# This output was generated with AUGUSTUS (version 3.4.0). # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de), # O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff. # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), # Using native and syntenically mapped cDNA alignments to improve de novo gene finding # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 # No extrinsic information on sequences given. # Sources of extrinsic information: M RM # Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ... # saccharomyces version. Using default transition matrix. # Looks like split/input_2/input_2.fa_chunk_0000005 is in fasta format. # We have hints for 0 sequences and for 0 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 96508, name = 2_related_000121F) ----- # # Predicted genes for sequence number 1 on both strands # start gene g1 2_related_000121F AUGUSTUS gene 2518 3712 1 - . g1 2_related_000121F AUGUSTUS transcript 2518 3712 1 - . g1.t1 2_related_000121F AUGUSTUS stop_codon 2518 2520 . - 0 transcript_id "g1.t1"; gene_id "g1"; 2_related_000121F AUGUSTUS CDS 2518 3393 1 - 0 transcript_id "g1.t1"; gene_id "g1"; 2_related_000121F AUGUSTUS CDS 3491 3712 1 - 0 transcript_id "g1.t1"; gene_id "g1"; 2_related_000121F AUGUSTUS start_codon 3710 3712 . - 0 transcript_id "g1.t1"; gene_id "g1"; # protein sequence = [MGKPKKDQVDWKNSPGDVEALVRFLHSQRSRVGQGGNFDSTVYNEAAKHLEACGPPSHGVAKTAVSIKKYYSSTKTYT # GASGWTYSHEGGFNVVSATEDAWRNFVSVHKQFKPFKTSGWPLWELMHEIVPTQARGVHVFNAASQDTAQETGDSLSKPELDPHSRSATPLQDVENRS # PSEDSAISESQITSSQAFDESQDTLSQVSMQVSSTLSQTSVTSSQLQKTPAPKRASSDIADTPTPWSSKCVHLTGPEAIHSLGQSVHGISDMLRDIFG # TTSKLTALSPSKKLAIAWQRIKEDVQGFYISDDQATDLKILFARDNAAADAYGAEEDPVDRASNGAISISSSSTSIASTPPCLWYSSRTDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1 ### # start gene g2 2_related_000121F AUGUSTUS gene 6249 6731 0.72 + . g2 2_related_000121F AUGUSTUS transcript 6249 6731 0.72 + . g2.t1 2_related_000121F AUGUSTUS start_codon 6249 6251 . + 0 transcript_id "g2.t1"; gene_id "g2"; 2_related_000121F AUGUSTUS CDS 6249 6731 0.72 + 0 transcript_id "g2.t1"; gene_id "g2"; 2_related_000121F AUGUSTUS stop_codon 6729 6731 . + 0 transcript_id "g2.t1"; gene_id "g2"; # protein sequence = [MVPKPHTDKFCLAVDHGAEPFALNSLIDHKDVRVKMDNLHDFGAALIHVRCVYRHSVKLVVFKSDVSTAYRCLPMHWC # KTWVRIGLQVGFGIRDLCSIVLGASWSSKGAMGTATEDRNDLRVVQIEGLTFEEIPRRSWEVPRVLTGANRLLGAREHWTVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g2 ### # start gene g3 2_related_000121F AUGUSTUS gene 10207 11031 0.99 - . g3 2_related_000121F AUGUSTUS transcript 10207 11031 0.99 - . g3.t1 2_related_000121F AUGUSTUS stop_codon 10207 10209 . - 0 transcript_id "g3.t1"; gene_id "g3"; 2_related_000121F AUGUSTUS CDS 10207 11031 0.99 - 0 transcript_id "g3.t1"; gene_id "g3"; 2_related_000121F AUGUSTUS start_codon 11029 11031 . - 0 transcript_id "g3.t1"; gene_id "g3"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPFIDWASRNITFRNTSHFHSPQTSVPSATNTVDAKVAV # PLPELSPSVSPTILETPPGDSPRSHSRSRSGTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRGCKDAGMKPILLRAIHSEVAA # RAADRSSTAPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g3 ### # start gene g4 2_related_000121F AUGUSTUS gene 12501 13574 0.96 - . g4 2_related_000121F AUGUSTUS transcript 12501 13574 0.96 - . g4.t1 2_related_000121F AUGUSTUS stop_codon 12501 12503 . - 0 transcript_id "g4.t1"; gene_id "g4"; 2_related_000121F AUGUSTUS CDS 12501 13574 0.96 - 0 transcript_id "g4.t1"; gene_id "g4"; 2_related_000121F AUGUSTUS start_codon 13572 13574 . - 0 transcript_id "g4.t1"; gene_id "g4"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFTDSISAISRPRRRNRGFGPATVPTTSTLPEVMEEDQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIESPILQAIARRAASEYPHDPPPHFDLDTGDHDDQDPPVDPDEPGADNNHDDLDDDSGGLPRGEPGDPSGPGGP # GGPGGPGGPGGPRSPISPDIPNKLHAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPQKLKTFFVNLALVFNDRPKYFTDQRK # VNYTLSYLSGSAKEWFVPDILDPDLDSLLAWMSSFKALVKELQDNFGIYNAQGEAEDSLGNLKMKETENIRKYNIRFNTLAAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g4 ### # start gene g5 2_related_000121F AUGUSTUS gene 14837 16807 0.89 + . g5 2_related_000121F AUGUSTUS transcript 14837 16807 0.89 + . g5.t1 2_related_000121F AUGUSTUS start_codon 14837 14839 . + 0 transcript_id "g5.t1"; gene_id "g5"; 2_related_000121F AUGUSTUS CDS 14837 16807 0.89 + 0 transcript_id "g5.t1"; gene_id "g5"; 2_related_000121F AUGUSTUS stop_codon 16805 16807 . + 0 transcript_id "g5.t1"; gene_id "g5"; # protein sequence = [MAGLFGRAPRVRREYTREGPSPVVPQPRSWQATEPISFNRNTPTGDKDGNPQVEQAGQIPDTPSVDRRRIHKWGARVQ # RAELGEYVRPEGGVYALENKGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREEGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSDEGEQNQSS # RNGGRREEDRGELPTGAPEVPPTRYDPDQPWYYDPRQGWHCKAAPRPPNKGRSMWESNKEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFG # VRPTIYAREKDKCALAASHLTGAALSHFDTLNRQRLKGEYTCLEDWTEFKREFGSKFGPIDEADEARRQLAWMKQMPEESFANFFIRFNEYTPLTGFN # DGALITYLKKGVAPWLPLQVVTGREEPRSYNEWTRVFTKLDGAVRVQAESLRNLHSEKPLQGWLSCFPGLELAPEAPYKSPLHRERDPADVWTSNPKP # AVTGRFQNRYNWKEGRQRASAAWGEGESYDSKNREEDEDCCHCRDGREWTEAVLQAGVTDTGRKWTLEERAEKWRRRRQELCMCCGRKEHWAKDCPNP # ESLERPAEDQGSSERASKADSTRGRGTANQGGGCKDNSTRPLEQIRTGILVEEREGMDDLWNVHILDSPKGGEQELLDEVGNGQGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g5 ### # start gene g6 2_related_000121F AUGUSTUS gene 17020 18536 0.27 + . g6 2_related_000121F AUGUSTUS transcript 17020 18536 0.27 + . g6.t1 2_related_000121F AUGUSTUS start_codon 17020 17022 . + 0 transcript_id "g6.t1"; gene_id "g6"; 2_related_000121F AUGUSTUS CDS 17020 17964 0.45 + 0 transcript_id "g6.t1"; gene_id "g6"; 2_related_000121F AUGUSTUS CDS 18129 18536 0.54 + 0 transcript_id "g6.t1"; gene_id "g6"; 2_related_000121F AUGUSTUS stop_codon 18534 18536 . + 0 transcript_id "g6.t1"; gene_id "g6"; # protein sequence = [MRHPKNLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGRIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALVSEIVQPGAEGGTEELGRGVNSEEIHEGTLQPPPEVPQPPPEAPQPPPEVPQQPPEAPLRAPRTGVKLEEVKDEKYEATQPG # PHELFPSDKNLGPDDPILMGINEWLAFASESMEEEVEEILEAGRAAMEKVTPKPAKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVQRPKDPESGNPSPEQRGIVKELDEEVLKRQETEELKKSIPVQYQDYLDVFSPGEART # LPPHRPYDIKIEMEGDVIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFLPRKRMVPCDSALTIEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g6 ### # start gene g7 2_related_000121F AUGUSTUS gene 23515 25985 0.1 - . g7 2_related_000121F AUGUSTUS transcript 23515 25985 0.1 - . g7.t1 2_related_000121F AUGUSTUS stop_codon 23515 23517 . - 0 transcript_id "g7.t1"; gene_id "g7"; 2_related_000121F AUGUSTUS CDS 23515 24348 0.51 - 0 transcript_id "g7.t1"; gene_id "g7"; 2_related_000121F AUGUSTUS CDS 24514 24850 0.55 - 1 transcript_id "g7.t1"; gene_id "g7"; 2_related_000121F AUGUSTUS CDS 24929 25146 0.53 - 0 transcript_id "g7.t1"; gene_id "g7"; 2_related_000121F AUGUSTUS CDS 25800 25985 0.68 - 0 transcript_id "g7.t1"; gene_id "g7"; 2_related_000121F AUGUSTUS start_codon 25983 25985 . - 0 transcript_id "g7.t1"; gene_id "g7"; # protein sequence = [MSSSSSNAVTGAPNPALPPVSSPPHPDPAERVVDAAIDELASTLEEPPLGQLALFKSVFGVGGGAGSSPPLIDTPGSA # PLSGGRAEEDVPSSPPLGKTGSTGVPPSLSQDRSSGLPVRRRANSPGSSNQFIPPVLLCLIPVPQRSPDVLHPFPRARATAALRAENETLRAEVADLR # KLLETSRAETSTLTSLLRDTTTSLDDRNKDLEASRRALQDVAADRLEYSRVLAQFRAIEAELPEAPLEVGVKRSFEAHEELDAANARAIRMRDRLEDL # EETVHRYRARAHVAEELIRKYPEDEGLYEVDLPSLSSLQNQLTASEAMVRRLATFAHRLYSADPANLLHHHNTYVGGLIEAIITLLSRSLLHPPERMR # TVVELALEYLSQGRLTHGELHLRSTSSLLYYYSNAADRVDGLYQDMFTHSRFSTDAAFLTAAQHAGYVEARPDSLNHPYIASSFLLIIPSPSTKSHFR # SYPAVPMMDSVMLMWEDMIRAYVREVLGYPASPDRASSPVDVPGSNDPLPTASP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g7 ### # start gene g8 2_related_000121F AUGUSTUS gene 27198 28895 1 - . g8 2_related_000121F AUGUSTUS transcript 27198 28895 1 - . g8.t1 2_related_000121F AUGUSTUS stop_codon 27198 27200 . - 0 transcript_id "g8.t1"; gene_id "g8"; 2_related_000121F AUGUSTUS CDS 27198 28895 1 - 0 transcript_id "g8.t1"; gene_id "g8"; 2_related_000121F AUGUSTUS start_codon 28893 28895 . - 0 transcript_id "g8.t1"; gene_id "g8"; # protein sequence = [MSLRTNPPRKADNRPTKPTAACAHREHIFDKDDVKDRYHDPDGSKYRVCKDQPCPNRYDKITTGYIPSFARLIDRKQE # DLILGRGAPPEQVASSSSQKPEGTPEAAPAPEPEYPVFPPPPSPVLDRPSSPISSLPRSSPPPPDPEDPDPGAEVSDPESDDDDDTMSKVFKAFDKVS # MLRSDGSNWDTWKNRVELATRSIGFSNHLTSNPKDDTEAWEAKKDDDGNLLNAIVGRLSDQIYRRYKNYENVFDLWKNLLSDFDSKSALTEAHLQQQL # HSMHCHEPPKVNEHLDKLLEIRDSLEVRKITIPEEMFNNTIIASIPNIFKPTINALVVVAARTSVPLTTRELVSTIRAEASGHTRGQSGKKESANYAG # GNSNRGRGGFNRNLGNFRGQSRGRGNGNRGGGQSRPNSNNSTCYNCGGKGHFANKCSSPKRQQANEAQESSQKKEKNQPSGSGSNNWRSKNKEVGSSA # TIEEVPESSWAAVEVTTTTSQEIFNFSDIANNYETASVASHSNGAILFDSGCSSHMTPLQDKLRNMRSVPTRIIQAANAETFTSNTAGNLQINLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g8 ### # start gene g9 2_related_000121F AUGUSTUS gene 30288 30971 0.99 + . g9 2_related_000121F AUGUSTUS transcript 30288 30971 0.99 + . g9.t1 2_related_000121F AUGUSTUS start_codon 30288 30290 . + 0 transcript_id "g9.t1"; gene_id "g9"; 2_related_000121F AUGUSTUS CDS 30288 30971 0.99 + 0 transcript_id "g9.t1"; gene_id "g9"; 2_related_000121F AUGUSTUS stop_codon 30969 30971 . + 0 transcript_id "g9.t1"; gene_id "g9"; # protein sequence = [MPPKTRAQSTANSEENTFFTTAQSFAPFSESISAIGQPHRRHRGFGPATVPTMSTLPETMEEDQQFEYSTLYTGDGQP # DQVLTPRHGQPPMVAPAWGCSTTQMESPILQAIACHTGKQPQCHATSDSPRDLPPHFDLDAGDHNDQDPPVNPDNPGADNGNPDHNDLDDNSGSLLCG # ELGDLSGPGGLSGPHTPISPDIPNEQCAMLELLSGLKGSIKTLGTILAVFN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g9 ### # start gene g10 2_related_000121F AUGUSTUS gene 34315 38022 0.97 - . g10 2_related_000121F AUGUSTUS transcript 34315 38022 0.97 - . g10.t1 2_related_000121F AUGUSTUS stop_codon 34315 34317 . - 0 transcript_id "g10.t1"; gene_id "g10"; 2_related_000121F AUGUSTUS CDS 34315 38022 0.97 - 0 transcript_id "g10.t1"; gene_id "g10"; 2_related_000121F AUGUSTUS start_codon 38020 38022 . - 0 transcript_id "g10.t1"; gene_id "g10"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # ERSQREPNHTEADLEENEIITATEESPIHRIRANHKTRQAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDNGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILQNPLEDRIRKASEREAQV # LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ # RHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLA # RLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE # ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNP # INGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g10 ### # start gene g11 2_related_000121F AUGUSTUS gene 38073 39230 0.78 - . g11 2_related_000121F AUGUSTUS transcript 38073 39230 0.78 - . g11.t1 2_related_000121F AUGUSTUS stop_codon 38073 38075 . - 0 transcript_id "g11.t1"; gene_id "g11"; 2_related_000121F AUGUSTUS CDS 38073 39230 0.78 - 0 transcript_id "g11.t1"; gene_id "g11"; 2_related_000121F AUGUSTUS start_codon 39228 39230 . - 0 transcript_id "g11.t1"; gene_id "g11"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPHRQQISATAAPFTLFPNESVQIAASIPTPVAGPATPSPANQDFSTQIGQIRELLDRAN # AMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g11 ### # start gene g12 2_related_000121F AUGUSTUS gene 41108 41626 0.77 + . g12 2_related_000121F AUGUSTUS transcript 41108 41626 0.77 + . g12.t1 2_related_000121F AUGUSTUS start_codon 41108 41110 . + 0 transcript_id "g12.t1"; gene_id "g12"; 2_related_000121F AUGUSTUS CDS 41108 41626 0.77 + 0 transcript_id "g12.t1"; gene_id "g12"; 2_related_000121F AUGUSTUS stop_codon 41624 41626 . + 0 transcript_id "g12.t1"; gene_id "g12"; # protein sequence = [MHNPVIDWKELCLTFQDQNVQISAALGSEIVQPGTEGGTEELGRGVNGKEIHEGTLQPPPEAPRQPPEAPQQPPEAPL # KAPRMRVKLEEVKDKEYEVRQPGPHELFPSDKNLGPDNPILMGIHEWLAFASKSTEQEVEETLEAGRSAMEAGTPRPAKDSEEAYQKWKSRDTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g12 ### # start gene g13 2_related_000121F AUGUSTUS gene 42218 43453 0.51 + . g13 2_related_000121F AUGUSTUS transcript 42218 43453 0.51 + . g13.t1 2_related_000121F AUGUSTUS start_codon 42218 42220 . + 0 transcript_id "g13.t1"; gene_id "g13"; 2_related_000121F AUGUSTUS CDS 42218 43453 0.51 + 0 transcript_id "g13.t1"; gene_id "g13"; 2_related_000121F AUGUSTUS stop_codon 43451 43453 . + 0 transcript_id "g13.t1"; gene_id "g13"; # protein sequence = [MEVDVVPPIGKLYNMSEKELKSLKEYIDEMLGKGFIQSSSSPAGAPVLFAKKKDGTLRLCVNCQALNKITKKNRYPLP # LIGTLVNQLRKAKIFTKINLRAGYNNIRVAQGYEWKTAFRTRYESFEYLVMPFGLMNAPSAFQFSMNEIFHNMVDVCMVIYLDNILIYSDDEVSHVEH # VRKVLERLRANHLHAKPEKCAFHVNTVEYLGVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLPRKDSVWNWT # PQCSSAFELLKSAFSEAPVLGHYNPDLPVILECDASDLAIAGILSQLNPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQ # IQVYSDHNNLQYFTITKQLTARQARWAEIFSGYDFVINY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g13 ### # start gene g14 2_related_000121F AUGUSTUS gene 53774 54142 0.82 - . g14 2_related_000121F AUGUSTUS transcript 53774 54142 0.82 - . g14.t1 2_related_000121F AUGUSTUS stop_codon 53774 53776 . - 0 transcript_id "g14.t1"; gene_id "g14"; 2_related_000121F AUGUSTUS CDS 53774 54142 0.82 - 0 transcript_id "g14.t1"; gene_id "g14"; 2_related_000121F AUGUSTUS start_codon 54140 54142 . - 0 transcript_id "g14.t1"; gene_id "g14"; # protein sequence = [MFTISALALINILACVVYRKIKFGLITEDGTTFTMTNAHAPWATGLGVTHALPLVQLRRQLFTDETEGVSNTDASVPM # EVTIMNESEQFKDDKSPGVHVSVNEYERLHLILIWYNINSHHQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g14 ### # start gene g15 2_related_000121F AUGUSTUS gene 57592 58482 0.85 + . g15 2_related_000121F AUGUSTUS transcript 57592 58482 0.85 + . g15.t1 2_related_000121F AUGUSTUS start_codon 57592 57594 . + 0 transcript_id "g15.t1"; gene_id "g15"; 2_related_000121F AUGUSTUS CDS 57592 57629 0.85 + 0 transcript_id "g15.t1"; gene_id "g15"; 2_related_000121F AUGUSTUS CDS 57723 58482 0.85 + 1 transcript_id "g15.t1"; gene_id "g15"; 2_related_000121F AUGUSTUS stop_codon 58480 58482 . + 0 transcript_id "g15.t1"; gene_id "g15"; # protein sequence = [MDSLILTKTNLHKYNKGFQTLFFAFHVDLAMQRPADSVIKVAGDAWIKLRFLVPTIASLVILDDNDIPSLQYYSPSTS # ELQKWVDQTFVVHRKSGSVDLGALRSELGLGKVPSDNGQQTWMHLSISDSNTISSMGLMIHTHHSPFDGTAMKVLANLYLKEFAKGLSGENVTGDLKW # GAEVDHLLPAAFNVMRPTEPIPIDPGSVEEPSFAHPFYAVSRSVIEAFVFNSQVCSYSRDNFAHNQLMILEWLLSQAQGRRSWMACYVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g15 ### # start gene g16 2_related_000121F AUGUSTUS gene 62468 62857 0.86 - . g16 2_related_000121F AUGUSTUS transcript 62468 62857 0.86 - . g16.t1 2_related_000121F AUGUSTUS stop_codon 62468 62470 . - 0 transcript_id "g16.t1"; gene_id "g16"; 2_related_000121F AUGUSTUS CDS 62468 62857 0.86 - 0 transcript_id "g16.t1"; gene_id "g16"; 2_related_000121F AUGUSTUS start_codon 62855 62857 . - 0 transcript_id "g16.t1"; gene_id "g16"; # protein sequence = [MEQEAISSTSSSIADQISAQTAGVGLLRIARGSGWKYLELLLTFGGPIEWVSSSIQLEGIMIWGKLVGTMFGLSVTYL # IENHDRMPLEETLETYNYFITQVDQLGLAYIAMQRYSEFDDPIIEGAQSYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g16 ### # start gene g17 2_related_000121F AUGUSTUS gene 64058 65497 1 - . g17 2_related_000121F AUGUSTUS transcript 64058 65497 1 - . g17.t1 2_related_000121F AUGUSTUS stop_codon 64058 64060 . - 0 transcript_id "g17.t1"; gene_id "g17"; 2_related_000121F AUGUSTUS CDS 64058 65497 1 - 0 transcript_id "g17.t1"; gene_id "g17"; 2_related_000121F AUGUSTUS start_codon 65495 65497 . - 0 transcript_id "g17.t1"; gene_id "g17"; # protein sequence = [MTRLASFSFDFNKLILQSSSLNQFPPELLTRIFAIYPPQTIQSPLNYTQVCSRWRSVAYSSPELWTTLVIEHPPALET # ESDATYYEAALTSWVLRCSDLSVDISFLGRYYRGTWDLPSQFQISLYVPICNKLLVDFSNKWRRLKAPYFWSAHFFPSSLKQFAALEELELGVGNCSP # PKNDHTPFPKTPRLFKLSLNLSRILRFHCIKNFIPETVRDLTVTSASGPIGISGDFAIEFLQPKRLQHLTHMDMSQFGWTTPHVLPSITLPRLQELTL # DGAITALGDILGVCTLPSLRKLSLSISRFDGDGEHGPVVGPALIALLKRSYHDQCGLVALGLTSMLASDNSNEAISLEALHCILSLASTIKELHICSE # GYTDTARLMEILRYDRVSPEKQILPLLTTFSVESLINLDQDFLDFVHSRWWPNNSSPRMVGVAKLEKLIVSYCDLTEEIEEQLDACYEGGLEVEVEVE # SSEQSSILE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g17 ### # start gene g18 2_related_000121F AUGUSTUS gene 71123 72929 0.66 + . g18 2_related_000121F AUGUSTUS transcript 71123 72929 0.66 + . g18.t1 2_related_000121F AUGUSTUS start_codon 71123 71125 . + 0 transcript_id "g18.t1"; gene_id "g18"; 2_related_000121F AUGUSTUS CDS 71123 72402 0.68 + 0 transcript_id "g18.t1"; gene_id "g18"; 2_related_000121F AUGUSTUS CDS 72524 72929 0.98 + 1 transcript_id "g18.t1"; gene_id "g18"; 2_related_000121F AUGUSTUS stop_codon 72927 72929 . + 0 transcript_id "g18.t1"; gene_id "g18"; # protein sequence = [MPDLPQELIDRFVDDHSESTEDLKNLSLVGRCWLHRARYHLFRLITLAPQDPKEIREYYAYLRRRVSMPARGGRNHYH # ALTSSEQRLLHSSLTQNPQPQKQFLSSFSDTLPYVRGLRLESSIRIGGGRKIPPMEYFHRWLGYGNEYAEESLLMRDLVSYDDNFLEKQNERWEAVDL # PWGHRAGLHELPFRNLRYLHIQWSAFGWISSSPVAEDDGDFPDSVNPDMWPGYQLGKLLKSSADTLNHVSIDEYPGFQLEQYGTPPHGTDALLDILAE # NAPNLKSLCLGGLMVPRRMSPHHHIDSPDPVPFFSRDRPAYRTGEEVPPVYSDPIYNDGTTPRQAIRLSLERLYLRGFDSKSTLLIEDVLLNRGILSS # NTEYLALSAMPENFDYMFLFSRLRQSITHLTLDLDNSSALVEPFFSNITNLVSVFAFPMDAGHHRTIPLLSLFPHRYEVQPPLSVHKLKTSSQQFRLH # IEFGHRIQQHIPPSVDHCLKILTVTAVITDIPPTDHAEPSKSSALKRTRVNFIDLVTVDLPETELEKAFPLTFQTGNLMSGSTDEWWRTPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g18 ### # start gene g19 2_related_000121F AUGUSTUS gene 74048 74866 0.28 - . g19 2_related_000121F AUGUSTUS transcript 74048 74866 0.28 - . g19.t1 2_related_000121F AUGUSTUS stop_codon 74048 74050 . - 0 transcript_id "g19.t1"; gene_id "g19"; 2_related_000121F AUGUSTUS CDS 74048 74408 0.76 - 1 transcript_id "g19.t1"; gene_id "g19"; 2_related_000121F AUGUSTUS CDS 74709 74866 0.28 - 0 transcript_id "g19.t1"; gene_id "g19"; 2_related_000121F AUGUSTUS start_codon 74864 74866 . - 0 transcript_id "g19.t1"; gene_id "g19"; # protein sequence = [MWLSHYVGGTGRRKIIHQGDSKFMMDLTLPLQPMRILYWMGMMEILALVLGSEGCHAVQCDCTDIQNNARFNIISFGP # GFPFQAPENPDAYFSSPIPTISEDIAGAARPGKWMVKLLRIGISSADRNDYSWIDMDSPQTSSSIIQGIDILMDTGKKQRIALVLNLKLIQEPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g19 ### # start gene g20 2_related_000121F AUGUSTUS gene 76771 83574 0.79 + . g20 2_related_000121F AUGUSTUS transcript 76771 83574 0.79 + . g20.t1 2_related_000121F AUGUSTUS start_codon 76771 76773 . + 0 transcript_id "g20.t1"; gene_id "g20"; 2_related_000121F AUGUSTUS CDS 76771 83574 0.79 + 0 transcript_id "g20.t1"; gene_id "g20"; 2_related_000121F AUGUSTUS stop_codon 83572 83574 . + 0 transcript_id "g20.t1"; gene_id "g20"; # protein sequence = [MSVFKELPEGELVKLKQVLRICERKSISSPVFSCLSPHGFSEMRSNDLFKLLAKCFQRDYRYFFNMDDVTLCDKYLYG # YGSVFVDMGIQGIIFKLLMLLGYTEKLLHDIVNAIPEEYVFQSKENEDRRDKRRDSRIKRANDEFNLLHKSSSIWPQIVSHDVRMNCLYKYQQAVRYV # VPEICACCGSADQLYTGCYRSQSEWPNLSVLKVTDPLILANTPQARFTYICKDLDGLLMDKRGIHCIDIDCSLFAIYFCSECYNSLRRVSMPRLALNN # YLYRGELIEGIENITWVEEMACAIYHTSAHVARIYGSSSAGDSLQLHGNVCAHPLDICSVAKKLPWSPADLNDLITVVFVSKAKLKQHDLQKLKPYFV # RRSIIRMLLSDLCHRNRLYVGLYTLDSSMLELYPDNDLLPGLQERIVYDCDSSVNELFGVESAGFDDHPAELLVDSEQDSVLLERSGIYDAESQDVPA # RFMTASSIYNIAQSLPANNADVVLKYDKDPISEYNNPDLFPGMFPTLFPLGIGGFEDRRRSPAVSLEAHVEHLLDQSTHEFRYHHFFSFVALNVIQRR # KAHLHTSLWISSNKFSSLVPMLLSVSSSVLSDLADKLRNEKDEAEFLDEELDAFQLLKQVNIIAAKIPGSQSSKTATRNHIRSYYGYFGLPHLFLTLN # PSAVHSPVFQVMYGEEKVDLEERFPFVVHPRGERACRVAKDPVAAADFFDFMYHIVFEHLLGWDFKSGKSNVDGGLFGHLRAFFGCAELTERGCFHGH # YLLFLRGGLNPSEVHQKMHEVEGFCSQFLAFFDDIIHHHLPTVDCTVSEGYEPRIEMPPHLPDDCSNDSAMFLDWQRLFDNEHKKIGESLQRHKCRAV # CHKGRSSNSSCRFGYPHEVVQSSSFDINENSIIFSRKESDVNGHNPELLVYTRHNHDLKCILSGKAAKAAMFYISDYITKMPLSTDILLSTLSKAVSS # LTTEELDDDPVIDSKKLLHRCLTHFGRKQQIHAQQCARYLRRLGDNMFSHQTVILPSGNLVSFVKQVYKLNNGSESSNDEQGEVDIQLSLGFKDGKMF # TYSQVIDYWYRDVTLFDMCFYDFIRYVSLQVQSKSKAVNTSATRLGVLRRYKLMFGHPLHQTHELIRHTNYEQGDVGKEFVPVMIGIVPPRKHHKDYA # LFVIAHFKPFSNSHDLIQDALEVELENLALSEEHQRILCNWEEIHECADQRDAERLRKKAYFLANSVQIPDDVYSVLDNDDELSAFVLPSSLKNKSTR # SALDVQELQLLRTDLTCSAWLKEPSDRLKESILTNSNSNLNFVTLNDINVQKWINEGKTLADKVASARYSKNNVASQDCNDGAEYDLDGNIGCYGGNN # YSKVSEKNSEGCSPMQLKNKIAEEFDLNDEQLIAFEIISSMIIYREILKIPEWIAKPALVMNLTGPGGTGKTHIIRAVEKVMEYYGIEHTYRALASTG # NAASLVNGKTIHSGLNISVREYKNGRSKRPLGELDENVAIFATVKKNNSLRREWKDVCLLLIDEVSMVDSILLADIDGSLRYAKEKPDDFFGGVNVIF # CGDPFQYPPVGTPLYVPIRSSGKQTDEELMRRLGRMAWKSINTVVELHKQKRMEGDLEYAAAVGRLRLRQCNSADVDLFNSRVIKTLSNPNGVVFDTE # AQYLASIIVSKNALRRALNGYKAAAICKGINSPKLVTVVAYDQIQYKTDDQLRSKGKKLFPSAFEQAQLLAMDTSSGKLRGGLPGILNLYIGMPVILK # HENLNTELGITNGARGHLRKLELSTDSNGLVYCKYALVEFVDSKVELSGLPKGYFPIKARSWRYSTYLLNAEHKKVLVSVVRMQLPFEPLFALTGQGA # QGHTLVAILCMLHLGGYGGYVSASRPRSREGLFITKKVTLDNLNLPAIPYDLWFEARRFEVMAHNTKVVWGFDEGDLKDVPDAEGEQRFHFSKVHYEF # TAYVGKKRSYDDVENNGKEHKKLKSGNNEHNLIGNSNNIAPRGPSWDSNNWSCCFDTAFVVLYNCYVCMSPASRNLWYNQSSSKEVFAHLESLCQSNV # EYMYTSMWNMMRDTWRHEVFDVFGSGYMRHGQVLLPVSTLIQCHVSEWSNVYVEVAGICSLHNVGCRCIGSVKCYNLLSDQLEPMFSFKGAINSIQDY # VDVLYRVNESLISSDISCSSQCESTLVLGGNSTQVIAFELNGVTDIIPSFELVIPLYNTSICLRYSLNSVIYYGMNHFTATILNKSGVWSYDGQINEG # IFEYNILFNREDAMQMMELNGRKAHIFVYVLSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g20 ### # # ----- prediction on sequence number 2 (length = 19755, name = 2_related_000197F) ----- # # Predicted genes for sequence number 2 on both strands # start gene g21 2_related_000197F AUGUSTUS gene 1435 1734 0.8 - . g21 2_related_000197F AUGUSTUS transcript 1435 1734 0.8 - . g21.t1 2_related_000197F AUGUSTUS stop_codon 1435 1437 . - 0 transcript_id "g21.t1"; gene_id "g21"; 2_related_000197F AUGUSTUS CDS 1435 1734 0.8 - 0 transcript_id "g21.t1"; gene_id "g21"; 2_related_000197F AUGUSTUS start_codon 1732 1734 . - 0 transcript_id "g21.t1"; gene_id "g21"; # protein sequence = [MVEEELRIAKKDRDAAAEQLSTSSRKIAELTTTLLYQQGIVDESNALATRQRVRLEELQEEVHRSRGHAAFVEQMIQE # YPDEGFYEVVLPPFPSSKGAH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g21 ### # start gene g22 2_related_000197F AUGUSTUS gene 10864 13409 0.57 - . g22 2_related_000197F AUGUSTUS transcript 10864 13409 0.57 - . g22.t1 2_related_000197F AUGUSTUS stop_codon 10864 10866 . - 0 transcript_id "g22.t1"; gene_id "g22"; 2_related_000197F AUGUSTUS CDS 10864 13141 0.76 - 1 transcript_id "g22.t1"; gene_id "g22"; 2_related_000197F AUGUSTUS CDS 13255 13409 0.57 - 0 transcript_id "g22.t1"; gene_id "g22"; 2_related_000197F AUGUSTUS start_codon 13407 13409 . - 0 transcript_id "g22.t1"; gene_id "g22"; # protein sequence = [MVAGQLGNRTQLDDYGDRGETLAHYNVKDFFAETYDKYEKAAGTEVSTTNPSTPLHGRWFPRNDRPEDRASYILVMLS # LLKPWRRVTDITDGFLNLEDAWDAFVSSCAEDILDFISNVQYFYRCSDQSAARREKEYKSYIAQEGDETTGDDSQMLALDIQEGAEVSVSDAEVYAAQ # QKEGMAQELYAYVAMECAFGAGVFDREYDIEDGVATAGRCSIDDKVDFQEWHQQLVDYTATGGLLVDNNIVDVGHVTVNPPPLPRVTAVDDGVVDPSE # GAIGGNLRKKLNEEQARAHDIVVDHVLRTLNGDPPPQLLMLLLGPGGTGKTVVINAINETMTKLGVGSWLAKTATTGVAASHFGGKTLHSWAGIKVAA # KASDDLIGNASAAVQKRRTANIGLSRYLLCDECSMATKELVGRTSTICSHIATVENKNNGDSYFGGMNVVLCGDFHQFPPVGQPNGALYLANASGANS # YAVLGRHLYSQFTTVVTLKKQIRVKDTRWMELLDRLRVGACNADDMEQLQKLRLDVDTNPAVDFAQPGWNSCILITPRNSVRRKWNRAALRRHCKLQR # TTLYSCPAEDTIGGIPLSNEQLLRIARLDGKRTGNLEHRVEIAVGMRAMILANIATEADLANGTRGTVTDIVLDDREPMDHEVKDGATLLHYPPAIVY # FKPDGSTSVKLQGFPEGLLPIVPQSNKFVAAVGDNKNRTILRRQVALTPGYAFTDLKGQGQTIEYVIVDLGRPSYGAKLDAFGAYVALSRSRGRDTIR # LLRGFDEALFVTHPSPDLEVEDARLVELEEETTVAWNTGNLWHRPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g22 ### # start gene g23 2_related_000197F AUGUSTUS gene 13607 14392 0.61 - . g23 2_related_000197F AUGUSTUS transcript 13607 14392 0.61 - . g23.t1 2_related_000197F AUGUSTUS stop_codon 13607 13609 . - 0 transcript_id "g23.t1"; gene_id "g23"; 2_related_000197F AUGUSTUS CDS 13607 14392 0.61 - 0 transcript_id "g23.t1"; gene_id "g23"; 2_related_000197F AUGUSTUS start_codon 14390 14392 . - 0 transcript_id "g23.t1"; gene_id "g23"; # protein sequence = [MWLEGAPTPAEMQEALKSKEFRDKVAKFISCTIRADVGKTMSELTQISTNPSIAYARPLSTKDPEYERKRAKQEVHLA # RNLQLHECSPERCYRKGTARCKRRAPWPTSQFDFIDEDGTWGMKRSVGFMNGFNPTISEVQFCNNDQKLVTNGDETQDMTYYITTYSTKKRERSTNES # AILAQRLAYHKEQERLNSDHVDVSRKLVMRCATALNRQQELSAPEVVSYLMGWGDRYISHNFTPIYIDGLNGMLRKHYPTLQEKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g23 ### # # ----- prediction on sequence number 3 (length = 36790, name = 2_related_000036F) ----- # # Predicted genes for sequence number 3 on both strands # start gene g24 2_related_000036F AUGUSTUS gene 1 454 0.46 - . g24 2_related_000036F AUGUSTUS transcript 1 454 0.46 - . g24.t1 2_related_000036F AUGUSTUS CDS 259 454 0.46 - 0 transcript_id "g24.t1"; gene_id "g24"; 2_related_000036F AUGUSTUS start_codon 452 454 . - 0 transcript_id "g24.t1"; gene_id "g24"; # protein sequence = [MEGWSLPTSPSLTIADIDSASPTFLGSSSSSTPTPDSASPISTNANSGSNTASTNAGSVPTTDLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g24 ### # start gene g25 2_related_000036F AUGUSTUS gene 7056 8054 0.63 + . g25 2_related_000036F AUGUSTUS transcript 7056 8054 0.63 + . g25.t1 2_related_000036F AUGUSTUS start_codon 7056 7058 . + 0 transcript_id "g25.t1"; gene_id "g25"; 2_related_000036F AUGUSTUS CDS 7056 7658 0.71 + 0 transcript_id "g25.t1"; gene_id "g25"; 2_related_000036F AUGUSTUS CDS 7797 8054 0.89 + 0 transcript_id "g25.t1"; gene_id "g25"; 2_related_000036F AUGUSTUS stop_codon 8052 8054 . + 0 transcript_id "g25.t1"; gene_id "g25"; # protein sequence = [MGRGSTASSGGSHYYGSQPGPVVGFGSGNANLDGYGGGHGRNYGGYSGDYNRGYENSYGQGGRSDKVDDGGYIAGHRR # SLSGVQGYGEGYRGVDGGGYRGGYSGGYGDGYGGEYGGGYGGGYGGGYRGEYGGGYGGGYRGGYGGGYEYRRDGSTFSHADGVNIEALVGVHKEVGYA # SSPVDNIPNQEQSQMSFHSEGTGSKVEGETEVLKKRKRNLPKPPNPAILKIHSKSHVPTTEEDFINEELAEFEHNRYADDEDDENADAEDEDADNNGE # DVTLTSWEYKRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g25 ### # start gene g26 2_related_000036F AUGUSTUS gene 10462 11506 0.48 + . g26 2_related_000036F AUGUSTUS transcript 10462 11506 0.48 + . g26.t1 2_related_000036F AUGUSTUS start_codon 10462 10464 . + 0 transcript_id "g26.t1"; gene_id "g26"; 2_related_000036F AUGUSTUS CDS 10462 10812 0.48 + 0 transcript_id "g26.t1"; gene_id "g26"; 2_related_000036F AUGUSTUS CDS 10922 11506 1 + 0 transcript_id "g26.t1"; gene_id "g26"; 2_related_000036F AUGUSTUS stop_codon 11504 11506 . + 0 transcript_id "g26.t1"; gene_id "g26"; # protein sequence = [MSTSRTQTTTAGPSGHCQQPPMPARTASFEDNDLDEDKEEVIRKAEEKVRRMKEKKAAAAAAAKQKAEEEAARKAVEE # ERAQAAAREERRKRMAEAAMARSRRGTSPEETLGSPRRPPVDEDPDDGGDGGDDDDEEERAPCEHCRNKKISCQMQAGKRSSIICKPCHDAKVKCSYS # GRPSTVKREGGGHPTGECLAVLESQVAQLLADNRQLRDGQVKANTYHRHFNRKLDWLITDAARRRRTPPEIPEARPLGLSRKRRRVMDSDKEEEQDRG # EGEAGEEEEDGEGEEEEEEDGSAPKVAQSEKGKERAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g26 ### # start gene g27 2_related_000036F AUGUSTUS gene 11852 13321 0.92 - . g27 2_related_000036F AUGUSTUS transcript 11852 13321 0.92 - . g27.t1 2_related_000036F AUGUSTUS stop_codon 11852 11854 . - 0 transcript_id "g27.t1"; gene_id "g27"; 2_related_000036F AUGUSTUS CDS 11852 13321 0.92 - 0 transcript_id "g27.t1"; gene_id "g27"; 2_related_000036F AUGUSTUS start_codon 13319 13321 . - 0 transcript_id "g27.t1"; gene_id "g27"; # protein sequence = [MDIEALHQAIILTLPADPSSVVGLELAKDPSNECWSLGSDKLLRLDDHIYVPNHGDLCLQVLRYFHDHPLSSHFGQNR # TLEAVHHQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLA # ELFVIQVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHLEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGI # TPFFANKGYHPNITVWPEVDMKSDLARDFVVNLDELHVFLREEILLAQSHYKEQADRKRILHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVI # SRPGTLSYELKLPDYLCRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAKILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADEL # HADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g27 ### # start gene g28 2_related_000036F AUGUSTUS gene 16536 17233 0.4 + . g28 2_related_000036F AUGUSTUS transcript 16536 17233 0.4 + . g28.t1 2_related_000036F AUGUSTUS start_codon 16536 16538 . + 0 transcript_id "g28.t1"; gene_id "g28"; 2_related_000036F AUGUSTUS CDS 16536 16746 0.63 + 0 transcript_id "g28.t1"; gene_id "g28"; 2_related_000036F AUGUSTUS CDS 16812 17233 0.68 + 2 transcript_id "g28.t1"; gene_id "g28"; 2_related_000036F AUGUSTUS stop_codon 17231 17233 . + 0 transcript_id "g28.t1"; gene_id "g28"; # protein sequence = [MMRSVPSKDLDAFASLRGKGSLAGASKRNPLAPPLEIKSSTSISKAPVAPPRLIRRNRELENLKADASSFLASPRSTR # SRDSDNELLSGFPLVDAAPRASSPTKVPVSRKEPKSKTAVKVVEDSKASDPPTSALVYKRVRLPPRSRKIAPAASKGKARQTIVTEADSTSSEVESED # EDEEEDSAPPPKRLKTTSSISGKSLFFIYFVLFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g28 ### # start gene g29 2_related_000036F AUGUSTUS gene 17848 18512 0.43 + . g29 2_related_000036F AUGUSTUS transcript 17848 18512 0.43 + . g29.t1 2_related_000036F AUGUSTUS start_codon 17848 17850 . + 0 transcript_id "g29.t1"; gene_id "g29"; 2_related_000036F AUGUSTUS CDS 17848 17896 0.43 + 0 transcript_id "g29.t1"; gene_id "g29"; 2_related_000036F AUGUSTUS CDS 17959 18512 0.97 + 2 transcript_id "g29.t1"; gene_id "g29"; 2_related_000036F AUGUSTUS stop_codon 18510 18512 . + 0 transcript_id "g29.t1"; gene_id "g29"; # protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTARELFLRSILDLQNAGEDPVVVLEALKAAEPNRRAIN # LNEWTLLATLFRWPSPFNLSGLDFDNRTPGEWIELLCSIHSGESTVRVDENGRLVESSPPPDSATEAFEGLNEVEKGSADEGTSSQVGGSVPMELDLP # MIESLAEQTLSPEKGAEPAQTLES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g29 ### # start gene g30 2_related_000036F AUGUSTUS gene 19961 21043 0.26 + . g30 2_related_000036F AUGUSTUS transcript 19961 21043 0.26 + . g30.t1 2_related_000036F AUGUSTUS start_codon 19961 19963 . + 0 transcript_id "g30.t1"; gene_id "g30"; 2_related_000036F AUGUSTUS CDS 19961 19984 0.54 + 0 transcript_id "g30.t1"; gene_id "g30"; 2_related_000036F AUGUSTUS CDS 20399 21043 0.4 + 0 transcript_id "g30.t1"; gene_id "g30"; 2_related_000036F AUGUSTUS stop_codon 21041 21043 . + 0 transcript_id "g30.t1"; gene_id "g30"; # protein sequence = [MAFANDAHNRRSTPYPTIGSNKGSNKDEKSVVNEVSPRLSKVHCHTDSHVSSNCMSCLAEDKGESIQFKSVSNGFLFH # DLVTHSKHINHALAQVVSSNLDTPPAPLELQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSCQDSGSDSSASDASFATAQSI # PTTGSEDTVVTPTEITVPVLKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g30 ### # start gene g31 2_related_000036F AUGUSTUS gene 21304 25035 0.15 - . g31 2_related_000036F AUGUSTUS transcript 21304 25035 0.15 - . g31.t1 2_related_000036F AUGUSTUS stop_codon 21304 21306 . - 0 transcript_id "g31.t1"; gene_id "g31"; 2_related_000036F AUGUSTUS CDS 21304 24345 0.28 - 0 transcript_id "g31.t1"; gene_id "g31"; 2_related_000036F AUGUSTUS CDS 24421 25035 0.15 - 0 transcript_id "g31.t1"; gene_id "g31"; 2_related_000036F AUGUSTUS start_codon 25033 25035 . - 0 transcript_id "g31.t1"; gene_id "g31"; # protein sequence = [MSRGNERKEKPRTRRTRRRMFSSLVNEPPTNKLEEHIKLNQQDRPPINLIDETNKQVVNEAIGVEKPINLNTEEVFTK # YKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTKERKEIIDKNHPEGFLWKQERDLMHEMMCKQEAGFAWGPSEAGTFKNE # FFPPVKVPVIPHEPWVERNIPIPPGIFEDFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMM # TFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTF # SGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRD # CPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNP # SCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQ # EADDVELDVQEALDEERSYEIRRNHMLESKNATCEVFSRNLFPTFDEEFVQKNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFI # RLIKKFQVYDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHTP # SLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQA # NGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALLKHNSFI # EKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNE # SIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEEEHQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g31 ### # start gene g32 2_related_000036F AUGUSTUS gene 25119 25730 0.71 - . g32 2_related_000036F AUGUSTUS transcript 25119 25730 0.71 - . g32.t1 2_related_000036F AUGUSTUS stop_codon 25119 25121 . - 0 transcript_id "g32.t1"; gene_id "g32"; 2_related_000036F AUGUSTUS CDS 25119 25730 0.71 - 0 transcript_id "g32.t1"; gene_id "g32"; 2_related_000036F AUGUSTUS start_codon 25728 25730 . - 0 transcript_id "g32.t1"; gene_id "g32"; # protein sequence = [MNQRMLHLIMKNRQVKRFKGKFSFLDELSSDQGEDEYAISFHFDEQQNIVLDGYKRCEQETFSKKELSEAYVLASREH # LKSQDDQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFNDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDNLNPQRP # HRINVITKIPLKRSEMIIGINLKTLKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g32 ### # start gene g33 2_related_000036F AUGUSTUS gene 25893 27078 0.81 - . g33 2_related_000036F AUGUSTUS transcript 25893 27078 0.81 - . g33.t1 2_related_000036F AUGUSTUS stop_codon 25893 25895 . - 0 transcript_id "g33.t1"; gene_id "g33"; 2_related_000036F AUGUSTUS CDS 25893 26619 0.95 - 1 transcript_id "g33.t1"; gene_id "g33"; 2_related_000036F AUGUSTUS CDS 26702 27078 0.85 - 0 transcript_id "g33.t1"; gene_id "g33"; 2_related_000036F AUGUSTUS start_codon 27076 27078 . - 0 transcript_id "g33.t1"; gene_id "g33"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVDESDDEDAIKLIPSSRPTNQINTNIDHMIMFNLGRIVLFKLIHLRRCRRRYSKEDIDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNY # VSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVAN # QSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLAEIFRLNLVKLRCTYNYTYRIKHHFKCY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g33 ### # start gene g34 2_related_000036F AUGUSTUS gene 27108 27602 0.44 - . g34 2_related_000036F AUGUSTUS transcript 27108 27602 0.44 - . g34.t1 2_related_000036F AUGUSTUS stop_codon 27108 27110 . - 0 transcript_id "g34.t1"; gene_id "g34"; 2_related_000036F AUGUSTUS CDS 27108 27602 0.44 - 0 transcript_id "g34.t1"; gene_id "g34"; 2_related_000036F AUGUSTUS start_codon 27600 27602 . - 0 transcript_id "g34.t1"; gene_id "g34"; # protein sequence = [MINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPR # DDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g34 ### # start gene g35 2_related_000036F AUGUSTUS gene 28331 28630 0.37 - . g35 2_related_000036F AUGUSTUS transcript 28331 28630 0.37 - . g35.t1 2_related_000036F AUGUSTUS stop_codon 28331 28333 . - 0 transcript_id "g35.t1"; gene_id "g35"; 2_related_000036F AUGUSTUS CDS 28331 28630 0.37 - 0 transcript_id "g35.t1"; gene_id "g35"; 2_related_000036F AUGUSTUS start_codon 28628 28630 . - 0 transcript_id "g35.t1"; gene_id "g35"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g35 ### # # ----- prediction on sequence number 4 (length = 94174, name = 2_related_000122F) ----- # # Predicted genes for sequence number 4 on both strands # start gene g36 2_related_000122F AUGUSTUS gene 688 1365 0.73 + . g36 2_related_000122F AUGUSTUS transcript 688 1365 0.73 + . g36.t1 2_related_000122F AUGUSTUS start_codon 688 690 . + 0 transcript_id "g36.t1"; gene_id "g36"; 2_related_000122F AUGUSTUS CDS 688 1365 0.73 + 0 transcript_id "g36.t1"; gene_id "g36"; 2_related_000122F AUGUSTUS stop_codon 1363 1365 . + 0 transcript_id "g36.t1"; gene_id "g36"; # protein sequence = [MILTLTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRF # ERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDK # VMDQQMNPNVNLAVWMTRIEELSDRFGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g36 ### # start gene g37 2_related_000122F AUGUSTUS gene 2064 4312 0.11 + . g37 2_related_000122F AUGUSTUS transcript 2064 4312 0.11 + . g37.t1 2_related_000122F AUGUSTUS start_codon 2064 2066 . + 0 transcript_id "g37.t1"; gene_id "g37"; 2_related_000122F AUGUSTUS CDS 2064 2697 0.56 + 0 transcript_id "g37.t1"; gene_id "g37"; 2_related_000122F AUGUSTUS CDS 2771 3134 0.5 + 2 transcript_id "g37.t1"; gene_id "g37"; 2_related_000122F AUGUSTUS CDS 3230 3365 0.63 + 1 transcript_id "g37.t1"; gene_id "g37"; 2_related_000122F AUGUSTUS CDS 3449 4312 0.55 + 0 transcript_id "g37.t1"; gene_id "g37"; 2_related_000122F AUGUSTUS stop_codon 4310 4312 . + 0 transcript_id "g37.t1"; gene_id "g37"; # protein sequence = [MIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVAN # QSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPF # DVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPLKNRQVNMIQREISFLDELSSDQGEDEYAISFHFDEKQNIVLDGYKQCEQETFSKKELSEAYV # LASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPINLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQ # RTRKRMATKERKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPD # EFRIERHIHGDPLLELPELSKHPKPFAPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVE # RNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDYMLDMMNEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g37 ### # start gene g38 2_related_000122F AUGUSTUS gene 4735 7017 0.54 + . g38 2_related_000122F AUGUSTUS transcript 4735 7017 0.54 + . g38.t1 2_related_000122F AUGUSTUS start_codon 4735 4737 . + 0 transcript_id "g38.t1"; gene_id "g38"; 2_related_000122F AUGUSTUS CDS 4735 4849 0.56 + 0 transcript_id "g38.t1"; gene_id "g38"; 2_related_000122F AUGUSTUS CDS 5168 7017 0.8 + 2 transcript_id "g38.t1"; gene_id "g38"; 2_related_000122F AUGUSTUS stop_codon 7015 7017 . + 0 transcript_id "g38.t1"; gene_id "g38"; # protein sequence = [MASCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTIETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHV # KGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNH # MLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQP # QLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIH # GRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLGEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSK # WFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHT # IKDWNFRPGQLVQVRNSGIEKSLDRKMYPRYRGPMVIIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNITNLST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g38 ### # start gene g39 2_related_000122F AUGUSTUS gene 7424 8201 0.3 - . g39 2_related_000122F AUGUSTUS transcript 7424 8201 0.3 - . g39.t1 2_related_000122F AUGUSTUS stop_codon 7424 7426 . - 0 transcript_id "g39.t1"; gene_id "g39"; 2_related_000122F AUGUSTUS CDS 7424 7851 1 - 2 transcript_id "g39.t1"; gene_id "g39"; 2_related_000122F AUGUSTUS CDS 7933 8068 0.95 - 0 transcript_id "g39.t1"; gene_id "g39"; 2_related_000122F AUGUSTUS CDS 8175 8201 0.31 - 0 transcript_id "g39.t1"; gene_id "g39"; 2_related_000122F AUGUSTUS start_codon 8199 8201 . - 0 transcript_id "g39.t1"; gene_id "g39"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAANDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSVSDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERA # TTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g39 ### # start gene g40 2_related_000122F AUGUSTUS gene 9972 10673 0.19 - . g40 2_related_000122F AUGUSTUS transcript 9972 10673 0.19 - . g40.t1 2_related_000122F AUGUSTUS stop_codon 9972 9974 . - 0 transcript_id "g40.t1"; gene_id "g40"; 2_related_000122F AUGUSTUS CDS 9972 10528 0.39 - 2 transcript_id "g40.t1"; gene_id "g40"; 2_related_000122F AUGUSTUS CDS 10598 10673 0.19 - 0 transcript_id "g40.t1"; gene_id "g40"; 2_related_000122F AUGUSTUS start_codon 10671 10673 . - 0 transcript_id "g40.t1"; gene_id "g40"; # protein sequence = [MCSLDVDLAMDALNALHVATTSSTLNLTNSLRRTQELRTQLDRLGALFDQARQSFLRSFLDLQQAGQDPIVVLEALKA # AEPQRESISVEDWTLLATLFQWSSPFNLNGLKFDNRTPAEWIDLLRSIHSGATSATVTVDGHLVDTSQPPEADVEVLEALDPQGSLPNTVVEKVSGVE # DLASLSEGSPIQTELDLPQIESLTESTLAPEKGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g40 ### # start gene g41 2_related_000122F AUGUSTUS gene 15726 16404 0.51 - . g41 2_related_000122F AUGUSTUS transcript 15726 16404 0.51 - . g41.t1 2_related_000122F AUGUSTUS stop_codon 15726 15728 . - 0 transcript_id "g41.t1"; gene_id "g41"; 2_related_000122F AUGUSTUS CDS 15726 16144 0.99 - 2 transcript_id "g41.t1"; gene_id "g41"; 2_related_000122F AUGUSTUS CDS 16203 16404 0.52 - 0 transcript_id "g41.t1"; gene_id "g41"; 2_related_000122F AUGUSTUS start_codon 16402 16404 . - 0 transcript_id "g41.t1"; gene_id "g41"; # protein sequence = [MVSSTDLDPFVSLRGQNALSGVPKTVSSPKVSDLISPSPANKAQAVPPRALRRNREIESLKADASSFLASPQSIHSKD # SDNELLRGSPSVDPAPRTSTSTKVPVDSKKPKSKTTIKVVEDSKASISSPAGMAYKRVRLPPRLRKIAPATAKGKSRQVVVSEDDSASNEVESEDEDE # EEDSAPPPKCLKTTSSISGKISFFISLLMF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g41 ### # start gene g42 2_related_000122F AUGUSTUS gene 22928 24671 0.33 + . g42 2_related_000122F AUGUSTUS transcript 22928 24671 0.33 + . g42.t1 2_related_000122F AUGUSTUS start_codon 22928 22930 . + 0 transcript_id "g42.t1"; gene_id "g42"; 2_related_000122F AUGUSTUS CDS 22928 23092 0.44 + 0 transcript_id "g42.t1"; gene_id "g42"; 2_related_000122F AUGUSTUS CDS 23298 24671 0.81 + 0 transcript_id "g42.t1"; gene_id "g42"; 2_related_000122F AUGUSTUS stop_codon 24669 24671 . + 0 transcript_id "g42.t1"; gene_id "g42"; # protein sequence = [MLWQEHIGTQASKRRHSPSSNGSASGSDNDVATIRAIARRKKKARLAKKPNVTFRTASQPSEEVVPTEQLASAANTRL # ETTRTSVGEPVQASLSSSRPQRNRRLPARYQDVLPEGTAVIVNAEPLVEEQVPLRRRVILHVREQLKTQLNSFGLWREYLQKPSHDPDGEVGIQDMAN # IPSAQDPDDDGHTSDDSHCDATLNPTQTLLTGWQNNGNSTKSNGEMDQLANLIRRPEFQVSELQGYSAHTANAKITQADENWDYNKLKDSFLETSVDI # EVLSGDKNIPSKVFSIPGLLYRSPLSVIPAAFASRLANQFHYTPFRLFQTSESPDGSDNDVQRVHTDIYNSDAFIQEHYRVLRAPTDDPNCKREKVVA # ALMCWSDATQLANFGTAKLWPIYMLFGNLSKYIRASPNSGAVNHLAYIPSIPDSIKHEISMFHTKWKTQSKEIITHCSRELYHAIWRYLLDDEFIHAY # RYGIVIKCFDGVERRIYPRFFTYSADYPEKYAFIICMCNQIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g42 ### # start gene g43 2_related_000122F AUGUSTUS gene 26837 27145 0.84 + . g43 2_related_000122F AUGUSTUS transcript 26837 27145 0.84 + . g43.t1 2_related_000122F AUGUSTUS start_codon 26837 26839 . + 0 transcript_id "g43.t1"; gene_id "g43"; 2_related_000122F AUGUSTUS CDS 26837 27145 0.84 + 0 transcript_id "g43.t1"; gene_id "g43"; 2_related_000122F AUGUSTUS stop_codon 27143 27145 . + 0 transcript_id "g43.t1"; gene_id "g43"; # protein sequence = [MYMRYFPGGGVGHTANRKFFKDVAEDAEELDGEPTGNQSPDEDDELYFPLDSELPLSDKEEMLGSSSDEENEDESDEE # DQVEDGSDGTDIDDWQWDDGYGSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g43 ### # start gene g44 2_related_000122F AUGUSTUS gene 28438 30084 0.5 + . g44 2_related_000122F AUGUSTUS transcript 28438 30084 0.5 + . g44.t1 2_related_000122F AUGUSTUS start_codon 28438 28440 . + 0 transcript_id "g44.t1"; gene_id "g44"; 2_related_000122F AUGUSTUS CDS 28438 28453 0.5 + 0 transcript_id "g44.t1"; gene_id "g44"; 2_related_000122F AUGUSTUS CDS 28601 30084 0.5 + 2 transcript_id "g44.t1"; gene_id "g44"; 2_related_000122F AUGUSTUS stop_codon 30082 30084 . + 0 transcript_id "g44.t1"; gene_id "g44"; # protein sequence = [MTVVLSSKSQLSLFSNRSALWLLSNPHVARRFKSSGKPSKRAKTLHNGNSIGVHRTQKHRPSTSAYKWSRNAVIERPE # LHLSLDDHIGIVRYFEENVEHWSKQKVLHSRLESFGIPTESIHPLLQLFVSEVLSGNLSNNDSYDKYTLDRFARSTPEDLPQTYADIVYTGIFYAWAT # DPASRDAVERTIGPATLLSIQRLFHAARLEHPADDFLEARRTRRKIIMHVGPTNSGKTHHALRALAAAPTGVYAGPLRLLAHEIWERLNLGQIVPAGV # EEDVMPASLPIDSALDVDVTAADTTPAVLSQGNSKFARACNMITGEEHKIVDPEAALESATVEMLSMTKKYDLAVIDEIQMIADVGRGYAWTSAVLGI # NAKEVHLCGEETAVPIVQALLAETHDELEVRRYKRLTPLQIDKSLDKDLSKVQKGDCVVAFSRSSIFWLKNSIEKATGMKCAVVYGKLPPEIRSGQAD # LFNDPNSGYDVIVGSDAIGMGLNLYVCCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g44 ### # start gene g45 2_related_000122F AUGUSTUS gene 30229 31038 0.57 + . g45 2_related_000122F AUGUSTUS transcript 30229 31038 0.57 + . g45.t1 2_related_000122F AUGUSTUS start_codon 30229 30231 . + 0 transcript_id "g45.t1"; gene_id "g45"; 2_related_000122F AUGUSTUS CDS 30229 31038 0.57 + 0 transcript_id "g45.t1"; gene_id "g45"; 2_related_000122F AUGUSTUS stop_codon 31036 31038 . + 0 transcript_id "g45.t1"; gene_id "g45"; # protein sequence = [MLQEQCGLATTFLPEDLPFVEQALAKPFAPLPAAILGPSYNSCRDIARALPPSASLRTIYDAHVYVAKTKPHYRYSSS # NIDKAADTVDEYSDQLSLEDRITFLLAPVPWREPDCVEVLYKLLKNYAEDLSVGVTDLFQGTQFLETLLIVEKKMSTLPLPKSDTKTLSILELFHKLL # GLYAWLAFRNPVAYYEPELVEEWKPRVERALHWALQGVTRHSKGTRKTVESPLPVAAVARKVEFRTAGDLRKQRKAEALSNKKTWANSGPVHA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g45 ### # start gene g46 2_related_000122F AUGUSTUS gene 33350 33886 1 + . g46 2_related_000122F AUGUSTUS transcript 33350 33886 1 + . g46.t1 2_related_000122F AUGUSTUS start_codon 33350 33352 . + 0 transcript_id "g46.t1"; gene_id "g46"; 2_related_000122F AUGUSTUS CDS 33350 33886 1 + 0 transcript_id "g46.t1"; gene_id "g46"; 2_related_000122F AUGUSTUS stop_codon 33884 33886 . + 0 transcript_id "g46.t1"; gene_id "g46"; # protein sequence = [MSFASFNNTSLITGALLLVPIVFILFKNLSSSPPSNTMSSDSTSTSTNSEEQPKSIMQPARADLLPPKDDPFTLEELK # KYDGTVEGMPIYVSIKGEYDSIQSTVLIVFGLFLYTGDIFEVTHRSDVYGAGKSYNIFAGTDGSKGLGMSSLKAEHAVPDYSGLDEKDMKTLNDWHAF # FL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g46 ### # start gene g47 2_related_000122F AUGUSTUS gene 34574 34927 0.76 + . g47 2_related_000122F AUGUSTUS transcript 34574 34927 0.76 + . g47.t1 2_related_000122F AUGUSTUS start_codon 34574 34576 . + 0 transcript_id "g47.t1"; gene_id "g47"; 2_related_000122F AUGUSTUS CDS 34574 34927 0.76 + 0 transcript_id "g47.t1"; gene_id "g47"; 2_related_000122F AUGUSTUS stop_codon 34925 34927 . + 0 transcript_id "g47.t1"; gene_id "g47"; # protein sequence = [MSSSTPEVWRPEDTVPPVPETPGSEIFRPDILDEIEKKIEEMSKELNVLSLDIHGTHLSQPIYKNPNKTLPYLYQAHP # ELKYEEAYATHQIYFTHSQPIHTIIDQQTNSRRSNILYV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g47 ### # start gene g48 2_related_000122F AUGUSTUS gene 44449 44991 0.47 - . g48 2_related_000122F AUGUSTUS transcript 44449 44991 0.47 - . g48.t1 2_related_000122F AUGUSTUS stop_codon 44449 44451 . - 0 transcript_id "g48.t1"; gene_id "g48"; 2_related_000122F AUGUSTUS CDS 44449 44991 0.47 - 0 transcript_id "g48.t1"; gene_id "g48"; 2_related_000122F AUGUSTUS start_codon 44989 44991 . - 0 transcript_id "g48.t1"; gene_id "g48"; # protein sequence = [MQLLRVISRITEPGTTYLPYFALCREYGVHAVDGMVKGRILDLRWTEPVTKELEPEGSSYLNRQSRPLSDEGDESNGR # TLVDNSNQLEGNLAAASEEDIVPIPEQEVFSHNRRRRSSRWRSVYEGSMDSVIGPKLVPTTPIMKYAMREVLREYDEEVVDDDDGTVSEYASAASLSD # VEEY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g48 ### # start gene g49 2_related_000122F AUGUSTUS gene 48427 48993 0.71 - . g49 2_related_000122F AUGUSTUS transcript 48427 48993 0.71 - . g49.t1 2_related_000122F AUGUSTUS stop_codon 48427 48429 . - 0 transcript_id "g49.t1"; gene_id "g49"; 2_related_000122F AUGUSTUS CDS 48427 48993 0.71 - 0 transcript_id "g49.t1"; gene_id "g49"; 2_related_000122F AUGUSTUS start_codon 48991 48993 . - 0 transcript_id "g49.t1"; gene_id "g49"; # protein sequence = [MQLPPTVLSLDKRRKQQSKGASASSSKSQTKTSSGKSKVKPNLAKNATPIRPSPSDSRKDEDNAGNGSGDDVQGEMAI # EDSKSPSTPDSGTEEESAGSGSDDDANSETVVANNKPRSKMPILRPSRSLETTLFDRLESMYGSGIKRMLNVQYRCVDGLAFPTSVTYTYLSGCTIKS # VHFHPGPYTRIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g49 ### # start gene g50 2_related_000122F AUGUSTUS gene 52795 53160 0.66 + . g50 2_related_000122F AUGUSTUS transcript 52795 53160 0.66 + . g50.t1 2_related_000122F AUGUSTUS start_codon 52795 52797 . + 0 transcript_id "g50.t1"; gene_id "g50"; 2_related_000122F AUGUSTUS CDS 52795 53160 0.66 + 0 transcript_id "g50.t1"; gene_id "g50"; 2_related_000122F AUGUSTUS stop_codon 53158 53160 . + 0 transcript_id "g50.t1"; gene_id "g50"; # protein sequence = [MKSQDLRWIIVSDHPLTHMLREITPKPTIGIFEAAITQALLLGKRFGIVTTGSGYSADIHKGVQAIMGGNSQRFAGIV # TTGLGVVELREGDRQKIERNMKEYSGKIAQKGADVILLGCAGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g50 ### # start gene g51 2_related_000122F AUGUSTUS gene 53521 54444 0.94 - . g51 2_related_000122F AUGUSTUS transcript 53521 54444 0.94 - . g51.t1 2_related_000122F AUGUSTUS stop_codon 53521 53523 . - 0 transcript_id "g51.t1"; gene_id "g51"; 2_related_000122F AUGUSTUS CDS 53521 54444 0.94 - 0 transcript_id "g51.t1"; gene_id "g51"; 2_related_000122F AUGUSTUS start_codon 54442 54444 . - 0 transcript_id "g51.t1"; gene_id "g51"; # protein sequence = [MSEYWISKKKYFCKYCEIYIADDAPSRQHHENGLRHQGNRERFIRGIYKDGEKKGREREEEKREMGRVELAAQAAYSQ # DISAGLAKASGSTLAQKPAPQTSKTKNSKPSNPFTNYSSPASLGYVDPDAESAAAEAALRQSQGIAGEWQVVESKTTPLKRTADEQQPLDYDDDARSF # KLRKKTLRSGLGEVYDPGVISLKPKPKPQQNVEEVVKKEEEEEDKPKWSTVKWKRATEASSLAEPANNDNDPTQKIEIKSEPSESSTTTKTEEKGKDE # VITPPPSTLAPTPSMFRKRKVTSGSGSRVKTET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g51 ### # start gene g52 2_related_000122F AUGUSTUS gene 56103 56462 0.34 + . g52 2_related_000122F AUGUSTUS transcript 56103 56462 0.34 + . g52.t1 2_related_000122F AUGUSTUS start_codon 56103 56105 . + 0 transcript_id "g52.t1"; gene_id "g52"; 2_related_000122F AUGUSTUS CDS 56103 56462 0.34 + 0 transcript_id "g52.t1"; gene_id "g52"; 2_related_000122F AUGUSTUS stop_codon 56460 56462 . + 0 transcript_id "g52.t1"; gene_id "g52"; # protein sequence = [MQDPSELQNNILESEEALFSKEVKENTGIHEQNLHVRVWDQFHSQNTGQGKYSAIVDTDDGEDSKLNSTNASSTSMID # SHTHVDDMPTPKPTPNAQQVEFARSDTAVLGWYSLEPSSGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g52 ### # start gene g53 2_related_000122F AUGUSTUS gene 60768 61793 0.4 - . g53 2_related_000122F AUGUSTUS transcript 60768 61793 0.4 - . g53.t1 2_related_000122F AUGUSTUS stop_codon 60768 60770 . - 0 transcript_id "g53.t1"; gene_id "g53"; 2_related_000122F AUGUSTUS CDS 60768 61793 0.4 - 0 transcript_id "g53.t1"; gene_id "g53"; 2_related_000122F AUGUSTUS start_codon 61791 61793 . - 0 transcript_id "g53.t1"; gene_id "g53"; # protein sequence = [MVNSLVGTGLLVGIPPIPMSDGQPVASSSNGRQPGSGTEPSKEGLWKNIFYPHRDTLLSLASREDAGIRDDEDGGVYR # CVDCMHEITGGFCTNCHRVYRAHRGIDFGDDSEGNEDVEPFFRLAFDDRLEGADYEEDDEEDDDYYEDVFFDLAYHLPLPRRTLGRRARVERNRALDV # EILGSDSEEDEVDRMDGFIDDDSDIQELEDVQEIPRDRNVEEVDLDYDGVGAINSSHGPSEVIEVTDEEDDDDSLGPARPVRRRVNRAQTTINLLSDD # EDEGEEESIHLSDDDSEEIDDDSKYSDIDDNEVNYQDGIHSGDDDDPDLESAYFVDLDDEQGDIYRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g53 ### # start gene g54 2_related_000122F AUGUSTUS gene 71476 72036 0.84 + . g54 2_related_000122F AUGUSTUS transcript 71476 72036 0.84 + . g54.t1 2_related_000122F AUGUSTUS start_codon 71476 71478 . + 0 transcript_id "g54.t1"; gene_id "g54"; 2_related_000122F AUGUSTUS CDS 71476 72036 0.84 + 0 transcript_id "g54.t1"; gene_id "g54"; 2_related_000122F AUGUSTUS stop_codon 72034 72036 . + 0 transcript_id "g54.t1"; gene_id "g54"; # protein sequence = [MSQFPQEHYPFHHHPDVPQHWIPSPPRGPIDGQYPTYYTPYPVYQNFQPPPEQPHSTTPKFKIEYSSIHATFLATIKD # ANSLKDRKSWVKWNEGVWQAVADGFVLGHICDEPSPGTPWTEWNTPIVRPNISIHPMRKEIEARLKWDKNDGWTSSILTARLSDEVRNHLPPMINDQG # ERCTARQIYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g54 ### # start gene g55 2_related_000122F AUGUSTUS gene 72121 72636 0.85 + . g55 2_related_000122F AUGUSTUS transcript 72121 72636 0.85 + . g55.t1 2_related_000122F AUGUSTUS start_codon 72121 72123 . + 0 transcript_id "g55.t1"; gene_id "g55"; 2_related_000122F AUGUSTUS CDS 72121 72636 0.85 + 0 transcript_id "g55.t1"; gene_id "g55"; 2_related_000122F AUGUSTUS stop_codon 72634 72636 . + 0 transcript_id "g55.t1"; gene_id "g55"; # protein sequence = [MDIKKFNLKWSSTLTTLRNYGYEIPWDTLILKYILKLPSGPRYIYLKQTLEEEFNQPGVIPNRDMFDKFAIRLENTRN # RELLDLADSGGGTYNRRFQRNGTGGTSDKPPESQKPKDPSNVSKLNSKPSAYVTMVTSLNSNSTSKIETVDNVTSVPSVIPTTNTTVRSTYPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g55 ### # start gene g56 2_related_000122F AUGUSTUS gene 77797 78471 0.18 + . g56 2_related_000122F AUGUSTUS transcript 77797 78471 0.18 + . g56.t1 2_related_000122F AUGUSTUS start_codon 77797 77799 . + 0 transcript_id "g56.t1"; gene_id "g56"; 2_related_000122F AUGUSTUS CDS 77797 77845 0.18 + 0 transcript_id "g56.t1"; gene_id "g56"; 2_related_000122F AUGUSTUS CDS 77915 78471 0.27 + 2 transcript_id "g56.t1"; gene_id "g56"; 2_related_000122F AUGUSTUS stop_codon 78469 78471 . + 0 transcript_id "g56.t1"; gene_id "g56"; # protein sequence = [MDALNALHVATTSSTLNLTNSLRRTQELRTQLDRLGTLFDQARQSFLQSFLDLQQAGQDPIVVLEALKAAEPQRKSLS # VEDWTVLATLFQWSSPFNLNGLNFDNRTPTEWIDLLRSIHSGASSATITLDGHLVDVFQSPDPAVQDSEDLDTQGSPPITVVEKDSGVEDIASLPEGS # PIQTELDLPQIESLTELTPSPEKGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g56 ### # start gene g57 2_related_000122F AUGUSTUS gene 79566 81017 0.15 + . g57 2_related_000122F AUGUSTUS transcript 79566 81017 0.15 + . g57.t1 2_related_000122F AUGUSTUS start_codon 79566 79568 . + 0 transcript_id "g57.t1"; gene_id "g57"; 2_related_000122F AUGUSTUS CDS 79566 79733 0.68 + 0 transcript_id "g57.t1"; gene_id "g57"; 2_related_000122F AUGUSTUS CDS 80373 80508 0.88 + 0 transcript_id "g57.t1"; gene_id "g57"; 2_related_000122F AUGUSTUS CDS 80590 81017 1 + 2 transcript_id "g57.t1"; gene_id "g57"; 2_related_000122F AUGUSTUS stop_codon 81015 81017 . + 0 transcript_id "g57.t1"; gene_id "g57"; # protein sequence = [MPIHQKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKDEKS # AVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRAHIAKVIADEACSILKS # RQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEIAVPVLKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g57 ### # start gene g58 2_related_000122F AUGUSTUS gene 81278 83746 0.77 - . g58 2_related_000122F AUGUSTUS transcript 81278 83746 0.77 - . g58.t1 2_related_000122F AUGUSTUS stop_codon 81278 81280 . - 0 transcript_id "g58.t1"; gene_id "g58"; 2_related_000122F AUGUSTUS CDS 81278 82214 0.96 - 1 transcript_id "g58.t1"; gene_id "g58"; 2_related_000122F AUGUSTUS CDS 82428 83746 0.79 - 0 transcript_id "g58.t1"; gene_id "g58"; 2_related_000122F AUGUSTUS start_codon 83744 83746 . - 0 transcript_id "g58.t1"; gene_id "g58"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKNGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPSEKKKFFNYFGSMTLNEREAQFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYKIRRNHMLESKNATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGGLSKDEWIKFIRLIK # KFQVDDQGRLYHRNTDQPDQPQLVVEKEKCMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEXTLGEWFFDDIICRWGCPEEVVTDNAGQMKN # MLAWLEEKHGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRCGLGCSPYFLVTRAEPLLPFDIVESTWLVNPPN # RILTRDELIGYRAQALSKHNSFIEKVRHRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSEIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAE # MDGTVLKEKVGAFRVLPHFTRNESIELPNNIHELIDLTAEQLDLMVEDEDKYWMTPEKDYIFDAIPHLRLSDTNSEEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g58 ### # start gene g59 2_related_000122F AUGUSTUS gene 84695 88411 0.9 - . g59 2_related_000122F AUGUSTUS transcript 84695 88411 0.9 - . g59.t1 2_related_000122F AUGUSTUS stop_codon 84695 84697 . - 0 transcript_id "g59.t1"; gene_id "g59"; 2_related_000122F AUGUSTUS CDS 84695 88411 0.9 - 0 transcript_id "g59.t1"; gene_id "g59"; 2_related_000122F AUGUSTUS start_codon 88409 88411 . - 0 transcript_id "g59.t1"; gene_id "g59"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFATRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFACLALTVDNQERWMDFLITNLGGEDVILGLPWLRKVNPEIDWEKGRLSVKPPRVAIEEVPDEEISYSHRAAANTESPIPELPN # LEPPAEPPHIEVPLEATLEESESAVVEEPPIHRIRANHKTRRAWVKAGILEEQTKEVWCAAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLIPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSSDLQEHRRV # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPAPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTRKDISFTWM # DTQQQAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRINTQADALSRMAAHQVLDNEDNRQQTVLKPNHFTKIAASILRNPLEDRIRKASQRE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCETCARK # KIQRHPRAVTQPLDVPLGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHALPCTSSITAEGVADIYYKEIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYHPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQNAGAALHLGKKQQKEGYERGKRKAHQFKVGDFVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPISLDRIHPVFHVDKLYPWK # GNTINGEIPPPPEPVYLEDEDEPEYEVEEILDSRVRWKRLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g59 ### # start gene g60 2_related_000122F AUGUSTUS gene 90555 92946 0.03 - . g60 2_related_000122F AUGUSTUS transcript 90555 92946 0.03 - . g60.t1 2_related_000122F AUGUSTUS stop_codon 90555 90557 . - 0 transcript_id "g60.t1"; gene_id "g60"; 2_related_000122F AUGUSTUS CDS 90555 91250 0.58 - 0 transcript_id "g60.t1"; gene_id "g60"; 2_related_000122F AUGUSTUS CDS 91334 91469 0.58 - 1 transcript_id "g60.t1"; gene_id "g60"; 2_related_000122F AUGUSTUS CDS 91562 91817 0.23 - 2 transcript_id "g60.t1"; gene_id "g60"; 2_related_000122F AUGUSTUS CDS 92721 92946 0.55 - 0 transcript_id "g60.t1"; gene_id "g60"; 2_related_000122F AUGUSTUS start_codon 92944 92946 . - 0 transcript_id "g60.t1"; gene_id "g60"; # protein sequence = [MNTPTKVSRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVPNI # VLDGYKRCEQETFSKQELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSESTETTQ # NQCNNENTSETIRDDNWNKPKNSQRTRKRMATKERKSQDLKDKKENVQPDLLNEPPTNKLEERIKLNQQDRSPINLIDEMDKQVVNEAIGVEKPINLN # TEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSE # AGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g60 ### # # ----- prediction on sequence number 5 (length = 22287, name = 2_related_000186F) ----- # # Predicted genes for sequence number 5 on both strands # start gene g61 2_related_000186F AUGUSTUS gene 4223 5098 0.64 + . g61 2_related_000186F AUGUSTUS transcript 4223 5098 0.64 + . g61.t1 2_related_000186F AUGUSTUS start_codon 4223 4225 . + 0 transcript_id "g61.t1"; gene_id "g61"; 2_related_000186F AUGUSTUS CDS 4223 5098 0.64 + 0 transcript_id "g61.t1"; gene_id "g61"; 2_related_000186F AUGUSTUS stop_codon 5096 5098 . + 0 transcript_id "g61.t1"; gene_id "g61"; # protein sequence = [MDCLLREGTPAYFLHILPMKEESPTGEMLRASDSSSPEGVQQPKDLEGGNPSPEQEGVVKELDEEALKRQETEELKKS # IPVQYQDYLDVFSPGEARTLPPHRPYDIKIKMEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPVGAPVLFAKKKDGTLRLCVNYQALN # KITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRTGYNNVRVAQRHKWKTAFRTQYGSFKYLVMLFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDNILI # YSDDKASHVEHVRKVLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g61 ### # start gene g62 2_related_000186F AUGUSTUS gene 9193 9702 0.77 - . g62 2_related_000186F AUGUSTUS transcript 9193 9702 0.77 - . g62.t1 2_related_000186F AUGUSTUS stop_codon 9193 9195 . - 0 transcript_id "g62.t1"; gene_id "g62"; 2_related_000186F AUGUSTUS CDS 9193 9702 0.77 - 0 transcript_id "g62.t1"; gene_id "g62"; 2_related_000186F AUGUSTUS start_codon 9700 9702 . - 0 transcript_id "g62.t1"; gene_id "g62"; # protein sequence = [MLALSTPLPHSDGAGRWDDIVPALPSIDQLTADWEQLMLQYIHHITNTPLPGLNTPAPMSSVDPVTEPLGEMIVEQSL # EAPVAPVSTPSVGSHPQVPLFLPEQESPTFPSPPPPSPTLPPLFGSIANLAIDLTGDNDELYETEESHVGWISVTREVVDLAAVKGIVKEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g62 ### # # ----- prediction on sequence number 6 (length = 249499, name = 2_related_000076F) ----- # # Predicted genes for sequence number 6 on both strands # start gene g63 2_related_000076F AUGUSTUS gene 162 869 0.62 + . g63 2_related_000076F AUGUSTUS transcript 162 869 0.62 + . g63.t1 2_related_000076F AUGUSTUS start_codon 162 164 . + 0 transcript_id "g63.t1"; gene_id "g63"; 2_related_000076F AUGUSTUS CDS 162 869 0.62 + 0 transcript_id "g63.t1"; gene_id "g63"; 2_related_000076F AUGUSTUS stop_codon 867 869 . + 0 transcript_id "g63.t1"; gene_id "g63"; # protein sequence = [MKGFQSYPSLSHENRARKTHKTEEMSALFKKMDIGLKLKLNFKIDKENRKRREKSLEYQLGNAAEDALDIASFVTIDT # KSLKNVRKDQTIFERLKDFLTTDTLDFFRQRNEEEERDRRIRTRDREEEAEEGTRKKRKSGKVTLVPRTTGLHVTTFDTLLFDTIDAFPTFPLFLFTN # KNLDLINTHMPELKRAKISHLEGKPHVLDLKEMAKWVKEAGGAFRDEDLDFIQCVSDWF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g63 ### # start gene g64 2_related_000076F AUGUSTUS gene 1828 3027 0.42 - . g64 2_related_000076F AUGUSTUS transcript 1828 3027 0.42 - . g64.t1 2_related_000076F AUGUSTUS stop_codon 1828 1830 . - 0 transcript_id "g64.t1"; gene_id "g64"; 2_related_000076F AUGUSTUS CDS 1828 3027 0.42 - 0 transcript_id "g64.t1"; gene_id "g64"; 2_related_000076F AUGUSTUS start_codon 3025 3027 . - 0 transcript_id "g64.t1"; gene_id "g64"; # protein sequence = [MIGELPESGGYNAISVFVDHFTKRLRLFATHTTITSEGMARVYCDKVFPIHGMPRKIVHDRGPQYHACFMYKLLGIES # NYTTAYHPQTNGQTEWINQEIEHYIRLFVNHHQSDWHEWLPMMEFAYNDRVHSATKVSPFYADNGRHPYKGTTPKMTSQNPTAQEFADSMKRIREEVG # LALKKAAEDMKRQYDKHRNEAIKYKAGDKVWLEGTNIMTDRPMKKLGDKQFGPFKVLEKIGSSSYKLDIPRTWKRVHNVFNETHLSPYHEPQFPTQPR # NTEPPPEVVGEEKEYEVEEVVDARKYRNGIQYKVKWRGYGPHEMTWEPAANMTNAKEAVQDFHKKYPNKPRPRTLKRIEIPIAQFPTELFRQIPTPDI # EPVPSTMPSEALVNRLARHGIRALKGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g64 ### # start gene g65 2_related_000076F AUGUSTUS gene 3618 4199 0.65 - . g65 2_related_000076F AUGUSTUS transcript 3618 4199 0.65 - . g65.t1 2_related_000076F AUGUSTUS stop_codon 3618 3620 . - 0 transcript_id "g65.t1"; gene_id "g65"; 2_related_000076F AUGUSTUS CDS 3618 4199 0.65 - 0 transcript_id "g65.t1"; gene_id "g65"; 2_related_000076F AUGUSTUS start_codon 4197 4199 . - 0 transcript_id "g65.t1"; gene_id "g65"; # protein sequence = [MAVTNLGKTDIFLGIDWLRYHNPSIDWKESTLTFEHCPDKCGYLPHYESPEDDGTEEKLVDGERIFWFDWDGYLSDQG # HIKVQTATTDAATPYLAEYADVFSKKDFDQMPERRPWDHAIELTPGSKPVDCKVYPLSPPEQKALDEFLEENLRSGRIRPSCSPMASPFFFVKKKDGT # LRPVQDYQKLDDMTVKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g65 ### # start gene g66 2_related_000076F AUGUSTUS gene 4694 5491 0.84 - . g66 2_related_000076F AUGUSTUS transcript 4694 5491 0.84 - . g66.t1 2_related_000076F AUGUSTUS stop_codon 4694 4696 . - 0 transcript_id "g66.t1"; gene_id "g66"; 2_related_000076F AUGUSTUS CDS 4694 5491 0.84 - 0 transcript_id "g66.t1"; gene_id "g66"; 2_related_000076F AUGUSTUS start_codon 5489 5491 . - 0 transcript_id "g66.t1"; gene_id "g66"; # protein sequence = [MFPLWQARPHCKVLSRESTEATVRQRHVEPDDTGGSGGYGQRIGFCPAPAVDAGLPGPISESASDFSSSSYVDSQFSF # EFGSTGTPNKNNLSTMTTRAEEKPVRYEPNTPEWVAQRLQMDKLLMAIGILRAWMPESRVREALEETVLAVRNLSHATTTEAVTNLKSRKRFVRGTRG # RELKLRTTIENIDNGVQIETEALLDSGATGSCINKDFVEHHQLTVKELPVKMPVYNADGTLNKNGSIEGYVQVRVAMRQEAGDGRSRYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g66 ### # start gene g67 2_related_000076F AUGUSTUS gene 5692 6291 0.93 - . g67 2_related_000076F AUGUSTUS transcript 5692 6291 0.93 - . g67.t1 2_related_000076F AUGUSTUS stop_codon 5692 5694 . - 0 transcript_id "g67.t1"; gene_id "g67"; 2_related_000076F AUGUSTUS CDS 5692 6291 0.93 - 0 transcript_id "g67.t1"; gene_id "g67"; 2_related_000076F AUGUSTUS start_codon 6289 6291 . - 0 transcript_id "g67.t1"; gene_id "g67"; # protein sequence = [MSNPTPAPTTTTSNIHGKSLLREPSIFDGDKAQFKEWRRTLFAYIRDPRNRIVTDSERIDIAVSYMRGPKVSSWVQNY # TDDNFNDDEEEWKVTWKGFKDALNASFLDKGLTENAQEKLEHLRQGPNERAEDFFKEFEVIMRDAGYAKDAPYVIRLIEMNVKPKLIDQVYGTSNERI # EKFDELKQKIISIDDMWWRREEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g67 ### # start gene g68 2_related_000076F AUGUSTUS gene 9779 13042 1 - . g68 2_related_000076F AUGUSTUS transcript 9779 13042 1 - . g68.t1 2_related_000076F AUGUSTUS stop_codon 9779 9781 . - 0 transcript_id "g68.t1"; gene_id "g68"; 2_related_000076F AUGUSTUS CDS 9779 13042 1 - 0 transcript_id "g68.t1"; gene_id "g68"; 2_related_000076F AUGUSTUS start_codon 13040 13042 . - 0 transcript_id "g68.t1"; gene_id "g68"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFHNTSHPDSPQTSVPSAINPVVAKVAV # PLPEPSPSVSPTILETPPGDSPRSRSRSHSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDVVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYTQVN # PYNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNQGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g68 ### # start gene g69 2_related_000076F AUGUSTUS gene 13375 15066 0.71 - . g69 2_related_000076F AUGUSTUS transcript 13375 15066 0.71 - . g69.t1 2_related_000076F AUGUSTUS stop_codon 13375 13377 . - 0 transcript_id "g69.t1"; gene_id "g69"; 2_related_000076F AUGUSTUS CDS 13375 14738 0.73 - 2 transcript_id "g69.t1"; gene_id "g69"; 2_related_000076F AUGUSTUS CDS 14811 15066 0.98 - 0 transcript_id "g69.t1"; gene_id "g69"; 2_related_000076F AUGUSTUS start_codon 15064 15066 . - 0 transcript_id "g69.t1"; gene_id "g69"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRPIARRTGKQPQRRAASESPRDPPPHFDLDAGDHDDQNPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPR # SPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAK # EWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLP # EPATLADYRQEVLRIDNRYWKREETRKHEAGKPFVARNPKKGSSDFKTGSANQHNNSQPSGSMAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRP # AFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKQKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g69 ### # start gene g70 2_related_000076F AUGUSTUS gene 18401 19202 0.41 + . g70 2_related_000076F AUGUSTUS transcript 18401 19202 0.41 + . g70.t1 2_related_000076F AUGUSTUS start_codon 18401 18403 . + 0 transcript_id "g70.t1"; gene_id "g70"; 2_related_000076F AUGUSTUS CDS 18401 18408 0.43 + 0 transcript_id "g70.t1"; gene_id "g70"; 2_related_000076F AUGUSTUS CDS 18464 19202 0.75 + 1 transcript_id "g70.t1"; gene_id "g70"; 2_related_000076F AUGUSTUS stop_codon 19200 19202 . + 0 transcript_id "g70.t1"; gene_id "g70"; # protein sequence = [MFSPFDRIPAPASSGVRTVAPCASSSQIASCTILDDPFATKSIPTPSKYNNNNKPPIRNPFSDPFITPTTSSPQQLQQ # LKQLPFKLTNQKPKKGCELAPNPLRPNVQAADCIHAWTTPYSIQKRLEEASSLPAKVIKLGDMIMAKGTVKPTKEVYAAGLLRYNQFGDLMGISESDR # MPASDRLIIGFIEHYAGKVSGKCISNWLSGLRLWHETMGAPWPAESDKLDGELTSKALITNDPHDTPSPSSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g70 ### # start gene g71 2_related_000076F AUGUSTUS gene 24930 25831 0.15 + . g71 2_related_000076F AUGUSTUS transcript 