVRLDSQSLVGTAEFLFTAEMKFFERCTKTLLASIELQTQRDTDIQTVV # LLYQIGLHVRLLGNMLQTGSDMLDWCLGALGTVQEAFSSLTTSLANLSIARVVSSHLDTVVKMLLVHCDRGFEDRGFEDRGFEDNNFRFTLVVLFLRT # ARLGDKSAVEFNSLLSKAVAVLTTLPLESMDLDMLRLDIGQTLATFKTPLSNSNLSTEISSAILSLMTWLSAQPSEEGLTVFCGIKSDNLVSLYDSLE # ASLPEEQLDTLNKLRTILTVDEDVKILPENMNIPDTLQLSMQELQDILSPLSSFLPIAPSTPTRNNIPDVLGLVISPPAALLRSPAATGLTKTYLNND # FRELRQAAVARQNTSRLPSMHGTSPTITIYFFKLTMLLDLQWM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g908 ### # start gene g909 4 AUGUSTUS gene 3876654 3877238 0.36 - . g909 4 AUGUSTUS transcript 3876654 3877238 0.36 - . g909.t1 4 AUGUSTUS stop_codon 3876654 3876656 . - 0 transcript_id "g909.t1"; gene_id "g909"; 4 AUGUSTUS CDS 3876654 3877238 0.36 - 0 transcript_id "g909.t1"; gene_id "g909"; 4 AUGUSTUS start_codon 3877236 3877238 . - 0 transcript_id "g909.t1"; gene_id "g909"; # protein sequence = [MLAIIEALKDWQHFLEGLPNPFEIVTDHRNLEYWRTAQDLSRQQARWALWLSRFEFTLTHRAGKANAQPHALSRVSQL # EVTDADDNQQQMVLQPEHFLRAATAILYQNPLEECIRKASERELEVLEGLRKLKTHGPHKLVNGLTKWEEKEGIVYYKVRVYVPPDPQLRQDVVAQCH # DALTAGHPEKHHTLELLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g909 ### # start gene g910 4 AUGUSTUS gene 3877277 3877834 0.31 - . g910 4 AUGUSTUS transcript 3877277 3877834 0.31 - . g910.t1 4 AUGUSTUS stop_codon 3877277 3877279 . - 0 transcript_id "g910.t1"; gene_id "g910"; 4 AUGUSTUS CDS 3877277 3877834 0.31 - 0 transcript_id "g910.t1"; gene_id "g910"; 4 AUGUSTUS start_codon 3877832 3877834 . - 0 transcript_id "g910.t1"; gene_id "g910"; # protein sequence = [MTGKVAVYLHDILIFSASLQEHRKIVHEVLEQLANNDLYLRPEKCEFEQTSIQYLGLIISEGEVCMDPVKVEAVKNWP # APTCLRDVRGFLGFANFYRHFIDGFAKKARALNDLTKKGVGWSWGTNEQVAFEALKKAFTTAPILVLWDPDKPTRIKVDASGSATGGALLQQQGDGFG # IPWHSDLLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g910 ### # start gene g911 4 AUGUSTUS gene 3879184 3879756 0.36 + . g911 4 AUGUSTUS transcript 3879184 3879756 0.36 + . g911.t1 4 AUGUSTUS start_codon 3879184 3879186 . + 0 transcript_id "g911.t1"; gene_id "g911"; 4 AUGUSTUS CDS 3879184 3879756 0.36 + 0 transcript_id "g911.t1"; gene_id "g911"; 4 AUGUSTUS stop_codon 3879754 3879756 . + 0 transcript_id "g911.t1"; gene_id "g911"; # protein sequence = [METLSTTWRTTLQQSRFAERIKNKMAHLPELATLADYCQEVLRIDNCYWKHEETRKREAGELFIAQNPKKGSLHFKAG # STNQQKNSQPSGSSAPFTPKAKPFSGGKPQNSSNSGQSGGQRPVFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEEI # PEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g911 ### # start gene g912 4 AUGUSTUS gene 3880089 3881648 0.91 + . g912 4 AUGUSTUS transcript 3880089 3881648 0.91 + . g912.t1 4 AUGUSTUS start_codon 3880089 3880091 . + 0 transcript_id "g912.t1"; gene_id "g912"; 4 AUGUSTUS CDS 3880089 3881648 0.91 + 0 transcript_id "g912.t1"; gene_id "g912"; 4 AUGUSTUS stop_codon 3881646 3881648 . + 0 transcript_id "g912.t1"; gene_id "g912"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHFDSPQTSVPSAINPVVAKVAV # PLPEPSPLVSPTILETPPGESPCSRSRSRMLRAKLLSSKFPFEPIYSYPTVSQFTAQLETPEVDIALVSAAVFNRACKDAGMEPILLRGIHSEVAACA # TDRSFSTPTVPSLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGALLPLGRIYPLSEKELVALKNFIDKQLATGAITPSSSPHGAPVLFVP # KKDSKLRLCVDFRGLNRISKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDKWKTTFRTRYGSYEWKVMPFGLTNAPAAFQCFVNDIFS # DMLDVCVIVYLDDILFYSDTPEENREHVKEVLQRLQKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFY # HHFIYNYSDIVVPMTQLTQKGTPWIWDNDCQEAFENLKIAFTSAPILVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g912 ### # start gene g913 4 AUGUSTUS gene 3882773 3883222 0.44 - . g913 4 AUGUSTUS transcript 3882773 3883222 0.44 - . g913.t1 4 AUGUSTUS stop_codon 3882773 3882775 . - 0 transcript_id "g913.t1"; gene_id "g913"; 4 AUGUSTUS CDS 3882773 3883222 0.44 - 0 transcript_id "g913.t1"; gene_id "g913"; 4 AUGUSTUS start_codon 3883220 3883222 . - 0 transcript_id "g913.t1"; gene_id "g913"; # protein sequence = [MYNNASQYPENGIPIPLKSVIRISSNSEGSSYTAQANFEQFNENVSSSGMLSSTVVDADHIDSTYQMRKLSALQHLKR # GNKPFIKFPSGSTPLSTYKNPKLYAYLWPTLFPYGVGMMENNDIHSNSSVGFRHIDMRAHTAYLLQSKPNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g913 ### # start gene g914 4 AUGUSTUS gene 3887055 3888221 0.91 + . g914 4 AUGUSTUS transcript 3887055 3888221 0.91 + . g914.t1 4 AUGUSTUS start_codon 3887055 3887057 . + 0 transcript_id "g914.t1"; gene_id "g914"; 4 AUGUSTUS CDS 3887055 3888221 0.91 + 0 transcript_id "g914.t1"; gene_id "g914"; 4 AUGUSTUS stop_codon 3888219 3888221 . + 0 transcript_id "g914.t1"; gene_id "g914"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g914 ### # start gene g915 4 AUGUSTUS gene 3889052 3891988 0.97 + . g915 4 AUGUSTUS transcript 3889052 3891988 0.97 + . g915.t1 4 AUGUSTUS start_codon 3889052 3889054 . + 0 transcript_id "g915.t1"; gene_id "g915"; 4 AUGUSTUS CDS 3889052 3891988 0.97 + 0 transcript_id "g915.t1"; gene_id "g915"; 4 AUGUSTUS stop_codon 3891986 3891988 . + 0 transcript_id "g915.t1"; gene_id "g915"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPAMFQAL # MNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGF # LGFANFYRHFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPNRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRLASMQ # PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHCPGRVNTQADALSHMAVHHVSDSDDN # RQQTVLKSGHFVKIAASILQNPLEDRIRKASEQEAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHLTAGHPG # LHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQQHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEG # VADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSAL # GMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREVRQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYR # ILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSR # APKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g915 ### # start gene g916 4 AUGUSTUS gene 3893209 3893898 0.69 + . g916 4 AUGUSTUS transcript 3893209 3893898 0.69 + . g916.t1 4 AUGUSTUS start_codon 3893209 3893211 . + 0 transcript_id "g916.t1"; gene_id "g916"; 4 AUGUSTUS CDS 3893209 3893898 0.69 + 0 transcript_id "g916.t1"; gene_id "g916"; 4 AUGUSTUS stop_codon 3893896 3893898 . + 0 transcript_id "g916.t1"; gene_id "g916"; # protein sequence = [MNLVLKILPSPFSNSEGEETTQLSPESSSQHVGPTVPGVGPIDDMTSGAPQAFVAGTHFGSLVNEPRVGQAQINSASH # IWYFIRALSSPDDPTPTSSTEPKKNWEMRPPAKKFSHLSCKLCLYVFNLLTSYLFIHLQSRTNCKPKIWRNSDGQNKTILQHLLRHHQKAWTNTVVLK # KLKGCEEVVRKADPDTRSKIPKEKLPFTIEGFRERLERWVAVDDQVQFYTPPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g916 ### # start gene g917 4 AUGUSTUS gene 3895965 3896585 0.33 + . g917 4 AUGUSTUS transcript 3895965 3896585 0.33 + . g917.t1 4 AUGUSTUS start_codon 3895965 3895967 . + 0 transcript_id "g917.t1"; gene_id "g917"; 4 AUGUSTUS CDS 3895965 3896585 0.33 + 0 transcript_id "g917.t1"; gene_id "g917"; 4 AUGUSTUS stop_codon 3896583 3896585 . + 0 transcript_id "g917.t1"; gene_id "g917"; # protein sequence = [MSTERPSSSKIESKKQKSTLSHGSTTQAQKSNQAASFTVITVAAGQRLMSIPEQSFGDETASNVRTPEGRQLMVEEPP # PVEPGMGPPQRRYTSMGYAQPASSPMGGFAYSPTWGMRGPPAGPAPQLDMESASNAGGRVSGQVAAIERIQGESTDPLTVRQQEKLPERRVSSAVSEQ # SRTSSRRLPTPQYSPLTFLPRDEEVHSPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g917 ### # start gene g918 4 AUGUSTUS gene 3898421 3898912 0.3 - . g918 4 AUGUSTUS transcript 3898421 3898912 0.3 - . g918.t1 4 AUGUSTUS stop_codon 3898421 3898423 . - 0 transcript_id "g918.t1"; gene_id "g918"; 4 AUGUSTUS CDS 3898421 3898912 0.3 - 0 transcript_id "g918.t1"; gene_id "g918"; 4 AUGUSTUS start_codon 3898910 3898912 . - 0 transcript_id "g918.t1"; gene_id "g918"; # protein sequence = [MFALEMALPHHGAGNWEDLIPAVPTLDHLMQEWEAMMLSYIHFVTDTPLPQIGPQEEGSGHHEEASNLQEGVGVGTAA # VPLFLPDLLSPTPVASPASPLSPPPLFGSVANLAIDMMADDNNEDIYESAGCIEHRNRLEGNLGEDDPMGDGANSSLKAESSVAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g918 ### # start gene g919 4 AUGUSTUS gene 3899243 3900008 0.39 + . g919 4 AUGUSTUS transcript 3899243 3900008 0.39 + . g919.t1 4 AUGUSTUS start_codon 3899243 3899245 . + 0 transcript_id "g919.t1"; gene_id "g919"; 4 AUGUSTUS CDS 3899243 3899529 0.39 + 0 transcript_id "g919.t1"; gene_id "g919"; 4 AUGUSTUS CDS 3899621 3900008 0.43 + 1 transcript_id "g919.t1"; gene_id "g919"; 4 AUGUSTUS stop_codon 3900006 3900008 . + 0 transcript_id "g919.t1"; gene_id "g919"; # protein sequence = [MLVENGGGIATVELMGEGGDTTKGSQSFVQLHLHLRQRREGDRIRSLFGILISSSLQKEPVRGSGGPPLARLQFSSAA # EQPEHWTHPPRIVAELKIPRNLSTKDWKRNEQIISKENGDDLLRYEVQEEHTSMFEPDPGNDRVAPVAELQKIWFPGADLTCVDELPRKQKCHEEWRL # EWRSPVWKKPTGTPTDEHEQKDVHFPHNRDAGRGYEEQVDDEQWETFW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g919 ### # start gene g920 4 AUGUSTUS gene 3901447 3902076 0.24 - . g920 4 AUGUSTUS transcript 3901447 3902076 0.24 - . g920.t1 4 AUGUSTUS stop_codon 3901447 3901449 . - 0 transcript_id "g920.t1"; gene_id "g920"; 4 AUGUSTUS CDS 3901447 3902076 0.24 - 0 transcript_id "g920.t1"; gene_id "g920"; 4 AUGUSTUS start_codon 3902074 3902076 . - 0 transcript_id "g920.t1"; gene_id "g920"; # protein sequence = [MPCMAHSPAEAPATPPPMQMQPFVPPTWIVPRLSGEAALQARNTICGSQSVTAASMAANSAAPDSPPSPNYAEIRGPA # TLASLMAQDYPESNEEWLGVAVSHPYQPNGVSTTSGEEGTVPPHHSHHPHEHSSPGGDDYMRHLPHYNPPSGGALDQGFNPLGVSPSGEPSFSLLARV # STLFFLPCQTPCLPGTVDFPLLTAFFIPVCSAY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g920 ### # start gene g921 4 AUGUSTUS gene 3903926 3904354 0.56 - . g921 4 AUGUSTUS transcript 3903926 3904354 0.56 - . g921.t1 4 AUGUSTUS stop_codon 3903926 3903928 . - 0 transcript_id "g921.t1"; gene_id "g921"; 4 AUGUSTUS CDS 3903926 3904354 0.56 - 0 transcript_id "g921.t1"; gene_id "g921"; 4 AUGUSTUS start_codon 3904352 3904354 . - 0 transcript_id "g921.t1"; gene_id "g921"; # protein sequence = [MFLHVVESSKWNSIFICKHRYNIRFTALNISRWDITKAANGKAINKPNRICSNIIRKITVVPDDEDDIRVMFHSEAVK # RSNELERRAAEKHIAEEARELARREEVLRLEQTMAKAKIVAETKKKRLEQLREQTIKPLTTPTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g921 ### # start gene g922 4 AUGUSTUS gene 3904453 3904890 0.35 - . g922 4 AUGUSTUS transcript 3904453 3904890 0.35 - . g922.t1 4 AUGUSTUS stop_codon 3904453 3904455 . - 0 transcript_id "g922.t1"; gene_id "g922"; 4 AUGUSTUS CDS 3904453 3904890 0.35 - 0 transcript_id "g922.t1"; gene_id "g922"; 4 AUGUSTUS start_codon 3904888 3904890 . - 0 transcript_id "g922.t1"; gene_id "g922"; # protein sequence = [MYTKVILTQLQEKLYPTQDINMSTFVELHDLGHYGLQGKTANIFQNVPSRKTRQSSSMMNVRGQLPDPSKYYSLPIQT # SFELFKFVKGKLRKAEKEQNLRALETNDVVNGSFLLCIIKKFSDSAVHSGSDYAESVRSLAGFRGFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g922 ### # start gene g923 4 AUGUSTUS gene 3924426 3931550 1 + . g923 4 AUGUSTUS transcript 3924426 3931550 1 + . g923.t1 4 AUGUSTUS start_codon 3924426 3924428 . + 0 transcript_id "g923.t1"; gene_id "g923"; 4 AUGUSTUS CDS 3924426 3931550 1 + 0 transcript_id "g923.t1"; gene_id "g923"; 4 AUGUSTUS stop_codon 3931548 3931550 . + 0 transcript_id "g923.t1"; gene_id "g923"; # protein sequence = [MLTLSVGSRRQKHAVVVDDLVQRLLRFSDDNAVNNPKNSNVYSEIHKQCSLQFGEVVTKILYTHFRAHHEIDRCDDPL # IAKSNLGVIITVFQNLTKEELSNMKQALKICERSDKSMLVFYSLNDEGHSEIRSNDLFKLMGKCFQRDYKKYYFKDNIGICNDYLYHYGIPLTDIGLQ # DVVFQVLVALGYVQHILQQILHSVQSKDLSYSSRNFYKKNKRKQIRIERASKEYSVLHQCSESWPERISTETKMNCVRNYRQFVQYSPPSICACCGSE # DRLRTGSYKNQAEWPNLSVLKIKDPYIVANTHPSRFIYICRELDGLLLNKEGIRSVDVTCTVFEIYFCHDCYGSLRRLKMPRLALNNYLYRGESLKEL # ENVTWVEEMACSIYRTTAHVTRIFGSSSVTDPLQLHGNVCAHPLNMCAIAKKLPWSPTDLNDLITIIFVGKRKLSETDLLKLKPFFVRRSVIRILLSD # LCKRNRLYKDLYSMDNSVLNQYPENDILPGLAERIIYDHESSSANLFGVESDGFDDHPAELLSDAAEDSILLERSGLYDPESQDVPARFMTASSINNI # AQSLSSTDVSKKDVFLMYERDPINEYNNPDLFPGMFPTLFPLGIGGFEDHHQCPAVSLEAHVEHLLDQSSREFRYHHFFSFVALNLIQRRKAHLHTSL # SISSKNFDMVAPAFSTVTANVLLDLAQKLKNEKDKSDFTDDEQHAFQLLNQVNVISAKIPGSQASRTTTRNQIRSYYAYFGMPQLFLTLNPSAVHSPI # FQVMYGQTDIDLAERFPHVVHPRSERACRVARDPVAAADFFDFMYHTIFQQLLGWDFKLGKSTENGGIFGHLRAFFGCAELTERGCFHGHYLLFLRGG # LNPSEIHEKLSGLDGYCEKFLSFFDDIIHHHLPCIDFVLPEGYEPRVEMPPEFYVIGKGNTFSTELISDWKKLFEDEHKRIGERFQRHRCRPVCHKGQ # TNTDVCRFGYPYEIVENSSYNIEQNSIIFARKETDVNGHNPQLLVCTRHNHDIKCILSGKAAKAAMFYISDYITKMPLNTEALLSTLSKAVASLTSDE # FDESTVFDSKKLLHRCLTHFGRKQQIHAQQCARYLRRQGDNMCSHQTIPLPSANLMIFIQQTYFNDTHNWEDENNHELDMQLSLGIKNGKMIGYNQVI # DYWYRDALLDDMCFYDFIRYISLQPQTRTRTSNTSTTRLGVLSRYKLSIHHPLCDTHELIRHTNFKQGDVGKEYVPVMIGAIPPRKNQQQYALFVIAH # FKPFSERNVLFKDDKVESEFHNLVISTEHQRVLTNWEEIHECADQRDAERLRKRANMLAKSLHVPVTIDEELDAEDETCYVFIDAKTSNPKNSKGNEH # NHELQLLKMDLTRSAWLNHPPEKLKKSMSASSNASVKLPSLNFTNVGKWIKDSKMIAEKLSSARFSQSNLYSQNSNEINGDLLDTTKSTLKGYHKSKM # IDNVQDHNIPEFTPAEVKNHIAKEYNLNNEQKIAFEIISSIIIFKEILKVPEWSEKQPLIMNLTGPGGTGKTHVVQAVQKVMEHYGMAHAYRALAPTG # NAASLINGKTIHSGLNIKVRENKNGRSKRNLGELKEKMAVYATVKKNNSIRTEWKDVCLLLIDEVSMVDSILLADIDGSLRYAKEKPDDFFGGINIIF # SGDPFQYPPVGTSLYTPIRSSGKQSEDELMRRLGRMAWKSINAVVELHEQKRMEDDPEYAAAVSRLRIRECIKSDVELFNSRAIKTLSNPKGVIFDSE # TDYLASMIVSKNATRRALNEYKAIAICNGVESLELVKVVAHDELKYKKYTEKKSKHENTFPSIFEQTQLQSMDTSSAKFRASLPGILNLYIGMPVILK # HENINTELGITNGARGCLRKLELSIDNNGFTYCEYALIEFFDCKVQLPGLPQGYFPIKARTWHFTTYIWDDKHEKVLVSVVRKQLPFEPLFALTGQGA # QGRTLPAILCMLHLGGYGSYVAASRPRTRKGLFITKKVTLDDLNTPAIPYDLWFEMRRFHTIAHNTKVIWGFDKGDLIEVPDAESEKKSNLSNVHYEF # NNYRDIKRQLDDSNDSPKKIKIAKTSSKTESNSNSFIAKPFNQDAFIMKGPSWDSENWSCSFDTAFIIFYNCFFSMSDKSRQLWINQSKSKHLFNHLQ # KLLSNVMETTVDTINVMRNEWRDGLFNEFGRACVQYGHVLLPISTLIQYHLHVCERSCVQLERICEVHNTCYRHISGLKCYNLIMPALEPLYSYKEIV # SSVQDYIDVMFMNHHGTFPTNKDYDNTECDEHCVSVTAMNNELPQIIAFEIIGVNNIIPLSEIHVSLPDLNVKLTYVLNSIIYHGMNHFCARIFNIHG # TWLYDGQIDGGKLQHDKISHNSEENLTILNEKSAHIYIYVRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g923 ### # start gene g924 4 AUGUSTUS gene 3933098 3933367 0.69 + . g924 4 AUGUSTUS transcript 3933098 3933367 0.69 + . g924.t1 4 AUGUSTUS start_codon 3933098 3933100 . + 0 transcript_id "g924.t1"; gene_id "g924"; 4 AUGUSTUS CDS 3933098 3933367 0.69 + 0 transcript_id "g924.t1"; gene_id "g924"; 4 AUGUSTUS stop_codon 3933365 3933367 . + 0 transcript_id "g924.t1"; gene_id "g924"; # protein sequence = [MKDTTEAVSTSMIDEEKAEIDKQCNADKSSNPPISGEQTPSIYDEERAPNSTSVANTSLELSTSSRCSLSEATSRFNG # NSSFVIHGEHA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g924 ### # start gene g925 4 AUGUSTUS gene 3937969 3938373 0.71 + . g925 4 AUGUSTUS transcript 3937969 3938373 0.71 + . g925.t1 4 AUGUSTUS start_codon 3937969 3937971 . + 0 transcript_id "g925.t1"; gene_id "g925"; 4 AUGUSTUS CDS 3937969 3938373 0.71 + 0 transcript_id "g925.t1"; gene_id "g925"; 4 AUGUSTUS stop_codon 3938371 3938373 . + 0 transcript_id "g925.t1"; gene_id "g925"; # protein sequence = [MSATQNPKTSSIPSSTQPHVYRTVPLGGSIGYAARATHTQASADANLDPRNSTPIRSFRASESQLSTSVVRPNASGAN # GTLQDHDQSYLATACPPPSPEVQCFVSPEAYIPLITGNTASSTISYAPGMIPTKDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g925 ### # start gene g926 4 AUGUSTUS gene 3944984 3946360 0.29 - . g926 4 AUGUSTUS transcript 3944984 3946360 0.29 - . g926.t1 4 AUGUSTUS stop_codon 3944984 3944986 . - 0 transcript_id "g926.t1"; gene_id "g926"; 4 AUGUSTUS CDS 3944984 3945244 0.72 - 0 transcript_id "g926.t1"; gene_id "g926"; 4 AUGUSTUS CDS 3945794 3946360 0.39 - 0 transcript_id "g926.t1"; gene_id "g926"; 4 AUGUSTUS start_codon 3946358 3946360 . - 0 transcript_id "g926.t1"; gene_id "g926"; # protein sequence = [MDATLKEVEAIRRDAVDDMDRRIWRQDITTNANGVPPMPESPSTVPFSSDSLQRYTELEHQMTQVGARLQTAVDDPLP # SLSITVKVPLKEQLSQGAENLKSHFIRVQRMIDLLQFVHKQITVLNGIREVFNALQLCLDDLMTRYESKTEDVLDDVPIDEQVSDTDESLSNKFTAIR # SNATVFINNLAQRFKQEEDERRRLEQACLAEEEERARLEKKQHEETERIKLNEIRLTEEAPTKEEPKKNGIGRRRESSIREEENRNGFEIERRERGIT # C] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g926 ### # start gene g927 4 AUGUSTUS gene 3948069 3948296 0.77 - . g927 4 AUGUSTUS transcript 3948069 3948296 0.77 - . g927.t1 4 AUGUSTUS stop_codon 3948069 3948071 . - 0 transcript_id "g927.t1"; gene_id "g927"; 4 AUGUSTUS CDS 3948069 3948296 0.77 - 0 transcript_id "g927.t1"; gene_id "g927"; 4 AUGUSTUS start_codon 3948294 3948296 . - 0 transcript_id "g927.t1"; gene_id "g927"; # protein sequence = [MFEDTSISGNGWVGTITSQGDSIHIDSINAINLQFELPEVPTKARAGCDEQALESHQVIELQIFSERKIWIKEKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g927 ### # start gene g928 4 AUGUSTUS gene 3949529 3950237 0.27 - . g928 4 AUGUSTUS transcript 3949529 3950237 0.27 - . g928.t1 4 AUGUSTUS stop_codon 3949529 3949531 . - 0 transcript_id "g928.t1"; gene_id "g928"; 4 AUGUSTUS CDS 3949529 3949963 0.71 - 0 transcript_id "g928.t1"; gene_id "g928"; 4 AUGUSTUS CDS 3950133 3950237 0.32 - 0 transcript_id "g928.t1"; gene_id "g928"; 4 AUGUSTUS start_codon 3950235 3950237 . - 0 transcript_id "g928.t1"; gene_id "g928"; # protein sequence = [MNITEEQYDWLLTWYKKTVEEQILKSLKEPTKLTSSTFVPLQLSHLHEIENSTNMQFRKIDNEFPDRTTTGSGQENLT # YGYSVAQEHPSTSISPTSVDSSASYFENEQLPLNRFLTPIIPYYTPAVPYRCPSRHVPGSIGQYRNPDSFHQQFRESSGCGEFQNYPLDTFVLFADAF # DDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g928 ### # start gene g929 4 AUGUSTUS gene 3955301 3956250 0.6 + . g929 4 AUGUSTUS transcript 3955301 3956250 0.6 + . g929.t1 4 AUGUSTUS start_codon 3955301 3955303 . + 0 transcript_id "g929.t1"; gene_id "g929"; 4 AUGUSTUS CDS 3955301 3955943 0.6 + 0 transcript_id "g929.t1"; gene_id "g929"; 4 AUGUSTUS CDS 3956000 3956250 0.91 + 2 transcript_id "g929.t1"; gene_id "g929"; 4 AUGUSTUS stop_codon 3956248 3956250 . + 0 transcript_id "g929.t1"; gene_id "g929"; # protein sequence = [MYKKAQSSFWTSEEIDLSSDITDWNNKLNVNEKFFLSRVLAFFAASDGIVNENLIRHFSNEIQVPEARCFYGFQIMME # NIHSETYSLLIQTYIRDAPERSMLFNSIETIPCIKRKAKWALQWIQDNRFTFAERLVAFAAIEGIFFSASFACIFWMKKRGLMPGLTFSNELISRDEG # MHTEFACLILSLLQRRPHARVITSIVIEAVDIEQQFVKEAIPIRLIGMNSKLMCNYIEFVADQLLAMLGCGKIYNSQNPFEFMDMISVDGKTNFFEKR # VSEYQKARVFDNTDSIKREFQSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g929 ### # start gene g930 4 AUGUSTUS gene 3958611 3959030 0.97 + . g930 4 AUGUSTUS transcript 3958611 3959030 0.97 + . g930.t1 4 AUGUSTUS start_codon 3958611 3958613 . + 0 transcript_id "g930.t1"; gene_id "g930"; 4 AUGUSTUS CDS 3958611 3959030 0.97 + 0 transcript_id "g930.t1"; gene_id "g930"; 4 AUGUSTUS stop_codon 3959028 3959030 . + 0 transcript_id "g930.t1"; gene_id "g930"; # protein sequence = [MTTSRTQTTTTSSSTAGPSRSCPVLPPPIDLTAQEEEGLEDEDEDEDEIIRRAQAHVERVRERKAAEAARKAAEENAA # RAATAREKAAQEAREWARRAQQQEEKEAVGRGGDSSESERDLSKRGVGFAAETRGQNFEEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g930 ### # start gene g931 4 AUGUSTUS gene 3959548 3960135 0.94 - . g931 4 AUGUSTUS transcript 3959548 3960135 0.94 - . g931.t1 4 AUGUSTUS stop_codon 3959548 3959550 . - 0 transcript_id "g931.t1"; gene_id "g931"; 4 AUGUSTUS CDS 3959548 3960135 0.94 - 0 transcript_id "g931.t1"; gene_id "g931"; 4 AUGUSTUS start_codon 3960133 3960135 . - 0 transcript_id "g931.t1"; gene_id "g931"; # protein sequence = [MKSDLARDFVINLNELHVFLREEILLAHSHYKEQADRKRISHPEFPIGSKVFVLAKYIRSTRPTEKFSEKYLGPFKII # SRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEQYNIAEILDSKLNRRYKRCPLRYYIRWAGYEGTDNESSWVAADEL # HADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g931 ### # start gene g932 4 AUGUSTUS gene 3960259 3961209 0.98 - . g932 4 AUGUSTUS transcript 3960259 3961209 0.98 - . g932.t1 4 AUGUSTUS stop_codon 3960259 3960261 . - 0 transcript_id "g932.t1"; gene_id "g932"; 4 AUGUSTUS CDS 3960259 3961209 0.98 - 0 transcript_id "g932.t1"; gene_id "g932"; 4 AUGUSTUS start_codon 3961207 3961209 . - 0 transcript_id "g932.t1"; gene_id "g932"; # protein sequence = [MVIRFQPGKLSEKPDSITRRWDVYPKEGDIGYTQVNPHNFRPIFTNEQLTTSLRATFLEGLMLRASIVMDIEVIILAL # PKDPSSVVGLELAKDPSNERWSLGSDGLLRLDNRIYVPNHGNLRLQVLRYFHDHPLSGHFSQNRTLEAVCRQYTWPKVKDFVRDYVTSCTTCGCNKPC # RHRPYGLLKPLPVLVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTFDTITSEQLAELFVIHIFSKHGVPNHVTSDRGSEFVLAFFRALG # KALSMELHYTSGYHPEADWQSERVNQTLKQYIRIYCSYQQDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g932 ### # start gene g933 4 AUGUSTUS gene 3961246 3962040 0.88 - . g933 4 AUGUSTUS transcript 3961246 3962040 0.88 - . g933.t1 4 AUGUSTUS stop_codon 3961246 3961248 . - 0 transcript_id "g933.t1"; gene_id "g933"; 4 AUGUSTUS CDS 3961246 3962040 0.88 - 0 transcript_id "g933.t1"; gene_id "g933"; 4 AUGUSTUS start_codon 3962038 3962040 . - 0 transcript_id "g933.t1"; gene_id "g933"; # protein sequence = [MPFGLTNAPAAFQRFVNDIFSDMLDVCIIIYLNDILIYSDTPEEHQEHIKKVLQRLRKHRLYANPDKCEFNMDTVEYL # GYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIIVLMTWLTQKGAPWIWDNDCQEAFENLKIAFTSAPILTHWEPNRPII # VETDASDYAIAAILSIQTVNGEIHPLAFLSRTLHVAELNYNTHDKELLAIFEVFKAWCHFLEGSGDPVDVVTDHKNLEYFSTTKILTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g933 ### # start gene g934 4 AUGUSTUS gene 3962158 3962907 0.96 - . g934 4 AUGUSTUS transcript 3962158 3962907 0.96 - . g934.t1 4 AUGUSTUS stop_codon 3962158 3962160 . - 0 transcript_id "g934.t1"; gene_id "g934"; 4 AUGUSTUS CDS 3962158 3962907 0.96 - 0 transcript_id "g934.t1"; gene_id "g934"; 4 AUGUSTUS start_codon 3962905 3962907 . - 0 transcript_id "g934.t1"; gene_id "g934"; # protein sequence = [MQTSVPSATNTVDAKVAVPLLEPSPLVSPTILETPPGDSLRSCSQTLRAKPLSSKFPFELIHSYPTVSQFAAQLETPE # VDIALVSAAVFNRVCKDAGMEPILLRAIHSEVTARAADHSSTAPTVSPLPHSIPAEYAEFADVFDEIAADALPEHRPYDLKIDLEQGASPPLGRIYPL # SEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRSLNCITKKDRYPLPLISDLLDGPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g934 ### # start gene g935 4 AUGUSTUS gene 3965206 3966240 0.85 - . g935 4 AUGUSTUS transcript 3965206 3966240 0.85 - . g935.t1 4 AUGUSTUS stop_codon 3965206 3965208 . - 0 transcript_id "g935.t1"; gene_id "g935"; 4 AUGUSTUS CDS 3965206 3965805 0.86 - 0 transcript_id "g935.t1"; gene_id "g935"; 4 AUGUSTUS CDS 3965956 3966240 0.94 - 0 transcript_id "g935.t1"; gene_id "g935"; 4 AUGUSTUS start_codon 3966238 3966240 . - 0 transcript_id "g935.t1"; gene_id "g935"; # protein sequence = [MSFTSPSTPNPVSPPVSPPPHPNSAEMTVDAPIDELASTIEEPPLGQLALFCSVFGIGVLLARYIVDNPLWPLLTAAG # LPCSFCVRGKKEANCSVRTHFTLPSEQWRNIAEKIEASTNSTVALIKLNALDEQDQQELDQLELGEFLRKQPQLPGPSASSSLPLPSPSVMATRRMPA # KRRKRSVQQEEGGSSWHKHPVEEVSELDVVPKAHNCKRKHPVGGRRDAEIPDYCRVVVDLRPHFVDTPALATLSGGPINETMHLRELGDSLGLFRREV # KAYIGSYRQLERQQMRVKRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g935 ### # start gene g936 4 AUGUSTUS gene 3969232 3969668 0.55 - . g936 4 AUGUSTUS transcript 3969232 3969668 0.55 - . g936.t1 4 AUGUSTUS stop_codon 3969232 3969234 . - 0 transcript_id "g936.t1"; gene_id "g936"; 4 AUGUSTUS CDS 3969232 3969435 0.78 - 0 transcript_id "g936.t1"; gene_id "g936"; 4 AUGUSTUS CDS 3969522 3969668 0.56 - 0 transcript_id "g936.t1"; gene_id "g936"; 4 AUGUSTUS start_codon 3969666 3969668 . - 0 transcript_id "g936.t1"; gene_id "g936"; # protein sequence = [MTEEQKKEMPHVTTGDLTGKTIMITGANSGIGFQAAKHFASMNPTRLIVMIEEIEADTVYKGAEPMALKLSSFHLSNK # TLDRLDIIDENAAISTNYEYITTNDGTFTSSRYIHPHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g936 ### # start gene g937 4 AUGUSTUS gene 3977438 3979014 0.92 - . g937 4 AUGUSTUS transcript 3977438 3979014 0.92 - . g937.t1 4 AUGUSTUS stop_codon 3977438 3977440 . - 0 transcript_id "g937.t1"; gene_id "g937"; 4 AUGUSTUS CDS 3977438 3977677 0.99 - 0 transcript_id "g937.t1"; gene_id "g937"; 4 AUGUSTUS CDS 3977734 3979014 0.92 - 0 transcript_id "g937.t1"; gene_id "g937"; 4 AUGUSTUS start_codon 3979012 3979014 . - 0 transcript_id "g937.t1"; gene_id "g937"; # protein sequence = [MYLIPSKQEILVDRDHVLRSASSESIGRLAGPPGTNFLTSQMKSLYKEVVNNRDAYARSACALSFGAVHDHVGGLAAG # AVLQTTVGVLMSLSNDTHPVVHFFALNALARVINAASLAYSPFVSKTLGMLLQLYSSESHEPEGGTLCNANLSGDYLAYPVVCQIIDAVITIVGPDIQ # DSVKTRALLLDLVHGFFSEDDQGVLVEAIKCQQHFLMFAAEYVNIPTLVNSFRGHLSSSRRPLKVASINAFYQLVQKDALVLSKLGGDRLVEDLFGML # DDDSSVDGVRNVITSRLEQTVVYNPSAWIDLCQRIMSRTNASQQITDAANARDDEGESLNLGNQEDGGRSRQTSRWRTQLFALQCLHHICTVVSKSGR # REHLDIIFAKSRDITTSGLLVTRVPDLIKMAFTASTAYVTEIRLEGLIVLRDVIQIFAKSPDPAFEDALLLKQHQSPITAALTPAFSTDSTPEILASA # VHACVTFVGCGVVKHVSSMGRILKLLTVALEQSKGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g937 ### # start gene g938 4 AUGUSTUS gene 3979460 3980017 0.4 - . g938 4 AUGUSTUS transcript 3979460 3980017 0.4 - . g938.t1 4 AUGUSTUS stop_codon 3979460 3979462 . - 0 transcript_id "g938.t1"; gene_id "g938"; 4 AUGUSTUS CDS 3979460 3980017 0.4 - 0 transcript_id "g938.t1"; gene_id "g938"; 4 AUGUSTUS start_codon 3980015 3980017 . - 0 transcript_id "g938.t1"; gene_id "g938"; # protein sequence = [MFLLQVRESALGAIHCFLQHNTTLVNLDVGRRIASVLGNPLSFANSFITLNIEQPLEPPLPSTFNKGLSLNGREALLR # RRVYQCFSILGFSGITDSTQSTPLQSVVILFASPEGYSGSTVQAAIASSSGSFTSVWQSVDGYAYGVTFTEVADDSVAANDAAVNEGDKLNRDTVELA # IDKLVCGVF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g938 ### # start gene g939 4 AUGUSTUS gene 3984425 3984658 0.62 - . g939 4 AUGUSTUS transcript 3984425 3984658 0.62 - . g939.t1 4 AUGUSTUS stop_codon 3984425 3984427 . - 0 transcript_id "g939.t1"; gene_id "g939"; 4 AUGUSTUS CDS 3984425 3984658 0.62 - 0 transcript_id "g939.t1"; gene_id "g939"; 4 AUGUSTUS start_codon 3984656 3984658 . - 0 transcript_id "g939.t1"; gene_id "g939"; # protein sequence = [MDFENLENIHDLETCEGRKPSDSSEPEEESSSIDGSDDNEDEDDPDHSDNSEISNSLGRIDKFLTFTSESKPLGKKQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g939 ### # start gene g940 4 AUGUSTUS gene 3990509 3990784 0.59 - . g940 4 AUGUSTUS transcript 3990509 3990784 0.59 - . g940.t1 4 AUGUSTUS stop_codon 3990509 3990511 . - 0 transcript_id "g940.t1"; gene_id "g940"; 4 AUGUSTUS CDS 3990509 3990784 0.59 - 0 transcript_id "g940.t1"; gene_id "g940"; 4 AUGUSTUS start_codon 3990782 3990784 . - 0 transcript_id "g940.t1"; gene_id "g940"; # protein sequence = [MHRSPQSHFEGYLDQTPERIPVQNELMFPMSSTTIPTDWAYSSMIDDNLSMTPHNSTNKRSILPPFSTFDDLGRLEFI # KTSDVLRHLAEDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g940 ### # start gene g941 4 AUGUSTUS gene 3998031 3998774 0.62 + . g941 4 AUGUSTUS transcript 3998031 3998774 0.62 + . g941.t1 4 AUGUSTUS start_codon 3998031 3998033 . + 0 transcript_id "g941.t1"; gene_id "g941"; 4 AUGUSTUS CDS 3998031 3998774 0.62 + 0 transcript_id "g941.t1"; gene_id "g941"; 4 AUGUSTUS stop_codon 3998772 3998774 . + 0 transcript_id "g941.t1"; gene_id "g941"; # protein sequence = [MLNETWPTSIVPYIYMNAPTSTTNSSGIPHTDPNNCFSVEYFVCELLRRSSTSSMVFFTAICYVEAVRSKVQGVFTSD # DYHVYVELNIAAKRTCTDIRSDVLYQNQLFFSTNTTSDKNQLRNSSFDIANEECIDGTAADIEILDNKEVIEKTMSEMVVHRRMESPNLFSVQPLPSP # LLCPRRTFIASLVLASKFNDDKPISNGTWSKLCNLPPLEIGRCERALGIALDWRLWVGKPNRRVDNSVIHI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g941 ### # start gene g942 4 AUGUSTUS gene 4003768 4004782 0.94 + . g942 4 AUGUSTUS transcript 4003768 4004782 0.94 + . g942.t1 4 AUGUSTUS start_codon 4003768 4003770 . + 0 transcript_id "g942.t1"; gene_id "g942"; 4 AUGUSTUS CDS 4003768 4003839 0.95 + 0 transcript_id "g942.t1"; gene_id "g942"; 4 AUGUSTUS CDS 4003910 4004782 0.96 + 0 transcript_id "g942.t1"; gene_id "g942"; 4 AUGUSTUS stop_codon 4004780 4004782 . + 0 transcript_id "g942.t1"; gene_id "g942"; # protein sequence = [MTKALTIKLAQAAPEIIIQAQAGFNKREQLLHWTRRKHMNDYLWKTLRKYGLPNEFISTVQALYKDAYTTTIVNGEKS # ETPFKVTRGLRQGDPLSCLLFDIAIDPLRELLRKSNLKGYQIPGYAERLIATFFTDNPTVYLSKEDDFGELQLILDEWCTASGARFNINKTEIIPIGS # PDHQENMRQTWLMNGEDGSQTPDHIKIAQESKAIWTLGALIRNGISQVEPSTKVIEKIDQSLARWDQSKPTMEGQHLIISMIVGGMTQYLTKVQGMLK # EVEIKLTKKELKNSYRMENLTSESMPKQLKHPSKMEADKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g942 ### # start gene g943 4 AUGUSTUS gene 4015165 4016148 0.8 - . g943 4 AUGUSTUS transcript 4015165 4016148 0.8 - . g943.t1 4 AUGUSTUS stop_codon 4015165 4015167 . - 0 transcript_id "g943.t1"; gene_id "g943"; 4 AUGUSTUS CDS 4015165 4016148 0.8 - 0 transcript_id "g943.t1"; gene_id "g943"; 4 AUGUSTUS start_codon 4016146 4016148 . - 0 transcript_id "g943.t1"; gene_id "g943"; # protein sequence = [MVVFEQNPGKFHIIINHSYPQSDLPCPSEICSLLPDSLIVDPSKISINSLINSDDYPCDWGTFADYYLQVTVAPKGTQ # VAVFDVDAAFRNMPLHRSTRRFIALFIDNLIFLDLCLNFSKRSAPGIRGQITDVMVKILCKHGVEALLEWVNDFIFLRFPKSCNSDGSFTYSYNETLV # WAVTAKLGWPWAPKEFVSFSFSFLYIDFLWVLSAKTVQLPLEKKVKYATCVLPCTEPDALMTLDKAEELTGTLNHVCLVLPTARTHLVSLYKFSAGFK # HSRSNMAAHRISFLLREDLTWWLQTFEANFVGMSIFTLPDYIDISLYVDASTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g943 ### # start gene g944 4 AUGUSTUS gene 4026903 4027505 0.93 - . g944 4 AUGUSTUS transcript 4026903 4027505 0.93 - . g944.t1 4 AUGUSTUS stop_codon 4026903 4026905 . - 0 transcript_id "g944.t1"; gene_id "g944"; 4 AUGUSTUS CDS 4026903 4027505 0.93 - 0 transcript_id "g944.t1"; gene_id "g944"; 4 AUGUSTUS start_codon 4027503 4027505 . - 0 transcript_id "g944.t1"; gene_id "g944"; # protein sequence = [MHNPVINWKELCLMFQDRNVRISAALALEIVQPGAEGGTEELERGVNNEKIHKGTLQQPPEAPLKAPRTKVKLEEIKD # EEYESGQPGSHDLFWLKPHFHDKFKQQNSQPPPPIFIKGKMEHFIERVLDSKPKKGQPEEIKYLVKWEGYGDEFNSWVGWEGMAGSLELLRSWHEKHL # RKRQPSQKHWGSLERDAQEEEKEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g944 ### # start gene g945 4 AUGUSTUS gene 4031308 4031903 0.58 - . g945 4 AUGUSTUS transcript 4031308 4031903 0.58 - . g945.t1 4 AUGUSTUS stop_codon 4031308 4031310 . - 0 transcript_id "g945.t1"; gene_id "g945"; 4 AUGUSTUS CDS 4031308 4031756 0.91 - 2 transcript_id "g945.t1"; gene_id "g945"; 4 AUGUSTUS CDS 4031861 4031903 0.58 - 0 transcript_id "g945.t1"; gene_id "g945"; 4 AUGUSTUS start_codon 4031901 4031903 . - 0 transcript_id "g945.t1"; gene_id "g945"; # protein sequence = [MVNLSLAPDISTHCRAHQTVAIPDTRVSELLRSSNDNDISARDNDRCTTYTPSNSFVTNCQYSSATNHLNDCTGTGYG # NQSICGESSNSYLGFAQNDVAYGLEDQFDGGFIDSFGFAVPSITAHFDPLSSSSIGQYDDLWSDYGGTTNDLTDFSCFIDKSFEY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g945 ### # start gene g946 4 AUGUSTUS gene 4038793 4039300 0.52 - . g946 4 AUGUSTUS transcript 4038793 4039300 0.52 - . g946.t1 4 AUGUSTUS stop_codon 4038793 4038795 . - 0 transcript_id "g946.t1"; gene_id "g946"; 4 AUGUSTUS CDS 4038793 4039232 0.6 - 2 transcript_id "g946.t1"; gene_id "g946"; 4 AUGUSTUS CDS 4039276 4039300 0.56 - 0 transcript_id "g946.t1"; gene_id "g946"; 4 AUGUSTUS start_codon 4039298 4039300 . - 0 transcript_id "g946.t1"; gene_id "g946"; # protein sequence = [MAGKEFNCTSSLIVAFQSHAVASSSADHMNISKADILNPDSDELSSSTNPAVKLAFAETHILNETKAYLESNGVVLVS # FSSSGTVRADTTILVKNICYGTSDIEIRELFEPHGTVSRVLVSPAGTIAVVEFEKPDKASRGFRAVGYRQSGKSVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g946 ### # start gene g947 4 AUGUSTUS gene 4051935 4052981 0.86 + . g947 4 AUGUSTUS transcript 4051935 4052981 0.86 + . g947.t1 4 AUGUSTUS start_codon 4051935 4051937 . + 0 transcript_id "g947.t1"; gene_id "g947"; 4 AUGUSTUS CDS 4051935 4052981 0.86 + 0 transcript_id "g947.t1"; gene_id "g947"; 4 AUGUSTUS stop_codon 4052979 4052981 . + 0 transcript_id "g947.t1"; gene_id "g947"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHEKPPAATVDVEDIWKQSAKTNSWDSDETEADASNLDANRYPLRDPRHSPYSQTNPSKSRPRPQHLLLHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g947 ### # start gene g948 4 AUGUSTUS gene 4053149 4056865 0.96 + . g948 4 AUGUSTUS transcript 4053149 4056865 0.96 + . g948.t1 4 AUGUSTUS start_codon 4053149 4053151 . + 0 transcript_id "g948.t1"; gene_id "g948"; 4 AUGUSTUS CDS 4053149 4056865 0.96 + 0 transcript_id "g948.t1"; gene_id "g948"; 4 AUGUSTUS stop_codon 4056863 4056865 . + 0 transcript_id "g948.t1"; gene_id "g948"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g948 ### # start gene g949 4 AUGUSTUS gene 4058641 4059033 0.72 - . g949 4 AUGUSTUS transcript 4058641 4059033 0.72 - . g949.t1 4 AUGUSTUS stop_codon 4058641 4058643 . - 0 transcript_id "g949.t1"; gene_id "g949"; 4 AUGUSTUS CDS 4058641 4059033 0.72 - 0 transcript_id "g949.t1"; gene_id "g949"; 4 AUGUSTUS start_codon 4059031 4059033 . - 0 transcript_id "g949.t1"; gene_id "g949"; # protein sequence = [MCFRIANKVMQGICQTVTTIELDVSVGFFSSLLGNVESALLSKVLAAETAAYLTIHHPDYAILAARIAVSNLHKVTEK # KFSVVINDLYDYVNPTTGEPAPMICEVTYRTVMAHKEILDSAIIYSRDFTYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g949 ### # start gene g950 4 AUGUSTUS gene 4064316 4064636 1 + . g950 4 AUGUSTUS transcript 4064316 4064636 1 + . g950.t1 4 AUGUSTUS start_codon 4064316 4064318 . + 0 transcript_id "g950.t1"; gene_id "g950"; 4 AUGUSTUS CDS 4064316 4064636 1 + 0 transcript_id "g950.t1"; gene_id "g950"; 4 AUGUSTUS stop_codon 4064634 4064636 . + 0 transcript_id "g950.t1"; gene_id "g950"; # protein sequence = [MANLLRSTKSGSNWTQNEFRAYNITVQLQDAATFFGVNPLPQPAVTQEVLTTLDADNMILNNNYKFSCYMDLAMNFVP # TEESAVDDFAVYLLKLLGYLPQSRMAWT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g950 ### # start gene g951 4 AUGUSTUS gene 4065722 4069438 0.88 - . g951 4 AUGUSTUS transcript 4065722 4069438 0.88 - . g951.t1 4 AUGUSTUS stop_codon 4065722 4065724 . - 0 transcript_id "g951.t1"; gene_id "g951"; 4 AUGUSTUS CDS 4065722 4069438 0.88 - 0 transcript_id "g951.t1"; gene_id "g951"; 4 AUGUSTUS start_codon 4069436 4069438 . - 0 transcript_id "g951.t1"; gene_id "g951"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFATRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEISYSHLAATHTESPILELPE # PESPAENPHIEVPPEATLEQSESIAVEELPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIIPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQNAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g951 ### # start gene g952 4 AUGUSTUS gene 4069489 4070655 0.91 - . g952 4 AUGUSTUS transcript 4069489 4070655 0.91 - . g952.t1 4 AUGUSTUS stop_codon 4069489 4069491 . - 0 transcript_id "g952.t1"; gene_id "g952"; 4 AUGUSTUS CDS 4069489 4070655 0.91 - 0 transcript_id "g952.t1"; gene_id "g952"; 4 AUGUSTUS start_codon 4070653 4070655 . - 0 transcript_id "g952.t1"; gene_id "g952"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLRRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g952 ### # start gene g953 4 AUGUSTUS gene 4118469 4120199 0.44 + . g953 4 AUGUSTUS transcript 4118469 4120199 0.44 + . g953.t1 4 AUGUSTUS start_codon 4118469 4118471 . + 0 transcript_id "g953.t1"; gene_id "g953"; 4 AUGUSTUS CDS 4118469 4118900 0.66 + 0 transcript_id "g953.t1"; gene_id "g953"; 4 AUGUSTUS CDS 4118959 4119111 0.65 + 0 transcript_id "g953.t1"; gene_id "g953"; 4 AUGUSTUS CDS 4119171 4120199 0.91 + 0 transcript_id "g953.t1"; gene_id "g953"; 4 AUGUSTUS stop_codon 4120197 4120199 . + 0 transcript_id "g953.t1"; gene_id "g953"; # protein sequence = [MEMRLPALFNLSTNTVDIDRSSDSDSSRTMDSYDSAPQSPSDAGQDDPMPLAPLNPQTMPQMAPQVPASHFHTQSPHP # PQTPPPQTPPPQTPPPQTPPPQTPPPQTPPPRSEDFQMDDVNATPRAPPDMTPRAPPGPRNQPIMQQPPSPTIQKGKRRRVHDPEPGPSQSNNKTPGA # QPTSHTGAQSNTQSNSQGPLQALLNHQTKTMGELYHHLQNSTAEILQKQDQVLQKQDHKIEKVVSHLAQNTEILGRIGETLDMLSGKSKHKESPGHRD # GGDSQRHGSGSKQGPQPSHDGDAAANPSDGGAAGSTTNRNNGNGNGEDGDDEGDSNENPFFRYARKKQPARSGGVKHRPAEELKIKVCTYLHHVFQPI # QRFSLKETMRKWLNEVMEGQDQLKEAVSQDEADEFTVLFKTNPLARPCSIDDFRYWIAGGPKSAWNKGASYVFVEILEKRKLIATPDVQTRDAIREAF # LLRLKTLHASWMERQKMLEDNKNPRSLFSKRWQRKNTVSHFYCLNTQTHTPKAVPSSKGGHHHLPLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g953 ### # start gene g954 4 AUGUSTUS gene 4121456 4125163 0.99 - . g954 4 AUGUSTUS transcript 4121456 4125163 0.99 - . g954.t1 4 AUGUSTUS stop_codon 4121456 4121458 . - 0 transcript_id "g954.t1"; gene_id "g954"; 4 AUGUSTUS CDS 4121456 4125163 0.99 - 0 transcript_id "g954.t1"; gene_id "g954"; 4 AUGUSTUS start_codon 4125161 4125163 . - 0 transcript_id "g954.t1"; gene_id "g954"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWERGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQCEPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMWTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQQQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQV # LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ # RHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFHLHGLPLHFKSDRGPQFAAKLMQSLLT # RLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE # ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNP # INGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g954 ### # start gene g955 4 AUGUSTUS gene 4125214 4126371 0.95 - . g955 4 AUGUSTUS transcript 4125214 4126371 0.95 - . g955.t1 4 AUGUSTUS stop_codon 4125214 4125216 . - 0 transcript_id "g955.t1"; gene_id "g955"; 4 AUGUSTUS CDS 4125214 4126371 0.95 - 0 transcript_id "g955.t1"; gene_id "g955"; 4 AUGUSTUS start_codon 4126369 4126371 . - 0 transcript_id "g955.t1"; gene_id "g955"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPATPSPANQDFSTQIGQIRELLDRAN # AMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g955 ### # start gene g956 4 AUGUSTUS gene 4132010 4132375 0.55 + . g956 4 AUGUSTUS transcript 4132010 4132375 0.55 + . g956.t1 4 AUGUSTUS start_codon 4132010 4132012 . + 0 transcript_id "g956.t1"; gene_id "g956"; 4 AUGUSTUS CDS 4132010 4132375 0.55 + 0 transcript_id "g956.t1"; gene_id "g956"; 4 AUGUSTUS stop_codon 4132373 4132375 . + 0 transcript_id "g956.t1"; gene_id "g956"; # protein sequence = [MMKDSPDSDFKVSFYQPRDLITRRGVGSPKQIQAMKQQAATTVHAAVKEYLEQQFGTAKITFQDGEARAYPYAFADFP # LAFYATLLSKDRSLQFSGKLWKSGGKHVGKLYPFSSRFNLRGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g956 ### # start gene g957 4 AUGUSTUS gene 4134507 4134821 0.93 - . g957 4 AUGUSTUS transcript 4134507 4134821 0.93 - . g957.t1 4 AUGUSTUS stop_codon 4134507 4134509 . - 0 transcript_id "g957.t1"; gene_id "g957"; 4 AUGUSTUS CDS 4134507 4134821 0.93 - 0 transcript_id "g957.t1"; gene_id "g957"; 4 AUGUSTUS start_codon 4134819 4134821 . - 0 transcript_id "g957.t1"; gene_id "g957"; # protein sequence = [MVELYFAGQSATRASPATDTSGSVSTGSTSTPDDMLQVPTDNNSPTTVSSLPVTSNFIETPLYHSNVHPPTTMGSQKV # TSAEPTYTSDFSNYSAGGKSWLNPLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g957 ### # start gene g958 4 AUGUSTUS gene 4139274 4139873 0.95 - . g958 4 AUGUSTUS transcript 4139274 4139873 0.95 - . g958.t1 4 AUGUSTUS stop_codon 4139274 4139276 . - 0 transcript_id "g958.t1"; gene_id "g958"; 4 AUGUSTUS CDS 4139274 4139873 0.95 - 0 transcript_id "g958.t1"; gene_id "g958"; 4 AUGUSTUS start_codon 4139871 4139873 . - 0 transcript_id "g958.t1"; gene_id "g958"; # protein sequence = [MSIREPESHALNTVYCSAACQSAAKSQYYGLLFTLERPLPQEIPSEPSTAEQLNERRKAQAQFANYLKNEMPGHAAPL # LVAQFIARQVNVEMSKLISQTLSKTTTTTDQADFTDADGGDYLLADHFERLRYVDVDSPKDGLKLLTAVLDSAMPGLDALATDERYATLLGKMLYNAY # GVYYDGGRDDRVWFSHHITHFSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g958 ### # start gene g959 4 AUGUSTUS gene 4141230 4141637 0.66 + . g959 4 AUGUSTUS transcript 4141230 4141637 0.66 + . g959.t1 4 AUGUSTUS start_codon 4141230 4141232 . + 0 transcript_id "g959.t1"; gene_id "g959"; 4 AUGUSTUS CDS 4141230 4141637 0.66 + 0 transcript_id "g959.t1"; gene_id "g959"; 4 AUGUSTUS stop_codon 4141635 4141637 . + 0 transcript_id "g959.t1"; gene_id "g959"; # protein sequence = [MNGDGEPNVMDSTLPLIPSANTADVATGLSTQIDSTNDALSMNFSSQMHAENNEYATLTDGNGDLSISQSEHSNLIPL # KHDERLDLTVGQVEMMEPGGELNGDSAGAGAIADDDQEYLQNADPNEMKRVKVCIST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g959 ### # start gene g960 4 AUGUSTUS gene 4142455 4143701 0.75 + . g960 4 AUGUSTUS transcript 4142455 4143701 0.75 + . g960.t1 4 AUGUSTUS start_codon 4142455 4142457 . + 0 transcript_id "g960.t1"; gene_id "g960"; 4 AUGUSTUS CDS 4142455 4142590 0.83 + 0 transcript_id "g960.t1"; gene_id "g960"; 4 AUGUSTUS CDS 4142665 4142700 0.91 + 2 transcript_id "g960.t1"; gene_id "g960"; 4 AUGUSTUS CDS 4142818 4143701 0.93 + 2 transcript_id "g960.t1"; gene_id "g960"; 4 AUGUSTUS stop_codon 4143699 4143701 . + 0 transcript_id "g960.t1"; gene_id "g960"; # protein sequence = [MQSYANDTYVIPTSVNQSFYIFIAVMLNDHGIYEQILEDEYFFHVYDPEFPTHKANFPRVLDDSTFNVLNSCIIFNQM # DIIQHVQQDNAFLRDIVKLYVDEDMLAGGGRKAQEQQQIGPQVNGHDPPSTSSPTNGAQPLANGYVPSSSPTPHPSTPSQAKQQPYSFAPPEEMSEAA # LELRRSVIFLIQQLCVMGKNVQLPARLALFRTLVDRGVLFAIQWALGLSEKQPVTKAMISAGGEVLAALLDHDLGGVRAHVLKQVVAIDKERAAGKRG # ADKAETIVELCCRNLSQSKDLAVQSQIGDALKVWLDVPLSTDNFSSGGSEATQVCISPTFLNCVCGIKSLYRQWHQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g960 ### # start gene g961 4 AUGUSTUS gene 4144422 4145369 0.68 + . g961 4 AUGUSTUS transcript 4144422 4145369 0.68 + . g961.t1 4 AUGUSTUS start_codon 4144422 4144424 . + 0 transcript_id "g961.t1"; gene_id "g961"; 4 AUGUSTUS CDS 4144422 4145369 0.68 + 0 transcript_id "g961.t1"; gene_id "g961"; 4 AUGUSTUS stop_codon 4145367 4145369 . + 0 transcript_id "g961.t1"; gene_id "g961"; # protein sequence = [MGDEQRAHAGRGKTREVRNSASFISIYSPRFNDPSSFTNSTRIIDTRNWPIGSRVLEAEEEDYFNGDDEDDFVPAISH # SWSRGTGASSPIPSSNGLKRKRRMAVAGALSNKGIRTHRPPSRSPHLGSLVDYEDDEEPVSIDTSEDPSASSSSSTLAPPSSPKPSHRQIPSPPNGPP # PKRLPSVDEEDEDNMLEALVARSRPQSPAPGLMSSVDSLGPMRPAEKRRRGDDDEDDEELLGRLSKTSKKPDLGKQKDMSGGLSISLINRNKTGDDPP # KKFKLKIGMAKANSLSSPKISSPSLATQAPSEPGAKDGDTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g961 ### # start gene g962 4 AUGUSTUS gene 4145824 4146507 0.27 - . g962 4 AUGUSTUS transcript 4145824 4146507 0.27 - . g962.t1 4 AUGUSTUS stop_codon 4145824 4145826 . - 0 transcript_id "g962.t1"; gene_id "g962"; 4 AUGUSTUS CDS 4145824 4146507 0.27 - 0 transcript_id "g962.t1"; gene_id "g962"; 4 AUGUSTUS start_codon 4146505 4146507 . - 0 transcript_id "g962.t1"; gene_id "g962"; # protein sequence = [MLYARSTSNGFGVIESATDVLKLFHGGRLNPKGIVGSDQEYLSAQDGTPAARSFFAHRVKPAVYTYIISAEDDSLRFS # ETGAAFFADFASKHALHANCCDRVRYSGEFHPRPRAKNNSWIGWQDFSDSMSDEMVDWEVLIDNNSGTYSPDKAMLPTLQALLEYNFPGFKVQALDRE # DEELTKSVQACRDYALKYRGVQVKHLQPHLEEGEESLMKCAGVSNPAIGVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g962 ### # start gene g963 4 AUGUSTUS gene 4152554 4153129 0.66 + . g963 4 AUGUSTUS transcript 4152554 4153129 0.66 + . g963.t1 4 AUGUSTUS start_codon 4152554 4152556 . + 0 transcript_id "g963.t1"; gene_id "g963"; 4 AUGUSTUS CDS 4152554 4153129 0.66 + 0 transcript_id "g963.t1"; gene_id "g963"; 4 AUGUSTUS stop_codon 4153127 4153129 . + 0 transcript_id "g963.t1"; gene_id "g963"; # protein sequence = [MSMRRNANATPNHPHRTQQTNLQNLGPQSHYVAGAQARPQVPALTHQYQSRQAFPSQSSTSAHQPQFTQSYQPSQAAQ # PAQLMRNQHQSQRPQQQSAQQQSNFQPSRPSLQTSSTQSQQSIASQPALTPQIILARQRQSVTSSGVFCVISLLSSVLTHLSRLGQQFATQEPVPQIP # TLNQVPPVLPSVLFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g963 ### # start gene g964 4 AUGUSTUS gene 4153626 4155101 0.84 + . g964 4 AUGUSTUS transcript 4153626 4155101 0.84 + . g964.t1 4 AUGUSTUS start_codon 4153626 4153628 . + 0 transcript_id "g964.t1"; gene_id "g964"; 4 AUGUSTUS CDS 4153626 4155101 0.84 + 0 transcript_id "g964.t1"; gene_id "g964"; 4 AUGUSTUS stop_codon 4155099 4155101 . + 0 transcript_id "g964.t1"; gene_id "g964"; # protein sequence = [MNQRRLSSMHKYAYQWLKQAEVGATESIPLTGLFIHCPATGQAQIGEIVNNKFTPMTPIGWIKALQKMVIPEVSQTVS # APANAPPSVTPTTVADAPPHSNPVSLPPTATATKLKGHAESLVNALNSAHEHPTTPLPSLSRKNSNITGSPRTPGDANRKSLARDVLFALGSVREKRQ # RESFGESDGRTAKRTALSDIPVPVAQSTVSSNQPPMVSSFPVQAPAFNYQHPSVISQPAVPQLPSDQSNVARQDKPSDVISAVPSHQAGPSSQANVNP # DAAPLVTKPSKFVMENIPVAGPSRFVGRISQAITNFNTAITSSTLQTAPVASPPKLAPISISQNRLIPEQLPARSPPKVNVTPLFLPETPSPPTSPPP # IPNMDEESLCLAESVTVRGSDIEHVDDFRAGKGQKVTVVDCVQVPSAPGWVKRDLARRMRKSKERQEEEEQAEIESVIEILDSDEEPEPRKTKEKYSR # RSQSSREGMAPQTGRSWNFTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g964 ### # start gene g965 4 AUGUSTUS gene 4155858 4156235 0.54 + . g965 4 AUGUSTUS transcript 4155858 4156235 0.54 + . g965.t1 4 AUGUSTUS start_codon 4155858 4155860 . + 0 transcript_id "g965.t1"; gene_id "g965"; 4 AUGUSTUS CDS 4155858 4156235 0.54 + 0 transcript_id "g965.t1"; gene_id "g965"; 4 AUGUSTUS stop_codon 4156233 4156235 . + 0 transcript_id "g965.t1"; gene_id "g965"; # protein sequence = [MMPPVDSVSLKRYLKAKHLGRVEAPTTSDEYEFLVSRSSHSCMPSRPAKIRDFGDLNSDQVSQLINDGMSFWQEEKKD # EETAFSEPGNSPSPSELPADADGSGVPSRRSTDELVLSGIGFDEELL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g965 ### # start gene g966 4 AUGUSTUS gene 4157805 4159703 0.56 + . g966 4 AUGUSTUS transcript 4157805 4159703 0.56 + . g966.t1 4 AUGUSTUS start_codon 4157805 4157807 . + 0 transcript_id "g966.t1"; gene_id "g966"; 4 AUGUSTUS CDS 4157805 4157810 0.56 + 0 transcript_id "g966.t1"; gene_id "g966"; 4 AUGUSTUS CDS 4157901 4159703 0.96 + 0 transcript_id "g966.t1"; gene_id "g966"; 4 AUGUSTUS stop_codon 4159701 4159703 . + 0 transcript_id "g966.t1"; gene_id "g966"; # protein sequence = [MEEKDQRGGRPKPPPLPTGNPELDLPTSIPPRPFRRPSAPNVSSIVEDEEESPTTRPTHPRMRQTSVASPPPQTLLIA # NTRARSQSAAAPPVKRKTSKTALASSSTPSSAAIMQNRELRIPQAFDGPGIPQKTRKVQKNRESLDLDDVMAGSDDEEFDETEIVSPSKSFASSTPSN # MRVSARTKELMDFLNDGPPPTGSNDFGGRPPINHPPVSKAGRELIDFLAQGPPDFGPPSQAVTDNGSTKSKGSGRLQRMISKLKLGESDKGSRQPSID # DLRKTPTTPSYHRPPLLMKASNGSLSTFGNRPIPPRPPQTQMISPPSSPAYDPADISPSIFSPAAPSTPKVRQTSVLPSSGIRKTLNRDQEAAPTLVA # PSQPHQPPVADKLQQLKVSRSTSSRENVRSEFDLEDTRPLPKSTPSATSEHSAPKKIAEIQPSTIRVSPPAIETSVSERKTLSPDTATPTPGVAASGI # SMVDAQDMKRLMAKATTPEECRLIMDMFMAKAGIPVEQTEYDVPYPSPSSADPPNSRPSSSSDTALEISLVELFLGGEPSLDPPPRKKRYTTKKVRVE # SQATNNLQKPVVPASNGNAIPTPIATFEKIAGVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g966 ### # start gene g967 4 AUGUSTUS gene 4161114 4161563 0.65 - . g967 4 AUGUSTUS transcript 4161114 4161563 0.65 - . g967.t1 4 AUGUSTUS stop_codon 4161114 4161116 . - 0 transcript_id "g967.t1"; gene_id "g967"; 4 AUGUSTUS CDS 4161114 4161563 0.65 - 0 transcript_id "g967.t1"; gene_id "g967"; 4 AUGUSTUS start_codon 4161561 4161563 . - 0 transcript_id "g967.t1"; gene_id "g967"; # protein sequence = [MDAFPNGTNAIVAVISYTGYDMEDAMILNKSAHERGFAYGTVYKSQIIDLKDMKGASKTGAPTLHFGLGPEIKVNSRA # ENKHSCLDFLDLDGLPYVGTRLSTGDPIAAYVDDVTRRTKFVKYKGDEAAFVDEVRLIGTLCSTDYPYGGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g967 ### # start gene g968 4 AUGUSTUS gene 4164411 4167634 0.17 + . g968 4 AUGUSTUS transcript 4164411 4167634 0.17 + . g968.t1 4 AUGUSTUS start_codon 4164411 4164413 . + 0 transcript_id "g968.t1"; gene_id "g968"; 4 AUGUSTUS CDS 4164411 4164527 0.69 + 0 transcript_id "g968.t1"; gene_id "g968"; 4 AUGUSTUS CDS 4164754 4164991 0.85 + 0 transcript_id "g968.t1"; gene_id "g968"; 4 AUGUSTUS CDS 4165252 4165620 0.46 + 2 transcript_id "g968.t1"; gene_id "g968"; 4 AUGUSTUS CDS 4165674 4165820 0.75 + 2 transcript_id "g968.t1"; gene_id "g968"; 4 AUGUSTUS CDS 4165879 4166085 0.99 + 2 transcript_id "g968.t1"; gene_id "g968"; 4 AUGUSTUS CDS 4166140 4166571 0.84 + 2 transcript_id "g968.t1"; gene_id "g968"; 4 AUGUSTUS CDS 4166667 4167634 0.96 + 2 transcript_id "g968.t1"; gene_id "g968"; 4 AUGUSTUS stop_codon 4167632 4167634 . + 0 transcript_id "g968.t1"; gene_id "g968"; # protein sequence = [MFGNNAITSSWANPQQNQQQQQQQQGTSAFGQPTALVRQASTNSGSVFGAPKPATGFGAFGGGGTSTFGGGGTSAFGN # TGQNTTSAFGQPANTGAFGGGTGGSIFGQPKTTSAFGTTTVQDYQQGRKTATAGSFGQQSSFGGTQTTGGSIFGQPQNTQPAQTSSIFGAPKPTTGFG # AFGNTTATNTNTGAFGATNNAFGQPQQQQPQQQPTTGFGFGQTQQQPQQQTASLFGNTNTGGSAFGNTNPTGAFGTTAFGTNSNQQPQQQQPTGSIFG # QPQPAANTGSTFGAFGNTATKPSIFGQPAQPAGQTSIFGQPAQQNQQQQQQPSIFGTTNAGGSSLFGNNANQQQQQQQPQQPGTSLFGNNAATGTGGL # FGTGTGTNLFGANNQQQQQQPQQQQTGTTGFGTSLFGAKPAAPAGGGIFGNNNAFGAAQPTTTAQQPTLFGNTFNQSTNQQQPAAGGGFFNKAPSMGM # ATSMGPGGNLFGNSTFGNSTNTLAGSTNTPNQQVNKKKIPFFVDVPTRSPVPRVQLGYTPAASKLRGFGSSTSSSALSGSVFAPSNSTTLTLSRSQTP # KQSIEAIFGTHSSPSLGSGQRKSVKKLILDKKVEPTELFVKSGGSPLRGGGKITFSPALSIAAREREAAAAASPPPSQPTKSPTPTPQPQRTPKKFTA # SHNGQGADEDDLQEGDYYVKPDMEKLKSSGFDQLSSFKDLVVGRVGYGEIHFLEPVDLTGLLKLGELLGSVIRFEDKECSVYPDADDTEKPPEGSGLN # VRAKISLKRCWAMDKAHREPIKDEKNASAVKHLKKLRNMKDTHFESFDISDGTWTFTVDHF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/7 # CDS introns: 0/6 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g968 ### # start gene g969 4 AUGUSTUS gene 4171687 4172241 0.51 - . g969 4 AUGUSTUS transcript 4171687 4172241 0.51 - . g969.t1 4 AUGUSTUS stop_codon 4171687 4171689 . - 0 transcript_id "g969.t1"; gene_id "g969"; 4 AUGUSTUS CDS 4171687 4172241 0.51 - 0 transcript_id "g969.t1"; gene_id "g969"; 4 AUGUSTUS start_codon 4172239 4172241 . - 0 transcript_id "g969.t1"; gene_id "g969"; # protein sequence = [MSSSLVTGHRHFPSATSIPNTVGERESSKQGERTHCSFLRPILKSSPDDYYIPEKAPVVGAQPQTLTSRKLHPAFDTM # RWACALSHIGLIVLLALFVFRNPDKADSSIISFRNPNFKIVDDDDADLGQTLQASVKLGFGWIITVCLFVSLSSNSSENHIIFLGLDHCPYIDNAKVG # SPPPTEPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g969 ### # start gene g970 4 AUGUSTUS gene 4172862 4173353 0.68 + . g970 4 AUGUSTUS transcript 4172862 4173353 0.68 + . g970.t1 4 AUGUSTUS start_codon 4172862 4172864 . + 0 transcript_id "g970.t1"; gene_id "g970"; 4 AUGUSTUS CDS 4172862 4173353 0.68 + 0 transcript_id "g970.t1"; gene_id "g970"; 4 AUGUSTUS stop_codon 4173351 4173353 . + 0 transcript_id "g970.t1"; gene_id "g970"; # protein sequence = [MQSSALCQRCASLRKLSSYTSLPTAQTRLISSSPYGRTHVWKRRPPILPNPVVPKFPQRVIRADGTSFTHWTTSPRSL # IRLTRDTTNNPVWNTALWADNKAVEDEANTTGRMGRFNKRFEGIGGAGGTVDWMAGTGEGSGIELEGELVDPSLYVAKTKKKKKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g970 ### # start gene g971 4 AUGUSTUS gene 4173731 4177317 0.22 - . g971 4 AUGUSTUS transcript 4173731 4177317 0.22 - . g971.t1 4 AUGUSTUS stop_codon 4173731 4173733 . - 0 transcript_id "g971.t1"; gene_id "g971"; 4 AUGUSTUS CDS 4173731 4176181 0.9 - 0 transcript_id "g971.t1"; gene_id "g971"; 4 AUGUSTUS CDS 4176234 4176369 0.93 - 1 transcript_id "g971.t1"; gene_id "g971"; 4 AUGUSTUS CDS 4176462 4177180 0.31 - 0 transcript_id "g971.t1"; gene_id "g971"; 4 AUGUSTUS CDS 4177252 4177317 0.69 - 0 transcript_id "g971.t1"; gene_id "g971"; 4 AUGUSTUS start_codon 4177315 4177317 . - 0 transcript_id "g971.t1"; gene_id "g971"; # protein sequence = [MLRLLMASTPAPLLLTFMPSSLRGFDDEDGDIAKKTRLEGDEFIDGDEEAVWQGSSDLLNSSDSRVPKRGVGDDNDGD # FGTLKRAHGKRQRKVSSDKESPRRHDMDVDAEAEDYLGDLRSLSRGKKRDRDETGSSYGGEIEQADEDADADVEEEKYRRRKRRNKRRSDANSSSRGK # KRDRDLEDELGDGEDETGLVSQRKLRKKRGKKMSDDEKASDVSMEDSSSMKGRKIGETWTSNGVQYKIGPNGQRLRFELVKKARQKANLEVYVEAWLT # EEEYRIAKARNILSWQESPNGSTEPETPPPTTPDVSPAPPRTGKHLLWDSTTSTPSSQPHDNPFETPKSASQQLATTISGAASRRIASAVRSISGGSK # PLSGSNIAPPSPSLMDSTNMRSPRTYKQFSKWEKQDLEAKAMMRMREANRKKEEEKESLPSVPPAVPKITFTPAADGGSTAKPPPPAFPLPGASTAPK # SIFNAPTTSSPLASGDNKSEAIKPPASTTPSVPFSKPTPAPQPATSPASTQASVPTSTPQVNGSANVIPAAPAKPSSFSFGPPAGVSHAASADKPKPA # VGLGFPSLGPSASVAPQPAGSSSTSASSTASLSSTPAPPKFSFNMPNPASSSNAEHKPDPPASNATSLGGVSLLSRLGGTSAPGQNNVTSSTTPSPFS # FGPSPAPAVSSTATSSSPFGGAFSAAPLSSPFGGASSTPAATTASQQPSQPTNAGSSSSAAAAAAPVKFNFFGSANKTSSPFGNSNSNTLNTTAPTTS # ATPSSLSGALNPLPASSANTAKPISSPFGSADKKPEEEKSTTSAPTFSFGTPASSSAGATNGGNIFGAAKAASTSNSTSSTNPSPFGSSFGGNSAFSS # GTFGSNINSKSAFGSTTTGPSNFGSSLTPSVAATVLQSGSGAFGAKPTDSDTATTPASTSVFSKPSEAPNPGSAAAPKSAFSFGTSATQNSGSTPAAK # SAFSFGTTATQNSGSAPAPKSAFSFGSSAPSSSSGSTSFGFGGQNTFGASAAAKPAGEAQTKTAFSFGSSSSTPLVTPNATPAGDPPKSAFSFGNNST # TPAGSPAKSAFSFGSTAAPGTSGATGGAFGMPASGQSTPSAFGGASTPNPFSAFANKPAGSGTVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g971 ### # start gene g972 4 AUGUSTUS gene 4182337 4182828 1 - . g972 4 AUGUSTUS transcript 4182337 4182828 1 - . g972.t1 4 AUGUSTUS stop_codon 4182337 4182339 . - 0 transcript_id "g972.t1"; gene_id "g972"; 4 AUGUSTUS CDS 4182337 4182828 1 - 0 transcript_id "g972.t1"; gene_id "g972"; 4 AUGUSTUS start_codon 4182826 4182828 . - 0 transcript_id "g972.t1"; gene_id "g972"; # protein sequence = [MTSIETLSKPLQLPLTPGVLELINAHLSQLQPEQILAWAIEYLPNLYQTTAFGLTGLVAIDMLSKLTTSPPPLIFLDT # LYHFRETYELVEEVKLKYRTPLHVYKPAECRTVEDFEAKYGQKLWESDEDTYDFAVKVSPNPPFDEDRNLYICFDTGRTCTKGIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g972 ### # start gene g973 4 AUGUSTUS gene 4184162 4184656 1 - . g973 4 AUGUSTUS transcript 4184162 4184656 1 - . g973.t1 4 AUGUSTUS stop_codon 4184162 4184164 . - 0 transcript_id "g973.t1"; gene_id "g973"; 4 AUGUSTUS CDS 4184162 4184656 1 - 0 transcript_id "g973.t1"; gene_id "g973"; 4 AUGUSTUS start_codon 4184654 4184656 . - 0 transcript_id "g973.t1"; gene_id "g973"; # protein sequence = [MAPHNEEDDPAVYRAGTYKKSDVLGHNTTKVADHDSNGANDHSVNGTNGHSNGTNGHSVDGTNGVNDKANGHPGSNGS # KHSSPIGSPAPVANEEGEEAAMEVDEAEEDSTLLTVQPGFNRLLLVLRDERVMRFVKYVSAAAEGSRWDVCAEYEVGVVQEEGDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g973 ### # start gene g974 4 AUGUSTUS gene 4184691 4185972 0.46 - . g974 4 AUGUSTUS transcript 4184691 4185972 0.46 - . g974.t1 4 AUGUSTUS stop_codon 4184691 4184693 . - 0 transcript_id "g974.t1"; gene_id "g974"; 4 AUGUSTUS CDS 4184691 4185593 0.52 - 0 transcript_id "g974.t1"; gene_id "g974"; 4 AUGUSTUS CDS 4185646 4185972 0.46 - 0 transcript_id "g974.t1"; gene_id "g974"; 4 AUGUSTUS start_codon 4185970 4185972 . - 0 transcript_id "g974.t1"; gene_id "g974"; # protein sequence = [MPLPNYQLWQRDWGGALELYPTKPGPDGLPEPECVPSKSVAPSWNQFIFFEVQPGRSFHSVEEVVVGSGGEDGRERLS # ISGWFHAAQEGEEGYEAPVDEIELKSSREQLTNTQTAFKSYQSSESPTDRPPLPDVELSEEDITFLSEFINPAYLQTRTMQSLASRFVEESSLELHSF # LTNSIAEALEPRLRDLDAHDGLGPDRNGKVPPHCSGVDAKNPDIVSADDATWSHFATNGTPTTPLPLGGTLSVNGIIPPVPAASATPVVPNPPSAWTL # KGPPHKWRYCTLLPPSASAPAVSITPISAHPNPSEILRKLQDELFPSQAFRAWLAIVSRLLPIRHFVEARRFRPGLDYTLATSEEKEARLDVVLGLTP # EVKDDESDEHETHAQRGWRAAEWGGWEVCFFLKTVLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g974 ### # start gene g975 4 AUGUSTUS gene 4186247 4186588 0.85 - . g975 4 AUGUSTUS transcript 4186247 4186588 0.85 - . g975.t1 4 AUGUSTUS stop_codon 4186247 4186249 . - 0 transcript_id "g975.t1"; gene_id "g975"; 4 AUGUSTUS CDS 4186247 4186588 0.85 - 0 transcript_id "g975.t1"; gene_id "g975"; 4 AUGUSTUS start_codon 4186586 4186588 . - 0 transcript_id "g975.t1"; gene_id "g975"; # protein sequence = [MARTHSRPSSPEPSASLIKRIKISHPTLHVATATNETLAAFASEVLESSNVAKLHKFYLESQPFHYALVGKLFQDDLL # KRVKDECLGELSFTEKETDIYKVRTVAAVFNKLSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g975 ### # start gene g976 4 AUGUSTUS gene 4187574 4192075 0.13 + . g976 4 AUGUSTUS transcript 4187574 4192075 0.13 + . g976.t1 4 AUGUSTUS start_codon 4187574 4187576 . + 0 transcript_id "g976.t1"; gene_id "g976"; 4 AUGUSTUS CDS 4187574 4188173 0.21 + 0 transcript_id "g976.t1"; gene_id "g976"; 4 AUGUSTUS CDS 4188280 4188323 0.24 + 0 transcript_id "g976.t1"; gene_id "g976"; 4 AUGUSTUS CDS 4189438 4192075 0.4 + 1 transcript_id "g976.t1"; gene_id "g976"; 4 AUGUSTUS stop_codon 4192073 4192075 . + 0 transcript_id "g976.t1"; gene_id "g976"; # protein sequence = [MILLSFDQLTCSVFKTTSAPESLLLSTPLPPSPYSPTSSTPSHRIDLQSFTQTRIAPRSVSRLDHNSWNSNSDESNMV # NKSDTPGSPRSDTTQHMSDISDSIASMSLDEAIQQPFQHASSILPETNIDIDCCGCLVHWEPGSVWTNYSFAMHSARKDQLPWELVRTSDDGRTIFIR # AHGCRGKLLDEREMDSGCCHICRNLYDERLYMKSNCAPRLSSKFNNSQTSGFATLLRSWSGILVNDTWLSSQDFRTGLMATGLSKDEADNLLDPADKQ # NVPKAVRLIQDLVSLGNKPMPSHPDEEKRRIATNAVAEALSYFVIPFIDVAMDLEAQCISLATYAHITAAMFLKERLNFLTSALYADSHAIGNYLFSV # LTKPITPADIYVYIVKNIFFTIAKLSLDDPDILYYIILDGTDRLERIFSNVRTQDHNRNFDTLQLAQKLSIAAEIVATLLRNTDLDSGHRRLNLHGAI # GVDHINPKSCMGNYRVGDVDIARAWRAGAHAANNILVRIFGPTGCIDFDSIFAPHDLDFLRPTRNGYVGSSFEDNEGSRLDCSVEEDVDSGYAAVIPH # GISDEEDEELPLGAQNLEDQLDLHNAMQEEEEVEGSKSFANHFLDIPDTTDPSKTRKYLKSSLVRVLCGGNHDRRKVAMRTLRAQGVTMDDLRRKVLN # EWDDDTVADSVDKMKAGDPAAVLVVIGKGDGASVSLAVVSVVGFSIPNVRGLASEAPMDWLETKGDRCPSAIVQILDLIPSDSTANRSWDWNGEYIRI # APETADQSITVSKQYQFTVPGYLMHPLAVQAIKAPASCALSATWRIAHSELLDSRDFAWSMLSPENEDFISNFDTLPSFPASAITLTHLPYRDSNGVY # PFIIEEIPANVLVSKKEGNDEVPCKLCSKKMKLTEMRTHVGAHILHMARYSDDEDVDEIIPNPCDWCGWCGHNDAGCWSKLVLDPKGKKQPKIESNCE # YHYSKMQYNRAAAWSPTSPCTNVPIHCPICSESLSGERRTFWKYNAVYHLLSEHSENDNGRVSLHAVPLEFILATFTSRREEEALGIPEDATMDFRDA # YGIPMSDDLQLQIDELSRKRGLSNADTTEHITKRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g976 ### # start gene g977 4 AUGUSTUS gene 4199833 4200543 0.59 + . g977 4 AUGUSTUS transcript 4199833 4200543 0.59 + . g977.t1 4 AUGUSTUS start_codon 4199833 4199835 . + 0 transcript_id "g977.t1"; gene_id "g977"; 4 AUGUSTUS CDS 4199833 4200543 0.59 + 0 transcript_id "g977.t1"; gene_id "g977"; 4 AUGUSTUS stop_codon 4200541 4200543 . + 0 transcript_id "g977.t1"; gene_id "g977"; # protein sequence = [MVTLYRGTPIPLIYGHEAIDSAQQVLTIFLSQNDTALLAAAPDHVFCLVTFSATWIIISNFSMHQLNGVNLGWANDKL # ISLVAEKLSHVASSPEHFPALCAHFIMRLVHAWETRNTRKPAASPAREEKDNDEYPVRMMPQMSAERTTVEDTSSEQSSFSAPNGVQDDLQYQPQQQQ # QIQPQMQFPSPDDPNQSMLSGLGAGHEWLEASDMLMDATFWTTFMENLNSQAPGFESIPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g977 ### # start gene g978 4 AUGUSTUS gene 4200906 4202452 0.14 - . g978 4 AUGUSTUS transcript 4200906 4202452 0.14 - . g978.t1 4 AUGUSTUS stop_codon 4200906 4200908 . - 0 transcript_id "g978.t1"; gene_id "g978"; 4 AUGUSTUS CDS 4200906 4201407 0.74 - 1 transcript_id "g978.t1"; gene_id "g978"; 4 AUGUSTUS CDS 4202016 4202452 0.17 - 0 transcript_id "g978.t1"; gene_id "g978"; 4 AUGUSTUS start_codon 4202450 4202452 . - 0 transcript_id "g978.t1"; gene_id "g978"; # protein sequence = [MSSSSSSSSSGSASPEPSLKRRREGKSADGVEATQSSSSDSDSSDEDDAPALSHAEKRRQKKKEKLAARKDKGLEPPP # SKKRKIDNQKEATDSTSQRQNSVWVGNLSFKTTTDALRKFFDGVGEITRINLPMKVATRPNMPGENRGFAFVDFSSTDNATSALINPKNHHLNGRNLV # VEYASADAVKRGPNKPRAVAGEGGPGDFKRKFGPGVNGSQNKPFRRNERGVGTGDEKSSNRRKDKPDYRHNAEDSQTVDHEESSTPQFGRRPYRKDQE # GVPRHKGPRNRPKPGAALAQAKRQSAAIVPTSGKKIVF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g978 ### # start gene g979 4 AUGUSTUS gene 4204176 4204819 0.4 + . g979 4 AUGUSTUS transcript 4204176 4204819 0.4 + . g979.t1 4 AUGUSTUS start_codon 4204176 4204178 . + 0 transcript_id "g979.t1"; gene_id "g979"; 4 AUGUSTUS CDS 4204176 4204234 0.4 + 0 transcript_id "g979.t1"; gene_id "g979"; 4 AUGUSTUS CDS 4204348 4204819 0.83 + 1 transcript_id "g979.t1"; gene_id "g979"; 4 AUGUSTUS stop_codon 4204817 4204819 . + 0 transcript_id "g979.t1"; gene_id "g979"; # protein sequence = [MCLRQPDLRAFYCLRRIRIPTHGPLIHSRATEKVTRHIEDAVSKGAQVLVGGKVVENTNFFQPTVLSDVPSDALINDE # ETFGPLAALVKFDTEDEVIKLANATEVGLAGYFFSRDIGRAWRVAEKLEVGMVAVNTGLISQAVIPFGGVKESGLGREGGPHGIDEYMNEKLIVFGGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g979 ### # start gene g980 4 AUGUSTUS gene 4212090 4213019 0.34 - . g980 4 AUGUSTUS transcript 4212090 4213019 0.34 - . g980.t1 4 AUGUSTUS stop_codon 4212090 4212092 . - 0 transcript_id "g980.t1"; gene_id "g980"; 4 AUGUSTUS CDS 4212090 4212543 0.39 - 1 transcript_id "g980.t1"; gene_id "g980"; 4 AUGUSTUS CDS 4212652 4213019 0.38 - 0 transcript_id "g980.t1"; gene_id "g980"; 4 AUGUSTUS start_codon 4213017 4213019 . - 0 transcript_id "g980.t1"; gene_id "g980"; # protein sequence = [MDRSLFEVARTKPKGDEHGEWHDRSLDVLSGYSGTPTSKDAPGSSNASLPTDLFPNKPHLLWDFLRTPQGSLDWSAPL # QAIQELMKQSADSSESRRYPPPPSVLNDSLDSILSLNQIQHLTSLPILDLVYCTIASRHFDEATRSVVAPRLQSLTAEIVAKMIFQSRRSETLESIQS # LFILSLWAPVCGADEDFRDGRLLVASAVSMAHDMRLNDACQIAARLRERKAKGEDVSDHEMFDAINKTRLVSISNSCIIAKIKFQSQWIALTNVESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g980 ### # start gene g981 4 AUGUSTUS gene 4218198 4218488 0.91 - . g981 4 AUGUSTUS transcript 4218198 4218488 0.91 - . g981.t1 4 AUGUSTUS stop_codon 4218198 4218200 . - 0 transcript_id "g981.t1"; gene_id "g981"; 4 AUGUSTUS CDS 4218198 4218488 0.91 - 0 transcript_id "g981.t1"; gene_id "g981"; 4 AUGUSTUS start_codon 4218486 4218488 . - 0 transcript_id "g981.t1"; gene_id "g981"; # protein sequence = [MAQRSSSLNKFILYENKLRFYIIASNSSDSRHRIIKIDRSVQDELVIVEDDAEYTGKEMSAMLKMLDDGNKNMGGLGK # AKVIFGVAGELTQNTSYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g981 ### # start gene g982 4 AUGUSTUS gene 4220986 4221300 0.57 + . g982 4 AUGUSTUS transcript 4220986 4221300 0.57 + . g982.t1 4 AUGUSTUS start_codon 4220986 4220988 . + 0 transcript_id "g982.t1"; gene_id "g982"; 4 AUGUSTUS CDS 4220986 4221300 0.57 + 0 transcript_id "g982.t1"; gene_id "g982"; 4 AUGUSTUS stop_codon 4221298 4221300 . + 0 transcript_id "g982.t1"; gene_id "g982"; # protein sequence = [MRRESATVLTVGEEKDVMERAAKAVAREINGASLDTSVDETSSSRASQPQSSPVLTAVATQRSRRGVLVGLLDKTLPG # ALDPTKKTLVWGAPDVDNIGRVSSRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g982 ### # start gene g983 4 AUGUSTUS gene 4221876 4223576 0.69 - . g983 4 AUGUSTUS transcript 4221876 4223576 0.69 - . g983.t1 4 AUGUSTUS stop_codon 4221876 4221878 . - 0 transcript_id "g983.t1"; gene_id "g983"; 4 AUGUSTUS CDS 4221876 4223576 0.69 - 0 transcript_id "g983.t1"; gene_id "g983"; 4 AUGUSTUS start_codon 4223574 4223576 . - 0 transcript_id "g983.t1"; gene_id "g983"; # protein sequence = [MLCILVDSTPALRAFEECNGVQAIVKILKRAGSPREVRYVTLLSEFESCIQLGFRMKCLEFLYFYLLDETKPSIPTTS # MSTGGSTLIDSVQTVPNTPSQQHGSDTRSHLGSRASNLSQSSLFPPTVPNTPRENTHSRQNSRSIIRGASNSSISSTTSSSSTSSVGSGSTAPRAQSK # KPYLNGLAAPIRPSPKPRSEYGSSTFSFPHSSYSGPSVRSEAASEKGYITESSPSSRSNSNHLNQAALGRQVVSDAEGKTLRSVSSGSTKSFTSTSST # TSAASTTSSATTAPGSAECSPKKPSGALPLLPTIPSGTVFKTPPGSPEMEFAAPPRLHSRTSRDTRTPSAPRTPAITSLSSKTPSGPPRTPAYKSSHH # GVLRSEGKQLFPSGASGGQARSLMMLAKDVDFVPQSPQKMQTFRRDNDPASAAPSPSVGVSVGTVTGMGGRRTRTHSRTRSAFALGATSTRISSRASS # RERGHSRARSVGRAEPELSQEQNQQVEMRDTDAATRATAGISLSQRNTTAEVSKEGLRMDIRARTTEEKKELLGTMLGNVDALVEGVRKAGIWGLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g983 ### # start gene g984 4 AUGUSTUS gene 4228530 4229582 0.46 - . g984 4 AUGUSTUS transcript 4228530 4229582 0.46 - . g984.t1 4 AUGUSTUS stop_codon 4228530 4228532 . - 0 transcript_id "g984.t1"; gene_id "g984"; 4 AUGUSTUS CDS 4228530 4229582 0.46 - 0 transcript_id "g984.t1"; gene_id "g984"; 4 AUGUSTUS start_codon 4229580 4229582 . - 0 transcript_id "g984.t1"; gene_id "g984"; # protein sequence = [MKTLGFKRLSSDAGIFIRRGKDGSLVIAIIYIDDALFAGPDKKLVDSLKGKFMSHWECRDLGEAKEFLRMRINRCGKK # IYIDQCAYLDKVLKRCGMENAKMADTPLPAGFQPEPTKGQSNSALCSKFQMVIGSLLYLMLGTRPDISFAVTKLAQHAANPSQEHLNKALYICRYLLG # TRSYALCYDGESGIGLSAWTDSDWASDPYTRRSQTGFFMKLANGIFSWTSHAQKTIAHSSTEAEYMALSDCSRQVVWIRNLLEELGYKLDAIPIAGDN # QGSIFMASNPVTSKHSKHIDIRYHYIREVVERGLVQVFFVDGSNNPADLFTKNLGCIKFELFRSMLGLEFYSSTNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g984 ### # start gene g985 4 AUGUSTUS gene 4230395 4231552 0.94 + . g985 4 AUGUSTUS transcript 4230395 4231552 0.94 + . g985.t1 4 AUGUSTUS start_codon 4230395 4230397 . + 0 transcript_id "g985.t1"; gene_id "g985"; 4 AUGUSTUS CDS 4230395 4231552 0.94 + 0 transcript_id "g985.t1"; gene_id "g985"; 4 AUGUSTUS stop_codon 4231550 4231552 . + 0 transcript_id "g985.t1"; gene_id "g985"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPATPSPANQDFSTQIGQIRELLDRAN # AMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g985 ### # start gene g986 4 AUGUSTUS gene 4231603 4235310 0.94 + . g986 4 AUGUSTUS transcript 4231603 4235310 0.94 + . g986.t1 4 AUGUSTUS start_codon 4231603 4231605 . + 0 transcript_id "g986.t1"; gene_id "g986"; 4 AUGUSTUS CDS 4231603 4235310 0.94 + 0 transcript_id "g986.t1"; gene_id "g986"; 4 AUGUSTUS stop_codon 4235308 4235310 . + 0 transcript_id "g986.t1"; gene_id "g986"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEVITATEESPIHRIRANHKMRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLMRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQV # LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ # RHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLA # RLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE # ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNP # INGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g986 ### # start gene g987 4 AUGUSTUS gene 4236563 4238254 0.96 + . g987 4 AUGUSTUS transcript 4236563 4238254 0.96 + . g987.t1 4 AUGUSTUS start_codon 4236563 4236565 . + 0 transcript_id "g987.t1"; gene_id "g987"; 4 AUGUSTUS CDS 4236563 4238254 0.96 + 0 transcript_id "g987.t1"; gene_id "g987"; 4 AUGUSTUS stop_codon 4238252 4238254 . + 0 transcript_id "g987.t1"; gene_id "g987"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDELDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g987 ### # start gene g988 4 AUGUSTUS gene 4238587 4242150 0.96 + . g988 4 AUGUSTUS transcript 4238587 4242150 0.96 + . g988.t1 4 AUGUSTUS start_codon 4238587 4238589 . + 0 transcript_id "g988.t1"; gene_id "g988"; 4 AUGUSTUS CDS 4238587 4242150 0.96 + 0 transcript_id "g988.t1"; gene_id "g988"; 4 AUGUSTUS stop_codon 4242148 4242150 . + 0 transcript_id "g988.t1"; gene_id "g988"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAVNTVDAKVAV # PLPEPSPSVSPTILETPPGDSLRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPMKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g988 ### # start gene g989 4 AUGUSTUS gene 4244447 4250505 0.15 - . g989 4 AUGUSTUS transcript 4244447 4250505 0.15 - . g989.t1 4 AUGUSTUS stop_codon 4244447 4244449 . - 0 transcript_id "g989.t1"; gene_id "g989"; 4 AUGUSTUS CDS 4244447 4247606 0.29 - 1 transcript_id "g989.t1"; gene_id "g989"; 4 AUGUSTUS CDS 4247699 4248191 0.23 - 2 transcript_id "g989.t1"; gene_id "g989"; 4 AUGUSTUS CDS 4249203 4250505 0.64 - 0 transcript_id "g989.t1"; gene_id "g989"; 4 AUGUSTUS start_codon 4250503 4250505 . - 0 transcript_id "g989.t1"; gene_id "g989"; # protein sequence = [MVAKHELGEYPCTAEYRDAIQAIEVAHLIGTDEWAQSCAAANMKPVQHPFWEDLPYTDIFCSITPDLLHQLYQGVMKH # LIKWITAIVGAGEVDARVRRLPAKHGMRHFHKGITTLSRVSGTEHKQMCMFLLSLVIDVPRLAPAKSRRLITATRSLLDFLYMSSFPIHSDESLTSVD # AALALFHENKDIFIELGAREHFNIPKIHFLCHYVRAFKLFGTLDNYNTETTERLHIDFAKDAYRASNRKDEYSQMTKWLERREKVNHHASYIAWQQSQ # PQLDIPSPTTISGVRYDFPGSQKTLHDMQCPLTQHFAKFPTVKTVSISKLEERSLLGYGATQFEYALKRFISQFRNPEFTPAEVNEMASFLSLPFRGV # PVWHRMKFRNEDLYGKKTLDVVSAHPRRLNAQGQVRQTSQFDAALIRVQKDDDNGKFLQGTCSWKEIDTKAIGNIRLRISPSIRILAKEYSDTAKKLW # NYLAKTYNVKSLGAVFNDFAAAMAIKIPYKQNPLSSMMEIGMYFTRMDEAGIGLADHLEALILLSKLPSRYSVVIQTMSQLETAELKKLTFAKVRIAV # MNAFSGDTIGNSQPQNANKFSNVHCKGNDPNGKNKKAKKNANAAQADADSMDFSPIGSTVDFGPVRTDLTPSVQDVRKHSIHPPYNPPPNATSLHLHK # KTRMAIKRARDIGVHATAEVIRTLEPAGHISELDSDDELDPPTKRTRAMSPVEDVENGSKAPTPPPPSPPMDFEVPGTASFDPDELMNFDLDREILAI # TGFMDTMGSVPSSDLDHMGYTNAPSSVAVAKTCKSAFEPDLLSRLYNYRIDAKYISNEHFCVHDVSYSVCKKCKGKQRNQPKWWMNDSGCSEHTTFDL # SDFIEYEDLEEKVLIATATTTAYITGVGTVLINFKDVRGRMHSARIAPVFYMKELSHRLIAQGRFLQDGKTVRGNADKVDFWDKDGLFLSFEPRTHSD # TIYILKDYSPQPMAVNLVIHSVDYTTMHRRMGHPSREALTQLRKHAEGVPTFSIPHEEDLCEGCAKGKMTLRPFPPTNRRASRPFEIIHSDLKEWPTI # SYHKYKYTIFFIDDYTSHGFYCHLKKKSGALPVIKQFIATVKNLYETNVKEWMSDGGGEFRSNALDEFFKNEGIKAQWSSPHIHQQNGRAERFIRTII # EKSEPQHFQACIPDSWWEFSVAHAVHVYNRTPMRRHKWKTPYEILYNKVPRIDHLRVFGCGTYVYLHEEIRTNKQSPRSELMTYLGVSDGGHGNIYMR # SNNAMFTATHAVFDEKLFPRCKSSEHHRSTRLPDRNPDPKDPIPPPGDDDVPIFHQPTTPQMRQDPEQDVAPPVPAEQPARDPSPPPQPRNEQPPAQE # QLRRSGRVRRPPTRLTGDPRSSTKLPTEQQVERPKRDIQRRAPQPGSSSAEQERPEPEQVPGPSTEHPTPENGEQPSVTPGDEANTLIRLCREGGAEL # IYFLMAKAVPFEGELKSSENVREWTYKDITRLPKAEREEWLKACQEELEALKRRGTFELMDRPADRKVIKNRWVFDVKSDGRKKARLVVKGFSQIEGL # DYDQVFSPVVRFETVRLLLALTALNNWYLTGLDVRNAYLYGILHETIYMEQPEGFRIKGKVLRSCTPCNRAKATRCLSAEDEWDSSEVINNTAVTPLV # PGERE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g989 ### # start gene g990 4 AUGUSTUS gene 4251294 4252106 0.7 - . g990 4 AUGUSTUS transcript 4251294 4252106 0.7 - . g990.t1 4 AUGUSTUS stop_codon 4251294 4251296 . - 0 transcript_id "g990.t1"; gene_id "g990"; 4 AUGUSTUS CDS 4251294 4252106 0.7 - 0 transcript_id "g990.t1"; gene_id "g990"; 4 AUGUSTUS start_codon 4252104 4252106 . - 0 transcript_id "g990.t1"; gene_id "g990"; # protein sequence = [MSTGAELDPSTYKCSGCSHQFSRASYFIQHLEKTSKPQCMAAHEDLKKTIHRSRFMPQKTPPMYRSPELSKISPSAPS # VPPLDTEHDLYVTTPQSVSDFYGHDYSDEDFPGFNEDYNGMGGDIDNDSEDEEQLPPELEDVWELPRVPASSAEHNVDVDAIPTLSTERSFLRDLPSH # CDGIHVESFGGQAGAPVKGRNSRNPVLYSSRDGFLQYRSHIPHKGENPWSPFASQMDWEVAKWAKTRGTGSTAFSDLLAVDGVCSLLSSPLRYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g990 ### # start gene g991 4 AUGUSTUS gene 4252289 4253011 0.29 + . g991 4 AUGUSTUS transcript 4252289 4253011 0.29 + . g991.t1 4 AUGUSTUS start_codon 4252289 4252291 . + 0 transcript_id "g991.t1"; gene_id "g991"; 4 AUGUSTUS CDS 4252289 4252373 0.66 + 0 transcript_id "g991.t1"; gene_id "g991"; 4 AUGUSTUS CDS 4252785 4253011 0.3 + 2 transcript_id "g991.t1"; gene_id "g991"; 4 AUGUSTUS stop_codon 4253009 4253011 . + 0 transcript_id "g991.t1"; gene_id "g991"; # protein sequence = [MSSRKGRVSQADLPQNYAPANSDPTRTPEAPPRKKAKIAPVTLHHGSQYQQEDDDESESSSGNDSNDPALGSDASMDN # PQDDLGAGQHLAEEVIIHGALDSHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g991 ### # start gene g992 4 AUGUSTUS gene 4254593 4254778 0.65 + . g992 4 AUGUSTUS transcript 4254593 4254778 0.65 + . g992.t1 4 AUGUSTUS start_codon 4254593 4254595 . + 0 transcript_id "g992.t1"; gene_id "g992"; 4 AUGUSTUS CDS 4254593 4254778 0.65 + 0 transcript_id "g992.t1"; gene_id "g992"; 4 AUGUSTUS stop_codon 4254776 4254778 . + 0 transcript_id "g992.t1"; gene_id "g992"; # protein sequence = [MTNQQVYDNIDWSAIEQDDDDYNGNGNHDGNPPAQASNKVNKQPVTAADATNEGSRIDSTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g992 ### # start gene g993 4 AUGUSTUS gene 4261233 4261842 0.36 + . g993 4 AUGUSTUS transcript 4261233 4261842 0.36 + . g993.t1 4 AUGUSTUS start_codon 4261233 4261235 . + 0 transcript_id "g993.t1"; gene_id "g993"; 4 AUGUSTUS CDS 4261233 4261310 0.36 + 0 transcript_id "g993.t1"; gene_id "g993"; 4 AUGUSTUS CDS 4261390 4261842 0.94 + 0 transcript_id "g993.t1"; gene_id "g993"; 4 AUGUSTUS stop_codon 4261840 4261842 . + 0 transcript_id "g993.t1"; gene_id "g993"; # protein sequence = [MFVFGEVQDPLSETVNLVEDIVRSQLARGLAIRRGARYLSAEDLIFLIRHDRGKVNRLRTYLSWKDVRKHAKDSDNAA # GGGGVEEAIEDGADGASSFLSAFRHSQHYSHIHCTDKLAAKAQKITIKLPWEITTLYSEVLRQSGREDEDEEDEDDIEAHEASIQRLKVRVYICSSQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g993 ### # start gene g994 4 AUGUSTUS gene 4262946 4264034 0.98 + . g994 4 AUGUSTUS transcript 4262946 4264034 0.98 + . g994.t1 4 AUGUSTUS start_codon 4262946 4262948 . + 0 transcript_id "g994.t1"; gene_id "g994"; 4 AUGUSTUS CDS 4262946 4264034 0.98 + 0 transcript_id "g994.t1"; gene_id "g994"; 4 AUGUSTUS stop_codon 4264032 4264034 . + 0 transcript_id "g994.t1"; gene_id "g994"; # protein sequence = [MNSTGKGLAAHLEVPLPYLLYRVHARYQEDLRGLQDISGVSSPISPNAPSGTPFGPSVNQVARNIAGRTPGRLNTRLS # PSLSRGSGTTPLGIRARLNSLGHRDNSSVSSLRPKKATASSSTLTLQSPLARNPTHLQSGSERRPSPPSSGEDEMDSDDDEMLKEEEAERVAEEQEAL # DKKLAELQKMITGDSLGLVSVGRKQVRRIGQQGGEYSRGRDDPNIPSETHHNYHKQRYNASLSSRSASTSQSVSSANSPQGSLPEIPSPIPDSLPQSP # QPRSPPLRRHMSPTKSLSPPALSPRSALGQSHRGLGHASGRLNEHDKDGSEASTGSFSDISGRLSSSSIPYILLNNLHRHQPICECFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g994 ### # start gene g995 4 AUGUSTUS gene 4264727 4265557 0.96 + . g995 4 AUGUSTUS transcript 4264727 4265557 0.96 + . g995.t1 4 AUGUSTUS start_codon 4264727 4264729 . + 0 transcript_id "g995.t1"; gene_id "g995"; 4 AUGUSTUS CDS 4264727 4265557 0.96 + 0 transcript_id "g995.t1"; gene_id "g995"; 4 AUGUSTUS stop_codon 4265555 4265557 . + 0 transcript_id "g995.t1"; gene_id "g995"; # protein sequence = [MKLRAFKRIAKFIRPHRAKQSQYDSPTTYTTAPARGPKTQTNRPNDGPDESPFGTYALNGQDNTVSTIAPRPASPRVF # DYGFPHLDSALQHDHPVPYPTEDLLALQQHSHVHVGGHVIFPVGPIDYLLRIEEATPGPGCNCLIPAGEMQIASPNLNIVLGPGRRVVLLIGSPTGEG # KEYVAEVIKHYILTTQQLEAGMRVRRNIAEAINIPNTQLSVGGNVGIHINIGEDQQVPQRPLGESSRPVTATPVQDNGKGKRREAAIIVSGSSIQNSF # AC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g995 ### # start gene g996 4 AUGUSTUS gene 4266201 4267112 0.98 + . g996 4 AUGUSTUS transcript 4266201 4267112 0.98 + . g996.t1 4 AUGUSTUS start_codon 4266201 4266203 . + 0 transcript_id "g996.t1"; gene_id "g996"; 4 AUGUSTUS CDS 4266201 4267112 0.98 + 0 transcript_id "g996.t1"; gene_id "g996"; 4 AUGUSTUS stop_codon 4267110 4267112 . + 0 transcript_id "g996.t1"; gene_id "g996"; # protein sequence = [MLAHRALQDSPSEIRPALTALDARNDPDMRPFDRASNWLRELPVNPKSFDDVFATHAAHDPTGEADRVPEQWRHPVTH # RVEIPVLHDYPVQARDAEHEGRSAYFTAITSLEEGRQHHPHEFTSAVPQPFTPEGRHYPSGEPKSTFAVKAVPREYANTDQAQSPARYLTPSQPLMNR # IGRPLDDGESAYATAISHELFDEQGRLLNHLPAPVQKPQASQERLTALQAMEPFQLQEDREDREQFTPTPRAHFRPEPGQPSYAVEQSLISQAPSQGN # QNHLLRKPSFNLERIALGAPSRIDNASDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g996 ### # start gene g997 4 AUGUSTUS gene 4267194 4267955 0.75 + . g997 4 AUGUSTUS transcript 4267194 4267955 0.75 + . g997.t1 4 AUGUSTUS start_codon 4267194 4267196 . + 0 transcript_id "g997.t1"; gene_id "g997"; 4 AUGUSTUS CDS 4267194 4267955 0.75 + 0 transcript_id "g997.t1"; gene_id "g997"; 4 AUGUSTUS stop_codon 4267953 4267955 . + 0 transcript_id "g997.t1"; gene_id "g997"; # protein sequence = [MVKRSFRSVEFGCSLAPESQGRSHPYQRPPLKFEVSRMQGRHPFNYSGPFQEIPLPSVSPNSQIFPMFAPDPLDSTDV # PHSVDHTNSSRPMNPLAASPELPVTNASSPGFPTLPSPFGHRGDLDVIVPSLSPLYGAHKSTPRPKDFNISFDGTAFDRKPNVVRTIPGAVHLDDLLD # VNDNQGESSGQSASSSFPPTYPYYYFSPKRRVNSPEEMSSSDIMLAQYGEQGNPEGFELSKPEFIEGSSKDSRYFVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g997 ### # start gene g998 4 AUGUSTUS gene 4270155 4270592 1 - . g998 4 AUGUSTUS transcript 4270155 4270592 1 - . g998.t1 4 AUGUSTUS stop_codon 4270155 4270157 . - 0 transcript_id "g998.t1"; gene_id "g998"; 4 AUGUSTUS CDS 4270155 4270592 1 - 0 transcript_id "g998.t1"; gene_id "g998"; 4 AUGUSTUS start_codon 4270590 4270592 . - 0 transcript_id "g998.t1"; gene_id "g998"; # protein sequence = [MSPQPSSTTSRNSGVRSVALPPSPSSEFHNNSTNDVPEKSSEITNDKDVPVVTDYKPVELSEDDGIAERMDHYGKAGG # DVHSVPAVISPQNDLEPPDGGLQAWLVVFGVRAVQMIQVLTLTVDVLGHVQHVYNVSAFFLASSLSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g998 ### # start gene g999 4 AUGUSTUS gene 4272056 4272433 0.68 + . g999 4 AUGUSTUS transcript 4272056 4272433 0.68 + . g999.t1 4 AUGUSTUS start_codon 4272056 4272058 . + 0 transcript_id "g999.t1"; gene_id "g999"; 4 AUGUSTUS CDS 4272056 4272433 0.68 + 0 transcript_id "g999.t1"; gene_id "g999"; 4 AUGUSTUS stop_codon 4272431 4272433 . + 0 transcript_id "g999.t1"; gene_id "g999"; # protein sequence = [MLSLRRKAMIAPSGQSVDHDSETMRLQLLGSPDLMSQLEQHQPEIASAARNNPARFAELLRQTRTTQQQTADLEAQQE # LSLMNADPFDVEAQRKIEERIRQQAVLDNMAHAIEWSPESFGRVTML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g999 ### # start gene g1000 4 AUGUSTUS gene 4272818 4273456 0.55 + . g1000 4 AUGUSTUS transcript 4272818 4273456 0.55 + . g1000.t1 4 AUGUSTUS start_codon 4272818 4272820 . + 0 transcript_id "g1000.t1"; gene_id "g1000"; 4 AUGUSTUS CDS 4272818 4273456 0.55 + 0 transcript_id "g1000.t1"; gene_id "g1000"; 4 AUGUSTUS stop_codon 4273454 4273456 . + 0 transcript_id "g1000.t1"; gene_id "g1000"; # protein sequence = [MEVRSPALLIPPHSLYLQGRDVDLLLGLDMLKSYQASIDLEKNVLRIQGREIPFLAEHQLPAKARGLEEEEEALNSAL # NASRTAGIQSFQSTVVTVALSYVLPGPSTGSQHFPGGGATLGGTPGPRLATAGAATPGASNIRAAPRSPATPSAHGPASRSSASSLSHPASGARQTHP # EANIAVLMDLGATREIAISMLDATGGNVDAAASLMF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1000 ### # start gene g1001 4 AUGUSTUS gene 4275938 4276516 0.27 - . g1001 4 AUGUSTUS transcript 4275938 4276516 0.27 - . g1001.t1 4 AUGUSTUS stop_codon 4275938 4275940 . - 0 transcript_id "g1001.t1"; gene_id "g1001"; 4 AUGUSTUS CDS 4275938 4276516 0.27 - 0 transcript_id "g1001.t1"; gene_id "g1001"; 4 AUGUSTUS start_codon 4276514 4276516 . - 0 transcript_id "g1001.t1"; gene_id "g1001"; # protein sequence = [MCSWEYPNKQGIGCNVINTNDAGNFLEFLQELRQDPIGMKLSLSAATGIATFSGPSGDPLTDVSGFAEVLDFIAIMNY # DVWGSWSAAVGPNSPLADSCAASENQQGSAATAVKNWNGAGMPLDKIVLGVASYGHSFVVSHDDAYMNGSTTELAPYPPFDKSAFPHGDSWDDDGGPD # ACGHHEPSGGEFGGYF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1001 ### # start gene g1002 4 AUGUSTUS gene 4278156 4278896 0.86 - . g1002 4 AUGUSTUS transcript 4278156 4278896 0.86 - . g1002.t1 4 AUGUSTUS stop_codon 4278156 4278158 . - 0 transcript_id "g1002.t1"; gene_id "g1002"; 4 AUGUSTUS CDS 4278156 4278896 0.86 - 0 transcript_id "g1002.t1"; gene_id "g1002"; 4 AUGUSTUS start_codon 4278894 4278896 . - 0 transcript_id "g1002.t1"; gene_id "g1002"; # protein sequence = [MTSALSPPTRARRIASNPALPQAQTSASGISRESSPSKKHRVHYHTEHPNTSESTYGTFPGPISESPSGSIHRVPSNA # SFQSQHQVLAPSQQPGEQDMMKDVSTELIPFAGIFGGLKRLFSRKKAYSELSTLESGGKNPWGYDASQRKWSGPLQPRIGKEKHTVSAATRGENLPLE # ILRCMSEWCSVLEERNTVPGKQFPFYRQYAKLIILLLSAGTSLGSIIGTVSSLEATLSGKFVPELSRQLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1002 ### # start gene g1003 4 AUGUSTUS gene 4284171 4285384 0.53 + . g1003 4 AUGUSTUS transcript 4284171 4285384 0.53 + . g1003.t1 4 AUGUSTUS start_codon 4284171 4284173 . + 0 transcript_id "g1003.t1"; gene_id "g1003"; 4 AUGUSTUS CDS 4284171 4284233 0.55 + 0 transcript_id "g1003.t1"; gene_id "g1003"; 4 AUGUSTUS CDS 4284395 4285384 0.53 + 0 transcript_id "g1003.t1"; gene_id "g1003"; 4 AUGUSTUS stop_codon 4285382 4285384 . + 0 transcript_id "g1003.t1"; gene_id "g1003"; # protein sequence = [MGNRFCIIGDAWFSSQHLLSLLNFILQEFYTPLVPRSITFFQQSVSEIARSFSDSGYKASSSHRRTDSSITSRDAHRL # SSTSAMTVTYGTQLSIFVIFDKKSGWIRLADSAVGEVDLHDDSQFGPTPRESSSPTSHRKSRIIMDTSSFGKWIPPALCELPMSAPGAPLQTTKVILL # TRGRRTHILPSPLPSNSSLHIPLRIVSWRNNPTDVVPRIFEGSEPDMDGYSTPAYLQLISLGELGVEVQEFSLPSLLTKGKGKARADDILYAEQDTGG # DAGFLCTGGHWDRQRTFASNLNRSYSTLSTNSSFSTDSTQLELEKGLYCWCRKGLEDFRVFWLGGSLTADYEDEEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1003 ### # start gene g1004 4 AUGUSTUS gene 4285687 4286910 0.84 - . g1004 4 AUGUSTUS transcript 4285687 4286910 0.84 - . g1004.t1 4 AUGUSTUS stop_codon 4285687 4285689 . - 0 transcript_id "g1004.t1"; gene_id "g1004"; 4 AUGUSTUS CDS 4285687 4286910 0.84 - 0 transcript_id "g1004.t1"; gene_id "g1004"; 4 AUGUSTUS start_codon 4286908 4286910 . - 0 transcript_id "g1004.t1"; gene_id "g1004"; # protein sequence = [MLAVKILEAIVRIVGGVAFDRSRHVVDSGLFGACGLLGCCGGPRKSSRRDKRSGKSSDRIGYSQAESAPRSPQSDLSF # PPTIAVGTGKGSIHSSGPPPSVLKPEHALRPYREESDDETGYIMGAWQPFQNRASGYIPVADSGSTSAVPPAAIKSSGFSRVAGGRAHIDSPYAISQE # QATGSTHTFPSIGHRNAANQNATGSVGELSLSRPKLDESPPPSVSSTVALGQRQLHEGSSGLPPGAMLPFHSRKKSQTAIIENVDAVPVAYRPAGSSA # SNSAGTSRPPSRSNRFESIGTSPAPPTAYRRRSATVESDDDSSYGRSKKKWYHLRRSRAHSTEGYPAPAAAENVNSSLAPPSSSTPGKSFVVIRKQQT # SPARSLQVASGSGSTPATPTPNSVSFAKDVGGGGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1004 ### # start gene g1005 4 AUGUSTUS gene 4289385 4290470 1 - . g1005 4 AUGUSTUS transcript 4289385 4290470 1 - . g1005.t1 4 AUGUSTUS stop_codon 4289385 4289387 . - 0 transcript_id "g1005.t1"; gene_id "g1005"; 4 AUGUSTUS CDS 4289385 4290470 1 - 0 transcript_id "g1005.t1"; gene_id "g1005"; 4 AUGUSTUS start_codon 4290468 4290470 . - 0 transcript_id "g1005.t1"; gene_id "g1005"; # protein sequence = [MAPSTRARSANNTPVKGQDTFVSELDTLATPTRKIPHCSKCKRPRAGHPRSGCPFVTPTDENGSDRSSTNLTDALGSM # TLDGQETPPPKTPARRTGRRSLGPAPPSVPVEFEDTKQVIRERRRSEKATTLAHSQTLQSLSDSDLEALLLPADTDVSDDGKGGEAGEEDQNIVHWKD # RIGMLSAGGGIPTRAIMPGTLVTPSPWSSFASIPEENKDGILRTSSPSNASSSSTETISVEVVSPSSTTAPRPLARTMSMEERAGFIAHLEELSSAKA # YVLSRADLTELRGRAPKGLYTRFLMDEEAGRNVLVVGRDEVDTERLYQTLDAEKQQAMYATRGVSMKSAAGGAVVGAVATFTGLAFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1005 ### # start gene g1006 4 AUGUSTUS gene 4294703 4294931 0.82 - . g1006 4 AUGUSTUS transcript 4294703 4294931 0.82 - . g1006.t1 4 AUGUSTUS stop_codon 4294703 4294705 . - 0 transcript_id "g1006.t1"; gene_id "g1006"; 4 AUGUSTUS CDS 4294703 4294807 0.82 - 0 transcript_id "g1006.t1"; gene_id "g1006"; 4 AUGUSTUS CDS 4294929 4294931 0.82 - 0 transcript_id "g1006.t1"; gene_id "g1006"; 4 AUGUSTUS start_codon 4294929 4294931 . - 0 transcript_id "g1006.t1"; gene_id "g1006"; # protein sequence = [MYASKLKRSEGHKDLRHVSIRLCKDSEDLDAESFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1006 ### # start gene g1007 4 AUGUSTUS gene 4303474 4304607 0.41 + . g1007 4 AUGUSTUS transcript 4303474 4304607 0.41 + . g1007.t1 4 AUGUSTUS start_codon 4303474 4303476 . + 0 transcript_id "g1007.t1"; gene_id "g1007"; 4 AUGUSTUS CDS 4303474 4304607 0.41 + 0 transcript_id "g1007.t1"; gene_id "g1007"; 4 AUGUSTUS stop_codon 4304605 4304607 . + 0 transcript_id "g1007.t1"; gene_id "g1007"; # protein sequence = [MLIIFILFSPYTCVILASIYNSANNSAFNSPAGMLGHQQLPSLSPQPPHLGLGLNSGYNSNSNDFTPSNSPSPPLSSA # GIRLPNAPLSDIAEYRSNSGNMNGEYNSGEYIEYNEYDRNSNEPELGYSESYDSPYLNNYNRLPTSVSPSPHPRTPHSLPLPLSSTNSPYLGSSHLGS # PHLGSPHLGSPGNMVPSPLAEAQLLQSQASAGSSNGSTSTLIDISSSPETLVNPDSAGTKISPMLMPPSLSREFTAPVGSGQRNKSHTISTSTPYEAY # LNASREARGQERMMYGTPRERSGSVSSAYSTHSASSASSAHSSRASSILLSARSVHASLPEIEGEDTVLVSVSGSMDELHMGLGGLHEMHETLDPSVL # HGERV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1007 ### # start gene g1008 4 AUGUSTUS gene 4310857 4311096 0.21 + . g1008 4 AUGUSTUS transcript 4310857 4311096 0.21 + . g1008.t1 4 AUGUSTUS start_codon 4310857 4310859 . + 0 transcript_id "g1008.t1"; gene_id "g1008"; 4 AUGUSTUS CDS 4310857 4311096 0.21 + 0 transcript_id "g1008.t1"; gene_id "g1008"; 4 AUGUSTUS stop_codon 4311094 4311096 . + 0 transcript_id "g1008.t1"; gene_id "g1008"; # protein sequence = [MGLVPGVSLAQWIGTRLTARGLSYASRAWFKTSGVQASSTENDAEIRELENGYGPSSSPAADYAKSTQKAFADSVVRN # E] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1008 ### # start gene g1009 4 AUGUSTUS gene 4312368 4312718 0.69 + . g1009 4 AUGUSTUS transcript 4312368 4312718 0.69 + . g1009.t1 4 AUGUSTUS start_codon 4312368 4312370 . + 0 transcript_id "g1009.t1"; gene_id "g1009"; 4 AUGUSTUS CDS 4312368 4312718 0.69 + 0 transcript_id "g1009.t1"; gene_id "g1009"; 4 AUGUSTUS stop_codon 4312716 4312718 . + 0 transcript_id "g1009.t1"; gene_id "g1009"; # protein sequence = [MSLASRLLRVAARTNRGSTGLTSPRRLLVPIHTQRNAGYATETPADAVKKEEFKVASEIPPPSGIADQINDGKTDWSK # SYHGLSEQAFAKEVAEVLMAPVEPLDVEIKPGTRNFFC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1009 ### # start gene g1010 4 AUGUSTUS gene 4321169 4322209 0.4 - . g1010 4 AUGUSTUS transcript 4321169 4322209 0.4 - . g1010.t1 4 AUGUSTUS stop_codon 4321169 4321171 . - 0 transcript_id "g1010.t1"; gene_id "g1010"; 4 AUGUSTUS CDS 4321169 4321623 1 - 2 transcript_id "g1010.t1"; gene_id "g1010"; 4 AUGUSTUS CDS 4321670 4321968 0.52 - 1 transcript_id "g1010.t1"; gene_id "g1010"; 4 AUGUSTUS CDS 4322064 4322209 0.51 - 0 transcript_id "g1010.t1"; gene_id "g1010"; 4 AUGUSTUS start_codon 4322207 4322209 . - 0 transcript_id "g1010.t1"; gene_id "g1010"; # protein sequence = [MKSVFQFLRERHLRTCISSVVKEINKINDAELKLGLSGASWHDDYKDSAAILRLIYRYGEIMDINMPRDKDTGKAKGF # AFIMYEDQRSTVLAVDNLNGAKVLERTLRVDHVKNYKQPRTKGEDGEWIEAEEQSLNAKPEIIIGSFVMLDDDPGSESSEDSGPEIDPEDPMRDYLLE # KRREAKALKKAKKSKSKGKHKDETPEERRARKERKKEKRKKKSEKSAGVLGVEKLLESFGAAGAETLMEEEPWKGSGLLGGRIAHIVAHPRGDSVMIG # IPPNHIAGLLQLTDMIKGTGGVVDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1010 ### # start gene g1011 4 AUGUSTUS gene 4322289 4322819 0.68 + . g1011 4 AUGUSTUS transcript 4322289 4322819 0.68 + . g1011.t1 4 AUGUSTUS start_codon 4322289 4322291 . + 0 transcript_id "g1011.t1"; gene_id "g1011"; 4 AUGUSTUS CDS 4322289 4322819 0.68 + 0 transcript_id "g1011.t1"; gene_id "g1011"; 4 AUGUSTUS stop_codon 4322817 4322819 . + 0 transcript_id "g1011.t1"; gene_id "g1011"; # protein sequence = [MSFSLPPINDNPDGGWGPSSSNFPGQFKFKDIPYAPYSKSDKLGRFADWNETTSDTRQNAVGMVSTQNTRTGPGGRRR # EGAQAFGSGTASAFAYFHVEDESSFSLVDNKNAPPRRGGTFIRGRGTARGGVGNYNARGGAQRGGRGGFGGRGGNAQRGRRGWRDWDKVSRTEKLRML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1011 ### # start gene g1012 4 AUGUSTUS gene 4323258 4324208 0.9 + . g1012 4 AUGUSTUS transcript 4323258 4324208 0.9 + . g1012.t1 4 AUGUSTUS start_codon 4323258 4323260 . + 0 transcript_id "g1012.t1"; gene_id "g1012"; 4 AUGUSTUS CDS 4323258 4324208 0.9 + 0 transcript_id "g1012.t1"; gene_id "g1012"; 4 AUGUSTUS stop_codon 4324206 4324208 . + 0 transcript_id "g1012.t1"; gene_id "g1012"; # protein sequence = [MCAPRSVYPWDIVIVREGNSLYFDKRDGGPFDTVTVNENAADPPQDPSPPNPNNPNEKVPDTPSINSATSLSLEATYV # NQNFAFQSVVETSPPPAVDFSNPNPFYGPDETEPLASCGYRYRVFDLSVQEDENFKICVRTEVDAYLPGSGNPREGQGLVTIRALNEFDPRAAGAGGA # PDWRTKLDSQRGAVVATEMKNNSCKLAKWAVQSILAGADLMKIGYVLYVSSVFLPTNCLVFRYVSRSNPRDAARHVILSTASMRPTDFAAQLNVSLNN # GWGIVRTVADLCMKMPEGKYVLVKDPNKVQAQLPFSSCMTDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1012 ### # start gene g1013 4 AUGUSTUS gene 4327486 4328100 0.51 + . g1013 4 AUGUSTUS transcript 4327486 4328100 0.51 + . g1013.t1 4 AUGUSTUS start_codon 4327486 4327488 . + 0 transcript_id "g1013.t1"; gene_id "g1013"; 4 AUGUSTUS CDS 4327486 4328100 0.51 + 0 transcript_id "g1013.t1"; gene_id "g1013"; 4 AUGUSTUS stop_codon 4328098 4328100 . + 0 transcript_id "g1013.t1"; gene_id "g1013"; # protein sequence = [MSKMLPPPLLAALPRPNDADAPEQFLVQLRSIIREILPRDENTRISASDNATWVLILNQLHDAFLVTFSFNDVWNAQP # ERVKLVEACLETIESILNRVDGALIARKEVPGSKDIPRKLFCALFTLCHTLDLYADTDITPRDGVSMPDALRESACRTAQLILRCMGGCHSPTGDEPM # WKIMRSIIEELLSLSHGELHAIVFLAVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1013 ### # start gene g1014 4 AUGUSTUS gene 4332545 4333319 0.51 + . g1014 4 AUGUSTUS transcript 4332545 4333319 0.51 + . g1014.t1 4 AUGUSTUS start_codon 4332545 4332547 . + 0 transcript_id "g1014.t1"; gene_id "g1014"; 4 AUGUSTUS CDS 4332545 4332910 0.51 + 0 transcript_id "g1014.t1"; gene_id "g1014"; 4 AUGUSTUS CDS 4333014 4333319 0.66 + 0 transcript_id "g1014.t1"; gene_id "g1014"; 4 AUGUSTUS stop_codon 4333317 4333319 . + 0 transcript_id "g1014.t1"; gene_id "g1014"; # protein sequence = [MVGAWEDVQNIVDSTDVATAQIAIARLLLALRSRDSAAITTALDGARMVLGGPIAAAGVNNYRRSYEAMLDLHLTHEL # ETIYNAISSLSEQSTSVNSALMRLSEILSSRLDSTLPTFRTRESVLRKEIGRSWLASAKIARKAGQWQTAYSAMLQSQQNKTRYSFMESAKLVKAMGD # PLHALQQLENSMQLHNLLEDEVNVVDLTNDDNEENLKKMKAKVIIKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1014 ### # start gene g1015 4 AUGUSTUS gene 4337467 4338056 1 - . g1015 4 AUGUSTUS transcript 4337467 4338056 1 - . g1015.t1 4 AUGUSTUS stop_codon 4337467 4337469 . - 0 transcript_id "g1015.t1"; gene_id "g1015"; 4 AUGUSTUS CDS 4337467 4337944 1 - 1 transcript_id "g1015.t1"; gene_id "g1015"; 4 AUGUSTUS CDS 4338001 4338056 1 - 0 transcript_id "g1015.t1"; gene_id "g1015"; 4 AUGUSTUS start_codon 4338054 4338056 . - 0 transcript_id "g1015.t1"; gene_id "g1015"; # protein sequence = [MSFLYPDIDKPPFELSETGWGEFEVHIKLHFIPESGEKVITIYHHLKLHPWSLSGDTESIPPLEVAQKAGTVHSWQYE # EIVFNDPYQNFLNILTNNPPTPIPRTNTSGRTIPFHIGNPASFESLKGGVPEFTSLLEKDEAERLDKAKKLIIAEQEKTRALLIAKEKELARLQKMLN # G] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1015 ### # start gene g1016 4 AUGUSTUS gene 4341516 4342890 0.61 - . g1016 4 AUGUSTUS transcript 4341516 4342890 0.61 - . g1016.t1 4 AUGUSTUS stop_codon 4341516 4341518 . - 0 transcript_id "g1016.t1"; gene_id "g1016"; 4 AUGUSTUS CDS 4341516 4342462 0.64 - 2 transcript_id "g1016.t1"; gene_id "g1016"; 4 AUGUSTUS CDS 4342884 4342890 0.61 - 0 transcript_id "g1016.t1"; gene_id "g1016"; 4 AUGUSTUS start_codon 4342888 4342890 . - 0 transcript_id "g1016.t1"; gene_id "g1016"; # protein sequence = [MKRLAMTAIHTSISPELSDFEATNSTTPREFSGLSVLEILELVYKSPTLAPPLPYDPNALVNARIKAALKDGKSEEIR # DLCSKFLVDENLGNTEMMSKIEEFVWASVLLMFATGKPGRKPRLDFFLMHLVTASLFLRSYVHALENPAHKATIIKAFLPHILLVTLSRGRPIIKPHL # LMGTTDKPRPPYASGSPYARSEHSIGSPLNDDEYNPWSSLIEASLYSTDSHLLKTMRALVLAAREYGDTPPGSVIGAFKEHSATVSKEETHPGIADVD # GSIFVRAAGMLMDYMGWTSYGQPEREDWDRSALGWDEAWNNED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1016 ### # start gene g1017 4 AUGUSTUS gene 4343585 4344034 0.34 - . g1017 4 AUGUSTUS transcript 4343585 4344034 0.34 - . g1017.t1 4 AUGUSTUS stop_codon 4343585 4343587 . - 0 transcript_id "g1017.t1"; gene_id "g1017"; 4 AUGUSTUS CDS 4343585 4344034 0.34 - 0 transcript_id "g1017.t1"; gene_id "g1017"; 4 AUGUSTUS start_codon 4344032 4344034 . - 0 transcript_id "g1017.t1"; gene_id "g1017"; # protein sequence = [MLTLPPIERLEINVMLTENAWVMFFGESLALEAKMNSYKRIVEAAKVDNPELLEGALFPLNVVANFKDRTTTLKIWSL # QADTELNFLGQVLELLAREKALLNSQGKPYTTAAQIHKDFIASVNKYEQRQKERAKVKGPKRAEGRQSKGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1017 ### # start gene g1018 4 AUGUSTUS gene 4349443 4350817 1 - . g1018 4 AUGUSTUS transcript 4349443 4350817 1 - . g1018.t1 4 AUGUSTUS stop_codon 4349443 4349445 . - 0 transcript_id "g1018.t1"; gene_id "g1018"; 4 AUGUSTUS CDS 4349443 4350507 1 - 0 transcript_id "g1018.t1"; gene_id "g1018"; 4 AUGUSTUS CDS 4350626 4350817 1 - 0 transcript_id "g1018.t1"; gene_id "g1018"; 4 AUGUSTUS start_codon 4350815 4350817 . - 0 transcript_id "g1018.t1"; gene_id "g1018"; # protein sequence = [MSPQYRRPLPSKDTVLTRYGGWIPADPAVYEAFFDDLLRSIDTKKAHVPAVQEFEDALNSDPELLLYCLDQVVVAAPK # FQVVRNERGAVTGGEPIGVPLYLLFDLLSNTAAGFDLLRMPKFNISLKSLLDSWGDYLQSAESNNTLNDSDEGWFGEVGLATLENDRGIFNEIYECPD # ETAVNRGFTSWDSFFTRKFKPNARPIEKPEPPNFFIYNACESTVVRKTTGVEEHDQFWLKGQAYSIYDMLARRDDEVAASFIGGTVYQAFLSPYDYHR # WHSPVDGTIREIQIIEGSYYAALPDEGAGESDSDLQLGDPRGAIIRSQPWLTQASTRAIIYIDADNKDVGCLVFIGVGMVEVSTCQVSVSEGQHVNIG # DELGMFRFGGSTHALIFGKDVKLKFFDLEQDKGHRRVNTPLAALEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1018 ### # start gene g1019 4 AUGUSTUS gene 4355549 4358224 0.35 + . g1019 4 AUGUSTUS transcript 4355549 4358224 0.35 + . g1019.t1 4 AUGUSTUS start_codon 4355549 4355551 . + 0 transcript_id "g1019.t1"; gene_id "g1019"; 4 AUGUSTUS CDS 4355549 4355872 0.79 + 0 transcript_id "g1019.t1"; gene_id "g1019"; 4 AUGUSTUS CDS 4355934 4356295 0.44 + 0 transcript_id "g1019.t1"; gene_id "g1019"; 4 AUGUSTUS CDS 4356382 4358224 0.45 + 1 transcript_id "g1019.t1"; gene_id "g1019"; 4 AUGUSTUS stop_codon 4358222 4358224 . + 0 transcript_id "g1019.t1"; gene_id "g1019"; # protein sequence = [MTSYRDLLGSLKDEPSKLSSLSSPPDLSSKSTSSPDNPKPKLHRPSASAASDLRLKYQTLSRHADEASNYDMRVMAAA # ISSSVQSATPQLPSIESSLQNFQTEITKQTVKSMLSASAAVPSIEENSLESLLVADRLGRLQFGDPRKRNTKVMRALMSVSSLHDAASDLKTRLDDLS # RTQTTAEIQSILCAVEDGSETLRREIASSTAAVSVKAKEVRGVLDSIEQSVQLITDLMAGKCFFDPGQDKNSPTIIAYCIALVARVFERTAQRGATFI # LKMIKIFGYTLATLGGRNLNTDQEIALAEIPESIERLEKKFNLDVDCVPYAVCPKCSKTYAPSFPNGASHPVYPPICLERQTPSEEPCSTSLLSYGKP # AKIFEYYPFFDWFGKFISLPGIEEYGDKFCEAVESHQNVPNKKVDQTDGCFVHEFPGADAQLFIADRGSEGRWLFTLNADFFNAEGNRIRGKKSSTGM # MAMSCLNLPLKMRNDHAYLYIPGIIQGPQEPNAINAEHRHYLKPLIDDLLTGYTRGIRPYATHRTYGQNCPYDRVFRVALALVLMDFKAARPFSGFLD # VTSHHFCYMCDCWHVSHLGRTDYEEWKSADDAFLRKGAELWRDAPDIKKRKILEDIFGTRASEFWRLPYWKASIQLGIDPMHTMFLILLQRYFRDILG # LDNPDDPKRTPKKPKFKFAFYYDFTPPPPLSSLVNQEDATRLRTSIIGYDSQPIDDNLLSLLEWPHLSMEHSAYRWARLQSLQVQVANDSRAQQAVLD # ILNDLSEQAPTTEAQRHQLYSRIQRHKWSAILYVCDNLAIFPNASGPDLRNSSQITQKDVTKRELSNILLHWVRIQLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1019 ### # start gene g1020 4 AUGUSTUS gene 4359305 4359985 0.97 + . g1020 4 AUGUSTUS transcript 4359305 4359985 0.97 + . g1020.t1 4 AUGUSTUS start_codon 4359305 4359307 . + 0 transcript_id "g1020.t1"; gene_id "g1020"; 4 AUGUSTUS CDS 4359305 4359985 0.97 + 0 transcript_id "g1020.t1"; gene_id "g1020"; 4 AUGUSTUS stop_codon 4359983 4359985 . + 0 transcript_id "g1020.t1"; gene_id "g1020"; # protein sequence = [MLHSFCKGASFRQWLLRENSPPILKYCQQLLDKAYNYDRGSSTPPPPVAQDDDIDESEVLTTVNAELVASNFVQPDSK # YKILPSPTLTRMLGTEPFECFSRIPGSKGDYTIPGKGAIGNSNVCFQAQGNYRPGQRWLAGQIRHIFRQTKSSPIQVGICRSMPTSTPHPFSDYWANG # FEADIVASKFSNSLEIINFSQIAGHSARWSISDDLVVVVNLCSVSLLSKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1020 ### # start gene g1021 4 AUGUSTUS gene 4360522 4361094 0.87 - . g1021 4 AUGUSTUS transcript 4360522 4361094 0.87 - . g1021.t1 4 AUGUSTUS stop_codon 4360522 4360524 . - 0 transcript_id "g1021.t1"; gene_id "g1021"; 4 AUGUSTUS CDS 4360522 4361094 0.87 - 0 transcript_id "g1021.t1"; gene_id "g1021"; 4 AUGUSTUS start_codon 4361092 4361094 . - 0 transcript_id "g1021.t1"; gene_id "g1021"; # protein sequence = [MRLPQTSHDLPAVSPLTGPQRTQKGSPRASPYNSPPSGVERNSTPVSPSSSLSSVHSLPSISSELEYDTDRERLTRSR # RLRRRQSLNYDSDNGVEDPRTNGTKQSSDSLADITTQRVGIQCSNVSHKADTQPTKPAKKYGPPALVFEDDSDDDLIPKPPGEVGRPNRGGYSLFLVL # GWPKKKYDKVKVRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1021 ### # start gene g1022 4 AUGUSTUS gene 4365194 4365639 0.88 + . g1022 4 AUGUSTUS transcript 4365194 4365639 0.88 + . g1022.t1 4 AUGUSTUS start_codon 4365194 4365196 . + 0 transcript_id "g1022.t1"; gene_id "g1022"; 4 AUGUSTUS CDS 4365194 4365370 0.96 + 0 transcript_id "g1022.t1"; gene_id "g1022"; 4 AUGUSTUS CDS 4365421 4365639 0.9 + 0 transcript_id "g1022.t1"; gene_id "g1022"; 4 AUGUSTUS stop_codon 4365637 4365639 . + 0 transcript_id "g1022.t1"; gene_id "g1022"; # protein sequence = [MTIEAGEKAIETAQEVKKIEEKERMATKKVHEIANALEEDNQQLLNDHGLLKEDHEHSQEELRKVKDQLKQTETEKLE # TETRLTRAQDRLDQLGRETLVVTQESEQREHKLQAEIDGLKVEHFIGCHHLAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1022 ### # start gene g1023 4 AUGUSTUS gene 4368804 4369286 0.54 + . g1023 4 AUGUSTUS transcript 4368804 4369286 0.54 + . g1023.t1 4 AUGUSTUS start_codon 4368804 4368806 . + 0 transcript_id "g1023.t1"; gene_id "g1023"; 4 AUGUSTUS CDS 4368804 4369286 0.54 + 0 transcript_id "g1023.t1"; gene_id "g1023"; 4 AUGUSTUS stop_codon 4369284 4369286 . + 0 transcript_id "g1023.t1"; gene_id "g1023"; # protein sequence = [MIKVCRERGDPAGVEFWSYALNVNEILGDQGQSDEEDTTIDVDIEGVVVKQSVKKVLRVYWRHPWLESLFRIMNQAPA # LEKLIFHRAGAKRILRIYSDTISHRAPITGYPREFFREAFLSALLPHDIAALNLAEYSFPLADFSGYNPSTTSGDGEPMQTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1023 ### # start gene g1024 4 AUGUSTUS gene 4369743 4370150 0.83 + . g1024 4 AUGUSTUS transcript 4369743 4370150 0.83 + . g1024.t1 4 AUGUSTUS start_codon 4369743 4369745 . + 0 transcript_id "g1024.t1"; gene_id "g1024"; 4 AUGUSTUS CDS 4369743 4370150 0.83 + 0 transcript_id "g1024.t1"; gene_id "g1024"; 4 AUGUSTUS stop_codon 4370148 4370150 . + 0 transcript_id "g1024.t1"; gene_id "g1024"; # protein sequence = [MVLKEYLQIDDPSDWQQFTVPAEELGSFLADPHSYELKLVSDMKLDTSAKTAHDMRRSPWNQTVISLLATKASEYASE # KSEYYGNDGQEVDWRGLFNNRVYRLLLEVVKAKAGVRDNHYEAQKQESKKRRVREYV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1024 ### # start gene g1025 4 AUGUSTUS gene 4374858 4376236 0.84 - . g1025 4 AUGUSTUS transcript 4374858 4376236 0.84 - . g1025.t1 4 AUGUSTUS stop_codon 4374858 4374860 . - 0 transcript_id "g1025.t1"; gene_id "g1025"; 4 AUGUSTUS CDS 4374858 4375949 0.86 - 0 transcript_id "g1025.t1"; gene_id "g1025"; 4 AUGUSTUS CDS 4376048 4376236 0.98 - 0 transcript_id "g1025.t1"; gene_id "g1025"; 4 AUGUSTUS start_codon 4376234 4376236 . - 0 transcript_id "g1025.t1"; gene_id "g1025"; # protein sequence = [MSPYQRPLPSKQTVLTRYGGWIPANPAVYDAFFNDLLREIDPKKAHVPAVQNFKDNINADPELVRTFEQLLLCMDKIV # VAAPKFQVNRNDQGEIIGGEPIGVPLYLLLDLLSNTSAGYDLFRKVEFNAAMKNLLDFWGSYLRGSQSNNTLNDSDEGWFGQLGLATLENERGIFNEI # YECPDYTAVNRGFTSWDAFFTRKFKPDARPIQRPDPPFFFIFNACESTVYRISTDIKEHDQFWLKGQPYSIYDMLGRRDDEVSRSFIGGTVYQAFLSP # YDYHRWHSPVDGTIREIQLVPGTYYAALPDDGAGESDPDFQPGDPRGAIIRSQAWLTEAATRAIIHIEADNKAIGRIVFIGIGMVEVSTCQITVEEGD # RVKAGDEIGMFHFGGSSHALIFERGVNLEFFDDVVINNHLHVNRPIAGLQVPKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1025 ### # start gene g1026 4 AUGUSTUS gene 4378219 4379799 0.45 + . g1026 4 AUGUSTUS transcript 4378219 4379799 0.45 + . g1026.t1 4 AUGUSTUS start_codon 4378219 4378221 . + 0 transcript_id "g1026.t1"; gene_id "g1026"; 4 AUGUSTUS CDS 4378219 4379799 0.45 + 0 transcript_id "g1026.t1"; gene_id "g1026"; 4 AUGUSTUS stop_codon 4379797 4379799 . + 0 transcript_id "g1026.t1"; gene_id "g1026"; # protein sequence = [MDPLCSYIEMLDIKATPIPESSIKLRKQNTLSQLEYFGINGNPNHETPDLTSSPDWNLSSTHSYLGSTDLHSVFDRQP # TEILIMIFSFLDFSEANLLEINEGPWALARVCRRWRGIVYDCSLFWLHANLDLSYWHFTRNWPSRADLLVSTFLDKSKGLPLNVRIQWPDIEGATNHI # LDAVEHILKTSHRWKSAVLNLHYALYYKLSSVIDGRFPQLESLMLKCNLPPKISRNSLPLIEVFQVAPKLRQVSIEGMPYATKNVTLPWNQLTHLNVY # HDHPNPNYHCLLLSSNLVECHIGAHCDLLQSPRGPYSSISLPHLKTLFVKGTGALVLPYVSAPNTEVLHVTDTPSAACSEACIEALQYFILGCSESLQ # DLTLHSDPLDYRLAEILYSVRRLVRLHLHLTLPRGSSLFKDLIKWLSYRHVPESSSATSLTVDLLGLLPVLKSLSMRIDPSLADSESLDEMDLTVLIK # MLESRRTMPRISEAHRDFRELDSFDLEIKSYSHGTGFNGFDALNDIGLKTSVRLIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1026 ### # start gene g1027 4 AUGUSTUS gene 4388082 4389710 0.94 - . g1027 4 AUGUSTUS transcript 4388082 4389710 0.94 - . g1027.t1 4 AUGUSTUS stop_codon 4388082 4388084 . - 0 transcript_id "g1027.t1"; gene_id "g1027"; 4 AUGUSTUS CDS 4388082 4389710 0.94 - 0 transcript_id "g1027.t1"; gene_id "g1027"; 4 AUGUSTUS start_codon 4389708 4389710 . - 0 transcript_id "g1027.t1"; gene_id "g1027"; # protein sequence = [MVERAQPIEDSKVEEPQQNLSEDSSQELTTTADDYAAEATSPIDDNTKEKGTIRERQEPLYSTFPRSQKMLILIIGSF # AGLVSPLTGSIYLPALNTIAADLGVRTSLVNLTITTYQIFQGLAPSFMASLADTHGRRPTYLLAFSIYIIANLALALQDSYAALMVLRCLQSAGSSAT # IALGSAVVADMVTRAERGSWVGYAGLGISLGPALGPTIGGLLNQFLGWRSIFWFLLILGSVLLVIIFMFMPETGRAVVGNGSVKPAWWDLSLAQWLRI # RSGHHFNGTEGVEEDISTINKPKKRLNPISSLRILLEPEGGITLGFGAIFFAGYFMVMTTLSEQLTARFGFSSAIVGLCYLPLGFGSLCSRWTSGLLF # DWNFRRHARLLGVPLDLSRQQQLEIFPIERIRLEICIPMIYISCGTLLAYAWAMQTNASLAGIEVSLFFLGLFYSGAQQGLNTLIVDTHADTPATATA # ANNLFRCLMSSGGTAIAPLMIEKIGIGLMGVFVSGVWFVFSPCLWAVLLYGKQWRESEKIKHEKENSNGQKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1027 ### # start gene g1028 4 AUGUSTUS gene 4394758 4395348 0.7 - . g1028 4 AUGUSTUS transcript 4394758 4395348 0.7 - . g1028.t1 4 AUGUSTUS stop_codon 4394758 4394760 . - 0 transcript_id "g1028.t1"; gene_id "g1028"; 4 AUGUSTUS CDS 4394758 4395348 0.7 - 0 transcript_id "g1028.t1"; gene_id "g1028"; 4 AUGUSTUS start_codon 4395346 4395348 . - 0 transcript_id "g1028.t1"; gene_id "g1028"; # protein sequence = [MSQDNEPSWDDEAAEDDEHQNEEDLNVFHTNELIKNKGSCTPLSNTNTRQQASVKLPTKLAQKIGNPTPTCYLQVPAP # KGFYGTDKSIAVGNSYVCYRPKDGSTGEWVAGQIRYIFDLKGVTNMAIVRSKPFVAPISDPFAEYVIAEFEARTISSYFSQDYDVVAMDSILGHAARW # ELSSDVAVVLCLSRVSVLTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1028 ### # start gene g1029 4 AUGUSTUS gene 4396524 4398863 0.5 - . g1029 4 AUGUSTUS transcript 4396524 4398863 0.5 - . g1029.t1 4 AUGUSTUS stop_codon 4396524 4396526 . - 0 transcript_id "g1029.t1"; gene_id "g1029"; 4 AUGUSTUS CDS 4396524 4398863 0.5 - 0 transcript_id "g1029.t1"; gene_id "g1029"; 4 AUGUSTUS start_codon 4398861 4398863 . - 0 transcript_id "g1029.t1"; gene_id "g1029"; # protein sequence = [METPENDGDSGLVDRFENLEVTSVFAKKALKTAHRLEDVLVEVGRRLEGLSEDTPPEKIHSILHSVEPSLAYVSRQVG # NIKNPAAATQVAGVLKKLETMEITWNLWRKRYPDVSSPIKIDNSMYHQIFLIYVVNTDMYYASGDTFVDLSNRWNTPTMIAYTIALVSRIFEGAARRA # SSTLLKLLKVYGLSVTLLAGGPNLIQQKALNDIPESIGTLEKRLNLQVPSIPHAVCPSCSYTYPPTYAKGSQKPIYPTRCTERLTETAEPCGTHLLSE # GKPIKTYHYYSFYEWFGRFIAQPKIEKYGDEFCNDVTALQREDPSEGMRSFKDGTFVRTFSAEDGKLFIEGRGNEGRWLFLLHADFFNVEGNRVRGKT # RSTGVTCLACLNLPLSMRYDSAWLYIPGIIQGPHEPNAKNSENRHYWRLMVTELLAGYSRGLKPHHTYQTYQMGSASNERIHRVAIGGASLDFKAARP # FGGFLDVTSHHTCFVCKCWHLAHIGRTDHTKWEPADIEFLKRGAFAWINAKTPDERSEIESFYGTRYSELWRLPYWDPTRQLLVEPMHTIFLILLQRF # ARDALGLDNPGPLNMEDDDNHDSGDATEKKKKSKAIYICYYYNFTPPPHPSVLTPLGHTPVTSSSQLRDNIQILISEPLPKDQQLSIVDWNDITAHER # AARLSKKRVLLPLVEIDPRAFQGIHDLHELLSLPAPSTELEKKAFQKQLSNHKWHVLAYVCNDLMEFPIDRAQKLKSQSSISKRDVTKRMFAAALAEW # VSLSIIRYLRSNMIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1029 ### # start gene g1030 4 AUGUSTUS gene 4398922 4399242 0.51 - . g1030 4 AUGUSTUS transcript 4398922 4399242 0.51 - . g1030.t1 4 AUGUSTUS stop_codon 4398922 4398924 . - 0 transcript_id "g1030.t1"; gene_id "g1030"; 4 AUGUSTUS CDS 4398922 4399242 0.51 - 0 transcript_id "g1030.t1"; gene_id "g1030"; 4 AUGUSTUS start_codon 4399240 4399242 . - 0 transcript_id "g1030.t1"; gene_id "g1030"; # protein sequence = [MRSGKGKKPTRYGDFLAKSIAKESQSKPTDVSSVESKTTRAALFTSSSNPVQRILKEENDRGVSSDYDLNVMATALLD # REAGQLPMIPSDESALFENLTVSQVVLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1030 ### # start gene g1031 4 AUGUSTUS gene 4408142 4408561 0.5 - . g1031 4 AUGUSTUS transcript 4408142 4408561 0.5 - . g1031.t1 4 AUGUSTUS stop_codon 4408142 4408144 . - 0 transcript_id "g1031.t1"; gene_id "g1031"; 4 AUGUSTUS CDS 4408142 4408561 0.5 - 0 transcript_id "g1031.t1"; gene_id "g1031"; 4 AUGUSTUS start_codon 4408559 4408561 . - 0 transcript_id "g1031.t1"; gene_id "g1031"; # protein sequence = [MLFLASSGPYFFFKGKESHLSATIGLSLSSISSSSSSPSSPSPSSPSPPSPSPPSPSPSSPSPSSPSPPSSPPPSPPA # LSSSRPPSPPVPSSPLSSSSPHSFSLRFSEGKFDSWRECTPGPGYDVSEDDHIQTDSRFTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1031 ### # start gene g1032 4 AUGUSTUS gene 4409143 4409580 0.75 + . g1032 4 AUGUSTUS transcript 4409143 4409580 0.75 + . g1032.t1 4 AUGUSTUS start_codon 4409143 4409145 . + 0 transcript_id "g1032.t1"; gene_id "g1032"; 4 AUGUSTUS CDS 4409143 4409580 0.75 + 0 transcript_id "g1032.t1"; gene_id "g1032"; 4 AUGUSTUS stop_codon 4409578 4409580 . + 0 transcript_id "g1032.t1"; gene_id "g1032"; # protein sequence = [MIELAESTRDLDGAAFWAYAFQSVKILGERGMSDEEDDEEDVVIDGVQTKQDVKLVKILWFRHESFRSLLQRIDETPK # VENEIFTQQGRFQVKRVRSNIVDERKPPTGYPKQVFRPEYLQKLLPHEKEALKLKKMPEFILRAHLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1032 ### # start gene g1033 4 AUGUSTUS gene 4422409 4422957 0.77 + . g1033 4 AUGUSTUS transcript 4422409 4422957 0.77 + . g1033.t1 4 AUGUSTUS start_codon 4422409 4422411 . + 0 transcript_id "g1033.t1"; gene_id "g1033"; 4 AUGUSTUS CDS 4422409 4422957 0.77 + 0 transcript_id "g1033.t1"; gene_id "g1033"; 4 AUGUSTUS stop_codon 4422955 4422957 . + 0 transcript_id "g1033.t1"; gene_id "g1033"; # protein sequence = [MEYPVDAAANRQASSWFPNAFAYVNVDLGPEYQQLVSSWIALERTTHWKTDSQVRLPSVNRPTLLSKWISKKRYTSKG # NDPNVTEQCGEDFIKHVQKWWTSLQPEWRVMGSRNLPPDSVTHDQWEKLDKYGINGWFSILVCLKWWGTNIQSPLTENKTGEMRDWLDMIEDVRYMME # VLTKTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1033 ### # start gene g1034 4 AUGUSTUS gene 4425477 4427120 0.38 - . g1034 4 AUGUSTUS transcript 4425477 4427120 0.38 - . g1034.t1 4 AUGUSTUS stop_codon 4425477 4425479 . - 0 transcript_id "g1034.t1"; gene_id "g1034"; 4 AUGUSTUS CDS 4425477 4426997 0.87 - 0 transcript_id "g1034.t1"; gene_id "g1034"; 4 AUGUSTUS CDS 4427061 4427120 0.38 - 0 transcript_id "g1034.t1"; gene_id "g1034"; 4 AUGUSTUS start_codon 4427118 4427120 . - 0 transcript_id "g1034.t1"; gene_id "g1034"; # protein sequence = [MGTFNTRQPKFHRLIMLSMCNARNNIQTLYTQAVKQSSVVGSTTGASSSAFPASSSSPFASSSSSNGAFGSQSAFGPS # SVSTPSIFGASANSNSVFGTSNSAPALATGSVNNGAFSSLMNKNPPNSAFATPSTTATPSAFGQPSAFGANNNNSPFGKPSTSVFGPSTFGQPSSTAF # GGTPITTNTSSVFGAPSTTTTSAFGQSSTFGSFPAASTTSAFGAPATATTSAFGQTSTPISSLIKPAISGGAFAAFANSGPSAFGSGAPSGSGSGGGF # AAFANSQPSTFSGTSSTNTSGSAFGQPSVFGASSTGGNAFGSSSASPAASTSAFGVLAPAAPSTTSGAFSQPASTASTSAFGQPAPSTSVFGQPTPST # SNPTSIFGQPSTNTTSAFAQTPAFTQPPSAFGSLTSSTSAPSAFGAFGTTATTNNTSAFGTQSAGGGGGTFGSSTPFSNTTNTSSNSTDSKPNFDAPH # LRKLFLPGKTPYDSQLPPNYLESVLPKAVVEVFKRDKFDWGEGGGVPEWIPPVELR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1034 ### # start gene g1035 4 AUGUSTUS gene 4429136 4429858 0.8 - . g1035 4 AUGUSTUS transcript 4429136 4429858 0.8 - . g1035.t1 4 AUGUSTUS stop_codon 4429136 4429138 . - 0 transcript_id "g1035.t1"; gene_id "g1035"; 4 AUGUSTUS CDS 4429136 4429858 0.8 - 0 transcript_id "g1035.t1"; gene_id "g1035"; 4 AUGUSTUS start_codon 4429856 4429858 . - 0 transcript_id "g1035.t1"; gene_id "g1035"; # protein sequence = [MRSTQYPGNTRYDRVELLPTFSKPTNSVDRRVLHSPGPSRTPRVVHRTSPYSNRSPSPDPKFQSSLPSTLPPSSSVLP # RSTPVSPQPPNNPLSKGYTIYKQNSSPIRPIKPRIIPSRITSDTLDATPQAGLGSQDIPENPNDTTGVVAGEDLGDDSDDGFVSDGKIAKPPGEVSRP # GRGGYNLRHELRWSSERFNKVKVRIISQIFASNTCSFSSRNLSMRSLSQNWTACNPSANKIFQK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1035 ### # start gene g1036 4 AUGUSTUS gene 4437823 4438083 0.8 - . g1036 4 AUGUSTUS transcript 4437823 4438083 0.8 - . g1036.t1 4 AUGUSTUS stop_codon 4437823 4437825 . - 0 transcript_id "g1036.t1"; gene_id "g1036"; 4 AUGUSTUS CDS 4437823 4438083 0.8 - 0 transcript_id "g1036.t1"; gene_id "g1036"; 4 AUGUSTUS start_codon 4438081 4438083 . - 0 transcript_id "g1036.t1"; gene_id "g1036"; # protein sequence = [MWKSVDLVLDYILFFTLLGLVRSTVITDDTSDLGTAPFEYIIVGGGTTALAVANRLAVNHSVLVVERGPDLVNDEVIN # DPFTKFGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1036 ### # start gene g1037 4 AUGUSTUS gene 4439740 4440685 0.23 - . g1037 4 AUGUSTUS transcript 4439740 4440685 0.23 - . g1037.t1 4 AUGUSTUS stop_codon 4439740 4439742 . - 0 transcript_id "g1037.t1"; gene_id "g1037"; 4 AUGUSTUS CDS 4439740 4440167 0.69 - 2 transcript_id "g1037.t1"; gene_id "g1037"; 4 AUGUSTUS CDS 4440592 4440613 0.31 - 0 transcript_id "g1037.t1"; gene_id "g1037"; 4 AUGUSTUS CDS 4440683 4440685 0.37 - 0 transcript_id "g1037.t1"; gene_id "g1037"; 4 AUGUSTUS start_codon 4440683 4440685 . - 0 transcript_id "g1037.t1"; gene_id "g1037"; # protein sequence = [MVKRLLLHYVVLWDSHPLAIGATPKQVFIDGIAQLGSPFVRPKSKALQHAPETPNFEEEKKAALEFDGLPPLGPKESV # SDVVIFQNFDTLFMDMGNGPGVKQVFAKDHLGAPQIAVVQNGKLNYIGASEGYSSNLTMTPRTVDLLGGSLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1037 ### # start gene g1038 4 AUGUSTUS gene 4443708 4444970 0.13 - . g1038 4 AUGUSTUS transcript 4443708 4444970 0.13 - . g1038.t1 4 AUGUSTUS stop_codon 4443708 4443710 . - 0 transcript_id "g1038.t1"; gene_id "g1038"; 4 AUGUSTUS CDS 4443708 4444175 0.39 - 0 transcript_id "g1038.t1"; gene_id "g1038"; 4 AUGUSTUS CDS 4444328 4444738 0.3 - 0 transcript_id "g1038.t1"; gene_id "g1038"; 4 AUGUSTUS CDS 4444968 4444970 0.56 - 0 transcript_id "g1038.t1"; gene_id "g1038"; 4 AUGUSTUS start_codon 4444968 4444970 . - 0 transcript_id "g1038.t1"; gene_id "g1038"; # protein sequence = [MLGFDADVVLWDSHPLAVGATPKQVFIDGIAQLNKPFAFPKSDVLQRAPETPNFDEETKAALKHDGLPPLEPKESISD # VVIFQNFDSLFLDMGNGVEQIFTAENYVGESQIAVVQNGKLACIGTPDVCITSVNVDSRTDGEVFDGLMDKLPTILGGNTAVIRAVDGLQFATRDALL # AYRSGVTTGVTAPCSSGLLAGLSTAFNTGAAHKLIEGAVVEDEVALHVSLSLSSSVSVSTQIATLRRLLLGGGAKGELGVQVTKVLEVRKADFVREHF # SLMQVCAGTGEDTTGYWRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1038 ### # start gene g1039 4 AUGUSTUS gene 4450247 4451598 0.24 - . g1039 4 AUGUSTUS transcript 4450247 4451598 0.24 - . g1039.t1 4 AUGUSTUS stop_codon 4450247 4450249 . - 0 transcript_id "g1039.t1"; gene_id "g1039"; 4 AUGUSTUS CDS 4450247 4450659 0.72 - 2 transcript_id "g1039.t1"; gene_id "g1039"; 4 AUGUSTUS CDS 4450776 4450904 0.56 - 2 transcript_id "g1039.t1"; gene_id "g1039"; 4 AUGUSTUS CDS 4451427 4451598 0.85 - 0 transcript_id "g1039.t1"; gene_id "g1039"; 4 AUGUSTUS start_codon 4451596 