24930 25831 0.15 + . g71.t1 2_related_000076F AUGUSTUS start_codon 24930 24932 . + 0 transcript_id "g71.t1"; gene_id "g71"; 2_related_000076F AUGUSTUS CDS 24930 25138 0.36 + 0 transcript_id "g71.t1"; gene_id "g71"; 2_related_000076F AUGUSTUS CDS 25197 25583 0.54 + 1 transcript_id "g71.t1"; gene_id "g71"; 2_related_000076F AUGUSTUS CDS 25663 25831 0.55 + 1 transcript_id "g71.t1"; gene_id "g71"; 2_related_000076F AUGUSTUS stop_codon 25829 25831 . + 0 transcript_id "g71.t1"; gene_id "g71"; # protein sequence = [MQKDDDVGKVAQATPIVICEFEQDVRLFHIINVTTMFAAKALEMFLALIVEKAGEVTLERGSKKVEAYHLKHAVETID # TFDFLREIVEGVPDPSAGGTIDLDALNAENASKKKRSKGKKAASANGEDGAPAPKKRKKKVKSEEDTEKKGNGRGEDAVMAEAGEAEPNEEEENEERT # QMTDEDEDEDDQWKNDKPYLPSRCITIAPFDSVSAAPDLSIVHSDDGAEIRRLGVSKGFMKIFELVDQLPSNACSIPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g71 ### # start gene g72 2_related_000076F AUGUSTUS gene 29508 30284 1 - . g72 2_related_000076F AUGUSTUS transcript 29508 30284 1 - . g72.t1 2_related_000076F AUGUSTUS stop_codon 29508 29510 . - 0 transcript_id "g72.t1"; gene_id "g72"; 2_related_000076F AUGUSTUS CDS 29508 30284 1 - 0 transcript_id "g72.t1"; gene_id "g72"; 2_related_000076F AUGUSTUS start_codon 30282 30284 . - 0 transcript_id "g72.t1"; gene_id "g72"; # protein sequence = [MAAPRALPTPPSLPATPPPPSATPPRPALPIPPTALSDPAGNLGSLRKKRNFKALQLPTPPSPISAAPAGPLPPLPGV # ARGLVATRNAPNQPFKRGLSIDVDNAQPHNTGLGLFGRGAALGSGLPPISASVLMTPESSTTQRLNLQATLTTALEQMRLSSRGSGNSTTTLSSSGLA # TGSSGVSSTSSVTTVDGAPSAELYRSKAERDRELIQAPLQDSDLKNIAELGMGNGGSVMKVEHVPSGVVMAKKVQLSALFLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g72 ### # start gene g73 2_related_000076F AUGUSTUS gene 30982 32223 0.24 + . g73 2_related_000076F AUGUSTUS transcript 30982 32223 0.24 + . g73.t1 2_related_000076F AUGUSTUS start_codon 30982 30984 . + 0 transcript_id "g73.t1"; gene_id "g73"; 2_related_000076F AUGUSTUS CDS 30982 31003 0.58 + 0 transcript_id "g73.t1"; gene_id "g73"; 2_related_000076F AUGUSTUS CDS 31059 31092 0.73 + 2 transcript_id "g73.t1"; gene_id "g73"; 2_related_000076F AUGUSTUS CDS 31152 31258 0.71 + 1 transcript_id "g73.t1"; gene_id "g73"; 2_related_000076F AUGUSTUS CDS 31376 31528 0.52 + 2 transcript_id "g73.t1"; gene_id "g73"; 2_related_000076F AUGUSTUS CDS 31641 31958 0.4 + 2 transcript_id "g73.t1"; gene_id "g73"; 2_related_000076F AUGUSTUS CDS 32039 32223 0.79 + 2 transcript_id "g73.t1"; gene_id "g73"; 2_related_000076F AUGUSTUS stop_codon 32221 32223 . + 0 transcript_id "g73.t1"; gene_id "g73"; # protein sequence = [MVKTTICGTDLHIFKGDVATCDTGRILGHEGVAVVEQVGDNVGLFKPGDKVIVSYGGWALGNTIDGTQAEYTRIPHAD # GSLHLAVESASDNAQLMLSDTVPTGYEFGLGALITSQLYSPLQIIMIDLNEKRLATARSLGATHTVVSGPNVVEQVMKITGGRGVDAALEAVGIPATF # ELCQKLVAVGGTIANLGVHGTKVDLHLETLWDKNITITTRLVDASSTPMLIKLVESGKILPEKFATHTFAFKDIEKAYSIFGAAEAHDCLKVVIEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g73 ### # start gene g74 2_related_000076F AUGUSTUS gene 33139 35793 0.24 - . g74 2_related_000076F AUGUSTUS transcript 33139 35793 0.24 - . g74.t1 2_related_000076F AUGUSTUS stop_codon 33139 33141 . - 0 transcript_id "g74.t1"; gene_id "g74"; 2_related_000076F AUGUSTUS CDS 33139 35578 0.56 - 1 transcript_id "g74.t1"; gene_id "g74"; 2_related_000076F AUGUSTUS CDS 35765 35793 0.24 - 0 transcript_id "g74.t1"; gene_id "g74"; 2_related_000076F AUGUSTUS start_codon 35791 35793 . - 0 transcript_id "g74.t1"; gene_id "g74"; # protein sequence = [MADSFNGPGDQTSSPTLTLSIGIGNTSPVPGFPSPSSSFVPPPVVTPIEFATVKDKRKDENSRKNSKTGLVNVATKSK # SQLDTKPNTSAPAVDPNSIISPTTPTPNSLHRQRSFPNSESFSEVAATVIELPTELPTDDETHNSSSNLAAKAFGAAASRDTQSPIIPTPPFSKQSLN # ASHSLPKTPVRTPSNPPTPSSPGFHFPPSASSRKPNRDSTMSNFSTSSAASTRSTTSLKSNRPAPPSPALSRRTSGTGVGAATSPIAKRFSAGPGGIP # AFGVVERSHSLRTSPTVSRNHSNSPKAALPMSSHPHRFSSPAFRRDSSTMSVPAPLPLTPVPGSATLPPVSASLLSGDLSSAGLSSAGLSSAALRTAT # TASTALTKGKGTGTASQMRRPIRIRDYAYIPREDESLDADARPLWENDPQFLGFGADGKGLHVPTPNRVKVLNKALLTATNLSTISSNLNTAYTMWKT # SYKRDRKERKAAVKRRAKETKRERAQARYSMNSVRSVGSTSSTASSVSSTSSRSEVSEVDEREDDDEDDGMGGWAGFRFGLARLSWGFGNSGASGSTG # TSVSASTPASKIATNTPNEPSASNTSNNSNSGPSSNAFPSRLDLDRNFGIDATSSESGDESSNNSTDTEGEQFHDAPSSHLRHADLDFGLDLEGRGID # SPSPLDYDRVYGYDEDAYGQIPNSAFPSASPYPGSGDGYGYEDDSLDSIGEGELIPGQYRALYSFEPEGPSEMKLTEGEIVIVVGRGGGGGWAVVVDK # YTEYSPRDVEPGGTTNPNVTSKYALVPESYLELIQPDEVADREVKKEKGTVTTPEVRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g74 ### # start gene g75 2_related_000076F AUGUSTUS gene 37463 38392 0.58 + . g75 2_related_000076F AUGUSTUS transcript 37463 38392 0.58 + . g75.t1 2_related_000076F AUGUSTUS start_codon 37463 37465 . + 0 transcript_id "g75.t1"; gene_id "g75"; 2_related_000076F AUGUSTUS CDS 37463 38392 0.58 + 0 transcript_id "g75.t1"; gene_id "g75"; 2_related_000076F AUGUSTUS stop_codon 38390 38392 . + 0 transcript_id "g75.t1"; gene_id "g75"; # protein sequence = [MSAMSMERPSSSKLKSRKQKSTLSRGNMTQAQKSNQAASSTAITVVAGQRLMSIPEQLFRDKPSNDIRTPEEHQPVAW # EPPSVDPGPTGTAMGPPQWRYASMGYAQPASSPMEGFTYSPTWGARGPPPGPASQLDMESALNAGGRVSGQVATIERLQGEDTDPLTVRQKEKFLERG # VSPAVSEQSRTLSRRLLTPPVQSVNPPLRQRSSLSSLLKSPAVNTPNWEGTHAIHHSRTNFPVQPSSEMTLRLEDFIRIQECTPEDVAMVLREVLELM # GIEILGNSIKFSNLQVQFLTVGTQLEIDLLEKAQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g75 ### # start gene g76 2_related_000076F AUGUSTUS gene 41294 43780 0.54 + . g76 2_related_000076F AUGUSTUS transcript 41294 43780 0.54 + . g76.t1 2_related_000076F AUGUSTUS start_codon 41294 41296 . + 0 transcript_id "g76.t1"; gene_id "g76"; 2_related_000076F AUGUSTUS CDS 41294 42606 0.67 + 0 transcript_id "g76.t1"; gene_id "g76"; 2_related_000076F AUGUSTUS CDS 42769 43780 0.59 + 1 transcript_id "g76.t1"; gene_id "g76"; 2_related_000076F AUGUSTUS stop_codon 43778 43780 . + 0 transcript_id "g76.t1"; gene_id "g76"; # protein sequence = [MSAPLRRSSSRTRSPQLPILTTIGEVPSPDLESDGEAEQDQLAFTIEFPSRPQLQLFETVFNTGKPLSGYCQDDPLWP # LLAEVASPCSNCSKSPAKCKVLPNSPQCTNCSVKKTCSLGKILRYRYFARRCNQDLTYSCRFLELHGTPAHQSTWGIPVGTWRQYDAALHERTSSTST # LLELNMLDDQDTADVDQQELQDFLALQQGEAAVAAKRKRDLSPLPVAGPSSKKVRSNASKKRPRRRSPMQETAQESPRRVRLVVPPVRSLPITTSTSL # PPRASPSLMEVPDDDLSVQGHSSLVQLAAVAEAQSGLVQQPVVPSSIKGTGPDLLSSNMPPVPRPTLVPRALATHPYCAENQRLTARVRLLESQLSDS # QRENSSLTSALRDTSHALESRQREVEQLQSSSREVHEQQVEYRRVLDQFRALDEALPGPPDRVSILLLYQQGVVDESNALATRQRHLVEELQEEVHRA # RGHAAFVEQMIKEYPDEGYYEVILPPLPQLEGDLNKAREDLRRVATFAHRLYRSDPATVLHHHYRYLGAIIEAVVAFLRRGLDSDNLDIVVHNFQLGL # DYMQAARGVHGDMYMRSLSSIQWFFNNAVDEDEGLYRMVLEHSRFNNDGPFLTAAQHAGFAPPPDSSLEPPLYQQMFALSMALPHSDGVGRWDDIVPA # LPSIDQLTADWEQLMLQYIHHITDTPLPVSDPPVPMLSMGPVPESSGEVNIEQSLEAPIVQVSSPSAGSHPPVPLFLSEQESPTSPSPPPRSPDLPPV # LGPSPAYPSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g76 ### # start gene g77 2_related_000076F AUGUSTUS gene 44132 44863 0.58 - . g77 2_related_000076F AUGUSTUS transcript 44132 44863 0.58 - . g77.t1 2_related_000076F AUGUSTUS stop_codon 44132 44134 . - 0 transcript_id "g77.t1"; gene_id "g77"; 2_related_000076F AUGUSTUS CDS 44132 44863 0.58 - 0 transcript_id "g77.t1"; gene_id "g77"; 2_related_000076F AUGUSTUS start_codon 44861 44863 . - 0 transcript_id "g77.t1"; gene_id "g77"; # protein sequence = [MTGVSPFFANKGYHPKLSITLEQVQGAEVNKYASNLKELHAYLQERIRVANEVYAQYANQKRQEAPDWKEGDHVWLNM # ENVRTRRPMKKLDHKWTGPYSILAKIGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVKDILDSKPKKGRPEEVEYL # VKWEGYSEEFNSWVGWEGMVGSIELLHSWHKHHPRKRQPSRLQWASLEREAREDEEDDREGTREHRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g77 ### # start gene g78 2_related_000076F AUGUSTUS gene 48528 49931 0.98 - . g78 2_related_000076F AUGUSTUS transcript 48528 49931 0.98 - . g78.t1 2_related_000076F AUGUSTUS stop_codon 48528 48530 . - 0 transcript_id "g78.t1"; gene_id "g78"; 2_related_000076F AUGUSTUS CDS 48528 49931 0.98 - 0 transcript_id "g78.t1"; gene_id "g78"; 2_related_000076F AUGUSTUS start_codon 49929 49931 . - 0 transcript_id "g78.t1"; gene_id "g78"; # protein sequence = [MRHPDNLVDLTNSIPLELFDGQPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEGIHEGTLQPPPEASQQPPEAPLRAPRTRVKLEEVKDEEYEASQPGPHKLFPSDKDLGPD # DPILMGINEWLAFASESTEEEVEEILEAGRSTMEKVTPKPAKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDLPTLDIESLNIPKIP # SRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDCLLREGTPAYFLHISPMKEESPTEEILLASDSNDPERVQQPKDPESGN # PSLGQGGVVKELDEEVSKRQETEESKKSIPVRCQGYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g78 ### # start gene g79 2_related_000076F AUGUSTUS gene 50444 52920 0.26 - . g79 2_related_000076F AUGUSTUS transcript 50444 52920 0.26 - . g79.t1 2_related_000076F AUGUSTUS stop_codon 50444 50446 . - 0 transcript_id "g79.t1"; gene_id "g79"; 2_related_000076F AUGUSTUS CDS 50444 51348 0.79 - 2 transcript_id "g79.t1"; gene_id "g79"; 2_related_000076F AUGUSTUS CDS 51429 51833 0.69 - 2 transcript_id "g79.t1"; gene_id "g79"; 2_related_000076F AUGUSTUS CDS 51909 52920 0.28 - 0 transcript_id "g79.t1"; gene_id "g79"; 2_related_000076F AUGUSTUS start_codon 52918 52920 . - 0 transcript_id "g79.t1"; gene_id "g79"; # protein sequence = [MLSEELSGSNLERALEFHCRLVADNRGTSYMVQCEPESVGEFPPEQFDQKRQLHGSDGHFLAQNHSLPRNIEVPEFLY # PGNTATRSPQLCSGTSPTVHALVQNSTPPPRVNLQTKPVTPVSTQRYQFGEVRMDGAQHSSRIYGQDLTARLVPNPVHVPPRLSNPSVIPYQGSVSMQ # SHAVGAESQRDPNQRRTLVVHEEAVPPQGAPLGTPFVTGAQMNRPGMVVDSAHSQESVAMIQQQAQVIETLQEQLREVKKGFTAGEVPTGGPLSKTGN # MAGLSGRAPRLMREYTRGGSSPVAPQPRSWQATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPKGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDR # ERPLSQGGQGQREQGGRSGGGAPPPPPSGGPGDSNSEGSDKGEQNQSSRNGGRREEDRGELPTGAPEVPPTCYDPDQPWYYDPRQGWHRKAAPRPPNE # GRSDNRSAWRTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNQQQLKGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMP # EESFANFFIRSNEYAPLTGFNDEALITYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRVQAESLRNFHGKKPLQGWLSRFPGLELAPEAP # YKSPLQREREPADVWTSNPKPAATGRFQNRSNGKEGRQRASAAWGEGESYDSENREEDEDCCHCRDGGEWTEAVLRAGVTNTGRKWTPEERAEKWRRR # RQEFCMHCG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g79 ### # start gene g80 2_related_000076F AUGUSTUS gene 53799 54428 1 - . g80 2_related_000076F AUGUSTUS transcript 53799 54428 1 - . g80.t1 2_related_000076F AUGUSTUS stop_codon 53799 53801 . - 0 transcript_id "g80.t1"; gene_id "g80"; 2_related_000076F AUGUSTUS CDS 53799 54428 1 - 0 transcript_id "g80.t1"; gene_id "g80"; 2_related_000076F AUGUSTUS start_codon 54426 54428 . - 0 transcript_id "g80.t1"; gene_id "g80"; # protein sequence = [MSATSTERPSNSKIEPKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNVRTPEGRQPAVE # EPPPVELGMGPPQQRYTSMGYAQPASSPMGGFAYSPTWGMRGPPPGPVPQLDMESASNAGGRVSGQVAAIKRIQGESTDPLTVRQQEKLPERRVSPAI # SEQSRTSSRRLPTPQYSPLTFLPRDEEVHSPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g80 ### # start gene g81 2_related_000076F AUGUSTUS gene 58480 58779 0.88 - . g81 2_related_000076F AUGUSTUS transcript 58480 58779 0.88 - . g81.t1 2_related_000076F AUGUSTUS stop_codon 58480 58482 . - 0 transcript_id "g81.t1"; gene_id "g81"; 2_related_000076F AUGUSTUS CDS 58480 58779 0.88 - 0 transcript_id "g81.t1"; gene_id "g81"; 2_related_000076F AUGUSTUS start_codon 58777 58779 . - 0 transcript_id "g81.t1"; gene_id "g81"; # protein sequence = [MGISRFGGLNQSKLKPKHTDPYGGLELCTGTTTQCDLPLRLMTDPKFKEYPTAEYNFLQSQGAEHDVPILTSAGPKWL # LAKRFCAATRQEAGGGRSEYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g81 ### # start gene g82 2_related_000076F AUGUSTUS gene 61841 62461 0.98 + . g82 2_related_000076F AUGUSTUS transcript 61841 62461 0.98 + . g82.t1 2_related_000076F AUGUSTUS start_codon 61841 61843 . + 0 transcript_id "g82.t1"; gene_id "g82"; 2_related_000076F AUGUSTUS CDS 61841 62461 0.98 + 0 transcript_id "g82.t1"; gene_id "g82"; 2_related_000076F AUGUSTUS stop_codon 62459 62461 . + 0 transcript_id "g82.t1"; gene_id "g82"; # protein sequence = [MEKKGIRRHIWHRKTLTNAPASIRTSPSPADTDPLAYPSPAVSSVTPRPDTSHSIDSKPSVFLTPLANCVQACNGQQL # AFQNFLQQNLSNNGSFDSGVGMSSTIQVASTSAACPDSGTANDCINWQNDSEINLPGPGIDENSSISVPTSVNSTSQNSLSHSIINRLNFGLSIMAQI # ILSRDSLEFTPLDPSALETIVKTVQATVKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g82 ### # start gene g83 2_related_000076F AUGUSTUS gene 64214 65260 1 + . g83 2_related_000076F AUGUSTUS transcript 64214 65260 1 + . g83.t1 2_related_000076F AUGUSTUS start_codon 64214 64216 . + 0 transcript_id "g83.t1"; gene_id "g83"; 2_related_000076F AUGUSTUS CDS 64214 65260 1 + 0 transcript_id "g83.t1"; gene_id "g83"; 2_related_000076F AUGUSTUS stop_codon 65258 65260 . + 0 transcript_id "g83.t1"; gene_id "g83"; # protein sequence = [MSTPIPPATPAPPASAEDLMTQLIKQVANLATAMEECSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS # QAKLIKSALGFFTESAGDWATPHLLHFNVEHPPFGGNWEEFLKEFVQRFESVDLGMEARSEIKNLKQGKGQTVAEFAQKFKDIGDRTGMSDIDLWEHF # FTALLPEIRQNLIIVNITQGLAPTLKEAIKRAISVDVYMHDPTMTGRNSGPAPTTPADPHAMDIDATHTSNGNTREAFLARMCGAQGHVKQNCPHRET # TCRYCGCRGHLTSSWDSDETDADASRYPLQDPRYSPCSQMNLSRSLPQPQHLLLQPYLLLRAPLTRTFPTGLVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g83 ### # start gene g84 2_related_000076F AUGUSTUS gene 65376 66314 0.89 + . g84 2_related_000076F AUGUSTUS transcript 65376 66314 0.89 + . g84.t1 2_related_000076F AUGUSTUS start_codon 65376 65378 . + 0 transcript_id "g84.t1"; gene_id "g84"; 2_related_000076F AUGUSTUS CDS 65376 66314 0.89 + 0 transcript_id "g84.t1"; gene_id "g84"; 2_related_000076F AUGUSTUS stop_codon 66312 66314 . + 0 transcript_id "g84.t1"; gene_id "g84"; # protein sequence = [MFATSLYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMADCGATALFLNQDFATQNHVRCAPLHKPIDIF # NIDGTPNRAGQITHFARLARTVNNQERWMDFLITNLGGEDVILELPWLRKVNPEIDWEKGRLSVKPPQVAIEEVPDEEISYSHRAATNTESSIPEFPN # LEPPTEPPQIEVPLEATLEESKSAVVEEPPIHQIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESTSERLPAHQPWDHAIDLIPGAPASDHAHQDLPHVPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g84 ### # start gene g85 2_related_000076F AUGUSTUS gene 69450 70658 0.7 - . g85 2_related_000076F AUGUSTUS transcript 69450 70658 0.7 - . g85.t1 2_related_000076F AUGUSTUS stop_codon 69450 69452 . - 0 transcript_id "g85.t1"; gene_id "g85"; 2_related_000076F AUGUSTUS CDS 69450 70658 0.7 - 0 transcript_id "g85.t1"; gene_id "g85"; 2_related_000076F AUGUSTUS start_codon 70656 70658 . - 0 transcript_id "g85.t1"; gene_id "g85"; # protein sequence = [MIGELPESGGYNAISVFVDHFTKRLRLFATHTTITSEGMARVYHDKVFPIHGMPRKIVHDRGPQYHARFMKELYKLLG # IESNYTTAYHPQTNGQTERINQEIEHYIRLFVNHHQSDWHEWLPMMEFAYNDRVHSATKVSPFYADNGRHPYKGTAPKMTSQNPTAQEFADSMKWIRE # EVGSALKKAAEDMKRQYDKHRNEAIKYKAGDKVWLEGTNITTDHPMKKLGDKRFGPFKVLEKIGSSSYKLDIPRMWKRVHNVFNETHLSPYHEPQFPT # QPRNTEPPPEVVGEEEEYEVEEVVDARKYRNGIQYKVKWRGYGPHEMMWEPAANMTNAKEAVQDFHKKYPNKPRPRTLKRIEIPIAQFPTELFRQIPT # PDIEPVPSTMPSEALVNRLARHGIHALKGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g85 ### # start gene g86 2_related_000076F AUGUSTUS gene 71565 72944 0.94 - . g86 2_related_000076F AUGUSTUS transcript 71565 72944 0.94 - . g86.t1 2_related_000076F AUGUSTUS stop_codon 71565 71567 . - 0 transcript_id "g86.t1"; gene_id "g86"; 2_related_000076F AUGUSTUS CDS 71565 72944 0.94 - 0 transcript_id "g86.t1"; gene_id "g86"; 2_related_000076F AUGUSTUS start_codon 72942 72944 . - 0 transcript_id "g86.t1"; gene_id "g86"; # protein sequence = [MNEDLLVNRVREAPKDTTIIEALKRIARNEEESFVWEDGLIKRGGRIYIPDVGTLRREVLQSYHDHKLRGHPGEKHTK # KLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLHPLPIGQRPWSSISLDHITQLPATAGPEKYDAILVVVCQLTKQAIYVPCHTTDKAEDF # ANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNNTPNTTTG # VSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKAYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTIL # LKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKCQTSLPPPIFIKGEMEHFVEDILDSKPKKGRPEEVEYLVKWEGYNDITPM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g86 ### # start gene g87 2_related_000076F AUGUSTUS gene 73273 74652 0.93 - . g87 2_related_000076F AUGUSTUS transcript 73273 74652 0.93 - . g87.t1 2_related_000076F AUGUSTUS stop_codon 73273 73275 . - 0 transcript_id "g87.t1"; gene_id "g87"; 2_related_000076F AUGUSTUS CDS 73273 74652 0.93 - 0 transcript_id "g87.t1"; gene_id "g87"; 2_related_000076F AUGUSTUS start_codon 74650 74652 . - 0 transcript_id "g87.t1"; gene_id "g87"; # protein sequence = [MDRLLREGTPAYFLHISPTKEESPTEEMLRASDSSATEGVHQPKDPESGDPSSEQGGVNKELDKEESKRQETEELKKS # IPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALN # KITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHKWKTAFRTRYGSFEYLVMPFGLTNAPSGFQFFMNEIFHDMVDVCVVIYLDDILI # YSDDEESHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTK # LLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDRHIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g87 ### # start gene g88 2_related_000076F AUGUSTUS gene 74829 75668 0.93 - . g88 2_related_000076F AUGUSTUS transcript 74829 75668 0.93 - . g88.t1 2_related_000076F AUGUSTUS stop_codon 74829 74831 . - 0 transcript_id "g88.t1"; gene_id "g88"; 2_related_000076F AUGUSTUS CDS 74829 75668 0.93 - 0 transcript_id "g88.t1"; gene_id "g88"; 2_related_000076F AUGUSTUS start_codon 75666 75668 . - 0 transcript_id "g88.t1"; gene_id "g88"; # protein sequence = [MILTGGRSGGGAPPPPPTPPPPSGGPGDSNSEGSDEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDP # RQGWHRTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEGIHEGTLQPPPEAPQQPPEAPQPPSEVPQQSPEAPLRAPRTGVKLEEVKDEEYKAS # QPGPHKLFPSDRDLGPDDPILMGINEWLAFASESTEEEVEEILKAGRSAMEKVTPNQRRIQRRPIKSGRVGTRNDPPPGLELSKKSGGGRKGGNMDLI # PTSPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g88 ### # start gene g89 2_related_000076F AUGUSTUS gene 76138 77352 0.37 - . g89 2_related_000076F AUGUSTUS transcript 76138 77352 0.37 - . g89.t1 2_related_000076F AUGUSTUS stop_codon 76138 76140 . - 0 transcript_id "g89.t1"; gene_id "g89"; 2_related_000076F AUGUSTUS CDS 76138 77352 0.37 - 0 transcript_id "g89.t1"; gene_id "g89"; 2_related_000076F AUGUSTUS start_codon 77350 77352 . - 0 transcript_id "g89.t1"; gene_id "g89"; # protein sequence = [MVQCKPESVGEFPPEQFDQKGQLHGSDGCFLAQKHSSPRNIEVPELLNPGNTATRSPQLRSGTFPTVHALAQNSTPPP # RVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSQISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPLQGA # PFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTAGEVPTGGPLSKTGNTAGLSGQAPRVMREYTRGGPSPVVPQPRSW # QATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPSVDRRRIHKWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLS # QGGQGQREQGGVKSMPRASIPPFGIPKICSLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g89 ### # start gene g90 2_related_000076F AUGUSTUS gene 79871 82144 0.68 - . g90 2_related_000076F AUGUSTUS transcript 79871 82144 0.68 - . g90.t1 2_related_000076F AUGUSTUS stop_codon 79871 79873 . - 0 transcript_id "g90.t1"; gene_id "g90"; 2_related_000076F AUGUSTUS CDS 79871 82144 0.68 - 0 transcript_id "g90.t1"; gene_id "g90"; 2_related_000076F AUGUSTUS start_codon 82142 82144 . - 0 transcript_id "g90.t1"; gene_id "g90"; # protein sequence = [MTTRAEEKPVRSEPNTPEWVAQRLQMDKLPMAIGILRAWMPESCVREASEETVLAVRNLSHATATEAVTNLKSRKRFV # RGTRGCELKLRTTIENINNGVQIETEALLDSGATGSCINKDFVEHHQLTVKELPVKMPVYNADGTLNKNGSIEGYVQVRMVIGDHAERIDMAVTNLGK # TDIFLGIDWLRYHNPSIDWKESTLMFECCPDKCGYLPHYESPEDDGTEEKLVDGERIFWFDWDGYFSDQGHIKVQTATTDAATPYLAEYADVFSKKDF # DQIPERRPWDHAIELTPGSKPVDCKVYPLSPPEQKALDEFLEENLRLGRIRPSRSPMASPFFFVKKKDGTLRPVQDYRKLNDMTVKNRYPLPLIQELI # DKLKNSKIFTKMDVRWGFNNIRIKEGDEWKAAFRTNRGLFKPTVMFFGLTNSPAMFQAFMNHILRELIDQGHVIVYMDDILIFTDNIEEHRIIVRKVL # DILKANKLYLKPEKCTFEAREVEYLGIIVGNGQIRMDPKKVEAVRTWQPPQKKRELQSFLGFCNFFRQFIRDFSKIAKPLTRLTGNATWEWTSLEQDA # FNQLKDQIIEDVTLIIPRETGKFRIEADSSDYANGAVLSQNVDGKWRPVAFRSRSLNEVERNYEIYDKEMMAIMDSLSDWRQYLLGAKEPVEVFTDHQ # NLQYFRKPQKLNRRQARWVVEIAEYCHALATTRPVPVPTTRCHTSYPPPVCPLHLPKYHQTPPQVFLTQLPKRPSPRHAYKNPLANNPFKY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g90 ### # start gene g91 2_related_000076F AUGUSTUS gene 82270 83223 1 - . g91 2_related_000076F AUGUSTUS transcript 82270 83223 1 - . g91.t1 2_related_000076F AUGUSTUS stop_codon 82270 82272 . - 0 transcript_id "g91.t1"; gene_id "g91"; 2_related_000076F AUGUSTUS CDS 82270 83223 1 - 0 transcript_id "g91.t1"; gene_id "g91"; 2_related_000076F AUGUSTUS start_codon 83221 83223 . - 0 transcript_id "g91.t1"; gene_id "g91"; # protein sequence = [MSNPTPAPTTTTSNIHGKSLLREPSIFDGDKAQFKEWRRTLFAYIRDPRNRIVTDSERIDIAVSYMRGPKVSSWVQNY # TDDNFNDDEEEWKVTWKGFKDALNASFLDKGLTENAQEKLEHFRQGPNERAEDFFKEFEVIMRDAGYAKDAPYVIRLIEMNVKPKLIDQVHGTSNERI # EKPDELKQKIISIDDIWWRREEMRRNWSNRYQRNAGQGPSSQRWQPQMTQAPITKAPIPAVPTQDRKDGTGTTFKGAGRPMDIDAARRNKECFHCGKQ # GHIAKFCPEKAPKPQFVRGMWSRMTQEDQEAMAKELGFVLPQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g91 ### # start gene g92 2_related_000076F AUGUSTUS gene 85785 87786 0.29 + . g92 2_related_000076F AUGUSTUS transcript 85785 87786 0.29 + . g92.t1 2_related_000076F AUGUSTUS start_codon 85785 85787 . + 0 transcript_id "g92.t1"; gene_id "g92"; 2_related_000076F AUGUSTUS CDS 85785 86428 0.48 + 0 transcript_id "g92.t1"; gene_id "g92"; 2_related_000076F AUGUSTUS CDS 86501 86542 0.76 + 1 transcript_id "g92.t1"; gene_id "g92"; 2_related_000076F AUGUSTUS CDS 86697 87786 0.53 + 1 transcript_id "g92.t1"; gene_id "g92"; 2_related_000076F AUGUSTUS stop_codon 87784 87786 . + 0 transcript_id "g92.t1"; gene_id "g92"; # protein sequence = [MLDEQDAVDADQQELQQFLTLQRDEAAVAAKRKRNRSPMPVAGPSSKKIRLDAPKKCSRRKSPAVEVNVEPFRRVRLV # VPPVRSVAPTSLPVPPPASSSLMGVLNRDLPMQGPSDLVRLADAAEVHPGLVQQAGSSSPARTPIKGTGQDLLSSTMPPILHPALVPRNPASHPYRAE # NQRLAARVCLLESQLADSQRENSSLTSALRDTSNLDNGSLIPWIGLFWDRLTRISELTTALLYQHGITDEGNTLSTRQRARLEELQEEVHRTRGRAAF # VERMIKEYPDEGYYEVVLPPLSQLEGDLVKVRADLRRVATLAHRLYRSDPATVLHHHNRYIGAIIEAVVAFLRRALETEDPDVMEHNIRLALDYMQTA # CGVHGDLHIRSLSSIQWFFNNAVDRDEGLYTLMLENSRFDSDRAFLTAAQHAGFTSPPPDSLEPPLHHRMLSLSTALPHRGGAGRWDDLVLAIPSDDQ # LTLDWEQLMLQYMHHITDTPLPVPDPPVPMSSMGPVPESSGEATCEAWHKRPALVLSGLGLSKQDSCLGRTRGGGISAATGVGSLTSGGCGAWVDLAK # GPGVGEGGVVGEDGGGWGCGALT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g92 ### # start gene g93 2_related_000076F AUGUSTUS gene 88752 90278 0.73 - . g93 2_related_000076F AUGUSTUS transcript 88752 90278 0.73 - . g93.t1 2_related_000076F AUGUSTUS stop_codon 88752 88754 . - 0 transcript_id "g93.t1"; gene_id "g93"; 2_related_000076F AUGUSTUS CDS 88752 90278 0.73 - 0 transcript_id "g93.t1"; gene_id "g93"; 2_related_000076F AUGUSTUS start_codon 90276 90278 . - 0 transcript_id "g93.t1"; gene_id "g93"; # protein sequence = [MNEDLLVNRVREAPKDTTIIEALRRIARNEEESLVWEDGLIKRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTK # KLVNQLFFWKGLSKDVNYYVRNCHSCLRAKASRSKPYGNLHPLPIGQRPWSSISLDHITQLPATAGPEKYDAILVVVCRLTKQAIYVPCHTTDNAEDF # ANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNNTPNTTTG # VSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKAYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTIL # LKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGKTEHFVEDILDSKPKKGRPEEVEYLVKWEGYNDEFNSWVGWEGMVGSI # ELLCSWHKHHPRKRQPSRLQWASLEREAREDEEEGSGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g93 ### # start gene g94 2_related_000076F AUGUSTUS gene 90332 91420 0.98 - . g94 2_related_000076F AUGUSTUS transcript 90332 91420 0.98 - . g94.t1 2_related_000076F AUGUSTUS stop_codon 90332 90334 . - 0 transcript_id "g94.t1"; gene_id "g94"; 2_related_000076F AUGUSTUS CDS 90332 91420 0.98 - 0 transcript_id "g94.t1"; gene_id "g94"; 2_related_000076F AUGUSTUS start_codon 91418 91420 . - 0 transcript_id "g94.t1"; gene_id "g94"; # protein sequence = [MSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPILFAKRKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKI # FTKIDLRAGYNNIRVAQGHEWKTAFQTRYGSFEYLVMPFGLTNASSAFQFFMNKIFHNMVDVCVVIYLDNILIYSDNEASHVEHVRKVLERLRVNHLH # AKPEKCVFHVDTVKYLGMIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYFGITKVFTKLLRKDSVWNWTPQCSSAFELLKLAF # SKAPVLGHYSPNLPVILECNASDLAIAGILSQLDPETGEIHDKPGGQSSFQDMILSSTIAQGGWEPSRTRSPADQTCTQRRELQGTRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g94 ### # start gene g95 2_related_000076F AUGUSTUS gene 92200 92739 0.69 - . g95 2_related_000076F AUGUSTUS transcript 92200 92739 0.69 - . g95.t1 2_related_000076F AUGUSTUS stop_codon 92200 92202 . - 0 transcript_id "g95.t1"; gene_id "g95"; 2_related_000076F AUGUSTUS CDS 92200 92392 0.76 - 1 transcript_id "g95.t1"; gene_id "g95"; 2_related_000076F AUGUSTUS CDS 92495 92631 0.69 - 0 transcript_id "g95.t1"; gene_id "g95"; 2_related_000076F AUGUSTUS CDS 92719 92739 0.77 - 0 transcript_id "g95.t1"; gene_id "g95"; 2_related_000076F AUGUSTUS start_codon 92737 92739 . - 0 transcript_id "g95.t1"; gene_id "g95"; # protein sequence = [MRHPENLISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKELCLTKEIHEGILQPPPEAPQQPPETPQQP # SEAPQQPPEAPLRAPRTRVKLEEVKDEEYEASQPGPHE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g95 ### # start gene g96 2_related_000076F AUGUSTUS gene 94007 94819 0.76 - . g96 2_related_000076F AUGUSTUS transcript 94007 94819 0.76 - . g96.t1 2_related_000076F AUGUSTUS stop_codon 94007 94009 . - 0 transcript_id "g96.t1"; gene_id "g96"; 2_related_000076F AUGUSTUS CDS 94007 94819 0.76 - 0 transcript_id "g96.t1"; gene_id "g96"; 2_related_000076F AUGUSTUS start_codon 94817 94819 . - 0 transcript_id "g96.t1"; gene_id "g96"; # protein sequence = [MEPISFTRQTPMGVREGNPQEGQTALLPATPSVDRRRIQEWGARVQRAELGEYVRPEGGRYALEDGGVAASGGGFRPP # DREPPPHLSSQTRDRKRPLSQGGWDQRRQEERSGGGAPPPPPPPPPPSEGPSDNDSEGSNKGEYTQSSRNEGRNGEEGVELLTGAPEVPPTRYDQDQP # WYYDPKQGWHRKAAPRTPNKGRNTWESNKEKNRITIESKLDVGKIESFADDDRSAWKTWVLSLGYVLLSTLEKRTNALRQPAISLVQHSPTSTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g96 ### # start gene g97 2_related_000076F AUGUSTUS gene 97188 98132 0.9 - . g97 2_related_000076F AUGUSTUS transcript 97188 98132 0.9 - . g97.t1 2_related_000076F AUGUSTUS stop_codon 97188 97190 . - 0 transcript_id "g97.t1"; gene_id "g97"; 2_related_000076F AUGUSTUS CDS 97188 98132 0.9 - 0 transcript_id "g97.t1"; gene_id "g97"; 2_related_000076F AUGUSTUS start_codon 98130 98132 . - 0 transcript_id "g97.t1"; gene_id "g97"; # protein sequence = [MSVTSMEPPSSSKIESKKQKSALSRGNTTQAQKSNQAASSTVITVATGQHLMSIPEQSFGDETASNVRTPKGRQPAVQ # EPPPVEPGMGPPPVQQQEKLPQRRVSPAVSKQSRTSSWRLPTPPVQSLNLPPPRRGSSLSTLLKSPAMNTPNWEHTHAIHHSRTNFPVQPLSEMTLRL # EDVIRIQECIPEDVAMVLREVLELMGIEILGDGLEFSDLRVQFLTMGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSF # RNPRGILPLLPHTHGREKEFCGEAGLHILYRASNYRSGAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g97 ### # start gene g98 2_related_000076F AUGUSTUS gene 101690 104773 0.99 - . g98 2_related_000076F AUGUSTUS transcript 101690 104773 0.99 - . g98.t1 2_related_000076F AUGUSTUS stop_codon 101690 101692 . - 0 transcript_id "g98.t1"; gene_id "g98"; 2_related_000076F AUGUSTUS CDS 101690 104773 0.99 - 0 transcript_id "g98.t1"; gene_id "g98"; 2_related_000076F AUGUSTUS start_codon 104771 104773 . - 0 transcript_id "g98.t1"; gene_id "g98"; # protein sequence = [MEPILLRAIHSEVAARAADRSSTTPTVPPLPPSIPAEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGALPPLGHIYP # LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNCITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDE # WKTTFRTHYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLNVCVIVYLDDILIYSDMPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYIL # SPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYHRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKTAFTSAPILAHWEPNCPLIVETN # ASSDYAIAAILSIQYADSEIHPLAFLSRMLHAAELNYDTHNKELLAIFEAFKAWRHYLEGSGDPVDVITDHKNLEYFSTTKVLTRRQVRWSEFLHQFN # MVIRFRPGKLGEKPDSITRRWDIYPKEGDIGYAQVNPHNFRPIFTNEQLTASLQATFLEGPALRASIIMDIEALHQAIILALPADPSSVVGLELAKDP # SNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVQDYVTSCTICGRNKPCRHQPYRLLKPLPVPVR # PWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTYDTVTSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPE # TDGQTERVNQTLEQYIRIYCSYIQDDWSPLLPIAEVAYNNAPNASTGITPFFANKGYHPNITVRPEVNMKSDLARDFVVNLDELHVFLREEILLAQSR # YKEQADRKRILHPEFPIGSEVFVLAKHIHSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRWIHPVFHVSQLEPVTPNPFPNCTQSPPPPIEVD # GEEEYNIAKILDSKLDRRYKHCPLCYYIRWAGYEGTDDEFSWVAADELYADELVPAFHTRYPQKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g98 ### # start gene g99 2_related_000076F AUGUSTUS gene 112460 114879 0.84 + . g99 2_related_000076F AUGUSTUS transcript 112460 114879 0.84 + . g99.t1 2_related_000076F AUGUSTUS start_codon 112460 112462 . + 0 transcript_id "g99.t1"; gene_id "g99"; 2_related_000076F AUGUSTUS CDS 112460 113998 0.92 + 0 transcript_id "g99.t1"; gene_id "g99"; 2_related_000076F AUGUSTUS CDS 114076 114879 0.92 + 0 transcript_id "g99.t1"; gene_id "g99"; 2_related_000076F AUGUSTUS stop_codon 114877 114879 . + 0 transcript_id "g99.t1"; gene_id "g99"; # protein sequence = [MNGLGVQVRVRGDPGSGLNEVGVMPFNSSPALPTSTHTFPSIQHPIGTLNLTTTYLTSPNFRVDELESLLSSRFMSMD # TGGTKGMEFTPTLVKNQQRDSLLSSAGGSPGTRNRLASVTGASAPHSPPRDILRRPSSPPQPYAYSHSRTPSDADSIAERFVISSRTVSNPSNPTNYN # SNPPPPPINAHNYPILPITRATTTTSTSTQPPSGIAARLRRESLGNRNMVSDSYLPLTTTGSSTQPFPSSSSSISSITGGTGSSAPPTTTLLSSPMAM # RRPGLNPFKSNTLAGAGSTTSTSGSPRLTNALPGATGSGLALGAGVVSSSPLGPGSAGLTSLSSLSNLSNLPRRPSSPSSLSRPSPPSFTPSSIGPAS # NSTGSGSITIGAVGTATAPLNTATGEIAVPRKRYSSSFGHRYSSSPARGGAAMSVGSQGSQGGSGIVEGTGVSNSGAGVVVGSLGQTSVRSGMSGMSA # MSIHSGQSAGSGSTGGVGSNISGIGTGREGLVNIGRGIGATPDSAHSSTYPDFHDTLDGQDLFSHDHDDISTFVHDIDSRKPLIGRSRMYADANMSRN # DTEANEVESEDDERQRTIRVRARDDSRERLPLNPSLNPLPFSREADSPQDAPTVSRGAGSSSTRSGVVKTPPSSRRASYTGLSPPSSPLRNAIPLIAE # DEDDQIEPSANAFITTSSSAVATLATSPSSQAAPLPSVPSSADPGSSNAATGAEEGSPSSPPQHSSPMLTTASDVEARLKKMNDVFLASLQGLGGRSI # KGRNDKGKERGGSGTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g99 ### # start gene g100 2_related_000076F AUGUSTUS gene 117251 117556 0.93 + . g100 2_related_000076F AUGUSTUS transcript 117251 117556 0.93 + . g100.t1 2_related_000076F AUGUSTUS start_codon 117251 117253 . + 0 transcript_id "g100.t1"; gene_id "g100"; 2_related_000076F AUGUSTUS CDS 117251 117556 0.93 + 0 transcript_id "g100.t1"; gene_id "g100"; 2_related_000076F AUGUSTUS stop_codon 117554 117556 . + 0 transcript_id "g100.t1"; gene_id "g100"; # protein sequence = [MTNPTGQKVVPDYGRVQGISSVSIINHHPNIPLGILIGCVAAFTIIVTSVGPEHHGYEFEKHRVAFEEGGADNDAVMT # EEVPEEMDEVFAGKDDAIMVGNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g100 ### # start gene g101 2_related_000076F AUGUSTUS gene 117901 118251 0.88 - . g101 2_related_000076F AUGUSTUS transcript 117901 118251 0.88 - . g101.t1 2_related_000076F AUGUSTUS stop_codon 117901 117903 . - 0 transcript_id "g101.t1"; gene_id "g101"; 2_related_000076F AUGUSTUS CDS 117901 118251 0.88 - 0 transcript_id "g101.t1"; gene_id "g101"; 2_related_000076F AUGUSTUS start_codon 118249 118251 . - 0 transcript_id "g101.t1"; gene_id "g101"; # protein sequence = [MTANAFPSIKHFPGQEVDEGNWDAHTESSLTPSDSASRVVWSFSQGKKARPLATSTTLTVHTEESVTTAANDNGESKS # DATTESGRYSSANADLPFKIPTIMMTAATPSPPSTTVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g101 ### # start gene g102 2_related_000076F AUGUSTUS gene 133605 140408 0.7 + . g102 2_related_000076F AUGUSTUS transcript 133605 140408 0.7 + . g102.t1 2_related_000076F AUGUSTUS start_codon 133605 133607 . + 0 transcript_id "g102.t1"; gene_id "g102"; 2_related_000076F AUGUSTUS CDS 133605 140408 0.7 + 0 transcript_id "g102.t1"; gene_id "g102"; 2_related_000076F AUGUSTUS stop_codon 140406 140408 . + 0 transcript_id "g102.t1"; gene_id "g102"; # protein sequence = [MSVFKELPEGELVKLKQVLRICERKSISSPVFSCLSPHGFSEMRSNDLFKLLAKCFQRDYRYFFNMDDVTLCDKYLYG # YGSVFVDMGIQGIIFKLLMLLGYTEKLLHDIVNAIPEEYVFQSKENEDRRDKRRDSRIKRANDEFNLLHKSSSIWPQIVSHDVRMNCLYKYQQAVRYV # VPEICACCGSADQLYTGCYRSQSEWPNLSVLKVTDPLILANTPQARFTYICKDLDGLLMDKRGIHCIDIDCSLFAIYFCSECYNSLRRVSMPRLALNN # YLYRGELIEGIENITWVEEMACAIYHTSAHVARIYGSSSAGDSLQLHGNVCAHPLDICSVAKKLPWSPADLNDLITVVFVSKAKLKQHDLQKLKPYFV # RRSIIRMLLSDLCHRNRLYVGLYTLDSSMLELYPDNDLLPGLQERIVYDCDSSVNELFGVESAGFDDHPAELLVDSEQDSVLLERSGIYDAESQDVPA # RFMTASSIYNIAQSLPANNADVVLKYDKDPISEYNNPDLFPGMFPTLFPLGIGGFEDRRRSPAVSLEAHVEHLLDQSTHEFRYHHFFSFVALNVIQRR # KAHLHTSLWISSNKFSSLVPMLLSVSSSVLSDLADKLRNEKDEAEFLDEELDAFQLLKQVNIIAAKIPGSQSSKTATRNHIRSYYGYFGLPHLFLTLN # PSAVHSPVFQVMYGEEKVDLEERFPFVVHPRGERACRVAKDPVAAADFFDLMYHIVFEHLLGWDFKSGKSNVDGGLFGHLRAFFGCAELTERGCFHGH # YLLFLRGGLNPSEVHQKMHEVEGFCSQFLAFFDDIIHHHLPTVDCTVSEGYEPRIEMPPHLPDDCSNDSAMFLDWQRLFDNEHKKIGESLQRHKCRAV # CHKGRSSNSSCRFGYPHEVVQSSSFDINENSIIFSRKESDVNGHNPELLVYTRHNHDLKCILSGKAAKAAMFYISDYITKMPLSTDILLSTLSKAVSS # LTTEELDDDPVIDSKKLLHRCLTHFGRKQQIHAQQCARYLRRLGDNMFSHQTVILPSGNLVSFVKQVYKLNNGSESSNDEQGEVDIQLSLGFKDGKMF # TYSQVIDYWYRDVTLFDMCFYDFIRYVSLQVQSKSKAVNTSATRLGVLRRYKLMFGHPLHQTHELIRHTNYEQGDVGKEFVPVMIGIVPPRKHHKDYA # LFVIAHFKPFSNSHDLIQDALEVELENLALSEEHQRILCNWEEIHECADQRDAERLRKKAYFLANSVQIPDDVYSVLDNDDELSAFVLPSSLKNKSTR # SALDVQELQLLRTDLTCSAWLKEPSDRLKESILTNSNSNLNFVTLNDINVQKWINEGKTLADKVASARYSKNNVASQDCNDGAEYDLDGNIGCYGGNN # YSKVSEKNSEGCSPMQLKNKIAEEFDLNDEQLIAFEIISSMIIYREILKIPEWIAKPALVMNLTGPGGTGKTHIIRAVEKVMEYYGIEHTYRALASTG # NAASLVNGKTIHSGLNISVREYKNGRSKRPLGELDENVAIFATVKKNNSLRREWKDVCLLLIDEVSMVDSILLADIDGSLRYAKEKPDDFFGGVNVIF # CGDPFQYPPVGTPLYVPIRSSGKQTDEELMRRLGRMAWKSINTVVELHKQKRMEGDLEYAAAVGRLRLRQCNSADVDLFNSRVIKTLSNPNGVVFDTE # AQYLASIIVSKNALRRALNGYKAAAICKGINSPKLVTVVAYDQIQYKTDDQLRSKGKKLFPSAFEQAQLLAMDTSSGKLRGGLPGILNLYIGMPVILK # HENLNTELGITNGARGHLRKLELSTDSNGLVYCKYALVEFVDSKVELSGLPKGYFPIKARSWRYSTYLLNAEHKKVLVSVVRMQLPFEPLFALTGQGA # QGHTLVAILCMLHLGGYGGYVSASRPRSREGLFITKKVTLDNLNLPAIPYDLWFEARRFEVMAHNTKVVWGFDEGDLKDVPDAEGEQRFHFSKVHYEF # TAYVGKKRSYDDVENNGKEHKKLKSGNNEHNLIGNSNNIAPRGPSWDSNNWSCCFDTAFVVLYNCYVCMSPASRNLWYNQSSSKEVFAHLESLCQSNV # EYMYTSMWNMMRDTWRHEVFDVFGSGYMRHGQVLLPVSTLIQCHVSEWSNVYVEVAGICSLHNVGCRCIGSVKCYNLLSDQLEPMFSFKGAINSIQDY # VDVLYRVNESLISSDISCSSQCESTLVLGGNSTQVIAFELNGVTDIIPSFELVIPLYNTSICLRYSLNSVIYYGMNHFTATILNKSGVWSYDGQINEG # IFEYNILFNREDAMQMMELNGRKAHIFVYVLSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g102 ### # start gene g103 2_related_000076F AUGUSTUS gene 150296 150935 0.79 + . g103 2_related_000076F AUGUSTUS transcript 150296 150935 0.79 + . g103.t1 2_related_000076F AUGUSTUS start_codon 150296 150298 . + 0 transcript_id "g103.t1"; gene_id "g103"; 2_related_000076F AUGUSTUS CDS 150296 150670 0.8 + 0 transcript_id "g103.t1"; gene_id "g103"; 2_related_000076F AUGUSTUS CDS 150723 150935 0.97 + 0 transcript_id "g103.t1"; gene_id "g103"; 2_related_000076F AUGUSTUS stop_codon 150933 150935 . + 0 transcript_id "g103.t1"; gene_id "g103"; # protein sequence = [MEFVFILFFYGLVQSSVLRNFTSLDFHSRQTLYDQVEQLIAGNLELLSPLDVIMHFLNDTISGNSIPDTSTMSMQRVA # SLSDHGGLWLVDSAREVVSVAVVAQISPYADDLKCGEYLDMNVYNQEINLDSLRRASARLFFNEVSSSAEFSDEIANIYTAHSSRFQKLLNVLQEVTM # QYLDSVKAIDGKVFCKIMH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g103 ### # start gene g104 2_related_000076F AUGUSTUS gene 151661 152020 0.71 + . g104 2_related_000076F AUGUSTUS transcript 151661 152020 0.71 + . g104.t1 2_related_000076F AUGUSTUS start_codon 151661 151663 . + 0 transcript_id "g104.t1"; gene_id "g104"; 2_related_000076F AUGUSTUS CDS 151661 152020 0.71 + 0 transcript_id "g104.t1"; gene_id "g104"; 2_related_000076F AUGUSTUS stop_codon 152018 152020 . + 0 transcript_id "g104.t1"; gene_id "g104"; # protein sequence = [MRVFLHTEALRCADDIDRLAEASRLAEEARELSRREEVLRLEKTMAKAKLLTDAKKKRLEELRVKTTKNSPSTVPAKR # AAVTVSNGSLRKSKRLELKKGVVDVDVEEEETTEDMFVDLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g104 ### # start gene g105 2_related_000076F AUGUSTUS gene 162494 164158 0.94 + . g105 2_related_000076F AUGUSTUS transcript 162494 164158 0.94 + . g105.t1 2_related_000076F AUGUSTUS start_codon 162494 162496 . + 0 transcript_id "g105.t1"; gene_id "g105"; 2_related_000076F AUGUSTUS CDS 162494 164158 0.94 + 0 transcript_id "g105.t1"; gene_id "g105"; 2_related_000076F AUGUSTUS stop_codon 164156 164158 . + 0 transcript_id "g105.t1"; gene_id "g105"; # protein sequence = [MQLPNSQGYDVVLVCTDLYGKQIHALACTSSITAAGVADIYYKEIFHLHGLPLHFKSDRGPQFAAKLMQFLLARLGIK # SDLTSGYRPQSNGQTERANQEVEKYIQLYVGCRQDDWAEYIVENHLWPLLAAAGLRCSFCVRGKKEANCSVVPHLARCSNCDDKFHLAVSQVDFCREV # AIRQKQELSELRKQVDKEQKRSYEAHEELDAANARAISLWDRLEEVGESVHCYRTRAYIAQELIRKYPEDEGLYEVDLPLLSSLQEKLTASEVMLHCM # ATFAHQLHSADPANLLHHHNAYVGGLIELVITLLSRSLFHPLEQLRTVLKLALEYLSQGQFTHGKLHLRSISSLLYYYSNAADCVDGLYRDMFTHSRF # SSNKVFLTAAQHAGYVNAHPGSLEPPLHRWVFSFGHPIPLPQSPTSDHIPAVPMVDSVMLMWEGMIEAYIHEVLSYPAPPDRVPPLVEVPSSNTPLPV # TTSLVTSEARCMLGVSIPAPRRTLLFLPGSLSPTFPCSPSPIPSSPCVPDVPYKVVDLTMDDAKDLYESWEEFLARMGGVATVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g105 ### # start gene g106 2_related_000076F AUGUSTUS gene 164511 165464 0.33 - . g106 2_related_000076F AUGUSTUS transcript 164511 165464 0.33 - . g106.t1 2_related_000076F AUGUSTUS stop_codon 164511 164513 . - 0 transcript_id "g106.t1"; gene_id "g106"; 2_related_000076F AUGUSTUS CDS 164511 165464 0.33 - 0 transcript_id "g106.t1"; gene_id "g106"; 2_related_000076F AUGUSTUS start_codon 165462 165464 . - 0 transcript_id "g106.t1"; gene_id "g106"; # protein sequence = [MHNPVIDWKELYLTFQDRNVRISAALVSEIVQPGAEGGTEELEKWVNSKKIHEASSQPARKHMKELPNHLLKFLNNLQ # KLRNNLQKLHNNLLKLLLKPQDQDNWDLLLPITKFIYNNTPNFANKGYHPKLSITLEQVQEAEINKYTSNLKELLMYLQERIRTANEGYMKYANQKHQ # EAPDWKEGDQVWLNMENVKTRRPTKKLDHKWMGPYSILSQVGSHAYRLDLPGDLHKIHNVFHMDRLKPHFHNKFKRQNSPPPPIFIKVESKHFVESIL # DSKPTKGTPNEMEYLVNWEGYDNDFNSWMRWRGMAGSLELVKQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g106 ### # start gene g107 2_related_000076F AUGUSTUS gene 183928 184326 0.6 - . g107 2_related_000076F AUGUSTUS transcript 183928 184326 0.6 - . g107.t1 2_related_000076F AUGUSTUS stop_codon 183928 183930 . - 0 transcript_id "g107.t1"; gene_id "g107"; 2_related_000076F AUGUSTUS CDS 183928 184326 0.6 - 0 transcript_id "g107.t1"; gene_id "g107"; 2_related_000076F AUGUSTUS start_codon 184324 184326 . - 0 transcript_id "g107.t1"; gene_id "g107"; # protein sequence = [MLLLTTTPITDCSILCMNPPHPVTTHFNPFYLEEKTIHANVIPLPSPLSSHTDFNFNITAVKAYLECTAHSDAKGTDC # TTYSQLMSIPNDGVQDGLEHAMTEQNKVHQGQTSSYWRFPTSIRFKTKMHYLLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g107 ### # start gene g108 2_related_000076F AUGUSTUS gene 187932 189134 0.77 - . g108 2_related_000076F AUGUSTUS transcript 187932 189134 0.77 - . g108.t1 2_related_000076F AUGUSTUS stop_codon 187932 187934 . - 0 transcript_id "g108.t1"; gene_id "g108"; 2_related_000076F AUGUSTUS CDS 187932 189134 0.77 - 0 transcript_id "g108.t1"; gene_id "g108"; 2_related_000076F AUGUSTUS start_codon 189132 189134 . - 0 transcript_id "g108.t1"; gene_id "g108"; # protein sequence = [MSIIYVQHHVQVYLLPMLFMELLNHSNSSFKYNCMLYRLPVDIWWYIFTVYDIDLRPLVLVCKFMQNIVGNLVFRSVY # FPRPNKLRLAKRTWDLAKRNVTAHILFLRIGTPHESDTALDNVHFRYRRRWIASWRTASDLLSTFCRLTEVVLAGAVLPSNFGEGLSSLIHLRNLEVK # RCCCEGIAHFSNVNLPLRRLRLELMCWHDNNQDLDIICSCEQLVSLSITWHNTISQEWVWIGKRLPSTVEELSLSASQSFWSNTSLLDADIIECLFIL # LRQFPNLKALTVPKGMGCMPRNSDKQCLFGYNIKYYCGPIRFLRYIASKSTVLVDIHLVNHCFYTIRVDEDLPNDLVVENFDLNLTTWDAESIQILMK # KISSVKRLSLRWNWLPRNIVSILSSYME] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g108 ### # start gene g109 2_related_000076F AUGUSTUS gene 196155 196655 0.29 + . g109 2_related_000076F AUGUSTUS transcript 196155 196655 0.29 + . g109.t1 2_related_000076F AUGUSTUS start_codon 196155 196157 . + 0 transcript_id "g109.t1"; gene_id "g109"; 2_related_000076F AUGUSTUS CDS 196155 196655 0.29 + 0 transcript_id "g109.t1"; gene_id "g109"; 2_related_000076F AUGUSTUS stop_codon 196653 196655 . + 0 transcript_id "g109.t1"; gene_id "g109"; # protein sequence = [MCEDCLYRKAMKHAFDEVLTHETEILERVHIDLFGPARTQTHGEANYIMLCMDRKLSFQVPSYLTNKQKEARLRALHK # YRVMVEKDTGRPLRIIRIDWGGELNNRLVDAYCAEHGIIMEKVPHDSSAANGVAEQSFQIVMEGTRTLLEDADLPYISGGRPQPPSYT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g109 ### # start gene g110 2_related_000076F AUGUSTUS gene 198692 199153 0.6 + . g110 2_related_000076F AUGUSTUS transcript 198692 199153 0.6 + . g110.t1 2_related_000076F AUGUSTUS start_codon 198692 198694 . + 0 transcript_id "g110.t1"; gene_id "g110"; 2_related_000076F AUGUSTUS CDS 198692 199153 0.6 + 0 transcript_id "g110.t1"; gene_id "g110"; 2_related_000076F AUGUSTUS stop_codon 199151 199153 . + 0 transcript_id "g110.t1"; gene_id "g110"; # protein sequence = [MSTSRTITTTTQKSPTAGPSRSRPAPPPPIDLTVPEESREDDDDDVEEDDDEAIRRAEEKVRRMKARKAAAAAKKKAE # EEAARKAAEEAQRKKEEAARELEERRRRMAEAATARSRRGSSPGGSSVSPQRPVVEIRKDKGKGKGKAQVSTDTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g110 ### # start gene g111 2_related_000076F AUGUSTUS gene 200158 203721 1 - . g111 2_related_000076F AUGUSTUS transcript 200158 203721 1 - . g111.t1 2_related_000076F AUGUSTUS stop_codon 200158 200160 . - 0 transcript_id "g111.t1"; gene_id "g111"; 2_related_000076F AUGUSTUS CDS 200158 203721 1 - 0 transcript_id "g111.t1"; gene_id "g111"; 2_related_000076F AUGUSTUS start_codon 203719 203721 . - 0 transcript_id "g111.t1"; gene_id "g111"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHFDSPQTSVPSAVNTVDAKVAV # PLPELSPSVSPTILETPPGDSFRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSATPAVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVCDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWNSISMDFIEQLPMSNGFTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g111 ### # start gene g112 2_related_000076F AUGUSTUS gene 204054 205745 1 - . g112 2_related_000076F AUGUSTUS transcript 204054 205745 1 - . g112.t1 2_related_000076F AUGUSTUS stop_codon 204054 204056 . - 0 transcript_id "g112.t1"; gene_id "g112"; 2_related_000076F AUGUSTUS CDS 204054 205745 1 - 0 transcript_id "g112.t1"; gene_id "g112"; 2_related_000076F AUGUSTUS start_codon 205743 205745 . - 0 transcript_id "g112.t1"; gene_id "g112"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPDGPGGPGGPGGPGGPGGPRSPNSPDIPNEQRAMLDLLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGVYDAQGEAEDALGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLAAYRLEVLRIDNRYWKREETKKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSANSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g112 ### # start gene g113 2_related_000076F AUGUSTUS gene 215158 215733 0.83 + . g113 2_related_000076F AUGUSTUS transcript 215158 215733 0.83 + . g113.t1 2_related_000076F AUGUSTUS start_codon 215158 215160 . + 0 transcript_id "g113.t1"; gene_id "g113"; 2_related_000076F AUGUSTUS CDS 215158 215733 0.83 + 0 transcript_id "g113.t1"; gene_id "g113"; 2_related_000076F AUGUSTUS stop_codon 215731 215733 . + 0 transcript_id "g113.t1"; gene_id "g113"; # protein sequence = [MISDEDPNTLKKASRTVHDNDRESAMYTYGTEVGKKSQNYAASDEESFIGIVDSGQNEQMENAEDSPSSEDDNPDPWV # AAGTQCRAFSLDSSSNQNNSQKRKMILKLKRPQTVISIQRIALMGTNSIAKAKTTVNLIMNPAVTISMRTMNQMTPATLIIPGIHTNIICHNNCQRLV # LVTGVTRCHTQENLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g113 ### # start gene g114 2_related_000076F AUGUSTUS gene 216913 217461 0.93 + . g114 2_related_000076F AUGUSTUS transcript 216913 217461 0.93 + . g114.t1 2_related_000076F AUGUSTUS start_codon 216913 216915 . + 0 transcript_id "g114.t1"; gene_id "g114"; 2_related_000076F AUGUSTUS CDS 216913 217461 0.93 + 0 transcript_id "g114.t1"; gene_id "g114"; 2_related_000076F AUGUSTUS stop_codon 217459 217461 . + 0 transcript_id "g114.t1"; gene_id "g114"; # protein sequence = [MQAPPIDQQLFDPFMCEDNLSINGLDKLTTEGQGLYQELGKKHWTEKHVERKDWKKEYQTKVSMREEASSPGSSHEAR # GPSGSVVHPSTPRDSTISTASKITSHTDQTHLPHPTHTSFEVSYSPIIISSGPNPFLLIDVLATEETPVLTNEPTHNSCTQSFDNDLPDPCVGLQPDR # SRYPWH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g114 ### # start gene g115 2_related_000076F AUGUSTUS gene 222840 223817 0.99 + . g115 2_related_000076F AUGUSTUS transcript 222840 223817 0.99 + . g115.t1 2_related_000076F AUGUSTUS start_codon 222840 222842 . + 0 transcript_id "g115.t1"; gene_id "g115"; 2_related_000076F AUGUSTUS CDS 222840 223817 0.99 + 0 transcript_id "g115.t1"; gene_id "g115"; 2_related_000076F AUGUSTUS stop_codon 223815 223817 . + 0 transcript_id "g115.t1"; gene_id "g115"; # protein sequence = [MAEHIDFDPAKIPAPDFAGEAYAFMRIALMADANTPEVTTNELAVQCLKDQWEAHIEGLRTQYQAQLQEAEALREQRG # QEAAEAEKLAEADRLEKEKELSKETEKKRLPIYSFQKGLGVDSIPLQLHPYAKKMMTARKYVPLWYFLPDAAADARERSKESLPSAIRSGGGCPLAGS # TVSLVGSHSVRASPNAIPDSQLSWPQVMRAKSAFLNALQLGAWPDTFIVMFAGFYSNMDMHRELQEQDGDRVMAHYHAEMRLAWYDAMERKDPFDLSI # ISDGVLRESRLQIVKQKQEKSLKGTSFPPTPRDRTYLTASPRLHNNSSTTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g115 ### # start gene g116 2_related_000076F AUGUSTUS gene 225624 226490 1 + . g116 2_related_000076F AUGUSTUS transcript 225624 226490 1 + . g116.t1 2_related_000076F AUGUSTUS start_codon 225624 225626 . + 0 transcript_id "g116.t1"; gene_id "g116"; 2_related_000076F AUGUSTUS CDS 225624 226490 1 + 0 transcript_id "g116.t1"; gene_id "g116"; 2_related_000076F AUGUSTUS stop_codon 226488 226490 . + 0 transcript_id "g116.t1"; gene_id "g116"; # protein sequence = [MAANFSTRDISITHWQFFTDSASSVDAIFDTSPTPGQIYCSNFYYKVVDFLDSDPSHTVEVAWVPNHLGIQGNEHADF # LAKAGTEQKNEALWNRSLSNARWMNKVRAEREWKKLWEARPIQGRFAIANQIPPSLKPTARLKDTPRELFGRLMQCRTGHAYIGEYYAQFVPNENVNC # PCGEELQTREHILRACPRYEDHRQILQKASEDICLKDILGTSEGIEALTEFLDESGAFTRTGRPRTTPTEPSYTPLEIWEEITFHEMEEENGTLEADW # CEETVDSTNEGTEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g116 ### # start gene g117 2_related_000076F AUGUSTUS gene 227399 229390 0.99 + . g117 2_related_000076F AUGUSTUS transcript 227399 229390 0.99 + . g117.t1 2_related_000076F AUGUSTUS start_codon 227399 227401 . + 0 transcript_id "g117.t1"; gene_id "g117"; 2_related_000076F AUGUSTUS CDS 227399 229390 0.99 + 0 transcript_id "g117.t1"; gene_id "g117"; 2_related_000076F AUGUSTUS stop_codon 229388 229390 . + 0 transcript_id "g117.t1"; gene_id "g117"; # protein sequence = [MPTLTPAAALALAYTSAVSGEPIASSQDGEAGTKNATSDVLKQSGSTSLSSSSLEKLPQETSTKSGETMKEWWKDGGT # GGAETEPRIIYSDAFTKSLHQAISESIPATSRALTTQQIHSLAAPVAERNTFSQRLTSPNTSRASSLITTHPSPQPNAVSTALLNALLTKLNQDDPLH # DRLMTNGTQKKKDDYLPPSKILGSRPATSKYPIDTTLPVNNLATHNVRSYPVNLTPVHSSLRPHCAARERLVQWKPAGKRSFQDSTGLPLVLPDEFVD # RIQHVLTNGYVESTLETYASGLLSFHIFCDSRNIPEAQRAPCSSDLLNAWISTMAGHYAGTSVKNYVHGVRAWHIIHGVQWKTDKNSFDTMIHGAERL # QPERSRRKKRMPFTHEYIAKLLEDFNTSDPFDAACGACLTTSFYCAARVGELPVPNLKDFTPDKYITSAHVRKARDRNGFETTILHIPHTKSNQLEGE # DIYFSKQLGSTDPESLFLNHLAVNKPSPTEHLFAYQHKTDRRPLTKHAFLQRINKTAKNLGLPILQGHGIPIGATFEYLLRGIPFDAVRVIGRWKSDA # FLLYLRKHAEIMAPYLQPELHQELIRYTMPPVRCECSPPIWVSTVAGCVVHSYTLGIATDREHFLSGISLPLGPEGLRPSPNVQSSQTTHIYIGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g117 ### # start gene g118 2_related_000076F AUGUSTUS gene 231198 231527 1 - . g118 2_related_000076F AUGUSTUS transcript 231198 231527 1 - . g118.t1 2_related_000076F AUGUSTUS stop_codon 231198 231200 . - 0 transcript_id "g118.t1"; gene_id "g118"; 2_related_000076F AUGUSTUS CDS 231198 231527 1 - 0 transcript_id "g118.t1"; gene_id "g118"; 2_related_000076F AUGUSTUS start_codon 231525 231527 . - 0 transcript_id "g118.t1"; gene_id "g118"; # protein sequence = [MSDDGNDSFVENSSNEGSLDEADSSEVSLEDDISSPKSKKIQVKKKAAPSSSSATENDMDVDEDFQSSANGKLKAEGD # GNRSAKKQRVDTDPWKLVSSKLYRDWTPHAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g118 ### # start gene g119 2_related_000076F AUGUSTUS gene 234452 234769 0.94 - . g119 2_related_000076F AUGUSTUS transcript 234452 234769 0.94 - . g119.t1 2_related_000076F AUGUSTUS stop_codon 234452 234454 . - 0 transcript_id "g119.t1"; gene_id "g119"; 2_related_000076F AUGUSTUS CDS 234452 234769 0.94 - 0 transcript_id "g119.t1"; gene_id "g119"; 2_related_000076F AUGUSTUS start_codon 234767 234769 . - 0 transcript_id "g119.t1"; gene_id "g119"; # protein sequence = [MYDSTVWNLSQNVDRTIGSNKVDVCPCVTPPMFPYITGCGGPIVGLEALSTQGIPVDRMLLIRKVENQLVDLARNVMS # TTVVGVYIIGSMVIGLRHFKKGDEEAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g119 ### # start gene g120 2_related_000076F AUGUSTUS gene 241681 242679 0.17 - . g120 2_related_000076F AUGUSTUS transcript 241681 242679 0.17 - . g120.t1 2_related_000076F AUGUSTUS stop_codon 241681 241683 . - 0 transcript_id "g120.t1"; gene_id "g120"; 2_related_000076F AUGUSTUS CDS 241681 242009 0.64 - 2 transcript_id "g120.t1"; gene_id "g120"; 2_related_000076F AUGUSTUS CDS 242166 242527 0.35 - 1 transcript_id "g120.t1"; gene_id "g120"; 2_related_000076F AUGUSTUS CDS 242633 242679 0.42 - 0 transcript_id "g120.t1"; gene_id "g120"; 2_related_000076F AUGUSTUS start_codon 242677 242679 . - 0 transcript_id "g120.t1"; gene_id "g120"; # protein sequence = [MSDSPTNNIPDSQHVRPSADQNHESCINEEYKSNAHYEYGFRATYPEWQPMFDYYSNQKLTTRPSNENKNDSIVSTSA # SSNSSVDRNHSSLSFCDYREEVDEDVVHPNMHPTPSSNLLEGPPLYHKCVSVGFSSNQREQHLHESRTQLEVLDRSNDAYNYDRQTPDMRRKPLPSYL # NIPNMYDNKCSQSFENVIGYVIDPFSHKSLFDMKNRSCLTSNDSRVSTQSDNVLGCEPSADEGDQVYTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g120 ### # # ----- prediction on sequence number 7 (length = 82485, name = 2_related_000124F) ----- # # Predicted genes for sequence number 7 on both strands # start gene g121 2_related_000124F AUGUSTUS gene 275 2907 0.52 - . g121 2_related_000124F AUGUSTUS transcript 275 2907 0.52 - . g121.t1 2_related_000124F AUGUSTUS stop_codon 275 277 . - 0 transcript_id "g121.t1"; gene_id "g121"; 2_related_000124F AUGUSTUS CDS 275 1525 0.67 - 0 transcript_id "g121.t1"; gene_id "g121"; 2_related_000124F AUGUSTUS CDS 1582 2907 0.65 - 0 transcript_id "g121.t1"; gene_id "g121"; 2_related_000124F AUGUSTUS start_codon 2905 2907 . - 0 transcript_id "g121.t1"; gene_id "g121"; # protein sequence = [MSPTPTRPFSRTPSPLLPPLTALGEVPSPAPESDGEVEADQLAFTIESPSRPQLQLFETVFNTGKSLSAYCQDDPLWP # ILAEVASPCTNCLKTPGKCKVLPSSPRCTNCSSKKTCSLGKILRFRYFARRCNQDLAYSRRFLELHGTPAHKSTWGIPLTAWREYDSALHARTSSTSI # LLELNMLDEQDAVDADQQELQQFMTLQRDEAAVAAKRKRNRSPKPVAGPSSKKIRSDAPKTDAPKKRSRRKSPAVEVNVEPFRRVRLVVPPVRSVAPT # SLPVPPPSSPSLMGVLNRDLPMQGPSDLVRLADAAEVHPGLVQQAGSSSPVRTPIKGTGQDLLSSTMPPILRPALVPRNPASHPYRAENQRLAARVRL # LEAQLADSQRENSSLTSALRDTSHALESRQREVEQLRSSSQEFLQRQEEYRHIIDQFNTLDRALSGPSDQSLLERFQKVEEELRITRKDRDDATGKLS # TSSRRISELTTALLYQHGITDEGNALSTRQRARLEELQEEVHRTRGRAAFVERMIKEYPDEGYYEVVLPPLSQLEGDLVKVRADLRRVATLAHRLYRS # DPATVLHHHNRYIGAIIEAVVAFLRRALETEDPDIMEHNIRLALDYMQTARGVHGDLHIRSTSSIQWFFNNAVDQDEGLYTLMLENSRFDSDRPFLTA # AQHAGFTSPPPDSLEPPLHRRMLSLSTALPHRGGAGRWDDLVPAIPSDDQLTQDWEQLMLQYMHHITDTPLPVPDPPVPMSSTGPVPESSDETNVEQS # FEAPIVPVSSPSGGSHPPVPLFLSEQESPTSPSPPPRSSVPPLLFGSVASLSIDLTGDDDELYETEEAYASRIDVAMEGTELAVDQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g121 ### # start gene g122 2_related_000124F AUGUSTUS gene 4128 5738 0.95 - . g122 2_related_000124F AUGUSTUS transcript 4128 5738 0.95 - . g122.t1 2_related_000124F AUGUSTUS stop_codon 4128 4130 . - 0 transcript_id "g122.t1"; gene_id "g122"; 2_related_000124F AUGUSTUS CDS 4128 5738 0.95 - 0 transcript_id "g122.t1"; gene_id "g122"; 2_related_000124F AUGUSTUS start_codon 5736 5738 . - 0 transcript_id "g122.t1"; gene_id "g122"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFATRNHVKCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDVILGLPWLRKVNPEIDWEKGRLSVRPPRVAIEEVPDEEIPYSHRTAANTESPIPEIPN # LEPPTEPSQIEMPLEATLEESESAVEEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLIPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPRVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSSDLQEHRRV # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRNWPAPTNLRDVRPGSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g122 ### # start gene g123 2_related_000124F AUGUSTUS gene 5789 6964 1 - . g123 2_related_000124F AUGUSTUS transcript 5789 6964 1 - . g123.t1 2_related_000124F AUGUSTUS stop_codon 5789 5791 . - 0 transcript_id "g123.t1"; gene_id "g123"; 2_related_000124F AUGUSTUS CDS 5789 6964 1 - 0 transcript_id "g123.t1"; gene_id "g123"; 2_related_000124F AUGUSTUS start_codon 6962 6964 . - 0 transcript_id "g123.t1"; gene_id "g123"; # protein sequence = [MSTPVPPTTPAPPTSAEDLMTQLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS # QAKLIKSALGFFTESAGDWATPHLLHFNAEHPPFGGDWEEFLKEFVQRFESVDPGMEARSEIKNLKQVKGQTVAEFAQKFKDIGDRTGMSDIDLRERF # FTALLPEIRQNLIIVNIAQGLAPTLKEAIKRAISVDVYMHDPTMTGRNSGHAPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQG # HVKQNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPTPFSLFPNESVQIASSIPTSAPATVPAIPSPPNQDFSNQIGQIRE # LLDRANAMSSSSSGLQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g123 ### # start gene g124 2_related_000124F AUGUSTUS gene 12597 14279 0.97 + . g124 2_related_000124F AUGUSTUS transcript 12597 14279 0.97 + . g124.t1 2_related_000124F AUGUSTUS start_codon 12597 12599 . + 0 transcript_id "g124.t1"; gene_id "g124"; 2_related_000124F AUGUSTUS CDS 12597 14279 0.97 + 0 transcript_id "g124.t1"; gene_id "g124"; 2_related_000124F AUGUSTUS stop_codon 14277 14279 . + 0 transcript_id "g124.t1"; gene_id "g124"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLFTSDGQP # VQVLTPRRGQPPVVAPARGRSTTQIDSPILQAIARRTGKQPQRRAASESPCDPPPHFNLDTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPRSSNSPDIPNEQRAMLDLLSGFKVSMETLGSVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRP # KYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGVYDAQGEAEDALGNLKMKETENIRKYNIRFNTLAASTNWDSAA # LKWAYGRGLAERIKDEMARLPEPATLAAYRLEVLRIDNRYWKREETKKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPLTQKPKPFSGGK # PNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g124 ### # start gene g125 2_related_000124F AUGUSTUS gene 14612 18175 0.99 + . g125 2_related_000124F AUGUSTUS transcript 14612 18175 0.99 + . g125.t1 2_related_000124F AUGUSTUS start_codon 14612 14614 . + 0 transcript_id "g125.t1"; gene_id "g125"; 2_related_000124F AUGUSTUS CDS 14612 18175 0.99 + 0 transcript_id "g125.t1"; gene_id "g125"; 2_related_000124F AUGUSTUS stop_codon 18173 18175 . + 0 transcript_id "g125.t1"; gene_id "g125"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHFDSPQTSVPSAINTVVAKVAV # PLPEPSPSVSPTILETPPGDSPRSRSRSRSRTSRAKPLLSKFPFEPIYSYPMVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTAPTVPPLPLSIPAEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHQEHVKEVLRRLRHHRLYANPEKYEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPIPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRHWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHWPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFCKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # TYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRFTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g125 ### # start gene g126 2_related_000124F AUGUSTUS gene 19232 19591 0.75 - . g126 2_related_000124F AUGUSTUS transcript 19232 19591 0.75 - . g126.t1 2_related_000124F AUGUSTUS stop_codon 19232 19234 . - 0 transcript_id "g126.t1"; gene_id "g126"; 2_related_000124F AUGUSTUS CDS 19232 19591 0.75 - 0 transcript_id "g126.t1"; gene_id "g126"; 2_related_000124F AUGUSTUS start_codon 19589 19591 . - 0 transcript_id "g126.t1"; gene_id "g126"; # protein sequence = [MSTSRTTTITTNPSTAGPSRSRPVPPPPIDLTAHEEEDLEDEDEDEIIRRAQARVERVRARKAAEAAKKAAEEKAARA # AAAQEKAAKEARERARRAQQQEEEAVGRGGDSSKSEGDLPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g126 ### # start gene g127 2_related_000124F AUGUSTUS gene 22275 22742 0.71 + . g127 2_related_000124F AUGUSTUS transcript 22275 22742 0.71 + . g127.t1 2_related_000124F AUGUSTUS start_codon 22275 22277 . + 0 transcript_id "g127.t1"; gene_id "g127"; 2_related_000124F AUGUSTUS CDS 22275 22742 0.71 + 0 transcript_id "g127.t1"; gene_id "g127"; 2_related_000124F AUGUSTUS stop_codon 22740 22742 . + 0 transcript_id "g127.t1"; gene_id "g127"; # protein sequence = [MAAEDAGEFLDDGEIEFEDEDEGVNEEVKQEACAESVFAIDPFNNSPSMSRNNKKYAKLTKRSRKKRAAEAVKRIASR # GIKPFVVELAKGALPLELEDFDASTLPVSSSGWNANPRKKLSPGLQRVWKDLEVLSSLNGLKLLRWDGQCVYHFLQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g127 ### # start gene g128 2_related_000124F AUGUSTUS gene 25666 29382 0.96 - . g128 2_related_000124F AUGUSTUS transcript 25666 29382 0.96 - . g128.t1 2_related_000124F AUGUSTUS stop_codon 25666 25668 . - 0 transcript_id "g128.t1"; gene_id "g128"; 2_related_000124F AUGUSTUS CDS 25666 29382 0.96 - 0 transcript_id "g128.t1"; gene_id "g128"; 2_related_000124F AUGUSTUS start_codon 29380 29382 . - 0 transcript_id "g128.t1"; gene_id "g128"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISLPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # NTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMQS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g128 ### # start gene g129 2_related_000124F AUGUSTUS gene 29433 30599 0.88 - . g129 2_related_000124F AUGUSTUS transcript 29433 30599 0.88 - . g129.t1 2_related_000124F AUGUSTUS stop_codon 29433 29435 . - 0 transcript_id "g129.t1"; gene_id "g129"; 2_related_000124F AUGUSTUS CDS 29433 30599 0.88 - 0 transcript_id "g129.t1"; gene_id "g129"; 2_related_000124F AUGUSTUS start_codon 30597 30599 . - 0 transcript_id "g129.t1"; gene_id "g129"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPMHTAHTTSADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g129 ### # start gene g130 2_related_000124F AUGUSTUS gene 32254 32817 0.93 - . g130 2_related_000124F AUGUSTUS transcript 32254 32817 0.93 - . g130.t1 2_related_000124F AUGUSTUS stop_codon 32254 32256 . - 0 transcript_id "g130.t1"; gene_id "g130"; 2_related_000124F AUGUSTUS CDS 32254 32817 0.93 - 0 transcript_id "g130.t1"; gene_id "g130"; 2_related_000124F AUGUSTUS start_codon 32815 32817 . - 0 transcript_id "g130.t1"; gene_id "g130"; # protein sequence = [MALLPQPVSTLIPDHSSSIQASCLGISSVQAGCFTPSQLLVPPVLPHVSAPSPFGLSQNFSNGAVVPPPIVNAGAASS # MQKERSDEVTIGHGQVIYYKYREVREPRQISFVTDIAWLDRVWDDEQPNWDPVDCGSLLEINGAPIALKYWKQVFSRKHDGAWSWFKRLWVEWKVGIV # YIQQFFVYDFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g130 ### # start gene g131 2_related_000124F AUGUSTUS gene 38512 39050 0.44 - . g131 2_related_000124F AUGUSTUS transcript 38512 39050 0.44 - . g131.t1 2_related_000124F AUGUSTUS stop_codon 38512 38514 . - 0 transcript_id "g131.t1"; gene_id "g131"; 2_related_000124F AUGUSTUS CDS 38512 38736 0.47 - 0 transcript_id "g131.t1"; gene_id "g131"; 2_related_000124F AUGUSTUS CDS 38793 39050 0.85 - 0 transcript_id "g131.t1"; gene_id "g131"; 2_related_000124F AUGUSTUS start_codon 39048 39050 . - 0 transcript_id "g131.t1"; gene_id "g131"; # protein sequence = [MTTIGGIDLSGSGIPSLVLRDLSEFATLPFLAAFDIPPDPKSSTPSKRITYIALAKKTMPKLVELCLQFKDRLELYSE # GTIEAVLSAYSIPVKLKYDCPSPSKHGKDPPLWKTATTCFLRIVKECAPQVIAFDEGRLPDLQYISFAERSTYTFRDIRRAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g131 ### # start gene g132 2_related_000124F AUGUSTUS gene 39217 41601 0.47 - . g132 2_related_000124F AUGUSTUS transcript 39217 41601 0.47 - . g132.t1 2_related_000124F AUGUSTUS stop_codon 39217 39219 . - 0 transcript_id "g132.t1"; gene_id "g132"; 2_related_000124F AUGUSTUS CDS 39217 41601 0.47 - 0 transcript_id "g132.t1"; gene_id "g132"; 2_related_000124F AUGUSTUS start_codon 41599 41601 . - 0 transcript_id "g132.t1"; gene_id "g132"; # protein sequence = [MTNVAGMLGLTTPRDAFFTSLAKFSVPTRVVSSLDSYTDPQTPRSATTSFSENLGLSLSGSTGSTSPGLSERNLACLK # VLISSSMFLAGSLGESWFGILEVLQNADYVLTSKGIAYGAQTPGSKGGAFSPGRGGHTTPSRSVSMALSSSGSGLGLSSAAVSSSQQPSPRHPLLSDL # DPEMMLTAIQRLFDASKNLEDGAFKFFTDALCKLSAEMIGMQTGTADGLGLEVIAETGSVEELSSLDGVVLSPPAPSIADTPHRRRVSGIHLPRTLVR # CSLFRFLSYINIVVYSQRSGDFGINKLGGVISQNIHRLVYRPPEVAWTTITTHLLSVIRLPTAPPPIRIQAARVLDDILITVPRNLGTAGELQAQVQQ # RVLEVLSYQVIPDYTSLPGAATANVGTTVELRRMGLETLHEILQVSGHTLIVGWETIFSMLESVCRPPPPTKSGSVDSTIAIPTASPPRAKPILLGLG # VPSEKNYTTLIKIAFQSLNLVCDSVSELSPEHLRLCISTLGQFGRQANTNIALTAAASLLWSVSDAIQAKRKDAEKEPEYSALWMFLLLEVLGLCSDD # RPEVRDGAIQTLFRTMQLYGASLSLQTWDECIWKVTFPLVESLSTEIHRRSALVEPFDGAGAGEQAWDESKILAFNSIGSIFHDFLSSKLVHLESFHS # AWDTFVTRIQESVLLDNRSISTPALRCLEKAVKASSASIFDVRQKVVEMKERIWIAIDAVGSAILRRRNGAQSPSLDSAILPNPFTQECLVAFVDVIQ # STRDLSRALEGADWPLERITRLMVILKGAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g132 ### # start gene g133 2_related_000124F AUGUSTUS gene 42003 42365 0.61 - . g133 2_related_000124F AUGUSTUS transcript 42003 42365 0.61 - . g133.t1 2_related_000124F AUGUSTUS stop_codon 42003 42005 . - 0 transcript_id "g133.t1"; gene_id "g133"; 2_related_000124F AUGUSTUS CDS 42003 42365 0.61 - 0 transcript_id "g133.t1"; gene_id "g133"; 2_related_000124F AUGUSTUS start_codon 42363 42365 . - 0 transcript_id "g133.t1"; gene_id "g133"; # protein sequence = [MFASSWNSLCSDAELMRSVWDRYDAQEHGSNALSTLITALKRLVTEKPALLGVGSQMFGVGVSSNNDSHYALSPSGSA # YSLDGVAGMVATAASATVSNVVGMMGSNAGLSLQGSTMKLQW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g133 ### # start gene g134 2_related_000124F AUGUSTUS gene 45159 46829 0.43 - . g134 2_related_000124F AUGUSTUS transcript 45159 46829 0.43 - . g134.t1 2_related_000124F AUGUSTUS stop_codon 45159 45161 . - 0 transcript_id "g134.t1"; gene_id "g134"; 2_related_000124F AUGUSTUS CDS 45159 46173 0.74 - 1 transcript_id "g134.t1"; gene_id "g134"; 2_related_000124F AUGUSTUS CDS 46292 46405 0.74 - 1 transcript_id "g134.t1"; gene_id "g134"; 2_related_000124F AUGUSTUS CDS 46753 46829 0.51 - 0 transcript_id "g134.t1"; gene_id "g134"; 2_related_000124F AUGUSTUS start_codon 46827 46829 . - 0 transcript_id "g134.t1"; gene_id "g134"; # protein sequence = [MTTSSSISLNLKVYFPIIVSNDTRFVLEAMLSGAGVEEGGLSAFDGLNDPLEINEDIIGSNSDGDDHHSFDAHQDREA # FLAITRDANAEVVVEGEDSIWRDLEHFAATGEFPQHLIQEGSNDQQSVRTGTSAPAHVVDDHDASRSQSQSGIPNQIEVSDDSTDSLFGDSPVAVSPE # LEADAPLGEYPASAEPNSNDLNVNIDAFLTMMQSHQMSNGPSLNMEEEHRPNGSVHMGGQQVMNEPQTIPELRFSPTNTPPEPFPITPPGAVTRTGFA # NDSILQGYQPFTANTRRGEKRKRLEEEFMPTSNHNHDDGDLHGMGSSIMHGYVDSLQIHSGARLRIILDRTMQQLSLCLLTSLQAPLEALTPALASFT # LLDWLQLSPSQTSELLTSLLRPQFSKHRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g134 ### # start gene g135 2_related_000124F AUGUSTUS gene 49037 49405 0.78 + . g135 2_related_000124F AUGUSTUS transcript 49037 49405 0.78 + . g135.t1 2_related_000124F AUGUSTUS start_codon 49037 49039 . + 0 transcript_id "g135.t1"; gene_id "g135"; 2_related_000124F AUGUSTUS CDS 49037 49405 0.78 + 0 transcript_id "g135.t1"; gene_id "g135"; 2_related_000124F AUGUSTUS stop_codon 49403 49405 . + 0 transcript_id "g135.t1"; gene_id "g135"; # protein sequence = [MLAIATASLLLASTAFAQSTTTFPDGVVATGTMGVTNPPEPTTGTAINQTSFSRLLSINSVDDWCIFAPPESQDIADS # ETIEVAWCTQQRNDARVIPDGTISGVSLLKTGSFFVSVLFHREN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g135 ### # start gene g136 2_related_000124F AUGUSTUS gene 49445 50224 0.79 + . g136 2_related_000124F AUGUSTUS transcript 49445 50224 0.79 + . g136.t1 2_related_000124F AUGUSTUS start_codon 49445 49447 . + 0 transcript_id "g136.t1"; gene_id "g136"; 2_related_000124F AUGUSTUS CDS 49445 50224 0.79 + 0 transcript_id "g136.t1"; gene_id "g136"; 2_related_000124F AUGUSTUS stop_codon 50222 50224 . + 0 transcript_id "g136.t1"; gene_id "g136"; # protein sequence = [MGYGDLTQINIPSGDWGGELDPHGAYGSGNPIGGNVTTNMTIDGETINVAEWMLYVSYEQFCFRACTWANSTYSAAAM # CWHELDEMGCEFVMPGNYDFNGTFETCEADVAYPPGWYVEGSSDGTTSFSSFAQYWTGVVDGVTYTQGDLVTPSTVQSTPSSSNCQTVATISNGIDLA # SLGVTGAATATGSGATATATGSAATATGTAGAASGSSSGSTTAAASSSSNAATSGARVFQAGMSEGLTVLSMISAIAAIAVFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g136 ### # start gene g137 2_related_000124F AUGUSTUS gene 65658 66363 0.39 + . g137 2_related_000124F AUGUSTUS transcript 65658 66363 0.39 + . g137.t1 2_related_000124F AUGUSTUS start_codon 65658 65660 . + 0 transcript_id "g137.t1"; gene_id "g137"; 2_related_000124F AUGUSTUS CDS 65658 65868 0.45 + 0 transcript_id "g137.t1"; gene_id "g137"; 2_related_000124F AUGUSTUS CDS 65927 66363 0.76 + 2 transcript_id "g137.t1"; gene_id "g137"; 2_related_000124F AUGUSTUS stop_codon 66361 66363 . + 0 transcript_id "g137.t1"; gene_id "g137"; # protein sequence = [MMRLAPSKDLDVFASLRGKVSPAVTSKITTPSPPLEIKPSTPAPKAPVAPPRLIRRNRELENLKTDASSFLASPRSAR # SKDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRSRKVAPAASKGKARQIVVTDEDSASNEVESED # EDEEEDSAPPPKRLKTTSSISGKVYSSFISFYFTNLMGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g137 ### # start gene g138 2_related_000124F AUGUSTUS gene 67275 67619 0.6 + . g138 2_related_000124F AUGUSTUS transcript 67275 67619 0.6 + . g138.t1 2_related_000124F AUGUSTUS start_codon 67275 67277 . + 0 transcript_id "g138.t1"; gene_id "g138"; 2_related_000124F AUGUSTUS CDS 67275 67619 0.6 + 0 transcript_id "g138.t1"; gene_id "g138"; 2_related_000124F AUGUSTUS stop_codon 67617 67619 . + 0 transcript_id "g138.t1"; gene_id "g138"; # protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGAS # SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g138 ### # start gene g139 2_related_000124F AUGUSTUS gene 69373 70151 0.24 + . g139 2_related_000124F AUGUSTUS transcript 69373 70151 0.24 + . g139.t1 2_related_000124F AUGUSTUS start_codon 69373 69375 . + 0 transcript_id "g139.t1"; gene_id "g139"; 2_related_000124F AUGUSTUS CDS 69373 69399 0.24 + 0 transcript_id "g139.t1"; gene_id "g139"; 2_related_000124F AUGUSTUS CDS 69506 69641 0.85 + 0 transcript_id "g139.t1"; gene_id "g139"; 2_related_000124F AUGUSTUS CDS 69724 70151 1 + 2 transcript_id "g139.t1"; gene_id "g139"; 2_related_000124F AUGUSTUS stop_codon 70149 70151 . + 0 transcript_id "g139.t1"; gene_id "g139"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAVNDVPPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERA # TTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g139 ### # start gene g140 2_related_000124F AUGUSTUS gene 70412 72238 1 - . g140 2_related_000124F AUGUSTUS transcript 70412 72238 1 - . g140.t1 2_related_000124F AUGUSTUS stop_codon 70412 70414 . - 0 transcript_id "g140.t1"; gene_id "g140"; 2_related_000124F AUGUSTUS CDS 70412 72238 1 - 0 transcript_id "g140.t1"; gene_id "g140"; 2_related_000124F AUGUSTUS start_codon 72236 72238 . - 0 transcript_id "g140.t1"; gene_id "g140"; # protein sequence = [MANKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIR # RNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLSEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQP # DQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKY # IIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGD # ISKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKY # RHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTILKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLM # VEDEDEYWMTPENDYIFDAIPRLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g140 ### # start gene g141 2_related_000124F AUGUSTUS gene 72612 74813 0.19 - . g141 2_related_000124F AUGUSTUS transcript 72612 74813 0.19 - . g141.t1 2_related_000124F AUGUSTUS stop_codon 72612 72614 . - 0 transcript_id "g141.t1"; gene_id "g141"; 2_related_000124F AUGUSTUS CDS 72612 74132 0.81 - 0 transcript_id "g141.t1"; gene_id "g141"; 2_related_000124F AUGUSTUS CDS 74216 74351 0.63 - 1 transcript_id "g141.t1"; gene_id "g141"; 2_related_000124F AUGUSTUS CDS 74445 74701 0.23 - 0 transcript_id "g141.t1"; gene_id "g141"; 2_related_000124F AUGUSTUS CDS 74799 74813 0.65 - 0 transcript_id "g141.t1"; gene_id "g141"; 2_related_000124F AUGUSTUS start_codon 74811 74813 . - 0 transcript_id "g141.t1"; gene_id "g141"; # protein sequence = [MKNRQQNIVLDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQ # LNNDQFNLNPIKSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRIATKERKAQDSKDKKENVQADILNEPPTNKLEERIKLNQQD # RSPINLIDETNKQVDSEAIGVEKPIKLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFAPTGRYTEERKEIIDKNHPE # GFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGK # SLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIP # HVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWP # PCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINLIGMFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g141 ### # # ----- prediction on sequence number 8 (length = 49501, name = 2_related_000157F) ----- # # Predicted genes for sequence number 8 on both strands # start gene g142 2_related_000157F AUGUSTUS gene 193 2874 0.81 + . g142 2_related_000157F AUGUSTUS transcript 193 2874 0.81 + . g142.t1 2_related_000157F AUGUSTUS start_codon 193 195 . + 0 transcript_id "g142.t1"; gene_id "g142"; 2_related_000157F AUGUSTUS CDS 193 2874 0.81 + 0 transcript_id "g142.t1"; gene_id "g142"; 2_related_000157F AUGUSTUS stop_codon 2872 2874 . + 0 transcript_id "g142.t1"; gene_id "g142"; # protein sequence = [MSEAHTPSTRSTNSTSTIIRTPTSPSRTSRVGTTTTDTGNGKKLKKSPGVGPGSGPRGRTPSNNVPPTELAQRRRSAS # VDYGELSVRSRNVPRPRSRAEEWVEGQGQREQHQREASVMETKEEENSALTKKTSVKRRKSDKRRSLPVSSATSSSPSPPSSSSPLPSKPPRAPPTGD # TPKKSMSVSVSRTSSIRSAASAPTSSSMSTSTTTTKQTTNQATNTKPDRRSSAPPVGGSTNGHGRPAELSGGTSLMSIVEDVAKANREGWGKVDKEKE # NIGAGSGLGVELRVREEEEEGANTLSSKRKQPTSIALEDVRAPRGIDLEDLKEQMERERAEKLEKRGHVLSQCKKKYLSLFSALILTNSTDTEKAAST # GRPRSGSASAAISGRPTRGVRDTSHSDLGPTTSASAPALAPLADIPVVNNTQTRIQGNPQNKHMPYRPGQAVLPLRSALKNSSRTPSPMLPQSQLQPL # PQSQQTSPEGSQMGSSVSTAGSSGASTGLPRQRDPLQQQQHQSPRTASSLVIPTITSQRDVKGKGRETIDEYTDSGAIAIMGSTRADSIPSPPPSNLS # AGISSPPRPISYYLPPTPLATSCIPTSSLATPVLDPSSSIPSIPPNSPPRLVHPDQQPLRAKRRSSGSGSSSESSGSDSSDAVSISSYETGREVFDDF # EDGDGQVSEILENARVDVVEDGSDETETETETETEIGQQSSSTTVTTQTQAQTLARGSSTISVPNPNPNPNTNPNPLPDTTTTTSHPEDTGNNTNTPP # RRRKSVRVSLQPTYSVTPPAIEYDAYEDDHGDEDEGGGEDHERRQTPNPNLNPKHMNGNANRNIDRGEQGIIHGIWTDSSDEDVEYQKARRLFSMSGG # FNLSGKKKGKGKKRGRGTGEGKAGVDVEQVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g142 ### # start gene g143 2_related_000157F AUGUSTUS gene 14701 17069 0.26 + . g143 2_related_000157F AUGUSTUS transcript 14701 17069 0.26 + . g143.t1 2_related_000157F AUGUSTUS start_codon 14701 14703 . + 0 transcript_id "g143.t1"; gene_id "g143"; 2_related_000157F AUGUSTUS CDS 14701 16083 0.6 + 0 transcript_id "g143.t1"; gene_id "g143"; 2_related_000157F AUGUSTUS CDS 16131 17069 0.3 + 0 transcript_id "g143.t1"; gene_id "g143"; 2_related_000157F AUGUSTUS stop_codon 17067 17069 . + 0 transcript_id "g143.t1"; gene_id "g143"; # protein sequence = [MGLTKKNVIRLEQAALQILGYTLFISPSAWNGFMEQIHEDCPLFLYPGDFENLRQLVRSSHVPVYIAGPEQGPCQLAA # IGTISQAEIEYHRLRISECAIRGKIIVSPNQDTESSRIEAGTEEDYLFDVFDAAEELLFEELVESDQLLPLSPRFLPSTSTNAVSKQSSTSVLPPQSY # PSSSTRSSPPAPGTCLSPVIKIEEVEVELVWPSSPHNAVSVRDQRSEHPARRESLRELSPSSCSAEPHPNSKPVLFSSTNSIAVAGRQSILAHSLTES # FNESHSDSRYAVSQGISGMSPHSIVMHSPALPPPSSKGQSTPETETGSGRSRYKRFETPASPGEYHNISQEVVDMLVDLEVIHSTPPLNNLIFTFAQT # NSGVFSHSGRFPALASPVHHNTSQGVMVISLDSGVPQSTPLPTNVPSRTDGRSPTTEYRSPGQFQTEDLSSQKREETLTADLNAPQLDLFEFGAQLGN # EDQVSSVPHTPPVRLQSTIESSLFSLSPLSPLPSIYDDSDCEVEDDMTKPDELYRSYTGAHLDVQIGHSESQVRVPVRFRTPEEGTQIEEEEEGEEEV # DYCDCSEYEDDGPHLSQLFSLSSLSPLSTTYNSDVEIDDAEEIDEEERDSEDNCEHDSDFDSNCSYASSTSATSAFDPSVSPPPFKIPDTYDRETGLW # TIPSPKSTEEELGNSESRHIRQEERPFDFTSTTSTPDIKDEFYSMSHYGPISLGQGGFADGVRAPSPHPLDLEAELIHREFLSFPPRDRLSSPAVVRI # NSMVQGALA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g143 ### # start gene g144 2_related_000157F AUGUSTUS gene 24508 24855 0.99 - . g144 2_related_000157F AUGUSTUS transcript 24508 24855 0.99 - . g144.t1 2_related_000157F AUGUSTUS stop_codon 24508 24510 . - 0 transcript_id "g144.t1"; gene_id "g144"; 2_related_000157F AUGUSTUS CDS 24508 24855 0.99 - 0 transcript_id "g144.t1"; gene_id "g144"; 2_related_000157F AUGUSTUS start_codon 24853 24855 . - 0 transcript_id "g144.t1"; gene_id "g144"; # protein sequence = [MSSKTAHTEKLPAVTVDAEDIWKQSAKTSSWDSDETEAESTRRQQISATGPTPFSLFPNESVQIASSTPTSAPATVPA # TPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g144 ### # start gene g145 2_related_000157F AUGUSTUS gene 25318 25677 0.98 - . g145 2_related_000157F AUGUSTUS transcript 25318 25677 0.98 - . g145.t1 2_related_000157F AUGUSTUS stop_codon 25318 25320 . - 0 transcript_id "g145.t1"; gene_id "g145"; 2_related_000157F AUGUSTUS CDS 25318 25677 0.98 - 0 transcript_id "g145.t1"; gene_id "g145"; 2_related_000157F AUGUSTUS start_codon 25675 25677 . - 0 transcript_id "g145.t1"; gene_id "g145"; # protein sequence = [MSTPIPPATPAPPASAEDLMTQLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS # QAKLIKSALGFFTESAGDWATPHLLHFNAEHPPFGGNWRSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g145 ### # start gene g146 2_related_000157F AUGUSTUS gene 30618 34920 0.3 + . g146 2_related_000157F AUGUSTUS transcript 30618 34920 0.3 + . g146.t1 2_related_000157F AUGUSTUS start_codon 30618 30620 . + 0 transcript_id "g146.t1"; gene_id "g146"; 2_related_000157F AUGUSTUS CDS 30618 33140 0.31 + 0 transcript_id "g146.t1"; gene_id "g146"; 2_related_000157F AUGUSTUS CDS 33214 34920 0.36 + 0 transcript_id "g146.t1"; gene_id "g146"; 2_related_000157F AUGUSTUS stop_codon 34918 34920 . + 0 transcript_id "g146.t1"; gene_id "g146"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRASSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEN # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMR # HMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNQGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKH # SSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPRVNLQTKPLTPVSTQRYQFGEVRMDGTQHSSRISGQDLTARLAPNPVHVPPRLSN # PSVIPYQGSVSMQSQAVGTESHRGPNQRRTLAVHEEAVPPQGAPFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTAG # EVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQAMEPISFNRNTPTGARDGNPQVEQAGQIPDTPSKEERTRWKTREEAKAVFNPPP # RVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPW # YYDPRQGWHRKAAARPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTL # NRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNKYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYD # EWTRVFTKLDGAVRAQAESLRSLHGEKALQGWLSRFPGLELAPETPYKSPLRREREPADVWTSNPKPAATGRFPSRSNWKEGRQRASAAWGEGESYDS # ENREEDEDCCHCRDGGEWTEAVLRAGVTDTGRKWTPEERAEKWRRRRQELCMRCGRKEHWAKDCPNPESLERPAEDQGSSERASKADSTRGRGTANQG # GGRKDDSTRPLERIRAGIVVEEREGMDDLWNVHILDSPKGGEQELLDEVGNGQGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g146 ### # start gene g147 2_related_000157F AUGUSTUS gene 35133 37211 0.52 + . g147 2_related_000157F AUGUSTUS transcript 35133 37211 0.52 + . g147.t1 2_related_000157F AUGUSTUS start_codon 35133 35135 . + 0 transcript_id "g147.t1"; gene_id "g147"; 2_related_000157F AUGUSTUS CDS 35133 37211 0.52 + 0 transcript_id "g147.t1"; gene_id "g147"; 2_related_000157F AUGUSTUS stop_codon 37209 37211 . + 0 transcript_id "g147.t1"; gene_id "g147"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGVEGGTEEPGRGVNGEGIHEGPLQPPPETFQQSPEAPQPGSQQPPEAPLRAPRTGVKLEEVKDEEYEASQPGPHE # LFPSDKNLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAIEKVTPKPAKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDLPTL # DIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASGSSAPEG # VQQPKDPESGDPSSEQEEVVRELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDVIPPIGKLYNMSEKELKSLKEYID # EMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEY # LVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEESHVEHVKKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKR # YWTGQNQGRLRSSRRSSDSQTSIGGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g147 ### # start gene g148 2_related_000157F AUGUSTUS gene 38402 39367 0.26 + . g148 2_related_000157F AUGUSTUS transcript 38402 39367 0.26 + . g148.t1 2_related_000157F AUGUSTUS start_codon 38402 38404 . + 0 transcript_id "g148.t1"; gene_id "g148"; 2_related_000157F AUGUSTUS CDS 38402 39367 0.26 + 0 transcript_id "g148.t1"; gene_id "g148"; 2_related_000157F AUGUSTUS stop_codon 39365 39367 . + 0 transcript_id "g148.t1"; gene_id "g148"; # protein sequence = [MPADIVSDRGSLFVSQFWKELCRALGIESRLSTAYHPQTDGQTERVNQAVEAYLRIYCSYDQDDWDLLLPMAEFVYNN # TPNTTTGVSPFFANKGYHPKLSITLELVQGAEVNEYASNLKELHTYLQERIQVANEVYAQYANQKRQEAPDWKEGDHVWLNMENVRTRRPMKKLDHKW # TGPYSILAKIGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEDILDSKPKKGRPEEVEYLVKWEGYSEEFNSWVGW # EGMAGSLELLRSWHKKHPRKRQPSQRHWARLIKDAQEDEEDEREDRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g148 ### # start gene g149 2_related_000157F AUGUSTUS gene 39771 40946 0.71 - . g149 2_related_000157F AUGUSTUS transcript 39771 40946 0.71 - . g149.t1 2_related_000157F AUGUSTUS stop_codon 39771 39773 . - 0 transcript_id "g149.t1"; gene_id "g149"; 2_related_000157F AUGUSTUS CDS 39771 40946 0.71 - 0 transcript_id "g149.t1"; gene_id "g149"; 2_related_000157F AUGUSTUS start_codon 40944 40946 . - 0 transcript_id "g149.t1"; gene_id "g149"; # protein sequence = [MEDSRVLDQFPALDEALSGAPGQVSTSFSPRFPPLFDPSSQSISERFRKVQEDLHNATRERRVAVEKLITSTRKNSQL # RTTLLHQQGLVDESNALATRQRRRVEELQEEVHRVRGRAVFVEQMLKEYPDEGYYEVVLPPLSQLEGDLNKAHEDLRRVATFAHRLYRCDPATVLHHH # HRYLGAIIEAVVAFLRRGLNSGDLDVTVHNFRLALDYVQAARGVHGDMYMRSISSIQWFFNNAVDEDEGLYRMILEHSRFDSDSPFLTAAHHAGFVPP # PDDSVEPPLHRRMLALSTALPHSDGVGRWEDIVPALPSIDQLTADWEQMMLQYIHHITDTPLSGIATQGPMSSVEPANESLPEVLVRQSPETPAALES # TSSVGPHPRSLYFCPSKGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g149 ### # start gene g150 2_related_000157F AUGUSTUS gene 41462 44232 0.09 - . g150 2_related_000157F AUGUSTUS transcript 41462 44232 0.09 - . g150.t1 2_related_000157F AUGUSTUS stop_codon 41462 41464 . - 0 transcript_id "g150.t1"; gene_id "g150"; 2_related_000157F AUGUSTUS CDS 41462 42654 0.58 - 2 transcript_id "g150.t1"; gene_id "g150"; 2_related_000157F AUGUSTUS CDS 44067 44232 0.28 - 0 transcript_id "g150.t1"; gene_id "g150"; 2_related_000157F AUGUSTUS start_codon 44230 44232 . - 0 transcript_id "g150.t1"; gene_id "g150"; # protein sequence = [MSLPSSSAATGAPNPVPPPVSSPSHPNSTEPTEDAAIDELANTLEEPPLGQLTLFLAEVDAYREVAVRQKQELSELRA # QVDKEQKRSYEAHEELDAANARAIRVRDRLEELEETVHRYRTRAHVAEELIRKYPEDEGLYEVDLPSLSSLQDKLTASEVMLRRMATFAHRLHSADPA # NLLHHHNTYVGGLIESVITLLSRSLLHPPEQMRTVVELALDYLSQGRLTHGELHLRSTSSLLYYYSNAADRVEGLYQDMFTHSRFSSDEAFLTAAQHA # GYIDARPGSLEPPLHRRLFSFDHPIPLPGSPTSDHIPAVPMMDTVMLMWEDMIGAYVREVLGYPVSPGRILPPVEVPSSNDPLPATTSLVVDGPPPVL # GASDSVSRSTPLFLPGSLSPTSPRSPSPIPSSPRVPDVVREVVDLTMDDAEDLYESQEEFLARTGGTVTIKQEITESDVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g150 ### # start gene g151 2_related_000157F AUGUSTUS gene 45617 46924 0.32 - . g151 2_related_000157F AUGUSTUS transcript 45617 46924 0.32 - . g151.t1 2_related_000157F AUGUSTUS stop_codon 45617 45619 . - 0 transcript_id "g151.t1"; gene_id "g151"; 2_related_000157F AUGUSTUS CDS 45617 46339 0.36 - 0 transcript_id "g151.t1"; gene_id "g151"; 2_related_000157F AUGUSTUS CDS 46478 46924 0.38 - 0 transcript_id "g151.t1"; gene_id "g151"; 2_related_000157F AUGUSTUS start_codon 46922 46924 . - 0 transcript_id "g151.t1"; gene_id "g151"; # protein sequence = [MACLPEPATLANYHQEVLRIDNRYWKREETKKCEAGKPFIARNPKKGSSDFKAGSTNQQNDSQPLGSLVPFMPKPKPF # NGGKPNNSDKPQNSLNSGQSSGQRPVFNHLGADGKVLPSEKERRMKNNLCLFCSGKHQIADCNKRKAESRRLYLNTSALLSIEQSLVISLTTEFLLSD # SAAPAEPISALLKFPTLVDSGSTDSFIDTHYVSQNSILTTKISPVNLCLFDGSLSSKPITDMVNIAVQLPSGELLLLPFYVTHLDSSCKAVLGYSFLS # HYNPLIDWTSRNITFRNTSHPDSPQSSVPSATNIVDAKVAVPLPEPLLLVSPTILETLPGDSLRSHSLLRSCTPCNRAKATRCLSAEDEWNSSEVINN # TAVTPLVPGDREYRGRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g151 ### # # ----- prediction on sequence number 9 (length = 6081561, name = 3) ----- # # Predicted genes for sequence number 9 on both strands # start gene g152 3 AUGUSTUS gene 67954 71436 0.86 + . g152 3 AUGUSTUS transcript 67954 71436 0.86 + . g152.t1 3 AUGUSTUS start_codon 67954 67956 . + 0 transcript_id "g152.t1"; gene_id "g152"; 3 AUGUSTUS CDS 67954 71436 0.86 + 0 transcript_id "g152.t1"; gene_id "g152"; 3 AUGUSTUS stop_codon 71434 71436 . + 0 transcript_id "g152.t1"; gene_id "g152"; # protein sequence = [MSDFFRALSPAIQSFAGSSSATTASDKRLSGAFHLLASAANVNEVLATLPDTYRDVLTGPLQGVRATANRLCSARKSL # ASLEAHKASGTIPPSIPKTSLDLQLTAEFKTSADGLTVTKAVSDLSAEFRQNLFAQQILAKSTEIKVLESKITPDKLLRELSPIITSNYASLKERMKR # AVFEDVQISNDRGQPSGQTELRFVRWEESPELEPQYRDLLSNCVQYAFRIIQLVEAMFAKQEGKRKEKRELKAAADVEMADLTQPGPSLQSTIDKAVA # AQVRAALKGKKRDSSSTSTVRFDSMNTDFSAHRFFKEENIGTSREEKRSQIVRRSSSRSDSLRLPQSAASASRQKVHQKGNARWKDRGEKTGSDEQGI # FIEQGQRKEVVSLSSTPHFDWSKYDSYPDELLTMPYPDAIRTILLQVPSDILDAAAYRSSVHIGPGVFLPLEYQMDLSVGQNYMFHSPRNSRLLIEAW # KDFEYRIKWRIFFTFKDGRQDADNYDPDYEVPRERTSKVPQLPQYIEYGLNIGQVYITKMMALMPKDQEGSAFKSLAPDPKRIRQYLIDNDYVVTNTD # KNLGIAVSQRTWIEEKSLALLNNPSDYERLTPAECKRILDKQCTQMELLCTLVDEAEPALEKQLKRFFRHKVTSPSGSHHIPTFYCIPKIHKEPVKGR # PIIPCHSAIQNPAAKYVSKKLKPLIEAAPSIIHGSKDLAIKLSKFKRDPRRRLFIVTGDVVAFYPNIPLQRCFDVVDELFCEFYHIEVDDLGVPISDE # WKHKVLLLERAMMYGCSDLVTQFFDSTIKDFIYFKQKRGLAMGVACSPDLANLFGFWFESRKQIWKRPEFGFYGRYIDDCLALVYAHSADEALALCEN # NINFDGCTIEWNVSEHFQHFLDMTLYLDEKGDLQHMPFRKAMSHQERIPWISHHPLDVKRGSFIGEMSRLATLSSTQSHYLVAIKDLASLYVKRGYPS # KAVYHWLNNNKKERWDNRLSLNNQHDGLSATEDVLVLKSTFNSAWDYFSASELGKRITRYWKEWLIHAEKGDYSSKYPKYRFGEDSLKDTVGSLRSVI # DSGAPAGVLTAPVTVPDIRLTGLADARWLVSRKRTRNLFDLANLWKKEVFQRMDVDTATNIAQGIPSDNYLDDVEMEDIQTKGDRPVPGDLEYIHYGH # AMES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g152 ### # start gene g153 3 AUGUSTUS gene 72349 72816 0.62 - . g153 3 AUGUSTUS transcript 72349 72816 0.62 - . g153.t1 3 AUGUSTUS stop_codon 72349 72351 . - 0 transcript_id "g153.t1"; gene_id "g153"; 3 AUGUSTUS CDS 72349 72816 0.62 - 0 transcript_id "g153.t1"; gene_id "g153"; 3 AUGUSTUS start_codon 72814 72816 . - 0 transcript_id "g153.t1"; gene_id "g153"; # protein sequence = [MLLLIAVHSELNTVYSVLNVVSDSDLNAVHNKLYAVLHSELSTVYNELVIVLDSELVIVLHSELNTVCNELVIISHSE # LNIVRHSELVVAVVDSELDVVIDSEFVVIIVDSELNVVRHSELVIAVVHSELDVVIDSELVIAVVHSELDVVLGVRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g153 ### # start gene g154 3 AUGUSTUS gene 98019 98531 0.32 - . g154 3 AUGUSTUS transcript 98019 98531 0.32 - . g154.t1 3 AUGUSTUS stop_codon 98019 98021 . - 0 transcript_id "g154.t1"; gene_id "g154"; 3 AUGUSTUS CDS 98019 98373 0.35 - 1 transcript_id "g154.t1"; gene_id "g154"; 3 AUGUSTUS CDS 98527 98531 0.32 - 0 transcript_id "g154.t1"; gene_id "g154"; 3 AUGUSTUS start_codon 98529 98531 . - 0 transcript_id "g154.t1"; gene_id "g154"; # protein sequence = [MIQYNYNLHPLEANWYEQEWASNHFPHSTLKSKSKSKSKSSSTLKSKSKSKSKSSSTLKSKSKSSSTLKSKSKSKSSS # TLKSKSKSKSSSTLKSKAKSKSEDFDFYLTILHPERACPFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g154 ### # start gene g155 3 AUGUSTUS gene 107181 107516 0.38 + . g155 3 AUGUSTUS transcript 107181 107516 0.38 + . g155.t1 3 AUGUSTUS start_codon 107181 107183 . + 0 transcript_id "g155.t1"; gene_id "g155"; 3 AUGUSTUS CDS 107181 107193 0.38 + 0 transcript_id "g155.t1"; gene_id "g155"; 3 AUGUSTUS CDS 107263 107516 0.59 + 2 transcript_id "g155.t1"; gene_id "g155"; 3 AUGUSTUS stop_codon 107514 107516 . + 0 transcript_id "g155.t1"; gene_id "g155"; # protein sequence = [MPFPDFDFAFDFKVELDFDFDFDFKVELDFDFDFDFKVELDFDFDFKVELDFDFKVELDFDFDFDFDFKVELDFDFDF # DFDFKVECGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g155 ### # start gene g156 3 AUGUSTUS gene 112924 113259 0.47 + . g156 3 AUGUSTUS transcript 112924 113259 0.47 + . g156.t1 3 AUGUSTUS start_codon 112924 112926 . + 0 transcript_id "g156.t1"; gene_id "g156"; 3 AUGUSTUS CDS 112924 112936 0.47 + 0 transcript_id "g156.t1"; gene_id "g156"; 3 AUGUSTUS CDS 113006 113259 0.69 + 2 transcript_id "g156.t1"; gene_id "g156"; 3 AUGUSTUS stop_codon 113257 113259 . + 0 transcript_id "g156.t1"; gene_id "g156"; # protein sequence = [MPFPDFDFAFDFKVELDFDFDFDFKVELDFDFDFDFKVELDFDFDFKVELDFDFKVELDFDFDFDFDFKVELDFDFDF # DFDFKVECGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g156 ### # start gene g157 3 AUGUSTUS gene 114096 116850 0.17 - . g157 3 AUGUSTUS transcript 114096 116850 0.17 - . g157.t1 3 AUGUSTUS stop_codon 114096 114098 . - 0 transcript_id "g157.t1"; gene_id "g157"; 3 AUGUSTUS CDS 114096 116147 0.49 - 0 transcript_id "g157.t1"; gene_id "g157"; 3 AUGUSTUS CDS 116239 116850 0.17 - 0 transcript_id "g157.t1"; gene_id "g157"; 3 AUGUSTUS start_codon 116848 116850 . - 0 transcript_id "g157.t1"; gene_id "g157"; # protein sequence = [MQYSPTEAKKVIQNQWHVPAAPLVMQPGFYPQVEGLPILLGYECGDCNHVTASVKTIERHVRTTHNVPFDINAIHYVP # IQRFHKHAIPFPIIPAYPPTSSTIDEIVNNATAQVEAVFETPIGEFSANNRLVSPWLLATKWPQLVQGRDLEALSNTCQKPVADDTVLQKACVVMQGL # MDLAIKSIPQLPELVLQRLNTPDRAKTQGGDTTMRTYIDEVNRLLCMLLRDTRNIFTFDLPLSVAQALQALQDGLVDDQISDVDLMYLVHQLLMSLWT # QHWPQDIETKFTTDPTMLFLAFRMIIPSGGFREPNQTSPVVARITYCQRLVFVLELLKNHDQPNYNASTECDRLEQYFTEKNDYTFNSLRSLQHLAST # LAIKQKSLPRVVWLDRKQWDHMLYLGDSIKFADLCQVFHNIEQELVPLWEDKIMLGTKLSIDIHSALLCDDLTRKLPPYSMFKDPRNTCLHTRSALFR # AIVSTPALRDQFIVGIDMANNTPRWNKVALRSWLYQYSHFNLLLMLRWEMLAGSPTRGTEMVSMLAQNTQTRPRNLYAIGPNIALVGQYHKSGAISGS # DKLLPRAGDAFTADLTIQNLALARPFAQFIATVCYPNDPKVIEAYRDLLFPNMGRAFDSDELSDAMAKYSHQVLNVRLGLNAFRHVSIAFRRMLVDQA # TEQETDNEIIRHVEAEQAGHSEHVEQTIYAVSLDSIGEYSDQMLGVFCDASARWQIKCGIVPTGVSRSYREATAACYQDLRSKGLFAVDEFTTAESRT # RALLADVKDFIKSSMTAATEDIATSLLNKLQPLLLQQQSSSTSATVVTTPPRPPPLVTTFSPNYITPGKGMPFPLAFWAFHALFLMERQTSRKPSLPK # SLQNLCLCLVFTGLVNIDIILSSHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g157 ### # start gene g158 3 AUGUSTUS gene 118666 119439 0.69 + . g158 3 AUGUSTUS transcript 118666 119439 0.69 + . g158.t1 3 AUGUSTUS start_codon 118666 118668 . + 0 transcript_id "g158.t1"; gene_id "g158"; 3 AUGUSTUS CDS 118666 119439 0.69 + 0 transcript_id "g158.t1"; gene_id "g158"; 3 AUGUSTUS stop_codon 119437 119439 . + 0 transcript_id "g158.t1"; gene_id "g158"; # protein sequence = [MSEGYKSALFWTPVGKTWSRIEQAKNFTYGIFKILYVKSQRRLRIESLSILYVKWTSGLTVDSIELTVYDDVELTVYD # DDDELTVYDDVKLTVYNSDDKLTVYDDVELTVYDDDDELTVYDDVKLTVYDNDDELTVYDDVKLTVYNSNDKLTVSDNVELTVYDDDNKLTVYDNIEL # TVYDNDDELTVYDDVKLTVYNSNDKLTVYDDDNKLTVYDNIELTVYNSNNKLTVSDNVEFTVGDDDQLIAYSVELTVEDND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g158 ### # start gene g159 3 AUGUSTUS gene 136164 136702 0.58 - . g159 3 AUGUSTUS transcript 136164 136702 0.58 - . g159.t1 3 AUGUSTUS stop_codon 136164 136166 . - 0 transcript_id "g159.t1"; gene_id "g159"; 3 AUGUSTUS CDS 136164 136548 0.58 - 1 transcript_id "g159.t1"; gene_id "g159"; 3 AUGUSTUS CDS 136653 136702 1 - 0 transcript_id "g159.t1"; gene_id "g159"; 3 AUGUSTUS start_codon 136700 136702 . - 0 transcript_id "g159.t1"; gene_id "g159"; # protein sequence = [MSKENEANTQLHYANSFHHLVNLLERKSHGLRDEKISVQPATATKTTPNPEDIRAKITLVGVDHVGGDYGYDGIPEPV # RGSGEGDTTRTDLDRENFTNANPSGGTPSRCKEENVDRDEGDLSIDSSNVIGDCVARSVEMGFFKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g159 ### # start gene g160 3 AUGUSTUS gene 139243 140211 0.68 + . g160 3 AUGUSTUS transcript 139243 140211 0.68 + . g160.t1 3 AUGUSTUS start_codon 139243 139245 . + 0 transcript_id "g160.t1"; gene_id "g160"; 3 AUGUSTUS CDS 139243 140211 0.68 + 0 transcript_id "g160.t1"; gene_id "g160"; 3 AUGUSTUS stop_codon 140209 140211 . + 0 transcript_id "g160.t1"; gene_id "g160"; # protein sequence = [MALNRRGYAGSTPYNPYEKSIITNEQVHSDEDKRQFFEQRGIEILRFIDQIIQRFDLPPISNFEGHQVGGIALLGWSL # GIAFTLAAIANVDSDSISDETRKRLNAHLRAHILLGTAILSLRSSISPTPQTSEPAVITIGLNLPKDFWAPTHDPLIPASARASLFIHLITCYYDYDK # ETISARDQAGILSTVAPSPSRIPSMFTFTDEERTEIVTPLPQDMHFSHVLQEPLREWYLKACFDEKLRSSLALKNMTVWHVSGDRSYPFIWPAYWLVQ # EDDRKAGQGESGRFVRFKLMEGCNHFVSCFTVHTTRQKFLMLVLDALG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g160 ### # start gene g161 3 AUGUSTUS gene 160757 161149 0.79 - . g161 3 AUGUSTUS transcript 160757 161149 0.79 - . g161.t1 