4451598 . - 0 transcript_id "g1039.t1"; gene_id "g1039"; # protein sequence = [MNSDRDVSSVSESGHETLIVTLPGSLKAVRESLSILLDSGAIVHAVELMKGGDGSGSASDPAGSYTVLTSSSHPHLLS # PTSTEELPEGCIYRINTGGALPPPSSDDTTGGQPGEEWKVETLIPAPPSRFNIRQPGSDVRQGDLVMRKGERITSGGGEIGSLIFIGKKEVKVFKKPI # VALMSTGNEIRDILGSISSGSGEGDWKSWDTNRPSLTAALEGMGYEVLDLGIVPDELDPFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1039 ### # start gene g1040 4 AUGUSTUS gene 4454451 4455146 0.97 - . g1040 4 AUGUSTUS transcript 4454451 4455146 0.97 - . g1040.t1 4 AUGUSTUS stop_codon 4454451 4454453 . - 0 transcript_id "g1040.t1"; gene_id "g1040"; 4 AUGUSTUS CDS 4454451 4455146 0.97 - 0 transcript_id "g1040.t1"; gene_id "g1040"; 4 AUGUSTUS start_codon 4455144 4455146 . - 0 transcript_id "g1040.t1"; gene_id "g1040"; # protein sequence = [MANNLVNVLKLHSKALEKVDPPTPSATSKYEPDSTQASLVCAAYHAALALRSPPLSVFDNTFTRVGGGGPPDWPLASA # DAYYKHSSSHHVVPQVRKPLLAINSTDDPVVVHAPTSPEEVGSGYTVVVLTEGGGHLGWFEPSSGIVLIGTDVSKLHVRRWMTKPTLEWLRLAAEVLV # HGHPDHPPRAIFVDEGGWIREVNGARQGLGCRAVEIGDLIDGTELKKEPGMLQGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1040 ### # start gene g1041 4 AUGUSTUS gene 4456801 4457238 0.74 - . g1041 4 AUGUSTUS transcript 4456801 4457238 0.74 - . g1041.t1 4 AUGUSTUS stop_codon 4456801 4456803 . - 0 transcript_id "g1041.t1"; gene_id "g1041"; 4 AUGUSTUS CDS 4456801 4457238 0.74 - 0 transcript_id "g1041.t1"; gene_id "g1041"; 4 AUGUSTUS start_codon 4457236 4457238 . - 0 transcript_id "g1041.t1"; gene_id "g1041"; # protein sequence = [MDLINRGRLSVQRVQKPAWDVIELLAERGGWDESKLGKGKNTRGKSTGGRSGNASKDEKNQSKKPSGATRKTRGGKKE # VAGEEEVHSEEKDVESEEGGLILSEDDEGTRHIKITPGKTQGKGQKRKAACSGHADERPSTRSRTRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1041 ### # start gene g1042 4 AUGUSTUS gene 4459909 4460631 0.98 + . g1042 4 AUGUSTUS transcript 4459909 4460631 0.98 + . g1042.t1 4 AUGUSTUS start_codon 4459909 4459911 . + 0 transcript_id "g1042.t1"; gene_id "g1042"; 4 AUGUSTUS CDS 4459909 4460631 0.98 + 0 transcript_id "g1042.t1"; gene_id "g1042"; 4 AUGUSTUS stop_codon 4460629 4460631 . + 0 transcript_id "g1042.t1"; gene_id "g1042"; # protein sequence = [MSGTFSHHEIFSWLTSIFFSRSDSVIYFQICNPYRAAFGITDLRQALIERAQTTLRHVVGARAVQSVVTEREAIAFEI # AEIVGDIADKWGVAIEGILIKDIIFSPEVSASLSSAAQQKRIGESKVIAARAEVDSARLMRQAADILASPAAMQIRQLEACEYNIVLFILGRSNIFSS # VQQMAKSGNSKVIFVPMQLQSDVVNQLASGSGSGTGVGAMIDNEAGDSLGGVGKVGLLNSMADM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1042 ### # start gene g1043 4 AUGUSTUS gene 4461118 4462866 0.47 + . g1043 4 AUGUSTUS transcript 4461118 4462866 0.47 + . g1043.t1 4 AUGUSTUS start_codon 4461118 4461120 . + 0 transcript_id "g1043.t1"; gene_id "g1043"; 4 AUGUSTUS CDS 4461118 4462866 0.47 + 0 transcript_id "g1043.t1"; gene_id "g1043"; 4 AUGUSTUS stop_codon 4462864 4462866 . + 0 transcript_id "g1043.t1"; gene_id "g1043"; # protein sequence = [MDEMLRLKALLAVPRTELNRLELEIARTQLVLDGLLRQKEKIKSYIEAHQALMSPIRQIPSETLADIFVWCLPADRNA # VRSLKEAPLLLTTICRNWRQVALDTPRLWTSLHIFLPPYPSDIAVSKRAIGVKTWLQRSGSLPLSISFHVKPQFGAPPTTTTTMDFSDRLKLLIRTLV # PFGHRFGDLFLSLPSTELGAFNDLSMCQFPILQSFRVRDANVFYGFFYPPGPWNDGTNSENGSRAPFAPLLTQMPALKRLEVAEISVRDGDHLTLSLN # WGLLTDLNLQNGDSTTDQRHGLRVTEAFGILRKTSSLQNLQICIVLMPDHPFDNTSTGMIHLPHLGSIRIEFIPFQFDDHTVPAQVSSVFQYISPPSL # KLFSVACYYPLPMGSGLSGMPPLSGIPFHTLKTLEIATRMTSETLTGWLSCVPELTSFKFKDLGCPAGAESLFAFTNTFRDSHLLALTPSHDNPSPLC # PKLTTFRMINHLPTETRISSSALLGFVQARAPTLKTFDLFFDRDQSFAENDLIELRKLKKNGFQMRLHYAKYPLHEEDLPSDGLHPRPNSQPPTMAHR # ISDMDGVFGTNRIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1043 ### # start gene g1044 4 AUGUSTUS gene 4463201 4464946 0.62 + . g1044 4 AUGUSTUS transcript 4463201 4464946 0.62 + . g1044.t1 4 AUGUSTUS start_codon 4463201 4463203 . + 0 transcript_id "g1044.t1"; gene_id "g1044"; 4 AUGUSTUS CDS 4463201 4464946 0.62 + 0 transcript_id "g1044.t1"; gene_id "g1044"; 4 AUGUSTUS stop_codon 4464944 4464946 . + 0 transcript_id "g1044.t1"; gene_id "g1044"; # protein sequence = [MGEMLRLKALLAVPRTELNRLEMEIAQTQSVLDGLLRQKEKIKSYIEAHQALMSPIRQIPSETLADIFVWCLPADRNA # VRSLKEAPLLLTTICRNWRQVALDTPRLWTSLHIFLPPSLSDIAVSKRAIGVKTWLQRSGSLPLSISFHVKPQFGAPPTTTTTTMDFSDRLKLLIRTL # VPFGHRFGNLFLSLPSTELGAFNDLSMCQFPILQSFRVRDANVFCGSFYAPGPWNDGPSSENGSRAPFAPLLTQMPALKRLEVAEISVRDGGHLTLPL # NWGLLTDLNLQNGDSTTDQCHGVRVIEAFDILRKTSSLQNLQICIVLMPDHPFDSTSTGMIHLPHLGSMRIKFMPFQPDDQSIPAQVSSVFQYISPPS # LKLLSVSWTNPFPMGSALSEIPFPTLETLEIAMEMTPGALTGWLSSVPELTSFKFEDLGCPAGAESLFAFTSTFRNSHFFALTPSHDNPSPLCPKLTS # FRMINHLFPTETRISSSALLGFVQARAPTLKTFDLFFDRDQSFAENDLIELRKLKKNGFQMRLHYAIYPLHEEEDLPSDGLHPRPNPQPPFIAKRNQM # SDMEGVFGTDRVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1044 ### # start gene g1045 4 AUGUSTUS gene 4465543 4466592 0.94 - . g1045 4 AUGUSTUS transcript 4465543 4466592 0.94 - . g1045.t1 4 AUGUSTUS stop_codon 4465543 4465545 . - 0 transcript_id "g1045.t1"; gene_id "g1045"; 4 AUGUSTUS CDS 4465543 4466592 0.94 - 0 transcript_id "g1045.t1"; gene_id "g1045"; 4 AUGUSTUS start_codon 4466590 4466592 . - 0 transcript_id "g1045.t1"; gene_id "g1045"; # protein sequence = [MFVVHAIILTFITTPLVLLFYPAKHRSRIVVEDLGSNIIASSDPSTESDEFTNKFALVLDQIDQLPAAMIVTRLLCPT # ITCTDSKAEISAPSLDEKSLPIIPYQASLPITPLPSPISLTLLRLIELSNRTSAVLKSHLAHTDPVVSVFKTFACLLGGGLKVLKLKVDIDVSPRDEF # TAVIKDRVRENGTGMIVIPWASGSHSTDAEESEIPGVRNPFDSVFTSSESKDQIMSSVLYSEFIRNIFLTAPCDVSLFVDRGPSGTSTTSGVGPDSLL # VLPFFGGPDDRLALKMLVKICAGHEDVRAIAVRVSRGTQDENEEEFDKKHAAEVFLHNVSCFLFLLQGSRADKHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1045 ### # start gene g1046 4 AUGUSTUS gene 4466900 4467697 0.67 - . g1046 4 AUGUSTUS transcript 4466900 4467697 0.67 - . g1046.t1 4 AUGUSTUS stop_codon 4466900 4466902 . - 0 transcript_id "g1046.t1"; gene_id "g1046"; 4 AUGUSTUS CDS 4466900 4467697 0.67 - 0 transcript_id "g1046.t1"; gene_id "g1046"; 4 AUGUSTUS start_codon 4467695 4467697 . - 0 transcript_id "g1046.t1"; gene_id "g1046"; # protein sequence = [MGRIPGFQNAIFPVISLPMLTLTSNIGLVLFLFIIGMEIDGTVIKKNFKASAGISIAGLVIPLGLGAALGVGVYREFT # DPSVNFGYFLLFTAVAVGITAFPVLCRILTELQLLDTTVGVVTLAAGVGNDVVGWILLALTVALVNASSGLVALWVLLTAVGYVFFLLYPVKWGYRWL # ARKTGSLEQGTPSTVMMTVTILLVFISAFFTDIIGIHPIFGGFLAGIIIPHTNGYGIALTEKIEDIVVILLLPLVGHNLITVFISYAHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1046 ### # start gene g1047 4 AUGUSTUS gene 4472883 4475165 0.13 - . g1047 4 AUGUSTUS transcript 4472883 4475165 0.13 - . g1047.t1 4 AUGUSTUS stop_codon 4472883 4472885 . - 0 transcript_id "g1047.t1"; gene_id "g1047"; 4 AUGUSTUS CDS 4472883 4474671 0.97 - 1 transcript_id "g1047.t1"; gene_id "g1047"; 4 AUGUSTUS CDS 4474766 4475022 0.41 - 0 transcript_id "g1047.t1"; gene_id "g1047"; 4 AUGUSTUS CDS 4475148 4475165 0.25 - 0 transcript_id "g1047.t1"; gene_id "g1047"; 4 AUGUSTUS start_codon 4475163 4475165 . - 0 transcript_id "g1047.t1"; gene_id "g1047"; # protein sequence = [MNWSKNFGSQSTSESAEVTNVLESLVNDNEGLKRDNAELQTLLAESRDDLHALQQEVEERRANMPMKSPRSHTGTPLH # ANFGRSHHYSGSLSRHSSLERNGLRPLEPLTPDTLTCELPPLSPGGSDSRSTFGSRSYGPLPPSPYQIEFDGESATGLASPEKTRTHRPLFLLTRSCG # VQTDHLPSNLLGLSPVPTSPAPSTSIPTPSPHDPRSETSSFSDSTTSNMGTIIERMTALFTRMSQADALTLTNRLKRQHLRGADVGHISRNTVNGIIN # ETSTIRIHFRHLLEDEHLVTMCTRKDLRALFKLFREFFVEMGTMRVTLNDVILDPSIATRVSELALDPAKAGVEKNPNGAASSSWMAPISKLFAPSSG # TRADTTAGAERAVSPSTAALSGLTRAPSNWANSRPPRFVPKLQPALSASATTVNVEFSSGVGRSITSSSATPAGPSRQESVVASTTDGGLSSAMGIFA # GAPLSSPDPWVVVPKGPRRVQSTLYRSESPVIFRQPGPDAGLNPNFLSRNVDAVIDEQNTRLPMVDEGANGEEKDIITPLMHHKLKRRGLSDSSIHST # FTGQGDELMPSQGTSTLPSETHWPSKGSVLQALSRKVQSFKSGITDVLPSSSYDDRRHLSGAGTGPRESGSSSRVVSKSGLSGYIPDISSWAATDSMN # IADSLMAVGSPPRDESMMRHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1047 ### # start gene g1048 4 AUGUSTUS gene 4476759 4479061 0.28 - . g1048 4 AUGUSTUS transcript 4476759 4479061 0.28 - . g1048.t1 4 AUGUSTUS stop_codon 4476759 4476761 . - 0 transcript_id "g1048.t1"; gene_id "g1048"; 4 AUGUSTUS CDS 4476759 4477690 0.56 - 2 transcript_id "g1048.t1"; gene_id "g1048"; 4 AUGUSTUS CDS 4477786 4478245 0.56 - 0 transcript_id "g1048.t1"; gene_id "g1048"; 4 AUGUSTUS CDS 4478561 4479061 0.41 - 0 transcript_id "g1048.t1"; gene_id "g1048"; 4 AUGUSTUS start_codon 4479059 4479061 . - 0 transcript_id "g1048.t1"; gene_id "g1048"; # protein sequence = [MRFSNVPATLLHIGMLSVDAYDDELRAAAYDLLGSVCTYLNYDKSPLVAPKGKRDCWLFSARSYSNLAGFVPGTLNGF # VIDLSTRLARFAPQLTLDFISEVVASMTTNDRNKSMQVLQRINCLRYMNPWIKNLELFANPTSPLFERSGARLRDCIRVLTDLSVNLPEAIIKASPRM # PRIPSHNTGWPEVSTLIRIALIAGTETTHPLNNQLYVPEIVHVVTLVAGVGSTLIRKSVYGIIINLVQSLYLARLDEGSAPELLQLIEEMTTQEHVLN # LFGLSRLTTTSEYTSFDVDKEKSIIYQQEKLTALLIRSMDVSSGSKASAFQYSSMIQMRSFTALGALATSDVDDDFMYQMLMAFRTALLQPDNTSDIA # ALVSMLRCITKAVPGLQTDSRHIPQLFWLGVAFLQSSHMAFFEDAAALVTLTMKEMEKRGTFVGAPVAVRLLEARSPIEEPAQQFDSTLQLSCDASFS # FSLAAVLFKGMRHSGLRDSAEEALRTLLRITAHFDAQLQPDVANEDLAYIDPDALGYFIALLAASTTTADYRALLQECGIQDAVLVEDDQTVMSVSEE # ISHVPLVSIDTLGINDPNTALLATSFIGVMLTTAQGDDAESEILYSVLADIAATYPEIIQMA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1048 ### # start gene g1049 4 AUGUSTUS gene 4484971 4486257 0.31 - . g1049 4 AUGUSTUS transcript 4484971 4486257 0.31 - . g1049.t1 4 AUGUSTUS stop_codon 4484971 4484973 . - 0 transcript_id "g1049.t1"; gene_id "g1049"; 4 AUGUSTUS CDS 4484971 4485999 0.77 - 0 transcript_id "g1049.t1"; gene_id "g1049"; 4 AUGUSTUS CDS 4486075 4486257 0.31 - 0 transcript_id "g1049.t1"; gene_id "g1049"; 4 AUGUSTUS start_codon 4486255 4486257 . - 0 transcript_id "g1049.t1"; gene_id "g1049"; # protein sequence = [MPTRRPSASAGIINNGSSSSTRVHKSSDSHSHHAIFGQSHSASSLTHGAPPTPQQKIVQVLLPCNSGEPLIRLESDNA # TQQAVDALVDLAHEALDMIGFALGELLEKLTQVSYIVCIFHVNVFEHHFQQQDPNGVVSIETMQSQLFLLKVLSVAMTTRWQPNLRAASRSSNRPMSD # ADTVRRVPGSSDSSTPISWSEPPPLEEACARYVLSVMILCIRQTVASEPPLIMPSSTFGDISFRDYIAEDINSGAVPFSHIRSSLSSSLPNELRTQPS # SDPVRSSEKVVNSDVILSSNDTAYEKTPTFFTTSSQVLSQQIMKYAGKIIFHISASNWKVVFHRLRLRIHFLATHPDESSDSTDLMILGYSLLDRSRL # LQIMNGTLFCGLLMTRILTVLLQNFLLCWSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1049 ### # start gene g1050 4 AUGUSTUS gene 4488092 4490049 0.2 - . g1050 4 AUGUSTUS transcript 4488092 4490049 0.2 - . g1050.t1 4 AUGUSTUS stop_codon 4488092 4488094 . - 0 transcript_id "g1050.t1"; gene_id "g1050"; 4 AUGUSTUS CDS 4488092 4489200 0.37 - 2 transcript_id "g1050.t1"; gene_id "g1050"; 4 AUGUSTUS CDS 4489266 4490049 0.25 - 0 transcript_id "g1050.t1"; gene_id "g1050"; 4 AUGUSTUS start_codon 4490047 4490049 . - 0 transcript_id "g1050.t1"; gene_id "g1050"; # protein sequence = [MVPQDLAQFQQFVSSNTLPANIADSVTIAVSLPQKTVSYPIGSSTQPMSPINATPSTTSSHSASSLATTASTSSLGAI # STDTGSSASIATTAGGSENGTGPTKLYDSNPVKSALSSSITAPFAQEVPRLSMDYNPAMGSTIAERFLINEESWKHHTQARAILGNLIGPNGEQLTST # DPYNTTVFVGGLSPLIQEETLRTFFAPFGDIHYVSFHDIAFGILANSSNLKVKVPVGKHCGFVQFVRKADAERAIEKMQGFPIGGTSHRPPDKAAQAA # AQAAQAAAMQSQSGPQTLHNMTMPMPSSLQSDNTSVSAVSTAHLTQEQAIQLLQKLSQQTYTEQPFSFSSSPTSSSMNGVNVGAYANSIARGAQGVSS # AHALERMFVNPSPTTALYSEEQLRSAHLSGREDLVGAPSYNGYFDLQTFSAQQQEQQHQGQQGQPSTRQSSSVPHAHQPRFSQHLQFPRDAVAGAVPF # SPFSPDPNATHVYHKNVFSDAQGREPHGFPPLDEPIDTGASSAARYTSSSARPPSVSQYTSFQGLMPRPGSGSTSTSPTNRTNIPVPISRPLSGQPTS # TSGVDPFEMHDLNGTLASLDLGEASLSSVMDSRPWGVKSPAGSSDSSASVQFQMTRDDVTSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1050 ### # start gene g1051 4 AUGUSTUS gene 4493428 4494294 0.54 + . g1051 4 AUGUSTUS transcript 4493428 4494294 0.54 + . g1051.t1 4 AUGUSTUS start_codon 4493428 4493430 . + 0 transcript_id "g1051.t1"; gene_id "g1051"; 4 AUGUSTUS CDS 4493428 4494294 0.54 + 0 transcript_id "g1051.t1"; gene_id "g1051"; 4 AUGUSTUS stop_codon 4494292 4494294 . + 0 transcript_id "g1051.t1"; gene_id "g1051"; # protein sequence = [MSSSTLINGFTVIPISYSSSSIHYIYARAHVSNKKAPNSWPSGRTLFLVNAPPDATERDLILLLKPYGTVEKVIFDSD # SAVEDADEEDSDSEDGEEEGGVHNHGDEESQPRKRQKLTMKKVEPPKVLPLPSMPLRKLRKTGQTAHVVFLDTSSLDRFFSASHTKPRSWPNSSEEPS # GLSHYLALSDSLRPPLDAVRQHANSAMDLYEFELAKSKRQSKYKKGEAIVDEDGFTLVTRGGAYGQTVGGGVAVATKKFQETGETSERTKKHSKEKTS # FYAFQKAEKQRNGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1051 ### # start gene g1052 4 AUGUSTUS gene 4496485 4496895 0.79 - . g1052 4 AUGUSTUS transcript 4496485 4496895 0.79 - . g1052.t1 4 AUGUSTUS stop_codon 4496485 4496487 . - 0 transcript_id "g1052.t1"; gene_id "g1052"; 4 AUGUSTUS CDS 4496485 4496895 0.79 - 0 transcript_id "g1052.t1"; gene_id "g1052"; 4 AUGUSTUS start_codon 4496893 4496895 . - 0 transcript_id "g1052.t1"; gene_id "g1052"; # protein sequence = [MSIRTLLTIVLPPIPTEGLTANDVPELAERVRDQMLDALRDISVKVEPAPAEEPRDLPPPTTSSDPALVSSPSNTKEE # GAFSPPDVNPEQVLEARTSSVVSIASSDSNHREQRSEPSENGTETEEDEGMILVGRPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1052 ### # start gene g1053 4 AUGUSTUS gene 4499501 4500700 0.12 + . g1053 4 AUGUSTUS transcript 4499501 4500700 0.12 + . g1053.t1 4 AUGUSTUS start_codon 4499501 4499503 . + 0 transcript_id "g1053.t1"; gene_id "g1053"; 4 AUGUSTUS CDS 4499501 4499880 0.12 + 0 transcript_id "g1053.t1"; gene_id "g1053"; 4 AUGUSTUS CDS 4500055 4500700 0.52 + 1 transcript_id "g1053.t1"; gene_id "g1053"; 4 AUGUSTUS stop_codon 4500698 4500700 . + 0 transcript_id "g1053.t1"; gene_id "g1053"; # protein sequence = [MLRLTVSTTTTAESSSSDQTTTATIINPPSENSAPPESGLSSAGPETNDNTCNLSSTTSQSAAARSQIAPIFAACLPI # IHARGRNIVMAQQLVEGAKQNLSMTVHLQSLGFGEDDNDRDDDDDKEEEFKSLPLSHMSFSMTHSVVLPYPIDHVFHALSDADQMERLQKLTPEAQKF # SLLPPDIVSLPHCALSSLTHADTMPEGCPRVRDLPPSSLDQPADSEMRTFQRTQFEFSGTVSILFGLFNRALSVSGAQIIDEEAKVVLFESGVVAQGI # KEVKLRTFRPILLPDDSNGEEPRKSGTEVKETVWGTSPFGLSLLLKFLAPWIHRHHMELYSKLFEST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1053 ### # start gene g1054 4 AUGUSTUS gene 4504420 4505148 0.38 + . g1054 4 AUGUSTUS transcript 4504420 4505148 0.38 + . g1054.t1 4 AUGUSTUS start_codon 4504420 4504422 . + 0 transcript_id "g1054.t1"; gene_id "g1054"; 4 AUGUSTUS CDS 4504420 4505148 0.38 + 0 transcript_id "g1054.t1"; gene_id "g1054"; 4 AUGUSTUS stop_codon 4505146 4505148 . + 0 transcript_id "g1054.t1"; gene_id "g1054"; # protein sequence = [MISYYPFHSVWSYEAISEDVGANNNNAFTHCASSTSTSASTSTSSSTPNVIASSQTTSTSAAPTSGNTVTVPTQTPDT # TKQPSPSSLSNSASSATPASGISTTSFTSISGSTIILGSTFTVIYPSSISYSGSSLISTSASGNTSSTAPASGGTSGSSQTFLTPSSRMSKGMIGGIT # GAAIGAVCAVLALWFLCRSLRKRKDAGKTATHDTSLVNDEPFTNQPTSWYTTTGMPSSLCIDVLVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1054 ### # start gene g1055 4 AUGUSTUS gene 4510198 4510875 0.99 + . g1055 4 AUGUSTUS transcript 4510198 4510875 0.99 + . g1055.t1 4 AUGUSTUS start_codon 4510198 4510200 . + 0 transcript_id "g1055.t1"; gene_id "g1055"; 4 AUGUSTUS CDS 4510198 4510875 0.99 + 0 transcript_id "g1055.t1"; gene_id "g1055"; 4 AUGUSTUS stop_codon 4510873 4510875 . + 0 transcript_id "g1055.t1"; gene_id "g1055"; # protein sequence = [MISYYPFHSVWSYEAISKDVGANNNNAFTHCPTTSISTTSTSTSSSATSTSVSGSIATVAVQAVDTTDIPLSSNSASS # STTPASVTSSAGSASIPASGSTIILGTTFSVIHPSSNSYFGSPPMSTSISSDANGTTPGSTEGSNQTFLAPSSHTSKGLIGGIAGAAIGIVCALLALW # FFCRSSRKRKGASRTVTHTPANVEPFADREPSWYTAGIVASYPLGDLAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1055 ### # start gene g1056 4 AUGUSTUS gene 4512191 4512891 0.59 - . g1056 4 AUGUSTUS transcript 4512191 4512891 0.59 - . g1056.t1 4 AUGUSTUS stop_codon 4512191 4512193 . - 0 transcript_id "g1056.t1"; gene_id "g1056"; 4 AUGUSTUS CDS 4512191 4512315 0.61 - 2 transcript_id "g1056.t1"; gene_id "g1056"; 4 AUGUSTUS CDS 4512498 4512891 0.63 - 0 transcript_id "g1056.t1"; gene_id "g1056"; 4 AUGUSTUS start_codon 4512889 4512891 . - 0 transcript_id "g1056.t1"; gene_id "g1056"; # protein sequence = [MPLVSISWYVSPTNTINLSGQPQKSEPKIFQILIRTHQTTLFFTVPPSTTVGFLKEQTLSALNSGLNEEEDIPPVKEV # GDFELCRCRVIKGKDRNADVQREYDILDEPESTIKGIKLANWEVLYLQFKDEEVAFDPPIDDEEDVEPQSTVPSSPPVNKGKRKATVYDEEDSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1056 ### # start gene g1057 4 AUGUSTUS gene 4518526 4519606 0.33 - . g1057 4 AUGUSTUS transcript 4518526 4519606 0.33 - . g1057.t1 4 AUGUSTUS stop_codon 4518526 4518528 . - 0 transcript_id "g1057.t1"; gene_id "g1057"; 4 AUGUSTUS CDS 4518526 4519024 0.36 - 1 transcript_id "g1057.t1"; gene_id "g1057"; 4 AUGUSTUS CDS 4519144 4519293 0.86 - 1 transcript_id "g1057.t1"; gene_id "g1057"; 4 AUGUSTUS CDS 4519386 4519606 0.94 - 0 transcript_id "g1057.t1"; gene_id "g1057"; 4 AUGUSTUS start_codon 4519604 4519606 . - 0 transcript_id "g1057.t1"; gene_id "g1057"; # protein sequence = [MLSKQILPEPTGSSEGREGELRFESPSPSVSSQQTELTSTETDALPSEMERTASISPAPETVPSTSSLKPDWSPLEVE # ILSNKFQKNVQFPQTDHSYYYPDSNGGYPGSDSNPAVNFAFLFSSRNARNLSSHPVPTYGQSTETRYYEAPSRESLLWKVDSATEQTESMDRISGSTF # SNTRRYMPNALTSRHQIYTSDDFGQEPSPLEGFRPLQPDFEFGSHAGHFNQMTPGTALGSNAESGHINYHPSAVLGRNIPTSTMTMNSGLIYPSDTGH # PQHGKLVFASEGIKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1057 ### # start gene g1058 4 AUGUSTUS gene 4520954 4522903 0.95 - . g1058 4 AUGUSTUS transcript 4520954 4522903 0.95 - . g1058.t1 4 AUGUSTUS stop_codon 4520954 4520956 . - 0 transcript_id "g1058.t1"; gene_id "g1058"; 4 AUGUSTUS CDS 4520954 4522903 0.95 - 0 transcript_id "g1058.t1"; gene_id "g1058"; 4 AUGUSTUS start_codon 4522901 4522903 . - 0 transcript_id "g1058.t1"; gene_id "g1058"; # protein sequence = [MLRPYTKSIDNSLELFRLIGDLLFAIISFPLRPVAALLPSFFGPRSLGDDIPPPYSEDPAAGDQHIPPSDFQQSSVHV # STFHPADPTADMEWRQYPNLPSAYPPTPLVTSSRLPVQGHVGYDASSAAGPHTIWIPPVVDEDEEDDGENQQGFRRSLLPPRVPLHPGLGNYDGLSDE # SDRGAENHQIIEIADFQSNGRASGETSSAEETDDMEMDDDERNHRHSSDGDAGTDSEEDSFNITLQTPRVPLSLQPSSATMSRSTIRLRASARSVFAD # LERETEGRRHLSGSVLLPPLDTTSKSGQGSSPSSIDSGSLSISSGDDSAFMSLPNPHSVVPSLIPISGTKNDDSMSDSSLGSAPGAGPATTTIRSISP # TGRGRKRSHSRSFPPEHSQRYTRSNALTFAGSTLQRLSSNESSSSSRAPSPSNDADVHEAVADTTLKDIRVLVDVEPISPSSASPVETQLGDVKSNNP # TGENADEVQPAEGSVAGPRKRRKVVSLSSGPGQGGPPTSESEPTSRSHTGSIPKPSDAFSSDKRKKGFLSTRTRRQLSGASTSASEGTDGPSSSDNDR # STRPASSSKGKGRSATPSSTRVSSVPTRRQFDVSHKLAGASASIRMTRSTVGLAPTAGTGTEASANDHPLRLARARAKKRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1058 ### # start gene g1059 4 AUGUSTUS gene 4523964 4524587 1 + . g1059 4 AUGUSTUS transcript 4523964 4524587 1 + . g1059.t1 4 AUGUSTUS start_codon 4523964 4523966 . + 0 transcript_id "g1059.t1"; gene_id "g1059"; 4 AUGUSTUS CDS 4523964 4524587 1 + 0 transcript_id "g1059.t1"; gene_id "g1059"; 4 AUGUSTUS stop_codon 4524585 4524587 . + 0 transcript_id "g1059.t1"; gene_id "g1059"; # protein sequence = [MDQYVPRDFVSAPAHTDSAPSTPDRSAGKIRIPPLSVIRKPNTYTHREIFGTDDEYEDDRHQDNDPQRFLDSLDFDPH # NMTIPFPSPRKIAGSKRVVSAQNAQRLREQAGWKAGELSRASAPTQEVFQSITATPNLSGGSFEEFRAECYAQSYIATGGPPLPSIPLSVNAFGVYQP # AQSIPPTFQPCLVVNQPQETWNTSDVEMSDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1059 ### # start gene g1060 4 AUGUSTUS gene 4524979 4526626 0.8 - . g1060 4 AUGUSTUS transcript 4524979 4526626 0.8 - . g1060.t1 4 AUGUSTUS stop_codon 4524979 4524981 . - 0 transcript_id "g1060.t1"; gene_id "g1060"; 4 AUGUSTUS CDS 4524979 4525870 0.81 - 1 transcript_id "g1060.t1"; gene_id "g1060"; 4 AUGUSTUS CDS 4526613 4526626 0.89 - 0 transcript_id "g1060.t1"; gene_id "g1060"; 4 AUGUSTUS start_codon 4526624 4526626 . - 0 transcript_id "g1060.t1"; gene_id "g1060"; # protein sequence = [MQFGLQYTQQTINKAIASNDNNTFTHCASTTLNNTSSASSVSVSATSSPISSSSSHLTGGAIGGVVVGTIVGVVGAAL # IVWFCWWKRKERSKTTKPENKIEPFTPQGAETETHNRRGNDPAETALSELTFSAFHISGGVSNSSKLYHDPAVYQGEPSVMSSPSPPGAAGPSYASAY # TGYPNGLISAYGAPSPLYPQSPSQLDSPSPILTGSLPTEKGARLYSSADQPTSPVPTTMGSMSSRPMLSPSGHSYNQSLGAFTEDSEREQLSIMSSIP # ERHMDGGRIPDEMLDGRLPPAYGDQLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1060 ### # start gene g1061 4 AUGUSTUS gene 4544580 4545404 0.29 - . g1061 4 AUGUSTUS transcript 4544580 4545404 0.29 - . g1061.t1 4 AUGUSTUS stop_codon 4544580 4544582 . - 0 transcript_id "g1061.t1"; gene_id "g1061"; 4 AUGUSTUS CDS 4544580 4545404 0.29 - 0 transcript_id "g1061.t1"; gene_id "g1061"; 4 AUGUSTUS start_codon 4545402 4545404 . - 0 transcript_id "g1061.t1"; gene_id "g1061"; # protein sequence = [MRSELRDNETESGVSTQMPSVQSSLNLTDAMSSESMKPTLENSSVLPSTLTVFSSTTVLPAGLLENHDESSLTIPKSL # STSKTRISRLMELVSSVQGLLQHEVKLQQFASRREEEPAATGTITVAPTIPALATTSAPVVVHPSTELMTALHLTERPLELSAKKLVGTRFEALARSH # PSEMEMGDTYDNPVSQSLSPYLPRYSRGFTWRNTSSCSSRTARYTEVDNPLPRPPKHEFQNKAALHTITTHPELFNISTPIRVDRLRKNSPRTLTKSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1061 ### # start gene g1062 4 AUGUSTUS gene 4558456 4559517 0.36 + . g1062 4 AUGUSTUS transcript 4558456 4559517 0.36 + . g1062.t1 4 AUGUSTUS start_codon 4558456 4558458 . + 0 transcript_id "g1062.t1"; gene_id "g1062"; 4 AUGUSTUS CDS 4558456 4558951 0.58 + 0 transcript_id "g1062.t1"; gene_id "g1062"; 4 AUGUSTUS CDS 4559087 4559517 0.56 + 2 transcript_id "g1062.t1"; gene_id "g1062"; 4 AUGUSTUS stop_codon 4559515 4559517 . + 0 transcript_id "g1062.t1"; gene_id "g1062"; # protein sequence = [MQATLETEIYQLRNRNRKQASVSKGKAPQKTTDHDGDAAMDADDEEEEIVSTNPLATASASPSTFNISSSSADPANAI # PSGYFSTTGTSTAGSSDSAAPSGSNIPLNSSSGIDVSAIVSEALRQLNHVPSKSSYTPKEGSVAYAKQVKKTAMSALPKDLKREWRVLDEFAKGTGPG # PEAKTAFHLYFGDEWRKTKWNRNVVQNLNVLINSQKKQARVAGNLSPEVIDAYLWDLIAQSRISWRARKPRPHATEHRWETVVEAVARAEDYEARREK # ELRINSRKRVVSASDILSTSFDCVLRNMKNAKKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1062 ### # start gene g1063 4 AUGUSTUS gene 4562299 4563299 0.48 + . g1063 4 AUGUSTUS transcript 4562299 4563299 0.48 + . g1063.t1 4 AUGUSTUS start_codon 4562299 4562301 . + 0 transcript_id "g1063.t1"; gene_id "g1063"; 4 AUGUSTUS CDS 4562299 4562456 0.48 + 0 transcript_id "g1063.t1"; gene_id "g1063"; 4 AUGUSTUS CDS 4562510 4563299 0.85 + 1 transcript_id "g1063.t1"; gene_id "g1063"; 4 AUGUSTUS stop_codon 4563297 4563299 . + 0 transcript_id "g1063.t1"; gene_id "g1063"; # protein sequence = [MPSADMNCHLELPEDIPLDIFKIDSLDPESFPTSGEIFDNHNSLRFPYEGEGFPHQWEYNSNDDGSHQQEYNVNNNNG # ILGTMLSGLDGSYQQGMDFNDEGSLDLMFPGLDNPYQREYIFNDNYLYEPIDPQIPLWQAYQLDGLRQSQEQPNLPLHAPVPIRPISIILLTNFEDMP # NPLPLSGPSPTLNSDSGVIIDAVHTTNPAPSHNADVPSQAEELQPDLSLLRLPSPPLSSLAITPREQNRQYLECLEEYTLYLNNKITQIGAQPAPMGR # FHPKEHSMSVHSLRVNTFLISCFKQILNFPDYSSTPIKFTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1063 ### # start gene g1064 4 AUGUSTUS gene 4565156 4566468 0.96 - . g1064 4 AUGUSTUS transcript 4565156 4566468 0.96 - . g1064.t1 4 AUGUSTUS stop_codon 4565156 4565158 . - 0 transcript_id "g1064.t1"; gene_id "g1064"; 4 AUGUSTUS CDS 4565156 4565868 1 - 2 transcript_id "g1064.t1"; gene_id "g1064"; 4 AUGUSTUS CDS 4565961 4566468 0.96 - 0 transcript_id "g1064.t1"; gene_id "g1064"; 4 AUGUSTUS start_codon 4566466 4566468 . - 0 transcript_id "g1064.t1"; gene_id "g1064"; # protein sequence = [MLKRRFVPCIFDEVENVEDYQPGGFHPVRIGDQFKDGRYRILHKLGNGGSSTIWLARDEQSLELGLGKLVTIKALRAD # AFKINPPEVVVPTLMPCSESFDFYRKAEDNFVVNGPNGSHTFIVSAFAGPSVRTISKFPENRRLRADLARRIAAQASSTLQHIHQAGFVHGDDVQKWS # DDELYFQLESPETDPVRTLNGQPIGPQVPSEVTEAIDSFIFFENGLLQENIVVIDFGQSYAGSEPPKDYKPRTMRNYMSPETRFEGRVGPEADVWTLG # CAIFEIRAGFPLFDPFFPSDAVILTKIVGTLGRLPDPWWNVFKNRHLFEEDGRPKTKKGIAFTPSIRELLLSIGTRDEIMDSDGGPMFEQTEMKIDGT # EVDLLVDLLEKMLKYRPEDRIGIDEVVSHPWFKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1064 ### # start gene g1065 4 AUGUSTUS gene 4571083 4571652 0.71 + . g1065 4 AUGUSTUS transcript 4571083 4571652 0.71 + . g1065.t1 4 AUGUSTUS start_codon 4571083 4571085 . + 0 transcript_id "g1065.t1"; gene_id "g1065"; 4 AUGUSTUS CDS 4571083 4571652 0.71 + 0 transcript_id "g1065.t1"; gene_id "g1065"; 4 AUGUSTUS stop_codon 4571650 4571652 . + 0 transcript_id "g1065.t1"; gene_id "g1065"; # protein sequence = [MTADRTKELRFRMVSLGENHGLTQDVTHNTAPFRLIVLGCMLANKWLEDHPPTKLGTLISAVSLGFHSSSLLRNRISN # IPIKILNQLESRALDIFAYDLSISTADWSDWLLHVMSYHLSPSSPSSPQPLSRPSANPHLIIKLALEEIINAPKACDSDSPQPRAVFLGLEERRREKQ # EKEQAHKANLKLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1065 ### # start gene g1066 4 AUGUSTUS gene 4574705 4575453 0.31 - . g1066 4 AUGUSTUS transcript 4574705 4575453 0.31 - . g1066.t1 4 AUGUSTUS stop_codon 4574705 4574707 . - 0 transcript_id "g1066.t1"; gene_id "g1066"; 4 AUGUSTUS CDS 4574705 4574951 0.84 - 1 transcript_id "g1066.t1"; gene_id "g1066"; 4 AUGUSTUS CDS 4575150 4575274 0.74 - 0 transcript_id "g1066.t1"; gene_id "g1066"; 4 AUGUSTUS CDS 4575325 4575453 0.37 - 0 transcript_id "g1066.t1"; gene_id "g1066"; 4 AUGUSTUS start_codon 4575451 4575453 . - 0 transcript_id "g1066.t1"; gene_id "g1066"; # protein sequence = [MTPIGSRLASGGRELDTYAPYAGLDSEAIQGIHILFDQATVSPVSQLILGTARIAHPELVKKIMELSKNCDRLGLAGA # NIYNCTGDFDANFTHGTMLPSRHTLQNLNSHAPPDVELGANLRRGVTASNGHHLTITKKNCARAEANASIRAQYSLRSQYWEELQQKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1066 ### # start gene g1067 4 AUGUSTUS gene 4589438 4591381 0.82 + . g1067 4 AUGUSTUS transcript 4589438 4591381 0.82 + . g1067.t1 4 AUGUSTUS start_codon 4589438 4589440 . + 0 transcript_id "g1067.t1"; gene_id "g1067"; 4 AUGUSTUS CDS 4589438 4591381 0.82 + 0 transcript_id "g1067.t1"; gene_id "g1067"; 4 AUGUSTUS stop_codon 4591379 4591381 . + 0 transcript_id "g1067.t1"; gene_id "g1067"; # protein sequence = [MQVCFDLNPDFLRTYALQDNIPGTDTVGLDQINQVLIVLIVICNTVMGLSTTQCNFLVAIAGMLIKLAMSTNGSAEGS # RLDHTFSPSQNGIISDMPTSLADALKKFGVDGVFIPYATCPSCNFTNKGLPLENGVYHWPDTCTNNIVGKQGITTCGTPLLFHRKNGTQPIKPYLVGS # LPDYLVRCLADPTYLEQSVQATDTALHDIQSGIKSERTGVHDVFEAEFIKDFQGPGGKLFVDRGNKIRLAFSIHVDFFNPNGITHRGAHDSIGVISCA # NLALDSSIRYLPEFMFLAGIVPGPNEPKGDEIDNFMRPVVEQFVQAWSPGFKVSRTASSEVPVVVEAGILLSVNDLPAARKVAGFQGIRSRFICSICQ # LRGTDQVFSTDCDHWIHWDVKNLRHWAYTYKNALTLGDRKQIWEEHGVRWSSLWMLEYWDPTKMLVIDAMHCILEGLIQYHCRHVLRLDASSTSISSE # GLKYAFDWPWIPYDEDLVPGGCNKLSQKHIPRVANIHQTLCLALAGDKALTLEAMWIRLENTAPRDALHFVAYTLSLPPILVDIDEQISSIYVKRAKK # NSTSKNPRQFIFPSAKPATQKSHFIALLLNWVSNAFSLLRLFTEKSLRDYSNPSTQMLTLFQLEMQKLSPTFRMLFARL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1067 ### # start gene g1068 4 AUGUSTUS gene 4591913 4592440 0.45 + . g1068 4 AUGUSTUS transcript 4591913 4592440 0.45 + . g1068.t1 4 AUGUSTUS start_codon 4591913 4591915 . + 0 transcript_id "g1068.t1"; gene_id "g1068"; 4 AUGUSTUS CDS 4591913 4592440 0.45 + 0 transcript_id "g1068.t1"; gene_id "g1068"; 4 AUGUSTUS stop_codon 4592438 4592440 . + 0 transcript_id "g1068.t1"; gene_id "g1068"; # protein sequence = [MESTIIQSWARTANLRRWLRRPDCPQAITQLQVIFNKCFVPVNAPSMTEEFVKTKGSHRAYAKFDGVNFSGVETHVGN # ATIFYRSARSAVPVVGQIQSIENASTSRTLRLYVRPYQQLSKASYDPFVRYPYLQATTYSSQLDEVEEMISLDDVVSHAARYDYSHNRSVFINLSRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1068 ### # start gene g1069 4 AUGUSTUS gene 4601214 4601423 0.4 + . g1069 4 AUGUSTUS transcript 4601214 4601423 0.4 + . g1069.t1 4 AUGUSTUS start_codon 4601214 4601216 . + 0 transcript_id "g1069.t1"; gene_id "g1069"; 4 AUGUSTUS CDS 4601214 4601423 0.4 + 0 transcript_id "g1069.t1"; gene_id "g1069"; 4 AUGUSTUS stop_codon 4601421 4601423 . + 0 transcript_id "g1069.t1"; gene_id "g1069"; # protein sequence = [MEKTQTAIEELGNESIEASAESTRINRDGSLPEDIPKADADPFDVPDGGTAAWLCAFGVRRSLFTIFMM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1069 ### # start gene g1070 4 AUGUSTUS gene 4608823 4611892 0.52 - . g1070 4 AUGUSTUS transcript 4608823 4611892 0.52 - . g1070.t1 4 AUGUSTUS stop_codon 4608823 4608825 . - 0 transcript_id "g1070.t1"; gene_id "g1070"; 4 AUGUSTUS CDS 4608823 4608952 0.53 - 1 transcript_id "g1070.t1"; gene_id "g1070"; 4 AUGUSTUS CDS 4609068 4611892 0.52 - 0 transcript_id "g1070.t1"; gene_id "g1070"; 4 AUGUSTUS start_codon 4611890 4611892 . - 0 transcript_id "g1070.t1"; gene_id "g1070"; # protein sequence = [MGASVIDYVLASKPALVSLTEGALKVSRSPLSDHAALELTIPYHPPAAPVPVLQSDMLTHHQISPLLSPTNLDLMVQD # ALRSTRTTAEAIDTLYGPVYADNGGIVVYLTASSGRDDMGSPQAAFSLFWGENSENNVSFRIQTVPKPTINHALLSAMIPALQIANRLPERTLHINVT # SEYLVRSLCYWAADNAEHAWDCAHSDILKVVVSHLCARVAAVEFHVIPTRGNGHLQRAKDIAYKTVRDVNANVWSLLAPHPLPHPEHLAQSIPNVRKV # STRLPEHVPPKLWTAVGPNDPDREDEDCIPRESHRGRAHEREQRRGNLVKLINCETALSFWSCVREWTDAKKRPVSVSAQQLSTVFEARLNPLPHPPA # YFDRDVRQLNTLLSSAIPRQTTDHTASRFFSRSITDDDVALCKKKLRGRSSKSARGIDRVSYRQIERIPNTTLAALFNRCIFDLDAPQQWFTTVLIGI # LKVGLNAKEPDSYRIIGLESCLLKMLTLIIDHRVRAWAEEAGILPNSQNGFWEGYRTHNNSFILRCAIETARANDKPLYVAFVDLKNAFPSTDIPTLW # RKLFNRGMSGPLFDWLRLLYARMTYVVHHGDEVTAAFRSLIGVLTGDTLSPMLWNIYFSDLHIPVHADDVYLNGNPVSHVEQADDVAIWSMSPEGLQD # KLNHFFRWCQLNSMVISVKKTKWMLFGPLPPLLPIFLIDSKRIELVPSYKYVGLNFTSVHKYILQAIYNIKAGKARNVTRATFALEPAIGCLPPQEGI # TLYMARVDPHLIFGCEIVLDIDLTLLEDLENVQHLYLRRLLGVNRRSTLAFLFTELGIEPIRYRRIKLALSYLHSLLSLQGHRLVTDALAHSFHLVRM # GQPAWISDLRNVLCHLPVPVLCTVDNLADPEALPHIIKEVELSCEESLSSMVRDSVKAHLLHNCTDYNEMGLPALLSATIIVHPSHAYGVCVAFAGCL # LRMSAMLSFNAAKTLPWSTSVNGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1070 ### # start gene g1071 4 AUGUSTUS gene 4615324 4616255 0.43 + . g1071 4 AUGUSTUS transcript 4615324 4616255 0.43 + . g1071.t1 4 AUGUSTUS start_codon 4615324 4615326 . + 0 transcript_id "g1071.t1"; gene_id "g1071"; 4 AUGUSTUS CDS 4615324 4615450 0.43 + 0 transcript_id "g1071.t1"; gene_id "g1071"; 4 AUGUSTUS CDS 4615504 4616255 1 + 2 transcript_id "g1071.t1"; gene_id "g1071"; 4 AUGUSTUS stop_codon 4616253 4616255 . + 0 transcript_id "g1071.t1"; gene_id "g1071"; # protein sequence = [MEGHRRGECEGSTEPSESGSQNDSDDNDYLARAGSNGEVKGEHTTYPKIPRSSPFRLTRASYKAAQNHNDDQFAVGGD # RDPGIRPPTGTPPKQKTKNSNLKSKKLPTSRNDDGGLVAVVLTDQEDSSSFDGQEQKPLFTAVETNPKAETSTVSAVKHEEEALPSPNAIIYASSDFL # ELGEAGAALRDRLLENTEGKEGHVGMFYTPTPVRDRKSYAYKEWIVVGRGEGSEALVKHIVRLADSQSVLRNRAPGTFVVGGELEVVEGPRIVTIPQL # VFGSFVAVVLLMYVLSTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1071 ### # start gene g1072 4 AUGUSTUS gene 4619881 4620912 0.51 + . g1072 4 AUGUSTUS transcript 4619881 4620912 0.51 + . g1072.t1 4 AUGUSTUS start_codon 4619881 4619883 . + 0 transcript_id "g1072.t1"; gene_id "g1072"; 4 AUGUSTUS CDS 4619881 4620021 0.7 + 0 transcript_id "g1072.t1"; gene_id "g1072"; 4 AUGUSTUS CDS 4620079 4620912 0.73 + 0 transcript_id "g1072.t1"; gene_id "g1072"; 4 AUGUSTUS stop_codon 4620910 4620912 . + 0 transcript_id "g1072.t1"; gene_id "g1072"; # protein sequence = [MHPLSDAAKVITDSGSVIVAVVAKIDVLEQSNDAALRSWAKDFAVAVARYRGVNRILSKWRDKPSFLEPAEVKDALVA # ADDFLLKHTHWTWDEAWLDSRWKRAALERKKIWEAEEERLRKLREEEEISTILAEAQAFLKTDVVVFDYPTEEEWEALRNQPPLQEDPAPISFFNPTL # DMPSESPDSSFGNSPLSFSDMSMSSPSSPPSAAPTPLQSPKIPVGNIDRIWDDPVLPAPQIGPSSNRADPGTQLNKELHGEPTARKIAPVSSGSGSTG # KHVGPAKSMDSASASEGHVSTSYDSTSGQASINADVVIRPRTTRATLPHY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1072 ### # start gene g1073 4 AUGUSTUS gene 4623875 4624549 1 + . g1073 4 AUGUSTUS transcript 4623875 4624549 1 + . g1073.t1 4 AUGUSTUS start_codon 4623875 4623877 . + 0 transcript_id "g1073.t1"; gene_id "g1073"; 4 AUGUSTUS CDS 4623875 4624549 1 + 0 transcript_id "g1073.t1"; gene_id "g1073"; 4 AUGUSTUS stop_codon 4624547 4624549 . + 0 transcript_id "g1073.t1"; gene_id "g1073"; # protein sequence = [MEDTPRAVTDGTWSSFELKRSDDTLYFNSLENVKLTSLSFISSSNSAEASILALGSSHVLLAGLTGSTSNREVVLLFW # DLSFSVLLASRTLPLPPYVVTNEKVSITLVGALSSSNVLLLVSPTSVISGRRQSQGQSSSSSSVWVVPVTVPPSSSIANAIGRAAAAMPWLAVSDAQG # DSHDAVRTKLVNEMRSAMDRNQPENANNVFFEWEKQAVLENSQDKLVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1073 ### # start gene g1074 4 AUGUSTUS gene 4625679 4625882 0.76 - . g1074 4 AUGUSTUS transcript 4625679 4625882 0.76 - . g1074.t1 4 AUGUSTUS stop_codon 4625679 4625681 . - 0 transcript_id "g1074.t1"; gene_id "g1074"; 4 AUGUSTUS CDS 4625679 4625882 0.76 - 0 transcript_id "g1074.t1"; gene_id "g1074"; 4 AUGUSTUS start_codon 4625880 4625882 . - 0 transcript_id "g1074.t1"; gene_id "g1074"; # protein sequence = [MALISQAQGALDTDDNDTEYDDLDPKTIAAYEQTINDFTALTGELNQQLEVLAKVVKPGGLSGGANM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1074 ### # start gene g1075 4 AUGUSTUS gene 4628998 4629444 0.99 + . g1075 4 AUGUSTUS transcript 4628998 4629444 0.99 + . g1075.t1 4 AUGUSTUS start_codon 4628998 4629000 . + 0 transcript_id "g1075.t1"; gene_id "g1075"; 4 AUGUSTUS CDS 4628998 4629444 0.99 + 0 transcript_id "g1075.t1"; gene_id "g1075"; 4 AUGUSTUS stop_codon 4629442 4629444 . + 0 transcript_id "g1075.t1"; gene_id "g1075"; # protein sequence = [MGYSTLSNLGAPTFFETAVKQGVVASPEFSFFLSANGSELYLGGTNSQLYTGDIEFHDVNTSPGYWKISGGSVGVPSN # AGVVSGIDTVVDSGTTLIYGPPNDVKNLWAAVPGAAAYDAEPGFYTYPCNQTLGVSFSWGGKNWSIPDEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1075 ### # start gene g1076 4 AUGUSTUS gene 4631374 4632286 0.92 + . g1076 4 AUGUSTUS transcript 4631374 4632286 0.92 + . g1076.t1 4 AUGUSTUS start_codon 4631374 4631376 . + 0 transcript_id "g1076.t1"; gene_id "g1076"; 4 AUGUSTUS CDS 4631374 4631423 0.92 + 0 transcript_id "g1076.t1"; gene_id "g1076"; 4 AUGUSTUS CDS 4631473 4632286 1 + 1 transcript_id "g1076.t1"; gene_id "g1076"; 4 AUGUSTUS stop_codon 4632284 4632286 . + 0 transcript_id "g1076.t1"; gene_id "g1076"; # protein sequence = [MEWRMANKEAKGISGKNSYCRGVADGFYDFSKKEKRREEKEAEAAELRRLETQREAEEAQRLQLEIIETKPALDDRKV # KIEVASPFRPSSYESDSEDDLGDAGYDDGDYGYNGNDEGSDLQAGLNTKEALEEDAVAPHFPSKEGVHDLDLDQLLKISDERARKQAENPDIALNKDK # KKKRNTRRVKGDLIEDVKSTTGEANEVPKNKVEEPEEPSWQSAGALIAFRQTSLLVAEEYLKKRGLKLYKRGKLAALTFKDANAKQSYDKGWEDAKKI # DLKTKKIKASEDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1076 ### # start gene g1077 4 AUGUSTUS gene 4633583 4636145 0.16 + . g1077 4 AUGUSTUS transcript 4633583 4636145 0.16 + . g1077.t1 4 AUGUSTUS start_codon 4633583 4633585 . + 0 transcript_id "g1077.t1"; gene_id "g1077"; 4 AUGUSTUS CDS 4633583 4633589 0.45 + 0 transcript_id "g1077.t1"; gene_id "g1077"; 4 AUGUSTUS CDS 4633696 4634056 0.21 + 2 transcript_id "g1077.t1"; gene_id "g1077"; 4 AUGUSTUS CDS 4634201 4634516 0.49 + 1 transcript_id "g1077.t1"; gene_id "g1077"; 4 AUGUSTUS CDS 4634571 4636145 0.92 + 0 transcript_id "g1077.t1"; gene_id "g1077"; 4 AUGUSTUS stop_codon 4636143 4636145 . + 0 transcript_id "g1077.t1"; gene_id "g1077"; # protein sequence = [MRFQALSSLAYLQPHISAIHAKAEALDVPTPIIDALRDLFHALNDPRSRPSSIRPLELISVLSSAGRANSLFNSREHQ # DAQELFQLLSECIKSEISAIDKESARDRGLGGLSQEVETKIGKSVAYKLFQSTCLLEDCLSEYTRLEILKDCICRKCSMTATHRRLMQEAKALSQVEN # PSASKKRRLKDVKKMAAKVKSALDEGRIEDEIKDVRMEKVISLSTKQAMIARPPPVLVLHLNRSMHFTHYATKNNIRVIFPEVLDLTQYTTSGNLSTI # PTSSLSTPPPHPKRSTTPTPEPRDSSSRTIYRLSAVVCHFGQHSFGHYICYRRKPKSSSGKPEEKWRPPRLVIELLDEVSAPSSIKREPDVDDTPTEG # EDAEGFEEYIWDDADPSTAAGTGRGWLRVSDDSVTEVGIESVLQEGSGAFMLYYERAVISGIVHAGLAHGGASPYPLSMSMVNGHAIIGNPNPVMNGY # PVGVGVGTPLNSEETLKPQRTMTMMMNGNGSLGSLFSMDEKGRDRDMMSLSSMSTSGSPPVVGPRVVRSVDAGRRRSHSAAPGTSEKNSLSSSLSPVS # YASSSSSMLPPASSPSLIMSPSRPIAVPHVSARPKVEDIDRFDEVERDYDDDTSSSLSTNSNRPSINGFNTHNVHYNNNSLNSSLSSLSSAPALMSKT # RNHQMSMSNTSLASMTSITSTTSSGSSAVSVPSSSVSSTSTGSAGSTGSTRRGRGRSAHKPGGPKGRSPQSRHPPLQSSPMVGLKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1077 ### # start gene g1078 4 AUGUSTUS gene 4636785 4638033 0.4 + . g1078 4 AUGUSTUS transcript 4636785 4638033 0.4 + . g1078.t1 4 AUGUSTUS start_codon 4636785 4636787 . + 0 transcript_id "g1078.t1"; gene_id "g1078"; 4 AUGUSTUS CDS 4636785 4637379 0.4 + 0 transcript_id "g1078.t1"; gene_id "g1078"; 4 AUGUSTUS CDS 4637438 4638033 0.81 + 2 transcript_id "g1078.t1"; gene_id "g1078"; 4 AUGUSTUS stop_codon 4638031 4638033 . + 0 transcript_id "g1078.t1"; gene_id "g1078"; # protein sequence = [MDVLRGLGPQGARSMLENHWAHFIDSGDWNWLVEHGINTVRIPVSYYHFLPGHSEPEVRQLMRGTEYEAFADVYVNAW # KYVVSNIQAAHEHEIGVLIDLHAAPGAQNTDSHSGLSGGKAGLWDSNEHQRRTVRILVAMAKEIAKYDNVVGLELLNEPKNNNRLMSWYDEAIGAIRS # GLGAQAQELPIYISDAWDTNWYSKYVNDQSNLGSFLVLDHHLYRCFTSQDQNKSASQHAGEVHPSNNGPSALMLANASKETQGSIIIGEWSAALNPAS # LASYPDHESKLAAQREWGHAQWEAYEQRCAGWFFWTLKKEGGSDRGWCYYTAVEQGVLPAQADRIKAAFVSGRHSIESLRAKGMVENQRAMQAHVGWW # NQHSSNPNEFEHWRFEEGFRQGEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1078 ### # start gene g1079 4 AUGUSTUS gene 4638553 4639632 0.85 + . g1079 4 AUGUSTUS transcript 4638553 4639632 0.85 + . g1079.t1 4 AUGUSTUS start_codon 4638553 4638555 . + 0 transcript_id "g1079.t1"; gene_id "g1079"; 4 AUGUSTUS CDS 4638553 4639632 0.85 + 0 transcript_id "g1079.t1"; gene_id "g1079"; 4 AUGUSTUS stop_codon 4639630 4639632 . + 0 transcript_id "g1079.t1"; gene_id "g1079"; # protein sequence = [MATATLFRHSSNPLDRGSSDNAASKLKNISLFTKSRNSVSSDDPLSLGGPDAQMRAFVHHLESVHPAAAASMKKQAYG # KGPVKSRQSVTGVIDLDEEEGGTDELGLSGRDSHGRRKRRKTETDENQEEEKEVVAEIEDLPYEEEEEYANDEVMSESSSDDEENSLSRKPSEEQEEI # LAEIADLEEAVPQLSADYKLLDRLGTGTFSSVYKALDLHYHDKWFNAPWHGHHHTSSSAHYQSLPRPPGTKVYVAVKRIYVTSSPERIRNEISILDEC # RSCRHVSQLITAFRQQDQVVVIMPYQKNDDFRVGVTYDRCSDDLTLCESARTTLQHYLWRASRHTCVVCSALSVMSILVISSIAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1079 ### # start gene g1080 4 AUGUSTUS gene 4639820 4641261 0.2 + . g1080 4 AUGUSTUS transcript 4639820 4641261 0.2 + . g1080.t1 4 AUGUSTUS start_codon 4639820 4639822 . + 0 transcript_id "g1080.t1"; gene_id "g1080"; 4 AUGUSTUS CDS 4639820 4639941 0.34 + 0 transcript_id "g1080.t1"; gene_id "g1080"; 4 AUGUSTUS CDS 4639989 4640029 0.72 + 1 transcript_id "g1080.t1"; gene_id "g1080"; 4 AUGUSTUS CDS 4640124 4640264 0.66 + 2 transcript_id "g1080.t1"; gene_id "g1080"; 4 AUGUSTUS CDS 4640333 4641261 0.73 + 2 transcript_id "g1080.t1"; gene_id "g1080"; 4 AUGUSTUS stop_codon 4641259 4641261 . + 0 transcript_id "g1080.t1"; gene_id "g1080"; # protein sequence = [MSRNKREYNVPHYKQMNREAKQKSMRPSEEVGYLDKDPRSMPHSKANRAGTRGFPVDVWAAGMILLFFLTKKFPLFQS # NDDIEALMEIGTIIGRRNMEQTACRTFSTNVPSITPDGISWSDFVTKQNPDLYSVPEPDVRFYPYTKQLKDQAQRQIQELDAPEQTPYHDPDREHDDI # SQHDNYRLTPVPSSSPSHLSINTKIANPSSASSLVFPSSPPKSIESGELSPLTPIEDEEFGESPRQSLFLRGPSQKQHEEDIDNALDLVEALLHPLCT # KRLTPRSALYHPFLYSSSNRRQQEADPMVDEDTDMEFGADEDLDEEVEPEDDEFFPHPFGEGVCRKWHARDEVGAPYVCIYAQDDFDSDDAANFGEDN # GEGRKKVWHSLTSGEGIAIGKQPCEFHKIGYELDMPET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1080 ### # start gene g1081 4 AUGUSTUS gene 4661681 4663207 0.41 + . g1081 4 AUGUSTUS transcript 4661681 4663207 0.41 + . g1081.t1 4 AUGUSTUS start_codon 4661681 4661683 . + 0 transcript_id "g1081.t1"; gene_id "g1081"; 4 AUGUSTUS CDS 4661681 4663207 0.41 + 0 transcript_id "g1081.t1"; gene_id "g1081"; 4 AUGUSTUS stop_codon 4663205 4663207 . + 0 transcript_id "g1081.t1"; gene_id "g1081"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDLVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDKPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSLNG # TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPQDDPNIPRYKKIEQMAKDLGWDHAESYFANTEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1081 ### # start gene g1082 4 AUGUSTUS gene 4663237 4664673 1 + . g1082 4 AUGUSTUS transcript 4663237 4664673 1 + . g1082.t1 4 AUGUSTUS start_codon 4663237 4663239 . + 0 transcript_id "g1082.t1"; gene_id "g1082"; 4 AUGUSTUS CDS 4663237 4664673 1 + 0 transcript_id "g1082.t1"; gene_id "g1082"; 4 AUGUSTUS stop_codon 4664671 4664673 . + 0 transcript_id "g1082.t1"; gene_id "g1082"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRSLKKPSVTME # DVDESDDEDAIKLIPSSRPTNQINSEYRPYNHVQPRTYCPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRLGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGEAEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSSD # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSK # GNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1082 ### # start gene g1083 4 AUGUSTUS gene 4665381 4667072 1 + . g1083 4 AUGUSTUS transcript 4665381 4667072 1 + . g1083.t1 4 AUGUSTUS start_codon 4665381 4665383 . + 0 transcript_id "g1083.t1"; gene_id "g1083"; 4 AUGUSTUS CDS 4665381 4667072 1 + 0 transcript_id "g1083.t1"; gene_id "g1083"; 4 AUGUSTUS stop_codon 4667070 4667072 . + 0 transcript_id "g1083.t1"; gene_id "g1083"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAISQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTEKQPQRRAASESPRDPPPHFDLDTGDHNDQDPPVDPNDPGADNNHDDLDDDSGGLPRGEPG # DPSGPGGPDGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQQKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKAQESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1083 ### # start gene g1084 4 AUGUSTUS gene 4667955 4669409 0.94 + . g1084 4 AUGUSTUS transcript 4667955 4669409 0.94 + . g1084.t1 4 AUGUSTUS start_codon 4667955 4667957 . + 0 transcript_id "g1084.t1"; gene_id "g1084"; 4 AUGUSTUS CDS 4667955 4669409 0.94 + 0 transcript_id "g1084.t1"; gene_id "g1084"; 4 AUGUSTUS stop_codon 4669407 4669409 . + 0 transcript_id "g1084.t1"; gene_id "g1084"; # protein sequence = [MTPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHPDSPQTSVPSAINTVDAKVAVPLLEPS # LSVLPTIQETPLGDSPRSRSRPRSRTSWAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALISAAVFNRACKDTGMEPILLRVIHSEVAARAADYS # SSTPTVPPLHSSIPEEYADFADVFDEIAADSLLEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDG # KLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGGEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQQFVNYIFSDMLD # VCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTIEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFI # YNYSDIVVPMTRLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1084 ### # start gene g1085 4 AUGUSTUS gene 4669827 4671484 0.33 + . g1085 4 AUGUSTUS transcript 4669827 4671484 0.33 + . g1085.t1 4 AUGUSTUS start_codon 4669827 4669829 . + 0 transcript_id "g1085.t1"; gene_id "g1085"; 4 AUGUSTUS CDS 4669827 4670408 0.58 + 0 transcript_id "g1085.t1"; gene_id "g1085"; 4 AUGUSTUS CDS 4670492 4671484 0.37 + 0 transcript_id "g1085.t1"; gene_id "g1085"; 4 AUGUSTUS stop_codon 4671482 4671484 . + 0 transcript_id "g1085.t1"; gene_id "g1085"; # protein sequence = [MVIRFRPGKLGEKPDSITRRWDIYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRVTCLEGPVLRASIIMDIEALHQAI # ILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHSNLCLQVLRYFHDHPLSGHFGQNRTLEAVRCQYTWPKVRDFVRDYVTSCTICGR # NKPRRHQPYGLLKPLPVPQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLE # QYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHP # EFPIGSEVFVLAKHIRSTRPTEKFSEKHLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNCTQSPPPPIEVDGEEEYNVAEILDS # KLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1085 ### # start gene g1086 4 AUGUSTUS gene 4671849 4672934 0.91 - . g1086 4 AUGUSTUS transcript 4671849 4672934 0.91 - . g1086.t1 4 AUGUSTUS stop_codon 4671849 4671851 . - 0 transcript_id "g1086.t1"; gene_id "g1086"; 4 AUGUSTUS CDS 4671849 4672430 0.91 - 0 transcript_id "g1086.t1"; gene_id "g1086"; 4 AUGUSTUS CDS 4672485 4672934 0.92 - 0 transcript_id "g1086.t1"; gene_id "g1086"; 4 AUGUSTUS start_codon 4672932 4672934 . - 0 transcript_id "g1086.t1"; gene_id "g1086"; # protein sequence = [MTTSRTTTTTQPTASTSSRPADPPSPGAPIDEDEDEIIREALARVERVKARKAAEEAAARKAAEEAEKTKKAAAQAAA # ARRQAAQDARDRAVRAREQEDKIVKRRRKLAEAATARSQGGTSTGDVSASPRRPIVEISKKKNKGKGKAKALDVDKDPDDGDDDDEDEEDREPCERCR # SKKIPCLKQAGKRSSVICKPCHDSKVRCSYSGRPYVVKKEGRAGPSGERLAVLESQMVQLLADNRALREANSKTQQYLHQLLRRQEDDHTRLISMDTR # MSLMGMGEGPSRRTTEQRRRIVEESDEEREEEEEERGVEEKEKETEKDGEGMAPTAAQSEKGKDKEVVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1086 ### # start gene g1087 4 AUGUSTUS gene 4674210 4674662 0.39 - . g1087 4 AUGUSTUS transcript 4674210 4674662 0.39 - . g1087.t1 4 AUGUSTUS stop_codon 4674210 4674212 . - 0 transcript_id "g1087.t1"; gene_id "g1087"; 4 AUGUSTUS CDS 4674210 4674662 0.39 - 0 transcript_id "g1087.t1"; gene_id "g1087"; 4 AUGUSTUS start_codon 4674660 4674662 . - 0 transcript_id "g1087.t1"; gene_id "g1087"; # protein sequence = [MDSYFMFLVTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEAC # SILKSHQDSGPDSSASDASFATAQSIPTTGSEDTVVTPTENAVSVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1087 ### # start gene g1088 4 AUGUSTUS gene 4675352 4675702 0.53 - . g1088 4 AUGUSTUS transcript 4675352 4675702 0.53 - . g1088.t1 4 AUGUSTUS stop_codon 4675352 4675354 . - 0 transcript_id "g1088.t1"; gene_id "g1088"; 4 AUGUSTUS CDS 4675352 4675702 0.53 - 0 transcript_id "g1088.t1"; gene_id "g1088"; 4 AUGUSTUS start_codon 4675700 4675702 . - 0 transcript_id "g1088.t1"; gene_id "g1088"; # protein sequence = [MATLFRWPRPFNLSGLDFDNRTPGEWIELLRSIHSGQSTAHIDENGHLVESSPPPDSATEAFEGLNEVEKGSADEGTS # SRVGGSVPMELDLPTIESLAEQTLSPEKGAEPAQTLES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1088 ### # start gene g1089 4 AUGUSTUS gene 4676614 4677316 0.76 - . g1089 4 AUGUSTUS transcript 4676614 4677316 0.76 - . g1089.t1 4 AUGUSTUS stop_codon 4676614 4676616 . - 0 transcript_id "g1089.t1"; gene_id "g1089"; 4 AUGUSTUS CDS 4676614 4677044 1 - 2 transcript_id "g1089.t1"; gene_id "g1089"; 4 AUGUSTUS CDS 4677109 4677316 0.76 - 0 transcript_id "g1089.t1"; gene_id "g1089"; 4 AUGUSTUS start_codon 4677314 4677316 . - 0 transcript_id "g1089.t1"; gene_id "g1089"; # protein sequence = [MHLVPSKDLDVFASLRGKVSPAVASKISTPSPPLEIKPSTSIPKAPVAPPRLIRRNQELESLKADASTFFSLPRSTRS # RDSDNELLSGFLSAVSASRASSSTKVSVDRKEPKPKTTVKVVEDSKASKPTPTAMVYKRVRLPPCSRKVAPITAKGKSRQVVVSDDNSASNKVESEDE # EEDENEEEDSAPPPKHLKTTSSISGKTYSSFFVSFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1089 ### # start gene g1090 4 AUGUSTUS gene 4679628 4680794 0.91 + . g1090 4 AUGUSTUS transcript 4679628 4680794 0.91 + . g1090.t1 4 AUGUSTUS start_codon 4679628 4679630 . + 0 transcript_id "g1090.t1"; gene_id "g1090"; 4 AUGUSTUS CDS 4679628 4680794 0.91 + 0 transcript_id "g1090.t1"; gene_id "g1090"; 4 AUGUSTUS stop_codon 4680792 4680794 . + 0 transcript_id "g1090.t1"; gene_id "g1090"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLAHMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPLNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1090 ### # start gene g1091 4 AUGUSTUS gene 4687209 4687574 0.92 + . g1091 4 AUGUSTUS transcript 4687209 4687574 0.92 + . g1091.t1 4 AUGUSTUS start_codon 4687209 4687211 . + 0 transcript_id "g1091.t1"; gene_id "g1091"; 4 AUGUSTUS CDS 4687209 4687574 0.92 + 0 transcript_id "g1091.t1"; gene_id "g1091"; 4 AUGUSTUS stop_codon 4687572 4687574 . + 0 transcript_id "g1091.t1"; gene_id "g1091"; # protein sequence = [MSASRTITTTVTSAAGPSRSRPLPPPSPPPSDSAAHEEEDLEDEDEDDIIRKAQARVERVRARKAAEAARKKAEEEAA # RAAAEKKRKAQEAREQARRAQQQEEEAVGRSGDSSESEGDLPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1091 ### # start gene g1092 4 AUGUSTUS gene 4688652 4692215 0.96 - . g1092 4 AUGUSTUS transcript 4688652 4692215 0.96 - . g1092.t1 4 AUGUSTUS stop_codon 4688652 4688654 . - 0 transcript_id "g1092.t1"; gene_id "g1092"; 4 AUGUSTUS CDS 4688652 4692215 0.96 - 0 transcript_id "g1092.t1"; gene_id "g1092"; 4 AUGUSTUS start_codon 4692213 4692215 . - 0 transcript_id "g1092.t1"; gene_id "g1092"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASQNITFRNTSHLDSPQTSVPSAINRVVAKVAV # LLPEPSPSVSPTILETPPGDSPRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFWTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSSTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDHGSEFVSAFFRALGKVLSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHISQLEPVTPNPFPNRTQYPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1092 ### # start gene g1093 4 AUGUSTUS gene 4692529 4694208 0.97 - . g1093 4 AUGUSTUS transcript 4692529 4694208 0.97 - . g1093.t1 4 AUGUSTUS stop_codon 4692529 4692531 . - 0 transcript_id "g1093.t1"; gene_id "g1093"; 4 AUGUSTUS CDS 4692529 4694208 0.97 - 0 transcript_id "g1093.t1"; gene_id "g1093"; 4 AUGUSTUS start_codon 4694206 4694208 . - 0 transcript_id "g1093.t1"; gene_id "g1093"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSITRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPG # DPSGPGGPDGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRAASTNWDSAAL # KWAYGRGLAERIKDEMARLPEPATLADYRQEVLCIDNHYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPLSGGKP # NNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1093 ### # start gene g1094 4 AUGUSTUS gene 4696903 4697583 0.83 + . g1094 4 AUGUSTUS transcript 4696903 4697583 0.83 + . g1094.t1 4 AUGUSTUS start_codon 4696903 4696905 . + 0 transcript_id "g1094.t1"; gene_id "g1094"; 4 AUGUSTUS CDS 4696903 4697583 0.83 + 0 transcript_id "g1094.t1"; gene_id "g1094"; 4 AUGUSTUS stop_codon 4697581 4697583 . + 0 transcript_id "g1094.t1"; gene_id "g1094"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPCCGQPPVVAPARGRSTTQIESPILQAIAHHTGKQPQHRAASESPRDPPPHFDLDASDHDNQDPPVNPEDPGTDNINDDLDNDSGGLPLSCPD # LPPIAPTDSEGPPSLYLNSPWDCFTHPRTSRVLHKPPRLNPASTIHPEFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1094 ### # start gene g1095 4 AUGUSTUS gene 4698579 4699442 0.81 + . g1095 4 AUGUSTUS transcript 4698579 4699442 0.81 + . g1095.t1 4 AUGUSTUS start_codon 4698579 4698581 . + 0 transcript_id "g1095.t1"; gene_id "g1095"; 4 AUGUSTUS CDS 4698579 4699442 0.81 + 0 transcript_id "g1095.t1"; gene_id "g1095"; 4 AUGUSTUS stop_codon 4699440 4699442 . + 0 transcript_id "g1095.t1"; gene_id "g1095"; # protein sequence = [MLELLSGFKGSIETLGTVLASLGRPSDSSESKSKVKEPEVFDGLDPRKLKTFFVNLAPVFNDRPKYFTDQRKVNYTLS # YLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFSVYDAQGEAEDSLGNLKMKETENIRFHTLAASTNWDSAALKWAYGRGLAERIKDEMAR # LPEPATLADYRQEVLRIDNCYWKCEETRKHEAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSALFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQ # RPVFNHLGADGKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1095 ### # start gene g1096 4 AUGUSTUS gene 4699780 4702014 0.44 + . g1096 4 AUGUSTUS transcript 4699780 4702014 0.44 + . g1096.t1 4 AUGUSTUS start_codon 4699780 4699782 . + 0 transcript_id "g1096.t1"; gene_id "g1096"; 4 AUGUSTUS CDS 4699780 4702014 0.44 + 0 transcript_id "g1096.t1"; gene_id "g1096"; 4 AUGUSTUS stop_codon 4702012 4702014 . + 0 transcript_id "g1096.t1"; gene_id "g1096"; # protein sequence = [MTKISPVNLRLFDGSLSSKPITDMANIAVQFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNIMFRNT # SHPDSPQTSVPSVINTIDAKVAVPLPEPSPSVSPTILETPPGDSLCSHSRMLQAKPLSSKFPFEPIYSYPTVSQFTAQLETPEVDIALVSAAVFNRAC # KDAGMEPILLRAIHSEVAACAANRSSTTLTVPPLPHSIPAEYAEFADVFDKIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVTLKDFIDKQ # LATGAITPSSSPHSAPVLFVPKKDGKLWLCMDFRSLNRITKKDRYPLPLISDLLNTPKRAKIYTKLDLTRAYHLVRIAEGDEWKTTFQTRYGSYEWKV # MPFGLTNPPAAFQHFVNDIFSDMLDVCVIIYLDNILIYSDTPEEHQEHIKEVLRRLRKHQLYANPDKCEFNMDTVEYLGYILSPDRLTMSKEKVQTVL # EWPVPRKVKDIQSFLGFANFYCRFIYNYSDIVVPMTRLTRKGTPWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPIIVETDASDYTIAAILSIQTVD # GEIHPLAFLSRTLHAAELNYDTHDKELLAIFKAFKAWHHYLEGSGDPVDVVTDHKNLEYFSTTKILTRRQVRWSEYLHQFNMVIRFRPGKLGEKPDSI # TRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTTSLRRTDAPSLYRHGYRGFASSYHSRSSEGPKLRRWFGTCQRSFQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1096 ### # start gene g1097 4 AUGUSTUS gene 4702318 4703307 0.87 + . g1097 4 AUGUSTUS transcript 4702318 4703307 0.87 + . g1097.t1 4 AUGUSTUS start_codon 4702318 4702320 . + 0 transcript_id "g1097.t1"; gene_id "g1097"; 4 AUGUSTUS CDS 4702318 4703307 0.87 + 0 transcript_id "g1097.t1"; gene_id "g1097"; 4 AUGUSTUS stop_codon 4703305 4703307 . + 0 transcript_id "g1097.t1"; gene_id "g1097"; # protein sequence = [MDFIEQLPMSNGYTAILVIVDRSSKQAIFIPTFDTITSEQLAELFVIHVFSKHGAPNHVTSDRGSEFVSAFFRALGKA # LSMELHYTSGYHPEAHGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNTSTGITPFFANKGYHPNITVQPEVDMKSDPARDFVVNLDEL # HAFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTCPTEKFSEKHLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLELVMPNPF # PNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1097 ### # start gene g1098 4 AUGUSTUS gene 4708341 4709903 0.32 - . g1098 4 AUGUSTUS transcript 4708341 4709903 0.32 - . g1098.t1 4 AUGUSTUS stop_codon 4708341 4708343 . - 0 transcript_id "g1098.t1"; gene_id "g1098"; 4 AUGUSTUS CDS 4708341 4709903 0.32 - 0 transcript_id "g1098.t1"; gene_id "g1098"; 4 AUGUSTUS start_codon 4709901 4709903 . - 0 transcript_id "g1098.t1"; gene_id "g1098"; # protein sequence = [MAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLV # YYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLP # NSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEK # YIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQ # FKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILD # SRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1098 ### # start gene g1099 4 AUGUSTUS gene 4709951 4712056 0.57 - . g1099 4 AUGUSTUS transcript 4709951 4712056 0.57 - . g1099.t1 4 AUGUSTUS stop_codon 4709951 4709953 . - 0 transcript_id "g1099.t1"; gene_id "g1099"; 4 AUGUSTUS CDS 4709951 4712056 0.57 - 0 transcript_id "g1099.t1"; gene_id "g1099"; 4 AUGUSTUS start_codon 4712054 4712056 . - 0 transcript_id "g1099.t1"; gene_id "g1099"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHVEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRQM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPS # TSLRTIRTSNSGALHKTSPADKPDGPSICHGLTFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1099 ### # start gene g1100 4 AUGUSTUS gene 4712107 4713273 0.88 - . g1100 4 AUGUSTUS transcript 4712107 4713273 0.88 - . g1100.t1 4 AUGUSTUS stop_codon 4712107 4712109 . - 0 transcript_id "g1100.t1"; gene_id "g1100"; 4 AUGUSTUS CDS 4712107 4713273 0.88 - 0 transcript_id "g1100.t1"; gene_id "g1100"; 4 AUGUSTUS start_codon 4713271 4713273 . - 0 transcript_id "g1100.t1"; gene_id "g1100"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSASAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1100 ### # start gene g1101 4 AUGUSTUS gene 4717248 4717613 0.52 - . g1101 4 AUGUSTUS transcript 4717248 4717613 0.52 - . g1101.t1 4 AUGUSTUS stop_codon 4717248 4717250 . - 0 transcript_id "g1101.t1"; gene_id "g1101"; 4 AUGUSTUS CDS 4717248 4717613 0.52 - 0 transcript_id "g1101.t1"; gene_id "g1101"; 4 AUGUSTUS start_codon 4717611 4717613 . - 0 transcript_id "g1101.t1"; gene_id "g1101"; # protein sequence = [MTTIPQPRASTSSRPADPPSPGASADEDEDSIMWDALARVERVKARKAEEARKQAEEEAAARRAVEEEQRRKEAAARA # SAVTSLPRFCVKEKGRNLMGTPTNQSNTQYASSLLSNLFNSKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1101 ### # start gene g1102 4 AUGUSTUS gene 4721573 4722816 0.64 + . g1102 4 AUGUSTUS transcript 4721573 4722816 0.64 + . g1102.t1 4 AUGUSTUS start_codon 4721573 4721575 . + 0 transcript_id "g1102.t1"; gene_id "g1102"; 4 AUGUSTUS CDS 4721573 4722052 0.64 + 0 transcript_id "g1102.t1"; gene_id "g1102"; 4 AUGUSTUS CDS 4722226 4722816 0.89 + 0 transcript_id "g1102.t1"; gene_id "g1102"; 4 AUGUSTUS stop_codon 4722814 4722816 . + 0 transcript_id "g1102.t1"; gene_id "g1102"; # protein sequence = [MKRKPDLVEAIIESNPQKEENHHGKRMRLHVEIPTSFTTTLDTPQGNASETPDDIDVDTFSSLSPDSLFDEVFTSPSS # FPASPPLHLHPDQKARIALRTAPPIPGLFFDPSVRLSEDLAEELAGYCMGRYFNDDDGKRRVNQVMLFERARVDQETVTEDAVPRSEHPTTSTLPIET # HSKETKQARQVILNLYAPGEGISPHVDLLRRFGDGIIGVSLCGGCVMRFERIREEGIEEVAERVSLQSRSDSPSSSVDSVFLSNSNVHELYLPPNSII # VLSGEARYKWTHGIERRTGDWVSYSDEVNVGDGEGVRQLTPNDSNLGVKVEWIPRTTRLSITFRWLLPGADIVGGDTSDCEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1102 ### # start gene g1103 4 AUGUSTUS gene 4723305 4724540 0.67 + . g1103 4 AUGUSTUS transcript 4723305 4724540 0.67 + . g1103.t1 4 AUGUSTUS start_codon 4723305 4723307 . + 0 transcript_id "g1103.t1"; gene_id "g1103"; 4 AUGUSTUS CDS 4723305 4724540 0.67 + 0 transcript_id "g1103.t1"; gene_id "g1103"; 4 AUGUSTUS stop_codon 4724538 4724540 . + 0 transcript_id "g1103.t1"; gene_id "g1103"; # protein sequence = [MPPTSTLAAKNMNLKGRKRFVADLEDLNVACTQGFVAHGLTLKSKTMNIILDRRLNSLLGVRAGDDEGTFEAVITTSS # GEHVLNVNIMLSDTADYPKTHNCFSYSPDSHVAANIQSVIEGIVSLPSCLLVETMDKVLANLTKAMSTGSLESESDDDEDEEGEDYAVSSDDDIYMNS # TSQNLMKMARLQHDFLEIVARGYRPGLIRFSGDDFCISVSLSVIKLAESVPPRALNAWDRRLLSKTQHLVLLISGFRGVYPPSDSDATKLKFHVGLSG # IHKPSKEHAKDACRNFVLITNDAEDELRLAREKAAAEAAVMNDFEMDEEDSDADPNPATKPEIEEEEEDVPDRFDKFSLSGSLDSLMNHQFAKLVNMR # RKYGLGWAGAERLLSEAEKSQKPEQEVLENKLQVSFGNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1103 ### # start gene g1104 4 AUGUSTUS gene 4726436 4727152 0.99 + . g1104 4 AUGUSTUS transcript 4726436 4727152 0.99 + . g1104.t1 4 AUGUSTUS start_codon 4726436 4726438 . + 0 transcript_id "g1104.t1"; gene_id "g1104"; 4 AUGUSTUS CDS 4726436 4727152 0.99 + 0 transcript_id "g1104.t1"; gene_id "g1104"; 4 AUGUSTUS stop_codon 4727150 4727152 . + 0 transcript_id "g1104.t1"; gene_id "g1104"; # protein sequence = [MYSRYLLVKSRATQGSTDEPETIPIPPRQPQQLTPFVKLDPAHPVTLGQQRIQIPEPTHQLETILRIRQAEAVEDNPD # SEDQAVFDFVESADEFIGKGKGKANDPMEIDDDDEMGFDDYSPSKGAPYQLSSSLAPTLARQQQLLPKSRPVDDWVHDSEYVQSAVSKLMPPPELSSP # GATMAVQKELKALLKEQKSCSSLKELGWFMSEEFMGDNLFQWIVELHSFDEKLPIAKDMKAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1104 ### # start gene g1105 4 AUGUSTUS gene 4728959 4730730 0.65 - . g1105 4 AUGUSTUS transcript 4728959 4730730 0.65 - . g1105.t1 4 AUGUSTUS stop_codon 4728959 4728961 . - 0 transcript_id "g1105.t1"; gene_id "g1105"; 4 AUGUSTUS CDS 4728959 4730339 0.83 - 1 transcript_id "g1105.t1"; gene_id "g1105"; 4 AUGUSTUS CDS 4730426 4730730 0.75 - 0 transcript_id "g1105.t1"; gene_id "g1105"; 4 AUGUSTUS start_codon 4730728 4730730 . - 0 transcript_id "g1105.t1"; gene_id "g1105"; # protein sequence = [MALTEDDGFEDDDSGFPETLPFVSTDEQEGTTDIHESAGKVEVSTKQYTHQTRTSNESYHQDPAPVQSQKEIDYLRQQ # LKDRHMNRLNEFLIDPKKGVQVYLVDENLSLIPTLTRFYIKFLLKDEVFSVKSESEIIASFNQALAIVEIAQTELPLTSQISRCLPWHDMFSGGCEEL # FKVDNLNVHVPTWANQSNHNLALDVVDGQIDINSTAAATIASTPDSEEQEAEDDIVTPTIEHDLNERSVQGEFVIESVNGTMSNNLLSESDASPSVSS # FSATWGSDQDTLEIATDDVRKWDVGFDKGDTGASAGWGVIDSADISWGEDDLDTWEIPPPTTLLPILGPTALPLTHTSGVIEWSMRRIRSIVHPDAAA # AATTQVSVISTSDGPSAEAVEVSLHACLSKVVMEPWIDWETQDEDGDTASPQIKANSRGLVVVYDEGQGVLYENDSDIRSNAFAVNDDGNTAQSPPVP # HDPLKHSIVLLIEPENAQLLRVGMGLGATWIQIARQSDLRSELEVKDMETTGVVKAPSEACLDESNVVGERFWYLSNLLVVLPSYHIPSPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1105 ### # start gene g1106 4 AUGUSTUS gene 4731012 4731356 0.99 - . g1106 4 AUGUSTUS transcript 4731012 4731356 0.99 - . g1106.t1 4 AUGUSTUS stop_codon 4731012 4731014 . - 0 transcript_id "g1106.t1"; gene_id "g1106"; 4 AUGUSTUS CDS 4731012 4731356 0.99 - 0 transcript_id "g1106.t1"; gene_id "g1106"; 4 AUGUSTUS start_codon 4731354 4731356 . - 0 transcript_id "g1106.t1"; gene_id "g1106"; # protein sequence = [MAPTPNAQHRFTFPPFPPVPTGATVISFKDFKENGIKIQEDDYDGPEVDALGISTVTIEKRHVGDFCKSNTRSAQHVV # TTGQESSTGGAPSVSKTWLQDWEEISTRKSGEFYDK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1106 ### # start gene g1107 4 AUGUSTUS gene 4732270 4733026 0.4 - . g1107 4 AUGUSTUS transcript 4732270 4733026 0.4 - . g1107.t1 4 AUGUSTUS stop_codon 4732270 4732272 . - 0 transcript_id "g1107.t1"; gene_id "g1107"; 4 AUGUSTUS CDS 4732270 4732698 0.68 - 0 transcript_id "g1107.t1"; gene_id "g1107"; 4 AUGUSTUS CDS 4732769 4733026 0.44 - 0 transcript_id "g1107.t1"; gene_id "g1107"; 4 AUGUSTUS start_codon 4733024 4733026 . - 0 transcript_id "g1107.t1"; gene_id "g1107"; # protein sequence = [MVAQAMNPAPRPPSPTARDATQKALRRENPNQLSSRDARVLMGLPTNSDTKEERVKLESFFSSTTVDDASKGPAPPRP # SREARRASVPNIPIDDGLIDWANSHLPSSLQIIDTSGAICGGLTILRLAEAIKGRPSSPPVPDSAFPADPGDDKLDGLFRLFDFLLDNDVKMGSVSIN # DIRQGKRDKVLQLLKALKAWEDKRKAIAQSIGKGAMQAGGFIAPPYSLPVPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1107 ### # start gene g1108 4 AUGUSTUS gene 4734481 4736469 1 - . g1108 4 AUGUSTUS transcript 4734481 4736469 1 - . g1108.t1 4 AUGUSTUS stop_codon 4734481 4734483 . - 0 transcript_id "g1108.t1"; gene_id "g1108"; 4 AUGUSTUS CDS 4734481 4736469 1 - 0 transcript_id "g1108.t1"; gene_id "g1108"; 4 AUGUSTUS start_codon 4736467 4736469 . - 0 transcript_id "g1108.t1"; gene_id "g1108"; # protein sequence = [MPDYVYALHDFSPENDDEVPFRAGERIEVIEKDEAYGDGWWQVRIALSYPIIPLLPSPLLCLGANAVVSKGRNLAGKT # GLFPQSYTAPAPTANGFTTGDDANDVPSNNTPLHPLDEESEPESSPQAPAIFVNGNEADGEVMKATLTDVQKAIEQLKMNRTSSIDGDGARSFSFAST # REDRDTDRESETDYELSDTEHQEFGDDGHHKSTRQRLAEKARKAVEDAEKLEMMMGGISAGNRTSAPPIEVEMSDESDGEDDEDYTHSSSFFRRHSAI # EEVDEDTEGNGTAPTQTPQVHQDLTLPVQEIDESDARTATAPSFPSLSTNEDATDTKSISLPTPTSPGFAHSESTISTVIPIPISAITPPSIPSTPPR # TITPAAAVARSPSPMRETLVALPSPTASSFHSNSGAFHFSPHQSQHNSVSSVPSSALATAPVTTSESSQTNSQPSQKDNEQAKEKEKTHPSEWNVDEV # VEWVRGKGFGEDVCAKFTEQEITGDVLLELDVNLLKNEIGIMAFGKRVRIANAIAELRRPPSINYDEQVLENPSSPFAGSQSVHRMMNQSPQLYAQSP # HSVNSQPYSHPTHSRNQSQSQSHHSFPGSATSMSGFRDSFGSNGALIAAAGLMSPESAPHTGDLLGSPRSDELFVNSQEKALVSANLVHLPLVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1108 ### # start gene g1109 4 AUGUSTUS gene 4738576 4739634 0.99 + . g1109 4 AUGUSTUS transcript 4738576 4739634 0.99 + . g1109.t1 4 AUGUSTUS start_codon 4738576 4738578 . + 0 transcript_id "g1109.t1"; gene_id "g1109"; 4 AUGUSTUS CDS 4738576 4739634 0.99 + 0 transcript_id "g1109.t1"; gene_id "g1109"; 4 AUGUSTUS stop_codon 4739632 4739634 . + 0 transcript_id "g1109.t1"; gene_id "g1109"; # protein sequence = [MDKIVVAAPKFQVSRNEQGEITSGEPIGVPLYLLLDLLSNTAAGYDLFRNTRFNDALKALLDSWGKYLQSSKSNNTLN # NSDEGWFSKLGLETLDNGRGIFNDIYECPDETAVNRGFTSWDAFFTRKFKPGARPIQPQPDFPNFFIYNACESTVLRKATGIKEHDQFWLKGQPYSIY # DMLATIQDDRVAQSFIGGTVYQAFLSPYDYHRWHSPVNGTIREIQIIPGTYYAALPDEGAEKSDPDFQPGDPRGAIIRSQAWLTQAATRAIIYIDTDN # KDIGCVAFIGVGMVEVSTCQVSVKVGGSVKVGDELGMFHFGGSTHALIFGPDVKLKFFDYVQANEHLHVNIPLAAVEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1109 ### # start gene g1110 4 AUGUSTUS gene 4742240 4743623 0.5 - . g1110 4 AUGUSTUS transcript 4742240 4743623 0.5 - . g1110.t1 4 AUGUSTUS stop_codon 4742240 4742242 . - 0 transcript_id "g1110.t1"; gene_id "g1110"; 4 AUGUSTUS CDS 4742240 4742950 0.89 - 0 transcript_id "g1110.t1"; gene_id "g1110"; 4 AUGUSTUS CDS 4743009 4743623 0.57 - 0 transcript_id "g1110.t1"; gene_id "g1110"; 4 AUGUSTUS start_codon 4743621 4743623 . - 0 transcript_id "g1110.t1"; gene_id "g1110"; # protein sequence = [MESETFLASNTVSEYLKKAEDRLREEEDRIERYLHTKTRKELISKCEHVLIREHSELMWDSFQKLLDFDQDEDLQRMY # ALLSRIPEGLEPLRKRFEGHVKQAGLSSISKLVGEGGNADSIDPKVYVDALLEVHKKNSETVARSFKSEAGFAASLDKACREFVNRNAATGTSSTKSP # ELIAKHADMLLRKNNKMAEEEDLEGALNRMVLFKYLEDKDVFQTFYTTKLSKRLIHSVSASDESEASMISKLKEACGFEYTNKLQRMFTGSCTLSPSV # FRTHRPLLDMSLSKDLTDSFKERMTQNHDDMDITFSIMVLGTNFWPLNPPPHEFVIPAEILTTYDRFQKYYQQKHSGRKLTWLWNYSKNELRTNYLNQ # KYILMTSSYQMAVLVLYNKNDTMSLEEIFVATSIGKDILTQVLALLVKAKILINEEADQYDLNPGMSFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1110 ### # start gene g1111 4 AUGUSTUS gene 4747662 4748132 0.46 - . g1111 4 AUGUSTUS transcript 4747662 4748132 0.46 - . g1111.t1 4 AUGUSTUS stop_codon 4747662 4747664 . - 0 transcript_id "g1111.t1"; gene_id "g1111"; 4 AUGUSTUS CDS 4747662 4748132 0.46 - 0 transcript_id "g1111.t1"; gene_id "g1111"; 4 AUGUSTUS start_codon 4748130 4748132 . - 0 transcript_id "g1111.t1"; gene_id "g1111"; # protein sequence = [MNTRAHANALDTADAERRIRSLTVPSMHARNEILEVYYRQDTKSRQPMPGDDVRSKTALKDFFGHEGVRQHLGISEGI # EIEVKGDFYGFLKYNERGITLPERVQKVAFKFKADPLCRTICAGLLEINSMMGVVRNEEKEIFKNFYRGLFYCFILVT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1111 ### # start gene g1112 4 AUGUSTUS gene 4751651 4751950 0.65 - . g1112 4 AUGUSTUS transcript 4751651 4751950 0.65 - . g1112.t1 4 AUGUSTUS stop_codon 4751651 4751653 . - 0 transcript_id "g1112.t1"; gene_id "g1112"; 4 AUGUSTUS CDS 4751651 4751950 0.65 - 0 transcript_id "g1112.t1"; gene_id "g1112"; 4 AUGUSTUS start_codon 4751948 4751950 . - 0 transcript_id "g1112.t1"; gene_id "g1112"; # protein sequence = [MNNALYLANYQNSSISRSQISIMAPCFWTQVDVEAGAAQADVLIWGMTTWISGHENVGPTGVSDYSSFKALDALIEHY # MNKSVYPNLKVSVSAIENTPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1112 ### # start gene g1113 4 AUGUSTUS gene 4753501 4754415 0.63 - . g1113 4 AUGUSTUS transcript 4753501 4754415 0.63 - . g1113.t1 4 AUGUSTUS stop_codon 4753501 4753503 . - 0 transcript_id "g1113.t1"; gene_id "g1113"; 4 AUGUSTUS CDS 4753501 4754415 0.63 - 0 transcript_id "g1113.t1"; gene_id "g1113"; 4 AUGUSTUS start_codon 4754413 4754415 . - 0 transcript_id "g1113.t1"; gene_id "g1113"; # protein sequence = [MVFSQDSFPLLRTLRVQLDCNVQTVDIPAPNLKSWVTIGKAYLSQVNTTLSVELHAQITDYSISNFPYDAVLRMSTLL # SRLRRLVVRELKPKHGWDSFLNSGCFRGLQELVVEQSESPGALNVLQAFFNSITCPALTSLSIIAHDSLKSVIQDFEKRSAFNLGHLDITGHTRILEG # SLQNTAALKTLVLRDIGKTSELSVASVFSYLDSTTVSLGPGSSLGSPFPALHRLELHLCSTPVLMEYDTMEALFLCLSSRLDSSSHSNSVSPLEVFIT # APDGQARKMLDHPRLGELRSLGIKVDIVAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1113 ### # start gene g1114 4 AUGUSTUS gene 4756460 4756963 0.91 - . g1114 4 AUGUSTUS transcript 4756460 4756963 0.91 - . g1114.t1 4 AUGUSTUS stop_codon 4756460 4756462 . - 0 transcript_id "g1114.t1"; gene_id "g1114"; 4 AUGUSTUS CDS 4756460 4756963 0.91 - 0 transcript_id "g1114.t1"; gene_id "g1114"; 4 AUGUSTUS start_codon 4756961 4756963 . - 0 transcript_id "g1114.t1"; gene_id "g1114"; # protein sequence = [MESNLEGATPGSSQAQDAKALPVHVALAWDLPVGKKFPVPQGSGIQQNIQNGVRKFFGDKKVGEALGVTGKLEATLPV # GECEYYAPKANSGQITVQVSFGGLEICGGTCTATVVIGVRPGGDSRVQGKIYNSANEIIFPFILKKGTSERSVLVFEFALPSHNLSSTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1114 ### # start gene g1115 4 AUGUSTUS gene 4759824 4761368 0.77 - . g1115 4 AUGUSTUS transcript 4759824 4761368 0.77 - . g1115.t1 4 AUGUSTUS stop_codon 4759824 4759826 . - 0 transcript_id "g1115.t1"; gene_id "g1115"; 4 AUGUSTUS CDS 4759824 4761368 0.77 - 0 transcript_id "g1115.t1"; gene_id "g1115"; 4 AUGUSTUS start_codon 4761366 4761368 . - 0 transcript_id "g1115.t1"; gene_id "g1115"; # protein sequence = [MSMPVPTVAESRAATQPDNLFTPMANGGDRLANFPAEPQIPVPSRGRAQTPYHPTVPPPDDDDEEEEEDESAPPVVVP # SVAGSAHPPSVSQHRRRHSEPLHHQNIPPPPPPVDPTRPSAFDRPLWSPSGNPLPEPPRDLFDSEAYKAVLNIPRGTDLFTALYGYQRNQVQQPGQSV # PSDLNPQRTRTGLFGRKNSKGGGLFRTLTGTRGRKQTLSEIQPQDVARDRVRLGDVRLVPFPVPVERVNGETPSTQGAFRHVPPSEDRYLPTTLPGAE # VNATATEGVIPPPPVLEEQPGGNPPFLVMPGPSAAPATGPSQINAPFPVMTAPPRAPSAGPQQQQQQQPNFPPESPVRHVYHPPLIFTQYSPTYQGFF # PHSPHRVLHNNNIYPTATHLHEALKYLPAHPTIANQIRLCVNLNDVYPLSAANTAYVRPDWGAIFLDEMEMVLELKFRQHAELRNLLIEGIDGQKGRE # IVYRDEHDTFWGDGGGEGRGVNELGKILAKVRDRLIDDRERGLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1115 ### # start gene g1116 4 AUGUSTUS gene 4762307 4762702 0.65 - . g1116 4 AUGUSTUS transcript 4762307 4762702 0.65 - . g1116.t1 4 AUGUSTUS stop_codon 4762307 4762309 . - 0 transcript_id "g1116.t1"; gene_id "g1116"; 4 AUGUSTUS CDS 4762307 4762702 0.65 - 0 transcript_id "g1116.t1"; gene_id "g1116"; 4 AUGUSTUS start_codon 4762700 4762702 . - 0 transcript_id "g1116.t1"; gene_id "g1116"; # protein sequence = [MIKQHTTQFLTTTEAKKILPNPKLGQLCPTIQVLGDHYKIVSFEFEDKTHGECRGDLNLVDGKGRIEDANGKLIYPAE # SKGPCVLYVLRKDVVQLQVLALSKDMAQEKHIPESESWKIPDYYNVTRRWVEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1116 ### # start gene g1117 4 AUGUSTUS gene 4764114 4764956 0.92 - . g1117 4 AUGUSTUS transcript 4764114 4764956 0.92 - . g1117.t1 4 AUGUSTUS stop_codon 4764114 4764116 . - 0 transcript_id "g1117.t1"; gene_id "g1117"; 4 AUGUSTUS CDS 4764114 4764956 0.92 - 0 transcript_id "g1117.t1"; gene_id "g1117"; 4 AUGUSTUS start_codon 4764954 4764956 . - 0 transcript_id "g1117.t1"; gene_id "g1117"; # protein sequence = [MNVETREIGHTEALKLHEIGALATRAGGASSAGPNPSSSDQVTAEKKKKKGKKEDKGKEDKGKEGKGKKGKGRKGKGK # KHKSQKDSAADKDKGNGLAAVLSCTGGGRALRDDERGFAQIQLDYFLSPNPRPPKLPAIHIPMDLPRRWAAQNVGAGGQTHQIINFQFAHPKCGKRQL # SLCRGSLNLSTNGGKVFDEAGKLIYSRAASEAMLRKAKMANKRSVSQMAIRQELCADLGHLLSFQAFPGPKLDSIKDNPIRNTLVNRECYFSDDCVVP # AQIVRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1117 ### # start gene g1118 4 AUGUSTUS gene 4767593 4768018 0.39 + . g1118 4 AUGUSTUS transcript 4767593 4768018 0.39 + . g1118.t1 4 AUGUSTUS start_codon 4767593 4767595 . + 0 transcript_id "g1118.t1"; gene_id "g1118"; 4 AUGUSTUS CDS 4767593 4768018 0.39 + 0 transcript_id "g1118.t1"; gene_id "g1118"; 4 AUGUSTUS stop_codon 4768016 4768018 . + 0 transcript_id "g1118.t1"; gene_id "g1118"; # protein sequence = [MIERDRTNILHSPLAATMSNDPSSSAQQSVQLLYAPNVQHNILTLTSIKFISAVFAGSVAGILGLTNFAGFGLFALAM # LWAALCIYVVCCKGKPGRYMASAVTAKGVNGGGSGIMELLNPGSDNAFTFVLVWTLFYGEQFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1118 ### # start gene g1119 4 AUGUSTUS gene 4772123 4772614 0.87 + . g1119 4 AUGUSTUS transcript 4772123 4772614 0.87 + . g1119.t1 4 AUGUSTUS start_codon 4772123 4772125 . + 0 transcript_id "g1119.t1"; gene_id "g1119"; 4 AUGUSTUS CDS 4772123 4772614 0.87 + 0 transcript_id "g1119.t1"; gene_id "g1119"; 4 AUGUSTUS stop_codon 4772612 4772614 . + 0 transcript_id "g1119.t1"; gene_id "g1119"; # protein sequence = [MSSNRSQHQQPEDWQSDSSAFPVIPPDSTTSSSASTSSTSALTSSSSTPLDVSSIGGNVSDQSKRHVMDMLTYYTGAK # EESFGVAIARRLQMRSMNVWATSPGNAQGRIPQRATEAQTIFEISITKGEYMLESCRPWYTQLNSDMCNPYGTLHGACACYIVDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1119 ### # start gene g1120 4 AUGUSTUS gene 4781998 4783103 0.67 - . g1120 4 AUGUSTUS transcript 4781998 4783103 0.67 - . g1120.t1 4 AUGUSTUS stop_codon 4781998 4782000 . - 0 transcript_id "g1120.t1"; gene_id "g1120"; 4 AUGUSTUS CDS 4781998 4782704 0.94 - 2 transcript_id "g1120.t1"; gene_id "g1120"; 4 AUGUSTUS CDS 4782842 4783103 0.67 - 0 transcript_id "g1120.t1"; gene_id "g1120"; 4 AUGUSTUS start_codon 4783101 4783103 . - 0 transcript_id "g1120.t1"; gene_id "g1120"; # protein sequence = [MSKEVKAWAATSPEKTEPISITRRAPDDEDVAIDIKFAGICHSDIHTVRSEWGSTTYPLVVGHEIAGVVNAVGKNVTK # FKVGDHVGVVPRGGSGFCVACSGDCSIGQGGPVDVCRYHFVFTATPLACRARKEGGHHWIWWSRSYGRQACEVSNFITILVHETDVHTRIALRALGSE # VTVFSQTNSKKELGLRLGADNYVATSEADVFSKLSRKFDLIINTVSANIPLELYLSCLRRDGSLVQVGAPEHPLQISPFSLDAQRVGIHGSMIGGIAE # TQQMLEFCGEKQIFPEIETIPASYINEAYERVMKSQVKFRFVIDVSTM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1120 ### # start gene g1121 4 AUGUSTUS gene 4787267 4788403 0.98 + . g1121 4 AUGUSTUS transcript 4787267 4788403 0.98 + . g1121.t1 4 AUGUSTUS start_codon 4787267 4787269 . + 0 transcript_id "g1121.t1"; gene_id "g1121"; 4 AUGUSTUS CDS 4787267 4788403 0.98 + 0 transcript_id "g1121.t1"; gene_id "g1121"; 4 AUGUSTUS stop_codon 4788401 4788403 . + 0 transcript_id "g1121.t1"; gene_id "g1121"; # protein sequence = [MTEDIGQNLWVNPLTKPVLRPQFLDLNSPSPIVALPSPRSSSDPIPHSFWDIYPSSSSSSVDAISSPIVNINDRVHRG # TVLRKTTQKPLGLGLRLPGKSGPCSRNSAPSIEIIRPLHSSDQTAKEKGLVGLGLKLPLGSPPASPSDSSSSFKPVSAKRRSLSELGNGHPSTRNRGP # SARVNNGGATSVTTVPSSEATIRLVTSTQHGSGSILLPKMSAQVLGQAPGVASGLAAELLDVVTIHQRRTSICLKPLLSSKDHHFTKRHMYPILESPE # SCTNSTTIPLTSASTIYPALNLTSPPSSRLRKLRSFSRSENVGVNTCSNMSSSFRKSSSLCSFQRSPRSPLQQLVDHGSEELWQPAPQKDPYLIAHNM # IARTLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1121 ### # start gene g1122 4 AUGUSTUS gene 4789700 4790103 0.61 - . g1122 4 AUGUSTUS transcript 4789700 4790103 0.61 - . g1122.t1 4 AUGUSTUS stop_codon 4789700 4789702 . - 0 transcript_id "g1122.t1"; gene_id "g1122"; 4 AUGUSTUS CDS 4789700 4790034 0.75 - 2 transcript_id "g1122.t1"; gene_id "g1122"; 4 AUGUSTUS CDS 4790085 4790103 0.62 - 0 transcript_id "g1122.t1"; gene_id "g1122"; 4 AUGUSTUS start_codon 4790101 4790103 . - 0 transcript_id "g1122.t1"; gene_id "g1122"; # protein sequence = [MEEFAEIDAEYNDAKKHSKDALNESRDALNNTTDEIREQYNEAMAKRTEYENALQTAESNGTTPPSAEGVDLRTADEY # RAELESQEAQLELVSKTQPGVIEQYEKRKRDVSSSPFYM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1122 ### # start gene g1123 4 AUGUSTUS gene 4793076 4793735 0.68 - . g1123 4 AUGUSTUS transcript 4793076 4793735 0.68 - . g1123.t1 4 AUGUSTUS stop_codon 4793076 4793078 . - 0 transcript_id "g1123.t1"; gene_id "g1123"; 4 AUGUSTUS CDS 4793076 4793735 0.68 - 0 transcript_id "g1123.t1"; gene_id "g1123"; 4 AUGUSTUS start_codon 4793733 4793735 . - 0 transcript_id "g1123.t1"; gene_id "g1123"; # protein sequence = [MPRQSRSFASSANSSDNESLKENHVNRLNRVKMEKVKQQQTKVKEENARRARARVEEQERGDGLDVDADADTDEEEDF # DNQGSGSPKGRKRARANTDGDSRPSQFQDGTSCAPRSVTLPRDPKDKCVVLVFHHRRNHSLEIIHISFIPGSIVRIQLRNFVTYDYVEFRPGPYLNMI # IGPNGTGKSSIACAIALGLNFSPKVRLFKLNPFTLVESVMFPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1123 ### # start gene g1124 4 AUGUSTUS gene 4796523 4799924 0.09 + . g1124 4 AUGUSTUS transcript 4796523 4799924 0.09 + . g1124.t1 4 AUGUSTUS start_codon 4796523 4796525 . + 0 transcript_id "g1124.t1"; gene_id "g1124"; 4 AUGUSTUS CDS 4796523 4797530 0.47 + 0 transcript_id "g1124.t1"; gene_id "g1124"; 4 AUGUSTUS CDS 4797647 4797689 0.43 + 0 transcript_id "g1124.t1"; gene_id "g1124"; 4 AUGUSTUS CDS 4797981 4798005 0.44 + 2 transcript_id "g1124.t1"; gene_id "g1124"; 4 AUGUSTUS CDS 4798099 4798321 0.39 + 1 transcript_id "g1124.t1"; gene_id "g1124"; 4 AUGUSTUS CDS 4798389 4799924 0.85 + 0 transcript_id "g1124.t1"; gene_id "g1124"; 4 AUGUSTUS stop_codon 4799922 4799924 . + 0 transcript_id "g1124.t1"; gene_id "g1124"; # protein sequence = [MRSHRTLIPFIALAVTLAANAAPVFHPLGARASDTNVLPMRRASPTPDLLEAQSNVDVDFNADSLLRSRTVEPRAKNK # NKKRKKQKAKAGGGGGQTNTSTDGQGVPVPEGNKEATTNGGKAEAAQAPPKKPQPANEANGNTRAGPSNSGASGVKEKEKEPVSAAITPSSDHEPKHG # GLSRVNTGSSVSSTSSHSSTSSDGSVYSCSSYGSSQSSVNPYNHDHVYGTQCDPVPHQPAEEAGESKEEEDKEKKKEDQEKEKKKRKQKMRNFFGGAS # TLVGVGLLGAGIYGIDSLAKSSKSAFASVGSEGESSESSGLASSGLESSGSESSGLDGIQFGRGKDIFVTIAYYDCYLGQFRQRYSESLSSDITLGKE # KPLWPLSSYGPAKYEPVIVVGLDACPEELRVKAWEAKVQNNLNGYIQYEATQISQADNAFNNARNNIQTLYTQAVKQSSVVGSTTGASSSAFPSSSSS # PFASSSSSNGAFGSQSAFGPSSVSTPSIFGASANSNSVFGTSNSAPTLATGSVNNGAFSSLMNKNSTTSAFATPSTTATTSAFGQPSAFGANNNNSPF # GKPPTSVFGTSTFGQPSSTAFGGTPSTTNTSSVFGAPSTTTTSAFGQSSTFGSSPAASTTSAFGAPAAASTSAFGQTSTPTSSLIKPAISGGAFAAFA # NSGPSAFGSGAPSGSGSGGGFAAFANSQPSTFSGTSSTNTSGSAFGQPSAFGASSTGGNAFGSNSAPPAAPTSAFGALAPAAPSTTFGAFSQPASTAS # TSVFGQPASSTSVFGQPAPSTTNPASVFGQPSTNATSAFAQTPAFTQPSSAFGSLTSSTSAPSAFGAFGTTATTNNTSAFGTQSAGGGFGSGGGGAFG # SSTPLSNTTNTSSNSTDSKPNFDAPHLRKLFRPGKTPYDSQLPPNYLESVLPKAVVEVFKRDRFDWGKGGGVPEWIPPVELR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1124 ### # start gene g1125 4 AUGUSTUS gene 4801173 4802327 0.99 + . g1125 4 AUGUSTUS transcript 4801173 4802327 0.99 + . g1125.t1 4 AUGUSTUS start_codon 4801173 4801175 . + 0 transcript_id "g1125.t1"; gene_id "g1125"; 4 AUGUSTUS CDS 4801173 4802327 0.99 + 0 transcript_id "g1125.t1"; gene_id "g1125"; 4 AUGUSTUS stop_codon 4802325 4802327 . + 0 transcript_id "g1125.t1"; gene_id "g1125"; # protein sequence = [MLIRNTVFPFLTLAISLSVQGAPIDFKPRGNSHIVIARNAAGFLERDASFDDKTSFLRSGERSRLEARQQQKGPKSGQ # QNSSSHKKNIVYSWGKNTDRNRRKKAKQRAKAKLRKATANTKSVHPTVTAKTVATPPHVGALKEPVQAPLTEAEKKKPEPEKAAEKKEEEKKKDGGEA # KKEEPKPVIPEHTETPAEKKEELNHLQTTEGEAPVPPTGADVATAATAAVGSLAQLAPMIAQGMAAGGSAGASSAIANDVMGGGASGSPNSGSSSNAG # SSSTGVPPSSTGSSSSSNFSGDTGSSSSDSSTGSNKGEGEKEGKGDEDGGKKEDDKEDDGTGDGKGDETSDGSNNGKSDENGNSENDKNTDSKKKSPD # SDSGHGPTEEVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1125 ### # start gene g1126 4 AUGUSTUS gene 4804896 4805201 1 - . g1126 4 AUGUSTUS transcript 4804896 4805201 1 - . g1126.t1 4 AUGUSTUS stop_codon 4804896 4804898 . - 0 transcript_id "g1126.t1"; gene_id "g1126"; 4 AUGUSTUS CDS 4804896 4805201 1 - 0 transcript_id "g1126.t1"; gene_id "g1126"; 4 AUGUSTUS start_codon 4805199 4805201 . - 0 transcript_id "g1126.t1"; gene_id "g1126"; # protein sequence = [MPTHDDDEDARTQVEVDRIPTSPSKYPTTIVDGEDVEKRSTRQEAQDVKPVYSPTNILDSREVVIVDWDGPDDPKNPK # KPVSALLVLQYTDSFVLQLAPES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1126 ### # start gene g1127 4 AUGUSTUS gene 4807013 4807330 0.6 - . g1127 4 AUGUSTUS transcript 4807013 4807330 0.6 - . g1127.t1 4 AUGUSTUS stop_codon 4807013 4807015 . - 0 transcript_id "g1127.t1"; gene_id "g1127"; 4 AUGUSTUS CDS 4807013 4807330 0.6 - 0 transcript_id "g1127.t1"; gene_id "g1127"; 4 AUGUSTUS start_codon 4807328 4807330 . - 0 transcript_id "g1127.t1"; gene_id "g1127"; # protein sequence = [MYYDERGLLLNVSRQYRKERKARRLAKLAQDGRTARTKTRSSSDTGKFSGLEEDAIIDDEDGDEESERDHQEEPTKAP # VRRKDHDIADMYKTMDGSALIAIGSYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1127 ### # start gene g1128 4 AUGUSTUS gene 4818985 4820202 0.5 - . g1128 4 AUGUSTUS transcript 4818985 4820202 0.5 - . g1128.t1 4 AUGUSTUS stop_codon 4818985 4818987 . - 0 transcript_id "g1128.t1"; gene_id "g1128"; 4 AUGUSTUS CDS 4818985 4820202 0.5 - 0 transcript_id "g1128.t1"; gene_id "g1128"; 4 AUGUSTUS start_codon 4820200 4820202 . - 0 transcript_id "g1128.t1"; gene_id "g1128"; # protein sequence = [MIMKQIALPSWDRLHYYASRVRIFKDDGTDNVHESVYAILGQSKPIFPNLAQLLPGTQICMYSLVFFLTSSISRAMIP # FPFFPQSEHLDFGPSLALLASKSPGLRSLFITTSQFSGISASLRGFRELEALHLGRLPQYEKDYIQSLASLTKLTYLNLTLPNGDSFDYVGLQTSFPS # LKQLSIIGSSSELHNFLKIVTPLSLQILSLAWHGYPSIIDAIGVTTSLGRFSSLQNLNIDNATSLFVVDPDRERLWSLFNPLLKLTQIRSLRYSSPLF # LTDQITATIASSWPHAETLHFTAVSWSEIPPVSSLAHFARECPNLGYLQYPIQIDASPGAAAPPPTPFMHPLRDFICSVHYDVLYPLDVALSLHQIFP # SLKNVSGDGNRWDEVKAILESYHLILAQDRRSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1128 ### # start gene g1129 4 AUGUSTUS gene 4823134 4823990 0.36 - . g1129 4 AUGUSTUS transcript 4823134 4823990 0.36 - . g1129.t1 4 AUGUSTUS stop_codon 4823134 4823136 . - 0 transcript_id "g1129.t1"; gene_id "g1129"; 4 AUGUSTUS CDS 4823134 4823923 0.4 - 1 transcript_id "g1129.t1"; gene_id "g1129"; 4 AUGUSTUS CDS 4823986 4823990 0.36 - 0 transcript_id "g1129.t1"; gene_id "g1129"; 4 AUGUSTUS start_codon 4823988 4823990 . - 0 transcript_id "g1129.t1"; gene_id "g1129"; # protein sequence = [MLHHSHSGQFCRHAAGSLEDVVLEAIRSGFEVYGLTEHVPRYRIEDLYPEEVTCLLMDFPKTHMWQCKAGMDLQALHD # QFDAFVYEAHRLKARYASQITLLVGLETDYITSIDLDQLDALLERNRGRIEYIVGSIHHVGEIPIDFDVDTFRKSLAQQPGTSENERMENFLCRYFDA # QFHVLQRFHPELIGHLDLCRLYHPEIRLSDYSRSWKRLKRNISYAIEYGALFEVNAAAFRKNWNTAYPAEDLLKVETFLLISLNNSSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1129 ### # start gene g1130 4 AUGUSTUS gene 4824820 4827581 0.32 - . g1130 4 AUGUSTUS transcript 4824820 4827581 0.32 - . g1130.t1 4 AUGUSTUS stop_codon 4824820 4824822 . - 0 transcript_id "g1130.t1"; gene_id "g1130"; 4 AUGUSTUS CDS 4824820 4825562 0.95 - 2 transcript_id "g1130.t1"; gene_id "g1130"; 4 AUGUSTUS CDS 4825616 4825767 0.88 - 1 transcript_id "g1130.t1"; gene_id "g1130"; 4 AUGUSTUS CDS 4827067 4827430 0.96 - 2 transcript_id "g1130.t1"; gene_id "g1130"; 4 AUGUSTUS CDS 4827539 4827581 0.52 - 0 transcript_id "g1130.t1"; gene_id "g1130"; 4 AUGUSTUS start_codon 4827579 4827581 . - 0 transcript_id "g1130.t1"; gene_id "g1130"; # protein sequence = [MSSTLARLTSALPPASTVLSALQLAPKRTPELQDKFVLCQVPCYTEGEDSLRRTIDSLAALNYDDKRKLIFIICDGNI # TGSGNDRTTPRIVQDILGVDPKLDPEPLMFKSVGEGSRALNYGKVYSGLYEFEGHVVPLFLPVYSFWCMDEFGWGNTRLVIGEGKDKKVIVNDDDKFD # ESMIPLKKFSEYEAEAWETGSRHSDETGYSKPHTHPRPTASRTGSPYNYQQGSQAGDYYRDTNLTMNSRSNPNPFTGSQQSLSNLSHHGGQQYAAPQL # PYMPFGGGPGSAAGSDYGGRMPMGPVMPMGYQNTGSMYGMPMGMGMNMMSPAAMDPRTTMMAGMMTGGSFGGSQSGAFAPPTMPASQEQRPLSTFSMA # TTVNPFAGPSQNPNPSDDELFAALRSYLGTQDLMTVTKKYVLLCPVDDDFYSCVVEPLEKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1130 ### # start gene g1131 4 AUGUSTUS gene 4827842 4831376 0.21 - . g1131 4 AUGUSTUS transcript 4827842 4831376 0.21 - . g1131.t1 4 AUGUSTUS stop_codon 4827842 4827844 . - 0 transcript_id "g1131.t1"; gene_id "g1131"; 4 AUGUSTUS CDS 4827842 4830956 0.35 - 1 transcript_id "g1131.t1"; gene_id "g1131"; 4 AUGUSTUS CDS 4831012 4831376 0.29 - 0 transcript_id "g1131.t1"; gene_id "g1131"; 4 AUGUSTUS start_codon 4831374 4831376 . - 0 transcript_id "g1131.t1"; gene_id "g1131"; # protein sequence = [MASNHNVQAVASGDLIDLVSSSGSATIYPTDDAILAVLQARFRADLPYTRAGATNFVAINPYKTLASVNNASAKEYEE # RSYKDTSLPMVDSPKLLQPHIYDLAARMYLVMRRRNESQALLARGITGSGKTSNLRLFTNQILRLSSHSSKEAKIAEQVKALGIVLESFGNSKTLMNP # NASRHSRYTELHFNERGRIAGAKVLTFGLDKSRLNRLTQEERSFHVFYQFIAGCTSAERDALNIEDPSDYALLASSGTYRLPAGPSSDDSIAMGDLRA # AMRTLGFKPKATAAIFSLLIAILLLGNLEFGEGDFHTVSAHVTNVEVLDHVSRLLGVSSEDLSQALTNKTSYVRKELYTALLNAQQSALQRDQLVRDL # YAIMFAFVVETANHKVAPSSKSPPPHSQIVLLDQPGYQSRGPTGTSSVALSGNAPLISAYGQNGFDEFCINFADEMLQSYFTRQTFEDTVGYSNHIVS # DGVSIPAISTMDNTACVEMLRGQLPDKAQRKPGGLLSLMNKASSAHKQGKGNSDHRNEDLLQEMQAKFGVHASFVATSGNANRMQFGVNHYAGVCMYD # VSDFVEKDTDLLDPAFVPLLRNSSESFVAKLFSGPSLAVEKHYKDESIVVQAQVSSRPLRTLTPFVSSNFTGEGERTSEDAQEHLELDRGKSYPVTTQ # INFTLSELFANISKARLWALSCIRPNDSGSPNSFDKRRVKAQIRSLLLSDLASRRSVEYIADFDLAQFCDRYVPTMRGSESERITQCARANGWIEGVD # YVVGHRSIWLSYSAWKMVEDTVRAVEKDAKRALGDAGMEMDDDEDASVAPDDGTEYTHEGGGYGYGGVGSQMDGGGLGASNDDLVLRRTGTNGTQHRS # PNQGPAYNALPAPNSPAQMSTPNAFRGQADDGGWGSEWDKKDESSVTGTGTVPAGSSVKEGDGLVVKDAPDSVEEVPSTRSRRFWLGTVWACTWFIPS # FLLTHVGRMKRPDVRLAWREKVTICFLILLLNGIVIFYIVIFGRLLCPDYDNAWLTNEVAEHTADNDYYVAIQGKVYDVSNFVQGQHSDIDGEDSNSD # DVLEALAGLDLTYYFPVPLVLGCGNLGPTSTMKLSFKNFTETEPTADHSSGEFAQSTTSQLHNSDWYTATFQPVINQYHIGTLVHSWDEIQSYASDED # IEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1131 ### # start gene g1132 4 AUGUSTUS gene 4833184 4834371 0.48 + . g1132 4 AUGUSTUS transcript 4833184 4834371 0.48 + . g1132.t1 4 AUGUSTUS start_codon 4833184 4833186 . + 0 transcript_id "g1132.t1"; gene_id "g1132"; 4 AUGUSTUS CDS 4833184 4833358 0.77 + 0 transcript_id "g1132.t1"; gene_id "g1132"; 4 AUGUSTUS CDS 4833683 4834371 0.61 + 2 transcript_id "g1132.t1"; gene_id "g1132"; 4 AUGUSTUS stop_codon 4834369 4834371 . + 0 transcript_id "g1132.t1"; gene_id "g1132"; # protein sequence = [MEDIAGWKASTVFITIDSLKNHEEKGAAGDIYGGRCPTWGEARDIEWRKAEEEPEVLIKWLEQYVVSQDLLVWTKSRV # IPAPTYDRDSKRWTVTVNKAGKICTLHPKHVVVATGMLGEPYMPTIEDQETFEGQIMHSEGFSGGADFIGKRVVVIGTGNSGADIALDLSTHKARSVT # MIQRSTTVVQPASTIAEQHLQVYPPDVPVEVSDFRAFATPTFRLFEILAETRGLMWDQEKDLIEGLRKAGMNVDMGPYGAGILPLVYLRFGGACSSVP # WPQHLTNVASCIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1132 ### # start gene g1133 4 AUGUSTUS gene 4840678 4841598 0.96 - . g1133 4 AUGUSTUS transcript 4840678 4841598 0.96 - . g1133.t1 4 AUGUSTUS stop_codon 4840678 4840680 . - 0 transcript_id "g1133.t1"; gene_id "g1133"; 4 AUGUSTUS CDS 4840678 4841598 0.96 - 0 transcript_id "g1133.t1"; gene_id "g1133"; 4 AUGUSTUS start_codon 4841596 4841598 . - 0 transcript_id "g1133.t1"; gene_id "g1133"; # protein sequence = [MLAISEDSLISLEEVHIQDGPSGNPRSLDIQASELRSWTSVGTTSSPFIRVLPPTSVCQQITEYSISNVTYTEVLKVI # RLFPHLRQLSVQNLSPENDLPGPELPATRLSQLQALHLIQLNLSASSANAFIALLDVIVCPALTHLLVDACGNISGAIQRLKERSNFELQHLIAAEDA # DAFVKGLSNCLELEEVEIRGAYLYKSITEVLAHLSTITTPTKLNNPSQLPPLPNLRRLHFQLGVLPFVDVVVENLHACVISRLFCAQHTTGLRQLEIC # ITTPDAQARKILDSPRLKYLHSVGVKIEIIGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1133 ### # start gene g1134 4 AUGUSTUS gene 4842978 4844348 0.5 - . g1134 4 AUGUSTUS transcript 4842978 4844348 0.5 - . g1134.t1 4 AUGUSTUS stop_codon 4842978 4842980 . - 0 transcript_id "g1134.t1"; gene_id "g1134"; 4 AUGUSTUS CDS 4842978 4844073 0.65 - 1 transcript_id "g1134.t1"; gene_id "g1134"; 4 AUGUSTUS CDS 4844212 4844348 0.52 - 0 transcript_id "g1134.t1"; gene_id "g1134"; 4 AUGUSTUS start_codon 4844346 4844348 . - 0 transcript_id "g1134.t1"; gene_id "g1134"; # protein sequence = [MRRMPLDVLELIFRFGAGYFTNPEDFFNSTTHCLDIKSPPWIYARVRSNGLPLIVYIDVLFAPASPDLVGIALRLISA # HSRRWQSLFLVGGQGIDTKIYSGDSLMSLENIQIQESSMEAPRPLDIAASQLRAWSAVGNLLSTSVQITPPTSLCRQITEYSISTVMYTEVHKILPLL # PNVRKLSVQDILNSNNPPTSELRLPYLRELNIRQQNNPLATFLPTDGLVALLDSISCPALTHLSVSVYGIFGDAFKRFERRSNFKLQHLIAGEGAGIL # VKGLQNRLALETIEIRGFHFYTSVIEVITHLHVPPALTPVALSMSWSPATSNSHSNISPPVTPFPNLRRFQFQLSLLPFMDIMEKLHACVSSRRSGSA # APLEILVAARDGQARTMLGHPRLKDLRSMGAKVEITST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1134 ### # start gene g1135 4 AUGUSTUS gene 4846678 4846989 0.64 + . g1135 4 AUGUSTUS transcript 4846678 4846989 0.64 + . g1135.t1 4 AUGUSTUS start_codon 4846678 4846680 . + 0 transcript_id "g1135.t1"; gene_id "g1135"; 4 AUGUSTUS CDS 4846678 4846989 0.64 + 0 transcript_id "g1135.t1"; gene_id "g1135"; 4 AUGUSTUS stop_codon 4846987 4846989 . + 0 transcript_id "g1135.t1"; gene_id "g1135"; # protein sequence = [MVLPEATTAGQFYLDYIIYNPIPTFTLPSPAATIIGSTYSTLSTCTAGTTPYPSSAAVPAIAGGVVGSIAGVVVGMIL # TFALLRKIRIRFWRKFTGIPAKYKH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1135 ### # start gene g1136 4 AUGUSTUS gene 4850801 4851575 0.51 - . g1136 4 AUGUSTUS transcript 4850801 4851575 0.51 - . g1136.t1 4 AUGUSTUS stop_codon 4850801 4850803 . - 0 transcript_id "g1136.t1"; gene_id "g1136"; 4 AUGUSTUS CDS 4850801 4851085 0.71 - 0 transcript_id "g1136.t1"; gene_id "g1136"; 4 AUGUSTUS CDS 4851135 4851575 0.51 - 0 transcript_id "g1136.t1"; gene_id "g1136"; 4 AUGUSTUS start_codon 4851573 4851575 . - 0 transcript_id "g1136.t1"; gene_id "g1136"; # protein sequence = [MQDGGYEGNLGNQGRDYGGSYGGFYGEGYKGPDSGYGGYNRGLYQNFERNYPGGRGYDHFSQSHSLQGFIKDDRGMKG # FEVAESARTGFQEATHLGTAQASEVAQRGVSSITEKLREPTAEGRSFYSYVRYGSLIALLDSEKTRKSLLEGEADPATDFIKKRKRNFPKPPDPLVLK # SHAKSQISATEEDFEEEEQAEFEHDPDADEEENEEENLGDEDSTLTSREYKREQFLTQTLFEFKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1136 ### # start gene g1137 4 AUGUSTUS gene 4852916 4853278 0.93 - . g1137 4 AUGUSTUS transcript 4852916 4853278 0.93 - . g1137.t1 4 AUGUSTUS stop_codon 4852916 4852918 . - 0 transcript_id "g1137.t1"; gene_id "g1137"; 4 AUGUSTUS CDS 4852916 4853278 0.93 - 0 transcript_id "g1137.t1"; gene_id "g1137"; 4 AUGUSTUS start_codon 4853276 4853278 . - 0 transcript_id "g1137.t1"; gene_id "g1137"; # protein sequence = [MQEILNDYGKSGENPYFKHFLSGVQGLYSLDGSSHQRKTYLATAPSSPPSMRLDIGDESDSDSDMGSEAYRGDDRDME # EPWEENTETTSTNEGKDQNTEILYLDQGILFYLFEFCFDELL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1137 ### # start gene g1138 4 AUGUSTUS gene 4855829 4857277 0.8 - . g1138 4 AUGUSTUS transcript 4855829 4857277 0.8 - . g1138.t1 4 AUGUSTUS stop_codon 4855829 4855831 . - 0 transcript_id "g1138.t1"; gene_id "g1138"; 4 AUGUSTUS CDS 4855829 4857277 0.8 - 0 transcript_id "g1138.t1"; gene_id "g1138"; 4 AUGUSTUS start_codon 4857275 4857277 . - 0 transcript_id "g1138.t1"; gene_id "g1138"; # protein sequence = [MEGSNSNTRTPSGSLTRPPSPQPASPPPSLPSQPPSETPDQSPLETPHGTPHGTPHGTPHGTPHGTPRESPLETPLEM # TLETHFKTPLETTLETHFETPHGTPCESPLETPLETRFETPHGTPRESPLEMRFETPLESRFESPLESRFESPLESRFESPLESRFESPLESRFESPL # ESRFESPLESRFESPLESRFESPLESRFESPLESRFESPLESRFKSPLESRFESPLESRFKSPLESRFESPLESRFEIPRESRFETPLESHFEMRFEM # RFETPHERPSETHSLQLLSPSPPCQPAPSTPSSASTLSQSLPGSPLKDQPPPSNRDSQPSKRKRTKKNPGRTPGGGFEDPGPIACPRKSIRTKKRRRT # DTYDYEDNTTSRFATGNVAAEPSKDVSVDLTTQLARISFGTQTTVGHVDYSSWVSGLKAIMEGTLDNVKDLAVSSLLNIARRCDLASKVDGTARFVRM # LNELYFAAKVNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1138 ### # start gene g1139 4 AUGUSTUS gene 4862509 4864152 0.99 + . g1139 4 AUGUSTUS transcript 4862509 4864152 0.99 + . g1139.t1 4 AUGUSTUS start_codon 4862509 4862511 . + 0 transcript_id "g1139.t1"; gene_id "g1139"; 4 AUGUSTUS CDS 4862509 4864152 0.99 + 0 transcript_id "g1139.t1"; gene_id "g1139"; 4 AUGUSTUS stop_codon 4864150 4864152 . + 0 transcript_id "g1139.t1"; gene_id "g1139"; # protein sequence = [MSDPLGQLRVCYTPLASAIVDTPEASLIACTGGKTSPFTKAIYKDFGDPKRHPPRLTTDTLNAIDSIQARNIFPQDLP # AYQKASVTARTNGVVSPFWRDWPLAEPCEFLTPEPLHHWHKMFWDHDIKWAIQAVGAASIDFRFSIHQPTVGYRSFKEGVSTLKQVTGRTQRDIQRYL # IPLISGAVTSQFVTALRALMDFRYAGQATRFNQVSASRVQAALDEFHENKDIIQHLKARVNPKGVPIVHWEIPKLEFMQSVEPSIRASGPIMQWTADT # TEHAHITLVKDPARSGNNHDFEVQICRHLDRQARVRRFDLMTAMVDARVDFRLGDIEGDEGRGDEGGDSGKELLDEEEATTKISSSEQLAAHLNPVSK # KLFGSFRPKRNFFLRARLLKQTPSAPLPLRIFSDEVSGEISAFSFVRDADLKTLTIEQVSILYALPDFRGACIDFLERYEAKTVSFVIGGRRGNSQLT # LPFTKVRNWSRFRIQSKTYFNTDLLTDPHTIFAAPPSADWEFGRQNAAIINIDPSFEWPRSSLEGEASIFVELCFTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1139 ### # start gene g1140 4 AUGUSTUS gene 4867669 4868020 0.69 + . g1140 4 AUGUSTUS transcript 4867669 4868020 0.69 + . g1140.t1 4 AUGUSTUS start_codon 4867669 4867671 . + 0 transcript_id "g1140.t1"; gene_id "g1140"; 4 AUGUSTUS CDS 4867669 4867729 0.77 + 0 transcript_id "g1140.t1"; gene_id "g1140"; 4 AUGUSTUS CDS 4867812 4868020 0.7 + 2 transcript_id "g1140.t1"; gene_id "g1140"; 4 AUGUSTUS stop_codon 4868018 4868020 . + 0 transcript_id "g1140.t1"; gene_id "g1140"; # protein sequence = [MPHKFEDSAASSKSIKKDMQAIDNAPTGRDLYRSAPVYQDAPDDPPEPMETLKNPGSAGTESQVGAAGATGTLEIVRD # APVCRDFSICA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1140 ### # start gene g1141 4 AUGUSTUS gene 4884477 4884812 0.84 + . g1141 4 AUGUSTUS transcript 4884477 4884812 0.84 + . g1141.t1 4 AUGUSTUS start_codon 4884477 4884479 . + 0 transcript_id "g1141.t1"; gene_id "g1141"; 4 AUGUSTUS CDS 4884477 4884812 0.84 + 0 transcript_id "g1141.t1"; gene_id "g1141"; 4 AUGUSTUS stop_codon 4884810 4884812 . + 0 transcript_id "g1141.t1"; gene_id "g1141"; # protein sequence = [MISNPSNSPCTLGAHSWIRRNVQIPVDESSTPYVWGVVDLVPETDFPDFRNWAGIRSDSGSCMIIPRERDMIRIYVQL # EGQNAIDATKEAADGSKVKMGPEWILDVSKSEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1141 ### # start gene g1142 4 AUGUSTUS gene 4885503 4885922 0.89 + . g1142 4 AUGUSTUS transcript 4885503 4885922 0.89 + . g1142.t1 4 AUGUSTUS start_codon 4885503 4885505 . + 0 transcript_id "g1142.t1"; gene_id "g1142"; 4 AUGUSTUS CDS 4885503 4885922 0.89 + 0 transcript_id "g1142.t1"; gene_id "g1142"; 4 AUGUSTUS stop_codon 4885920 4885922 . + 0 transcript_id "g1142.t1"; gene_id "g1142"; # protein sequence = [MIQKSTEFSSGIGVHYLPSDIVDIKNQGLASGIVIGKRMPPGTVVRLLDFCPIHIHDLLPSDTRFKILVFAGNASSSA # QRMRLQQLAVKIGNLRSLLGLDILPGNSSQSGLDVLTILSTKLELALFKELPLKLRSHWSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1142 ### # start gene g1143 4 AUGUSTUS gene 4886695 4887339 0.48 - . g1143 4 AUGUSTUS transcript 4886695 4887339 0.48 - . g1143.t1 4 AUGUSTUS stop_codon 4886695 4886697 . - 0 transcript_id "g1143.t1"; gene_id "g1143"; 4 AUGUSTUS CDS 4886695 4887339 0.48 - 0 transcript_id "g1143.t1"; gene_id "g1143"; 4 AUGUSTUS start_codon 4887337 4887339 . - 0 transcript_id "g1143.t1"; gene_id "g1143"; # protein sequence = [MSFDAFHGFSIDNHNLTIIEVDGINTLPHTVNFIEIYPAQRYSFVLNANRPISNYRIRALSNTGVGAQNFTNGVNSAI # LRYVGAPEEEPQTSQPLSSDVMIFREGDLHPLENPGAPGNPYPGGADLVLNFTLGFDAEMVLFSMNGVVFESPTVPVLLQILSGAHHAQDLLPKGGVH # TLPPNKVIEINFFGGDAPAGPHPFHLHGVSRLILYAGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1143 ### # start gene g1144 4 AUGUSTUS gene 4897953 4899569 0.36 + . g1144 4 AUGUSTUS transcript 4897953 4899569 0.36 + . g1144.t1 4 AUGUSTUS start_codon 4897953 4897955 . + 0 transcript_id "g1144.t1"; gene_id "g1144"; 4 AUGUSTUS CDS 4897953 4899569 0.36 + 0 transcript_id "g1144.t1"; gene_id "g1144"; 4 AUGUSTUS stop_codon 4899567 4899569 . + 0 transcript_id "g1144.t1"; gene_id "g1144"; # protein sequence = [MDTEESACPQCGYFSKRKLPVSPSDSSRIAELCSTSQCPTVEEEKSFQSFVGEGQSFLNDLDTRIALMKTSIQALENT # RELLKPVVMQYKESLNPIRRVPSDVWGHIFFYGAGYDKDHEEYFDSASHSLDLNSPPWVYGRVCRQWKDIIHNMPSLWTRVKIKLHKMQTSDSHIPMV # LLLISIYFRHSKTLPLIVYLDMSSPESSPSISDFITDISNVVLTHSWRWKLLVLAGGQGTGATSVSEDDFISLERIEIRESDSRDGPTSSLEIVAPKL # RAWSTVGSCWSNSVKIMPTSSLFHQITDYSISAVASSEVLKIIPQFPNLRKLSVRGLLVGNDRPRSEVILCLPNLGEFSIEQYNPLTAFPALTALLDS # LSCPVLTHLTVIASGIISDAVKRFEMRSKFQLEHLIIGRDAGKFVKGLLNPLVLRSIAIRGDHSFSSVHLVLSEITGTDAQTPSFPDLRELQFYWNQS # LSMSPVDFKIMDMVYACVNSRIQRSNATGVAPLKMLITASDEQARKMLDHPLWRDLRSKGAAVDIIAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1144 ### # start gene g1145 4 AUGUSTUS gene 4903912 4904103 0.6 - . g1145 4 AUGUSTUS transcript 4903912 4904103 0.6 - . g1145.t1 4 AUGUSTUS stop_codon 4903912 4903914 . - 0 transcript_id "g1145.t1"; gene_id "g1145"; 4 AUGUSTUS CDS 4903912 4904103 0.6 - 0 transcript_id "g1145.t1"; gene_id "g1145"; 4 AUGUSTUS start_codon 4904101 4904103 . - 0 transcript_id "g1145.t1"; gene_id "g1145"; # protein sequence = [MFSIVSIEELTIPMDDWKITRNTDSTSSAHSDTGGYRAPLQDLDLDPVGDFSYNVDSHSDPGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1145 ### # start gene g1146 4 AUGUSTUS gene 4911389 4912342 1 + . g1146 4 AUGUSTUS transcript 4911389 4912342 1 + . g1146.t1 4 AUGUSTUS start_codon 4911389 4911391 . + 0 transcript_id "g1146.t1"; gene_id "g1146"; 4 AUGUSTUS CDS 4911389 4912342 1 + 0 transcript_id "g1146.t1"; gene_id "g1146"; 4 AUGUSTUS stop_codon 4912340 4912342 . + 0 transcript_id "g1146.t1"; gene_id "g1146"; # protein sequence = [MSNPTPAPTTTTSNIHGKSLLREPSIFDGDKAQFKEWRRTLFAYIRDPRNRIVTDSERIDIAVSYMRGPKVSSWVQNY # TDDNFNDDEEEWKVTWKGFKDALNASFLDKGLTENAQEKLEHLRQGPNERAEDFFKEFEVIMRDAGYAKDAPYVIRLIEMNIKPKLIDQVYGTSNERI # EKFDELKQKIISIDDMWWRREEMRRNWSSRYQRNAGQGPSSQRWQPQTTQAPATKAPTPAVPTQDRKDGTGTTFKGAGRPMDIDAARRNKECFHCGKQ # GHIAKFCPEKAPKPQFVRGMWSRMTQEDQETMAKELGFVLPQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1146 ### # start gene g1147 4 AUGUSTUS gene 4912468 4916301 0.94 + . g1147 4 AUGUSTUS transcript 4912468 4916301 0.94 + . g1147.t1 4 AUGUSTUS start_codon 4912468 4912470 . + 0 transcript_id "g1147.t1"; gene_id "g1147"; 4 AUGUSTUS CDS 4912468 4916301 0.94 + 0 transcript_id "g1147.t1"; gene_id "g1147"; 4 AUGUSTUS stop_codon 4916299 4916301 . + 0 transcript_id "g1147.t1"; gene_id "g1147"; # protein sequence = [MTTRAEKKPVRYEPNTPEWVAQRLQMDKLPMAIGILRAWMPESRVREASEETVLAIRNLSHATATEAVTNLKSRKRFV # RGTRGRELKLRTTIENIDNGVQIETEALLDSGATGSCINKDFVEQHQLTVKELPVKMPVYNADGTLNKNGSIEGYVQVRMVIGDHAERIDMAVTNLGK # TDIFLGIDWLRYHNPSIDWKESTLTFERCPDKCGYLPHYESPEDDGTEEKLVDGERIFWFDWDGYFSDQSHIKVQTATTDAATPYLAEYADVFSKKDF # DQMPERRPWDHAIELTPGSKPVDCKVYPLSPPEQKALDEFLEENLRSGRIRPSRSPMASPFFFVKKKDGTLRPVQDYRKLNDMTVKNRYPLPLIQELI # DKLKNSKIFTKMDVRWGFNNIRIKEGDEWKAAFRTNRGLFEPTVMFFGLTNSPATFQAFMNHILRELIDQGHVIVYMDDILIFTDNIEEHRIIVRKVL # DILKANKLYLKPEKCTFEAREVEYLGIIVGNGQIRMDPKKVEAVRTWQSPQKKRELQSFLGFCNFFRRFIRDFSKIAKPLTRLTGNATWEWTSLEQDA # FNQLKDRIIEDVTLIIPRETGKFRIEADSSDYANGAVLSQNVDGKWRPVAFRSRSLNEVERNYEIYDKEMMAIMDSLSDWRQYLLGAKEPVEVFTDHQ # NLQYFRKPQKLNRRQARWVVEIAEYHIELFHKPGKSMGKADALSRMSGLEKGENDNTDVTLLKPEFFISQVTDQTSAPEDDLLNLIRRKKNQRDRLVQ # VALESKDKEWLETEDGLAVWQGRIYVPKDKELRGRIIQAHHDAQTAGHPGRYKTIELITRNYWWPGISRDVRIYVEGCEKCQATKTHRTKPVGPLHPH # DVPSEPWEIIGTDMIGELPESGGYNAISVFVDHFTKRLRLFATHTTITSEGMARVYRDKVFPIHGMPRKIVHDRGPQYHARFMKELYKLLGIESNYTT # AYHPQTNGQTERINQEIEHYIRLFVNHHQSDWHEWLPMMEFAYNDRVHSATKVSPFYADNGRHPYKGTTPKMTSQNPTAQEFADSMKRIREEVGSALK # KAAEDMKRQYDKHRNEAIEYKAGDKVWLEGTNITTDRPMKKLGDKRFGPFKVLEKIGSSSYKLDIPRTWKRVHNVFNETHLSPYHEPQFPTQPRNTEP # PPEVVGEEEEYEVEEVVDARKYRNGIQYKVKWRGYGPHEMTWEPAANMTNAKEAVQDFHKKYPNKPRPRTLKRIEIPIAQFPTELFRQIPTPDIEPVP # STMPSEALVNRLARHGIRALKGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1147 ### # start gene g1148 4 AUGUSTUS gene 4918686 4918955 0.86 - . g1148 4 AUGUSTUS transcript 4918686 4918955 0.86 - . g1148.t1 4 AUGUSTUS stop_codon 4918686 4918688 . - 0 transcript_id "g1148.t1"; gene_id "g1148"; 4 AUGUSTUS CDS 4918686 4918955 0.86 - 0 transcript_id "g1148.t1"; gene_id "g1148"; 4 AUGUSTUS start_codon 4918953 4918955 . - 0 transcript_id "g1148.t1"; gene_id "g1148"; # protein sequence = [MFEDIKKLRGSTKFDVQNRLMGFFKASNDGVKFTGNIDHMGNDWKGDAWDNAYMAMTDPGEYKKKLQVGRGKWNVELR # LEEQKKAMGSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1148 ### # start gene g1149 4 AUGUSTUS gene 4925449 4925889 0.36 - . g1149 4 AUGUSTUS transcript 4925449 4925889 0.36 - . g1149.t1 4 AUGUSTUS stop_codon 4925449 4925451 . - 0 transcript_id "g1149.t1"; gene_id "g1149"; 4 AUGUSTUS CDS 4925449 4925804 0.41 - 2 transcript_id "g1149.t1"; gene_id "g1149"; 4 AUGUSTUS CDS 4925880 4925889 0.6 - 0 transcript_id "g1149.t1"; gene_id "g1149"; 4 AUGUSTUS start_codon 4925887 4925889 . - 0 transcript_id "g1149.t1"; gene_id "g1149"; # protein sequence = [MKVILQGPHANTIIQKAFGSQADVQKIHSCVQKLVTGKVFIPAADVDMEAGNGAGGATDPQSKHITFSLGYFSGTTKE # DSDRRAGTLIHEASHALCGTYDYFDHSNCEPTTLKANNLNGCM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1149 ### # start gene g1150 4 AUGUSTUS gene 4926959 4928026 0.44 + . g1150 4 AUGUSTUS transcript 4926959 4928026 0.44 + . g1150.t1 4 AUGUSTUS start_codon 4926959 4926961 . + 0 transcript_id "g1150.t1"; gene_id "g1150"; 4 AUGUSTUS CDS 4926959 4928026 0.44 + 0 transcript_id "g1150.t1"; gene_id "g1150"; 4 AUGUSTUS stop_codon 4928024 4928026 . + 0 transcript_id "g1150.t1"; gene_id "g1150"; # protein sequence = [MIPLDKESGTPHSFQETITPDLHSAVMRLKLYIPSEKKAHVVITIPSYFSEQEEQIVFDTFQDLDIFLPFPIRHAEIF # HHALAAGRRYWSPRNELVLNMGDNHAGVQLCMSDSEDGIFSTKVIAGIVCDATVEGILQSIHSVLQTLETKSLTTGPDLHAFLTTHLPTKPTQSLVTE # LSNKLPSLAFFCFTTTTPELQAAEEAFRRITARAPLFISSLTSLRLGIETVCKNVLCILIPKTTSVPRICFRYMVVSGDTATVNLVAGGPLHRVPLGT # INITGVTVGQKVLISLEIDEHMSGNMLVSEVLLSGGRGNLLGHIEIESIAGGLNRWELNRAVNADQNIELDDLVSECALPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1150 ### # start gene g1151 4 AUGUSTUS gene 4931884 4933539 0.98 + . g1151 4 AUGUSTUS transcript 4931884 4933539 0.98 + . g1151.t1 4 AUGUSTUS start_codon 4931884 4931886 . + 0 transcript_id "g1151.t1"; gene_id "g1151"; 4 AUGUSTUS CDS 4931884 4933539 0.98 + 0 transcript_id "g1151.t1"; gene_id "g1151"; 4 AUGUSTUS stop_codon 4933537 4933539 . + 0 transcript_id "g1151.t1"; gene_id "g1151"; # protein sequence = [MPPKTRAQSRVNSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDNPGADNNHDDLDDDSGGLPRGEPG # DPSGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKV # NYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEESLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGL # AERIKDEMARLPEPATLADYRQEVLRIDNRYWKHEETRKREAGKPFVARNPKKGSSDFKTGSSNQHNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQN # SSNSGQSSGQCPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1151 ### # start gene g1152 4 AUGUSTUS gene 4933872 4937222 0.84 + . g1152 4 AUGUSTUS transcript 4933872 4937222 0.84 + . g1152.t1 4 AUGUSTUS start_codon 4933872 4933874 . + 0 transcript_id "g1152.t1"; gene_id "g1152"; 4 AUGUSTUS CDS 4933872 4937222 0.84 + 0 transcript_id "g1152.t1"; gene_id "g1152"; 4 AUGUSTUS stop_codon 4937220 4937222 . + 0 transcript_id "g1152.t1"; gene_id "g1152"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASQNITFRNTSHPDSPQTSVPSAINPVVAKVAV # LLPEPSPSVSPTILETPPGDSPCSGSCSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPPVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGCIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQQFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKRQLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSYIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNKQLTASLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRLYVPNHGDLRLQVLCYFH # DHPLSAHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYSLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITIRPEVNMKSDLARDFVVNLDELHTFLREEILLAQSRYKEQGDRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLLRAQAPRLSSPHSPGFPRLTAGAGYAESIPESYSISSTSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1152 ### # start gene g1153 4 AUGUSTUS gene 4940708 4941568 0.53 + . g1153 4 AUGUSTUS transcript 4940708 4941568 0.53 + . g1153.t1 4 AUGUSTUS start_codon 4940708 4940710 . + 0 transcript_id "g1153.t1"; gene_id "g1153"; 4 AUGUSTUS CDS 4940708 4941568 0.53 + 0 transcript_id "g1153.t1"; gene_id "g1153"; 4 AUGUSTUS stop_codon 4941566 4941568 . + 0 transcript_id "g1153.t1"; gene_id "g1153"; # protein sequence = [MSAMAMERPSSSKLESKKQKSTLSRGNMTQAQKSNQAASSTVITVAAGQHLMSIPEQLFGEETASNVRTPEGRQPAVQ # EPPPVEPGVGPPQWRYTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPVPQLDMESASHAGGRVSGQVAAIKRIQGENTDPLTARQQEKLLERRVSPAA # SEQSRMSSRRLLTPPVQSLNPPPQRRGSSLSGLLKSPAMNMPNWECTHALHHSRTNFPVQPLSKMTLRLEDVIRIQECLPEDVAMVLWQVLESMGIKT # LGDGLEFSDLQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1153 ### # start gene g1154 4 AUGUSTUS gene 4944231 4944473 0.66 + . g1154 4 AUGUSTUS transcript 4944231 4944473 0.66 + . g1154.t1 4 AUGUSTUS start_codon 4944231 4944233 . + 0 transcript_id "g1154.t1"; gene_id "g1154"; 4 AUGUSTUS CDS 4944231 4944473 0.66 + 0 transcript_id "g1154.t1"; gene_id "g1154"; 4 AUGUSTUS stop_codon 4944471 4944473 . + 0 transcript_id "g1154.t1"; gene_id "g1154"; # protein sequence = [MSTPVPPAPNTSAEDFMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGTEACRFMAQFQNLASEQPDLAKSQVK # LC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1154 ### # start gene g1155 4 AUGUSTUS gene 4944906 4945933 0.71 + . g1155 4 AUGUSTUS transcript 4944906 4945933 0.71 + . g1155.t1 4 AUGUSTUS start_codon 4944906 4944908 . + 0 transcript_id "g1155.t1"; gene_id "g1155"; 4 AUGUSTUS CDS 4944906 4944913 0.84 + 0 transcript_id "g1155.t1"; gene_id "g1155"; 4 AUGUSTUS CDS 4945144 4945933 0.72 + 1 transcript_id "g1155.t1"; gene_id "g1155"; 4 AUGUSTUS stop_codon 4945931 4945933 . + 0 transcript_id "g1155.t1"; gene_id "g1155"; # protein sequence = [MKGQWFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLREHFFTALLPEIRQHLITVNIAQGIAP # TLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTRVAFLARMRGRCFGCGAQGHVKQNCPHRETTCRYCGCRGHLE # AVCQDKFMGLRRDRGRRQQISATGPAPFSLFPNESVQIASLTPTSAPAPVPATPSPPNQDFSNQIGQIRELLDCANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1155 ### # start gene g1156 4 AUGUSTUS gene 4948616 4952297 0.96 - . g1156 4 AUGUSTUS transcript 4948616 4952297 0.96 - . g1156.t1 4 AUGUSTUS stop_codon 4948616 4948618 . - 0 transcript_id "g1156.t1"; gene_id "g1156"; 4 AUGUSTUS CDS 4948616 4949129 0.96 - 1 transcript_id "g1156.t1"; gene_id "g1156"; 4 AUGUSTUS CDS 4949410 4952297 0.96 - 0 transcript_id "g1156.t1"; gene_id "g1156"; 4 AUGUSTUS start_codon 4952295 4952297 . - 0 transcript_id "g1156.t1"; gene_id "g1156"; # protein sequence = [MIDSGATGLFLHQKFVNKHHIYIRSLPRPIELYNIDGTANLAGRITHSARLLARVDQNQPQILEFLVTNIGSEDVILG # LPWLRKVNPDINWRDGQIQIPAKPKIQHHVAIEEIPEPKEPNVGGNTEQILEPNRAESNGLPHTVPKTELGPETAETGTSSEDELVFEESGSPLYRLT # GNRKRRRAWLRAGFIQEVTEELWCAAGYTYSQQLAEAANKDKPQKTFKEMVPEPYRRHAKVFSEKESERLPEHKPWDHAIDLKPDAPETLCTKIYPMS # VNEQKELDRFLEDNLRKGYIRPSKSPLSSPVFFVKKKDGKLRFIQDHRRLNEYTVKNRYPLPLVADIINCLRQAKYFTKFDVRWGYNNVRIKEGHEWK # AAFSTNRGLFEPLVMFFGLTNSPATFQALMNSIFADLIAAGKVAVYLDDILIFSASLQEHRKIVHEVLERLAKNDLYLRPEKCEFEQTSIEYLGLIIS # EGEVRMDPVKVEAVKNWPAPTCLRDVRGFLGFANFYRRFIDGFAKKARALNDLTKKGVGWSWGTNEQVAFEALKEAFTTAPILVLWDPDKPTRIEVDA # SGFATGGALLQQQRDGLWHPVAFRSASMDPAERNYEIYDREMLAIIEALKDWRHFLEGLPNPFEIVTDHRNLEYWRTAQDLSRRQARWALWLSRFDFT # LTHRAGKANAQADALSRVSQLEVMDADDNQQQIVLWPEHFLRAATAVLFQNPLEERIRKASERESEVLEGLRKLKTHGPHKLVNGLAEWEEKEGIVYY # KGRVYVPPDPQLRRDVVAQCHDALTAGHPGKHRTLELVSRQFWWPTVRSFVDKYVEGCDNCQRRRVRPQPQSSLEPLPVPGGPWQDIGVDLIGELPMT # QDGHNAAITFTDHYSKMIHCFPTTTELTAEGVADFYYKEIFRLHGLPRRFISDRGPQFAADIMKALLKRLGIESALTTSYHPETNGQTERANQEIERY # IRIFEVGQPIWLSVNNLKIRRKSEKLGSRRLGPFEVIEKTGAHTYRLALPTWMKIHDNINVKRLAPWKGNEVNGILPAPPEPEVIDGEEFYDVDRILD # SRIHGRWKKLQYLVRWKGYDEGHDTWENEENVVGSSDEAINEFYAAHPNAPRKISATIFHSLPWQPMVNFTEVNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1156 ### # start gene g1157 4 AUGUSTUS gene 4952807 4953580 0.98 - . g1157 4 AUGUSTUS transcript 4952807 4953580 0.98 - . g1157.t1 4 AUGUSTUS stop_codon 4952807 4952809 . - 0 transcript_id "g1157.t1"; gene_id "g1157"; 4 AUGUSTUS CDS 4952807 4953580 0.98 - 0 transcript_id "g1157.t1"; gene_id "g1157"; 4 AUGUSTUS start_codon 4953578 4953580 . - 0 transcript_id "g1157.t1"; gene_id "g1157"; # protein sequence = [MSSAQDVRDAITELTKNQAKLQDVVSELVSGLSTTKSVGKPQNYNGKRGEDARRFLAAFELWANSIPALSTDCKKKIT # SAITYLEGDAAIWATPISETINRSSITGSGVPFPYDTWEEFVTAFKTRFETTDASADAKQLLKRLYQNRTTVGTYASTFQQYADRTGYSDKDLRDRFY # DHLADRVKDGLVFTTRPTGSLQELIEAAIDVDNRQITRAWEQGKKLVDDGILTNFRPTTVATPFTAPTRDPNAMDIDATTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1157 ### # start gene g1158 4 AUGUSTUS gene 4962677 4963477 0.63 - . g1158 4 AUGUSTUS transcript 4962677 4963477 0.63 - . g1158.t1 4 AUGUSTUS stop_codon 4962677 4962679 . - 0 transcript_id "g1158.t1"; gene_id "g1158"; 4 AUGUSTUS CDS 4962677 4963477 0.63 - 0 transcript_id "g1158.t1"; gene_id "g1158"; 4 AUGUSTUS start_codon 4963475 4963477 . - 0 transcript_id "g1158.t1"; gene_id "g1158"; # protein sequence = [MLSSAGTLKRGTPNKTKPDSVNKILEPTVTATKEQIAREYLTSKAATIGSSALLTKEDIYDAMLWATRLPKKDLDVTR # KTVEHGITLLRDIDEKQNQHQILGEIKGAVESSFVKLDIQKQLHHQLTQVRNEFNKRLDSIVANINGTKEKIDSIAKNSQPVAPEASYANVTRANGKR # TLAPTQVMTRQRMHAHIEVKRRQILILNVGNEAGKEIISKNSGEILEYLNNMLIKMGALNKGTFVSATKLKNTDNILTEVSSPKLADWIH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1158 ### # start gene g1159 4 AUGUSTUS gene 4968026 4968526 0.97 + . g1159 4 AUGUSTUS transcript 4968026 4968526 0.97 + . g1159.t1 4 AUGUSTUS start_codon 4968026 4968028 . + 0 transcript_id "g1159.t1"; gene_id "g1159"; 4 AUGUSTUS CDS 4968026 4968526 0.97 + 0 transcript_id "g1159.t1"; gene_id "g1159"; 4 AUGUSTUS stop_codon 4968524 4968526 . + 0 transcript_id "g1159.t1"; gene_id "g1159"; # protein sequence = [MDRLLREGTPAYFLHISPTKEEFPTEEILRASNSSSPEEVQQPKDPESGRTRSEQGEVVKKLDEEESKCQETEELKKS # IPVQYQDYLDVFSPGEARTLPPHQPYDIKIKTEGDVIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1159 ### # start gene g1160 4 AUGUSTUS gene 4978267 4980019 0.53 - . g1160 4 AUGUSTUS transcript 4978267 4980019 0.53 - . g1160.t1 4 AUGUSTUS stop_codon 4978267 4978269 . - 0 transcript_id "g1160.t1"; gene_id "g1160"; 4 AUGUSTUS CDS 4978267 4979223 0.86 - 0 transcript_id "g1160.t1"; gene_id "g1160"; 4 AUGUSTUS CDS 4979363 4980019 0.53 - 0 transcript_id "g1160.t1"; gene_id "g1160"; 4 AUGUSTUS start_codon 4980017 4980019 . - 0 transcript_id "g1160.t1"; gene_id "g1160"; # protein sequence = [MLNEQDEVEADQQELQKFLALQQDEASVAARRKRARSPLPVAGPSTKKVRSEVPKKHSCRKSSGVEVASDPPRRVHLV # VPPGRSLTTVTTNPVLPHALPSPMGVSVRDDPVQDSSSLVQLATIAKTHSGLVRRPVSPPAPQTSIKGGESDTFSSKMPATPCSTLVPRVLTAHPYRA # ENQRLIAQIRLLESQLADSQRENFSLTTALRDTSQALEARQREGLLERFQKGEGELRVAKKDWDAAAEQLSTSSHKVSELTTALLHQQGIVDEANALA # THQRICLEELQEEVHRTRGRATFVEQMIQEYPDEGFYEVVLPPLSQLEGDLINARANLRRVATLAHRLYCSDPATVLHHHNRYIGAIIEAVVAFLRRG # LNSEDPEVVAHSFQLALDYMQSARGIHGDLHMRSISSIQWFFNNAVDQEEGLYNLVLEHSRFNDDGPFLTASQHASFLAPPPNSLEPPLHCRMLALST # ALPHREGAGRWDDIVPVIPSDNQLTLDWEQLMLRYIYHITDTPLPAPDIPVPMVVGPDVESSDAVVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1160 ### # command line: # augustus --species=saccharomyces split/input_2/input_2.fa_chunk_0000007