3 AUGUSTUS stop_codon 160757 160759 . - 0 transcript_id "g161.t1"; gene_id "g161"; 3 AUGUSTUS CDS 160757 161149 0.79 - 0 transcript_id "g161.t1"; gene_id "g161"; 3 AUGUSTUS start_codon 161147 161149 . - 0 transcript_id "g161.t1"; gene_id "g161"; # protein sequence = [MRASMEPFPLSSDTISSIINNPSLLKQSSYLAQFGISTSQADYILVEGYNKGFKNIFILNAALTTLAFVASVVLIGHK # ELLRGDEEQLKKEAKEALRERAGKDAVGIVEDQSLKMGAQPEDIEMGSMASP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g161 ### # start gene g162 3 AUGUSTUS gene 163978 164495 0.99 + . g162 3 AUGUSTUS transcript 163978 164495 0.99 + . g162.t1 3 AUGUSTUS start_codon 163978 163980 . + 0 transcript_id "g162.t1"; gene_id "g162"; 3 AUGUSTUS CDS 163978 164100 0.99 + 0 transcript_id "g162.t1"; gene_id "g162"; 3 AUGUSTUS CDS 164157 164495 1 + 0 transcript_id "g162.t1"; gene_id "g162"; 3 AUGUSTUS stop_codon 164493 164495 . + 0 transcript_id "g162.t1"; gene_id "g162"; # protein sequence = [MLDQYIRQAHAKGLAEKMSCVCTELKGVEGELDGAKFDVVTCVMAYHHFGSVTEITSILVRFLKPNGMLVVVDIEAPS # IPGKAPTDVNSLVVEGLQDLDHVAHKRGFKVTEMKELFEGAGLVSFDMKHLTHVKVEGKFEVDTFLAVGFRPVEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g162 ### # start gene g163 3 AUGUSTUS gene 167702 168228 0.52 + . g163 3 AUGUSTUS transcript 167702 168228 0.52 + . g163.t1 3 AUGUSTUS start_codon 167702 167704 . + 0 transcript_id "g163.t1"; gene_id "g163"; 3 AUGUSTUS CDS 167702 167957 0.71 + 0 transcript_id "g163.t1"; gene_id "g163"; 3 AUGUSTUS CDS 168011 168228 0.52 + 2 transcript_id "g163.t1"; gene_id "g163"; 3 AUGUSTUS stop_codon 168226 168228 . + 0 transcript_id "g163.t1"; gene_id "g163"; # protein sequence = [MSGRRIRFVPLILILRREIVGLTRCSGYLSFGRQAVRSKLISSGVLENDAYVVIAGPANTYAHYVATLEEYSVQRYEG # ASTIFGQYTLDAYIDKYTSLVPFIADTVTGTPASDAPPAEQTSKAISLQVSLLSIIDCPGTDHRHIAVTCCVRLGSFWF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g163 ### # start gene g164 3 AUGUSTUS gene 170021 170896 0.96 - . g164 3 AUGUSTUS transcript 170021 170896 0.96 - . g164.t1 3 AUGUSTUS stop_codon 170021 170023 . - 0 transcript_id "g164.t1"; gene_id "g164"; 3 AUGUSTUS CDS 170021 170896 0.96 - 0 transcript_id "g164.t1"; gene_id "g164"; 3 AUGUSTUS start_codon 170894 170896 . - 0 transcript_id "g164.t1"; gene_id "g164"; # protein sequence = [MYIDIVPEDGPSSVGRKGSSHIDITSSRDAIVSSAHGPRPIRSIKPSLAFTSSFDASVAAQSMFTIYYADVCYEDQSV # LTAMVNQAAPGGATLYTCDLVPRYWNMICNSPGRAISHSMTTHVLILFLDPTSFTIQHRVIREPYSSFSEPTTLFSATYKFRYVPEKVSPPQISPFSA # VDSSISTFQEMDISSYREYNGPGYSTGSVSEMSSSYDSKWDCFNDLSGGQRGYTSLPTTPDCWDEYNASSIDGSCSSSSSPTTSSFPQHSQFVSNFYQ # HVYRSLLVLFQYPLHQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g164 ### # start gene g165 3 AUGUSTUS gene 174536 175465 0.8 - . g165 3 AUGUSTUS transcript 174536 175465 0.8 - . g165.t1 3 AUGUSTUS stop_codon 174536 174538 . - 0 transcript_id "g165.t1"; gene_id "g165"; 3 AUGUSTUS CDS 174536 175465 0.8 - 0 transcript_id "g165.t1"; gene_id "g165"; 3 AUGUSTUS start_codon 175463 175465 . - 0 transcript_id "g165.t1"; gene_id "g165"; # protein sequence = [MQEVFGLLRPAMLGDPTLTLGKVLAGKLTTILIHILSDSRSDFGVTIAGEFSNGYNDCGLFLKGTSSYTPTYGGDCNL # WQDASTWNDTVIAGVKAFALASMDATQNWFFWTWKIGNSTANNRVESPLWSYQLGLEGGWIPTDPREAVGACAAQGVSQPWNQTFQSWQTGGVGAGTI # AATATAEFGVWPPAQISGVALDQMAFVPTYTPTGSVATLPPPTLTATTKSISEGNGWFDSSDTTSAATAIAGCSYPNAWDAISATVPATVCGGGVVTT # STAAAASTVISASTTGVISVPATTSTTADDTTITQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g165 ### # start gene g166 3 AUGUSTUS gene 176746 177297 0.9 - . g166 3 AUGUSTUS transcript 176746 177297 0.9 - . g166.t1 3 AUGUSTUS stop_codon 176746 176748 . - 0 transcript_id "g166.t1"; gene_id "g166"; 3 AUGUSTUS CDS 176746 177297 0.9 - 0 transcript_id "g166.t1"; gene_id "g166"; 3 AUGUSTUS start_codon 177295 177297 . - 0 transcript_id "g166.t1"; gene_id "g166"; # protein sequence = [MERYPDYSVDGSAPGTPLPPGEADRFLEQPRASFLESNTGNSVQSTPNNSSPLLVANKHETDHELQQAKPGSGTKRGR # LVILTLVGLGVLAVIVLAVVLPVYFKVIKPRQNQDNLTSGSSASGSSAGSGSVGSGSGNPASPSGATSGGDGSEIIVDGGANFTYKNPFGGYCEFPGI # SITFSST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g166 ### # start gene g167 3 AUGUSTUS gene 185831 186437 0.53 - . g167 3 AUGUSTUS transcript 185831 186437 0.53 - . g167.t1 3 AUGUSTUS stop_codon 185831 185833 . - 0 transcript_id "g167.t1"; gene_id "g167"; 3 AUGUSTUS CDS 185831 186131 0.55 - 1 transcript_id "g167.t1"; gene_id "g167"; 3 AUGUSTUS CDS 186244 186437 0.54 - 0 transcript_id "g167.t1"; gene_id "g167"; 3 AUGUSTUS start_codon 186435 186437 . - 0 transcript_id "g167.t1"; gene_id "g167"; # protein sequence = [MADASDLDAAAVADSQVLGVIVIARNGDRVEYYQDPKTYEGGVTETTALGEVSFVDTIVAERALTEIKVRVKNGGEGT # VIFDSAIALLQGLYPPNPKNKIVLANDSVVTAPLGGYQYVPVETVEPSNDRSLESWTDCPVSRNRMVSTCDVWLTQSSIGIRKTYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g167 ### # start gene g168 3 AUGUSTUS gene 189823 190647 0.85 - . g168 3 AUGUSTUS transcript 189823 190647 0.85 - . g168.t1 3 AUGUSTUS stop_codon 189823 189825 . - 0 transcript_id "g168.t1"; gene_id "g168"; 3 AUGUSTUS CDS 189823 190476 1 - 0 transcript_id "g168.t1"; gene_id "g168"; 3 AUGUSTUS CDS 190603 190647 0.85 - 0 transcript_id "g168.t1"; gene_id "g168"; 3 AUGUSTUS start_codon 190645 190647 . - 0 transcript_id "g168.t1"; gene_id "g168"; # protein sequence = [MRFNIIHLSLGLASVATIPYWDSFDGPPIDLEYHYIPPSTKEHQQDNKYAGYTDDVVHRILDRKSKRITSVPFTGDPR # QFSFKILTPIQVFELVCPCTVDVVVEPQQGGAGAQATSTFRETRCKDHFINGVPRLPDGLDPHAKPPSRPASPASNSPHCPASQHSPGPPHSPAHSSD # SWYTTDSDSPQSPGSPHPDSHSDSATSPATHRYVNHIGSLNVSGSASVHNGNTFYY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g168 ### # start gene g169 3 AUGUSTUS gene 192333 193688 0.74 - . g169 3 AUGUSTUS transcript 192333 193688 0.74 - . g169.t1 3 AUGUSTUS stop_codon 192333 192335 . - 0 transcript_id "g169.t1"; gene_id "g169"; 3 AUGUSTUS CDS 192333 193688 0.74 - 0 transcript_id "g169.t1"; gene_id "g169"; 3 AUGUSTUS start_codon 193686 193688 . - 0 transcript_id "g169.t1"; gene_id "g169"; # protein sequence = [MFRGTVYDLQSLSSPGSAVPAGIHDIDEDIMKHRGKPLPVADSELMRRGLRKESSLGATSLLGYASNLSLPMRQDSND # SYHGEPGLGRRPSAASAVLLGGTGPVGTRNITAINNGNRSTTYHPDLDDVIDVRGDSDEEREAEMDLADVAEEENFQGAEALPTPVSGGVITGVSPYR # MSEAFTSLEGHGLSSPGPLGSDRFPYAVSNHASHPSTSTIATSLYPHTITTKGGSSSLGFGLSNPYASTSTVYLGSLGHLTRPSLDTERETGQDIHSS # MRHGRPSLSIESAVDKRGRRMSRGSTLATTYEGFEGENTLVYESPISPGGSYPYSPTSTSYTHDTRAQTKNWQRQSSFLGSESHGYGAGYGFKKPHHY # QLGLDDVYAADASMSMSGHDHSREDGDGGDTTIHAVSPSWAIDGVSGVEIMDVPSVPPPTYLSPGSKSRSSSRSMEGRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g169 ### # start gene g170 3 AUGUSTUS gene 194027 194557 0.57 - . g170 3 AUGUSTUS transcript 194027 194557 0.57 - . g170.t1 3 AUGUSTUS stop_codon 194027 194029 . - 0 transcript_id "g170.t1"; gene_id "g170"; 3 AUGUSTUS CDS 194027 194557 0.57 - 0 transcript_id "g170.t1"; gene_id "g170"; 3 AUGUSTUS start_codon 194555 194557 . - 0 transcript_id "g170.t1"; gene_id "g170"; # protein sequence = [MTSSTSSVAPASSSSSFDTDSGNSHRLAITGAVLGVFGIIGVGIILWWTLRMKPKVPYEEEAPSTPVPRPSPHTASGS # GVADALRRSLTLNRSLSNDIGRSKSSNLNRNKSLAAKITPFNPDATIEGDGPRFVHTPGANMRIATRLSNGVWQFSEPVRGALGQVSFWLLMIPVSFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g170 ### # start gene g171 3 AUGUSTUS gene 194881 196587 0.71 + . g171 3 AUGUSTUS transcript 194881 196587 0.71 + . g171.t1 3 AUGUSTUS start_codon 194881 194883 . + 0 transcript_id "g171.t1"; gene_id "g171"; 3 AUGUSTUS CDS 194881 196587 0.71 + 0 transcript_id "g171.t1"; gene_id "g171"; 3 AUGUSTUS stop_codon 196585 196587 . + 0 transcript_id "g171.t1"; gene_id "g171"; # protein sequence = [MPCESCGGNPKGPFNPRVSISSIQDAFKEYHGRGTLHINRSQVQQVLSEGEKDLKDYDMEIARLQARVLFFGRKKDRL # QAHLSDCASLISSIRRLPDDILRIIFDYHACGPLIPGAVCSHWRAIVLSTPSLWSQITFLFDTGRPSAVTTNALQLYLDRSKESALHMEIFVSHFGAG # QPLSIDYFEHQAFQYLATHAHRWKTLGLTIQSSLGFLERHSVLSCPQLEHLTLYGSHLEGPSPPINLTLMPKLHSVTIDSSYTHYVHPSVPWHQITKL # SLNSLSSVPQFLVACPNLLVLQIELKPNESNPIPDDVQTLTTHHGLSKLTLSFFQTAPDEDEEDDDNELVSNLDVLVSILAQLDLPNLNSFQLVVSTR # INRYPLTDWSVEALATFTSFMDRCGGHLAVLNLMDLSMDLSNLLSILRKVPSLVELTLSDSPLSKTSVGGRSRLYLPPLVSSAFLRSLHAFRRFDGLS # PASPLLPKLQKLRLQVDKEFDEEVFVDTISSRWIPSDDYAQEVGVTSLQKVELRFGDEFFHTFDLDTVKSMTKLSSLKVLWKQGMKVDVICGGIYVDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g171 ### # start gene g172 3 AUGUSTUS gene 198337 198822 0.99 + . g172 3 AUGUSTUS transcript 198337 198822 0.99 + . g172.t1 3 AUGUSTUS start_codon 198337 198339 . + 0 transcript_id "g172.t1"; gene_id "g172"; 3 AUGUSTUS CDS 198337 198822 0.99 + 0 transcript_id "g172.t1"; gene_id "g172"; 3 AUGUSTUS stop_codon 198820 198822 . + 0 transcript_id "g172.t1"; gene_id "g172"; # protein sequence = [MGNNNAGVYSVASFNSSFARLFPPSIAAQNIDSSRLLVKVLKQIDDDMVAEVKALTIVGQFVASGLLRLPIAKSNDVG # RIKRSIKITKVRGVGDTLPNDDDLFELKPVIVMLQMPGKPLTHIPEFMSEKNLETKRQMMGDTLKLMCDRVGKLALEHRFVHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g172 ### # start gene g173 3 AUGUSTUS gene 198830 199174 0.62 - . g173 3 AUGUSTUS transcript 198830 199174 0.62 - . g173.t1 3 AUGUSTUS stop_codon 198830 198832 . - 0 transcript_id "g173.t1"; gene_id "g173"; 3 AUGUSTUS CDS 198830 199174 0.62 - 0 transcript_id "g173.t1"; gene_id "g173"; 3 AUGUSTUS start_codon 199172 199174 . - 0 transcript_id "g173.t1"; gene_id "g173"; # protein sequence = [MLYPMNGGDKDMNQRLTNNRRKKQVSDLRVLVIPIISLPSLPYVDCPPIMTPAHKIIPCYTVVYGRKIFSSPIDDVDV # DNLGALVDNEDVSDNVVTKEIKAKVSYKVRTSDNLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g173 ### # start gene g174 3 AUGUSTUS gene 212979 213263 0.99 + . g174 3 AUGUSTUS transcript 212979 213263 0.99 + . g174.t1 3 AUGUSTUS start_codon 212979 212981 . + 0 transcript_id "g174.t1"; gene_id "g174"; 3 AUGUSTUS CDS 212979 213263 0.99 + 0 transcript_id "g174.t1"; gene_id "g174"; 3 AUGUSTUS stop_codon 213261 213263 . + 0 transcript_id "g174.t1"; gene_id "g174"; # protein sequence = [MPPRIIPEAALEALALVLLLDDALVPEDEVTDADVDPSPDALEELDEELGEGKEVIEKEIEVLVLASAQNWFVNPSAV # ASSLAQLDCMQDMRAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g174 ### # start gene g175 3 AUGUSTUS gene 214702 215516 0.28 - . g175 3 AUGUSTUS transcript 214702 215516 0.28 - . g175.t1 3 AUGUSTUS stop_codon 214702 214704 . - 0 transcript_id "g175.t1"; gene_id "g175"; 3 AUGUSTUS CDS 214702 215112 0.47 - 0 transcript_id "g175.t1"; gene_id "g175"; 3 AUGUSTUS CDS 215166 215516 0.28 - 0 transcript_id "g175.t1"; gene_id "g175"; 3 AUGUSTUS start_codon 215514 215516 . - 0 transcript_id "g175.t1"; gene_id "g175"; # protein sequence = [MIAIYVQEYIDSIFGAPQKASQAEGPPGPNALTTTHPNLATFDSLSFFFQDKHVDCMSRATTFERSYKAPMFMCPSSK # LIMNCDYITPSHHIPSSAMTSADGRWYYLNDQFGYWPTSLFEAQTKAPWPAPRPVNPDAIVQHSRVIAGAVWPPSHHLPSLDLTPEPRLDYPPYESIA # GPSRVVTMDTNEMVSDTSSVSSSADSPVSPISSTDSLDTADNFEEGSQTNPIHVDDGSGEDKNLIEDEESLGTGVSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g175 ### # start gene g176 3 AUGUSTUS gene 220631 221044 0.39 + . g176 3 AUGUSTUS transcript 220631 221044 0.39 + . g176.t1 3 AUGUSTUS start_codon 220631 220633 . + 0 transcript_id "g176.t1"; gene_id "g176"; 3 AUGUSTUS CDS 220631 221044 0.39 + 0 transcript_id "g176.t1"; gene_id "g176"; 3 AUGUSTUS stop_codon 221042 221044 . + 0 transcript_id "g176.t1"; gene_id "g176"; # protein sequence = [MWSAQFAPSENEVSAYRIFLHDWVARPITPPSMSIASSSNSTNAVVYAWWNGATEVTAWKLMGSTDLMPLAAEALNVV # DKVDFETTLTYTGIRHYTFFQVAALNARGEILEYSGFTALNGTSFAKADNQTATASPLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g176 ### # start gene g177 3 AUGUSTUS gene 221460 223584 0.5 - . g177 3 AUGUSTUS transcript 221460 223584 0.5 - . g177.t1 3 AUGUSTUS stop_codon 221460 221462 . - 0 transcript_id "g177.t1"; gene_id "g177"; 3 AUGUSTUS CDS 221460 222142 0.8 - 2 transcript_id "g177.t1"; gene_id "g177"; 3 AUGUSTUS CDS 222276 223584 0.5 - 0 transcript_id "g177.t1"; gene_id "g177"; 3 AUGUSTUS start_codon 223582 223584 . - 0 transcript_id "g177.t1"; gene_id "g177"; # protein sequence = [MIATPWLSYCTVCRDHDKPRAAFCGLCLRESQSYEAELQINPTFHVGCIENEDHELWPNVQATCRSCRAEWLWRKACS # ANVREAVGGRRFRIDDWEAKSTLDGFIDLSEGRVSDVILVARERYWIRTYTKLADMLSQALAASRYEGREERLTAAAAGEDTEMDLSDEDDDEDDLEL # AQLTEDGGIRELALGDWARNRILDGFWISPADQWYNHIQPDLPWDVRAVHPCPWTVESDDSAPQGDSEQTTEEEHPKDSTVHAPIPPSHPLCEQTFNA # HQKQMRILLLPAMKNIVRRIVIESSADAADPAIRAARMTLEDVMKELRDEATWFDGVDWLERRRNARHDAAAREEATSDDHSTSSGSSKSSDECFTIT # SPVLSTTTLQTTPSPPPIEDKSASADSKNVYRAVTIAVSPVLDPPRLIHPIPHVPIMAAHLPHFTQAAASEAAAVAAGVANRNQPPADVQEHPAQEIK # DDVVEIKLGEADGEGEEEIDYLEYEDDVFDSDEVESRYESRSRSRSPPRLNRPSYTPSTPVSPRKRSCDEIDDERIYERGNEDGNHSDINDTTPIRHR # QPRTPPKRLRREGPPILKGLSVDDPVKRMLHKRSSEGVDAREDQIQSKRAKMSEEAESPPTSLTAEDSENSSADADLDEGEDRASGRKQATVAER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g177 ### # start gene g178 3 AUGUSTUS gene 224526 224907 0.83 - . g178 3 AUGUSTUS transcript 224526 224907 0.83 - . g178.t1 3 AUGUSTUS stop_codon 224526 224528 . - 0 transcript_id "g178.t1"; gene_id "g178"; 3 AUGUSTUS CDS 224526 224834 0.91 - 0 transcript_id "g178.t1"; gene_id "g178"; 3 AUGUSTUS CDS 224905 224907 0.83 - 0 transcript_id "g178.t1"; gene_id "g178"; 3 AUGUSTUS start_codon 224905 224907 . - 0 transcript_id "g178.t1"; gene_id "g178"; # protein sequence = [MYNRHSSTNVSIAENSGQLGVNQNHPQPADISPMSSLTSTSNMSQLYIRHQDGGRGTSPRALPEETTPAEVVELPPKY # VVREDALIPHMLTEKPLHRLLVASE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g178 ### # start gene g179 3 AUGUSTUS gene 229036 229599 0.88 + . g179 3 AUGUSTUS transcript 229036 229599 0.88 + . g179.t1 3 AUGUSTUS start_codon 229036 229038 . + 0 transcript_id "g179.t1"; gene_id "g179"; 3 AUGUSTUS CDS 229036 229599 0.88 + 0 transcript_id "g179.t1"; gene_id "g179"; 3 AUGUSTUS stop_codon 229597 229599 . + 0 transcript_id "g179.t1"; gene_id "g179"; # protein sequence = [MKVWPALGYASSFPSSSFNPFADDEELLGPLQDNDSDNETDSFSNAPSTPAATIVVPRSSYIKSMSPYQSKCSPRVEM # EITEMRSTFDIGEDGKLSGVREASVRLKALAPKALNQIDLKDDDDRLIDVVAINDVDRFLSRTATPTWSWEQDPKRSSLEKLKQLVYTRYSHKREEAE # SLRAFKYGSCF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g179 ### # start gene g180 3 AUGUSTUS gene 245191 245619 0.99 + . g180 3 AUGUSTUS transcript 245191 245619 0.99 + . g180.t1 3 AUGUSTUS start_codon 245191 245193 . + 0 transcript_id "g180.t1"; gene_id "g180"; 3 AUGUSTUS CDS 245191 245619 0.99 + 0 transcript_id "g180.t1"; gene_id "g180"; 3 AUGUSTUS stop_codon 245617 245619 . + 0 transcript_id "g180.t1"; gene_id "g180"; # protein sequence = [MSDPAQPAQPTPTPPTANDLMAQLIKQVANLATAMEEHSSARSSMNKPEVFKGKDSAEARCFMAQFQNWASEQPDLTK # SQAKLIKSALGFFTESAGDWATPLTSLPRFCVKEKGRNQMCTLTNQSNTQYASSLLSNLFNSKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g180 ### # start gene g181 3 AUGUSTUS gene 249974 251140 0.93 + . g181 3 AUGUSTUS transcript 249974 251140 0.93 + . g181.t1 3 AUGUSTUS start_codon 249974 249976 . + 0 transcript_id "g181.t1"; gene_id "g181"; 3 AUGUSTUS CDS 249974 251140 0.93 + 0 transcript_id "g181.t1"; gene_id "g181"; 3 AUGUSTUS stop_codon 251138 251140 . + 0 transcript_id "g181.t1"; gene_id "g181"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSASAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g181 ### # start gene g182 3 AUGUSTUS gene 251191 254907 0.85 + . g182 3 AUGUSTUS transcript 251191 254907 0.85 + . g182.t1 3 AUGUSTUS start_codon 251191 251193 . + 0 transcript_id "g182.t1"; gene_id "g182"; 3 AUGUSTUS CDS 251191 254907 0.85 + 0 transcript_id "g182.t1"; gene_id "g182"; 3 AUGUSTUS stop_codon 254905 254907 . + 0 transcript_id "g182.t1"; gene_id "g182"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPIFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g182 ### # start gene g183 3 AUGUSTUS gene 258257 260190 0.44 - . g183 3 AUGUSTUS transcript 258257 260190 0.44 - . g183.t1 3 AUGUSTUS stop_codon 258257 258259 . - 0 transcript_id "g183.t1"; gene_id "g183"; 3 AUGUSTUS CDS 258257 258895 0.55 - 0 transcript_id "g183.t1"; gene_id "g183"; 3 AUGUSTUS CDS 258976 260190 0.7 - 0 transcript_id "g183.t1"; gene_id "g183"; 3 AUGUSTUS start_codon 260188 260190 . - 0 transcript_id "g183.t1"; gene_id "g183"; # protein sequence = [MSSNWSCILFERNIVIHCEDSDAAFQHFYPLTLLESHSRRLKTKRETPTLSGRVTPFESIVKRFTFPAPRLHSIRRLT # NLNVAGVIPITVIDSQTGAIITVTTSIAAAPHTSTISSNTSTTSAISSPPSSAESSSSSNSTSITTPSSSSLNTPPPIQVLPQPVVQPSTSTPSNFNP # NPFPFPPWYPESAHFVRQWWPTLSNVPRISCTVVLLASHDPITHKTRFVLAQHYFRVPMRCADWVGFGERGKTGLGRRGMHNPDVDEDGADGVGNNGV # DGTSNATYASGVAATAGSSSSTPVASVSAIEQSLGPMEMYFLDGPPEGSVVAPFYEGSPAATASISVLSAGVDTASAVSPIGWTVNGSSSGSSCHSSS # PDGTNSSKAKGKGRARTAEDEDETTPSIDSHSRDPSPEDEDGDGVQERPRPLVAVDFGHAVWIEYYDQDGQSEMATAGSRRMHNAPAQHHVEQHQHDD # GNVIMQVIGHQHGHIYESVDDDEDKDSAHNSETDVEDGKADDDSETATATDPEEVGFEREESSAEQDEIREQEFQDHKRLRFVTFPPFTDDGRVNDIH # GGWGGAEVRTLEIPPELDLHSVETINIDQSQGAIILSVKQGRIFILCYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g183 ### # start gene g184 3 AUGUSTUS gene 273643 274251 0.88 + . g184 3 AUGUSTUS transcript 273643 274251 0.88 + . g184.t1 3 AUGUSTUS start_codon 273643 273645 . + 0 transcript_id "g184.t1"; gene_id "g184"; 3 AUGUSTUS CDS 273643 273748 0.88 + 0 transcript_id "g184.t1"; gene_id "g184"; 3 AUGUSTUS CDS 273815 274251 0.88 + 2 transcript_id "g184.t1"; gene_id "g184"; 3 AUGUSTUS stop_codon 274249 274251 . + 0 transcript_id "g184.t1"; gene_id "g184"; # protein sequence = [MNFTSASLPFAHKRFSNNRRVGFEERRGRWSRFKDKVVELIQTAIRAPTGSPSDGLGADGTESSTSTSVFIAAQKLLS # AEKDGEDWEINETVINGENPELLRNERDSGSPFRSDSGGGSISRHSGENGDSNYAYHPPSLRTKLHWLTMQINSFFNQKFDDPQTELDFRKLRWYSTK # AWAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g184 ### # start gene g185 3 AUGUSTUS gene 280183 280506 0.77 + . g185 3 AUGUSTUS transcript 280183 280506 0.77 + . g185.t1 3 AUGUSTUS start_codon 280183 280185 . + 0 transcript_id "g185.t1"; gene_id "g185"; 3 AUGUSTUS CDS 280183 280506 0.77 + 0 transcript_id "g185.t1"; gene_id "g185"; 3 AUGUSTUS stop_codon 280504 280506 . + 0 transcript_id "g185.t1"; gene_id "g185"; # protein sequence = [MSNKTDPALNVILQKIRLINFAEHADALRPGHKPIIVSIPEDSSKFQRGGMNVHIPLTFSDGVRWLARIRQKSTPSTR # LILESEIQTMQFLNAAGMQVPNAFMPRGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g185 ### # start gene g186 3 AUGUSTUS gene 281977 283419 0.99 - . g186 3 AUGUSTUS transcript 281977 283419 0.99 - . g186.t1 3 AUGUSTUS stop_codon 281977 281979 . - 0 transcript_id "g186.t1"; gene_id "g186"; 3 AUGUSTUS CDS 281977 283419 0.99 - 0 transcript_id "g186.t1"; gene_id "g186"; 3 AUGUSTUS start_codon 283417 283419 . - 0 transcript_id "g186.t1"; gene_id "g186"; # protein sequence = [MVYSRSMLTVVIAVGAASSALAAPMSSLPVAREVTPGVPFPTRSNPANLLVHPAAREFDVVIDHGRAHEVSILPVLPL # PPRCADFFVLQYVKVDEELKFNSDRPVGLERRQDSEKGLDPSPATAPDTFKPPTPTTQSHGGTKAKLTSMMNKVTQHPKFVSMMQNPKLLKLMQHPKI # APYANRLGLNGGEPAKNAAAVPTPPAENPVSPIASVAPQIPPLNFDRREVADPTPSDSNSFSPSPYAKSVRLARSFLAPRKDGDSQSGTSGPPSGNTG # IPPTSHQTSSAHGAQSVPHGPEGMSSGSCTNDPWYPPGPRRAERHQEAKYDPTNTFCRPGTLCGRSDNPEFEQWFMDLEGKGKMASVYLQTSTWAGFL # KTSVGQKVQQKGQEFEEYVLERMQKKWGPPLRPDPPLTSEEFPETFAKMERTTKLIDTYLYARTWSAFWESKIGQEVTGKGPLFKAFVQAQMENKWGP # PFDHHSSHQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g186 ### # start gene g187 3 AUGUSTUS gene 286855 287778 0.35 - . g187 3 AUGUSTUS transcript 286855 287778 0.35 - . g187.t1 3 AUGUSTUS stop_codon 286855 286857 . - 0 transcript_id "g187.t1"; gene_id "g187"; 3 AUGUSTUS CDS 286855 287778 0.35 - 0 transcript_id "g187.t1"; gene_id "g187"; 3 AUGUSTUS start_codon 287776 287778 . - 0 transcript_id "g187.t1"; gene_id "g187"; # protein sequence = [MESISLLLMSSVTTTTFPTTLAYYGAGIIGFFTLASFGMKKIFGCFRWIPFSRNDLSTNVIQDLRQTLSQRDAEIAEL # RESLSTAENRSTNTARELEASRKEIEHVNRTRTNLEKRAREALVGKEALEHELGTRAEELATSREDANTIQEALNQTKTLLDMRTAELKVAQAFLPRS # DRYAGADIMKMVESLNSEIHQTASIMADVFSPDLQGPGTVLGDGEVGLHEAAVHTEEILGEGMAKMLQTFNHQEENILLQIAFQASMCAFTEWIMDSW # CYHDRDSEVEAVLQETYEQLRETGKLWDVHPRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g187 ### # start gene g188 3 AUGUSTUS gene 295302 296286 0.68 + . g188 3 AUGUSTUS transcript 295302 296286 0.68 + . g188.t1 3 AUGUSTUS start_codon 295302 295304 . + 0 transcript_id "g188.t1"; gene_id "g188"; 3 AUGUSTUS CDS 295302 296052 0.68 + 0 transcript_id "g188.t1"; gene_id "g188"; 3 AUGUSTUS CDS 296201 296286 0.98 + 2 transcript_id "g188.t1"; gene_id "g188"; 3 AUGUSTUS stop_codon 296284 296286 . + 0 transcript_id "g188.t1"; gene_id "g188"; # protein sequence = [MVQIYTVLGALLAAGAASVLALPVSVSEVGIVTDVPSLLQPGFLKSQGWHSYSLDSLTVTDALSALRSIERQLRERQF # GVNEGKVWGTVDLAVIEPLEKRLIELSKEPTKDASYKQLLKSLISNLQSSQLLKDRLTTFSQSRNPSTLVKHALAILITQLRPAFQKQQPNSSDHILQ # KISTLSDFYQMKILSKWAGSSNDVKKQDVSKQDEELNAHIDEMVEAKDATSRYWAQVNFNKWFQAWLDLSQGERVSKAKRSSALKDIPVDQHRRRQLY # GDLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g188 ### # start gene g189 3 AUGUSTUS gene 297839 299692 0.9 - . g189 3 AUGUSTUS transcript 297839 299692 0.9 - . g189.t1 3 AUGUSTUS stop_codon 297839 297841 . - 0 transcript_id "g189.t1"; gene_id "g189"; 3 AUGUSTUS CDS 297839 299692 0.9 - 0 transcript_id "g189.t1"; gene_id "g189"; 3 AUGUSTUS start_codon 299690 299692 . - 0 transcript_id "g189.t1"; gene_id "g189"; # protein sequence = [MLDLSCSRIYDSQFELWHTSRSPFASLIGTNHVPTLSELNQLESLLVFPYNEHHRLTTEIRRVQTILNGLIHEQQLIE # KYIEAHKALMSPVRRLPSETLSEIFKWCLPNDLPYAVRNPSQAPLIFTTICRAWRRTAINTPGLWNSLHVYLPPHLSGATCSRRINGFTTWLKRSGSL # PLSISFHGSTTITLDTTPSIPCCPDENMEMAINSLMQFSDRFGELFLSLSSVDFSAFYRLSPPRFPILRSLQIRDEDFHRGKIRNLGPEVEQMHSSYF # TALLSRMPVLKELQMRKFTVADDRYSSLPCNWEHITKLEITATLGPDQVITILSSTPKMESITLSIGLSTPHVFHDLRVVQLNNLVEMKLTFLRLFTQ # VSMTMHRPDVISAFEAEITSIFDCIQCTALYSLSFLCHHVLLSRLPFIGLPLHALETLELTMPMTVEMMADCISKTPNLVNFQLTDLDDVSTGPQLHA # DPLQESYLQRLTPSSDSPTAPLWWPKLQNIRILSRLMSPYAYRYANAFSTSTLTRFLKTRSESNSLSVPRLKSCDILFRQRPAFSEAELQTLRNLKEK # RGLKLRLNGARCPSVWEFGPDSPETGLVEPLNGTKLSDMECIFGTDVIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g189 ### # start gene g190 3 AUGUSTUS gene 301111 302478 0.48 - . g190 3 AUGUSTUS transcript 301111 302478 0.48 - . g190.t1 3 AUGUSTUS stop_codon 301111 301113 . - 0 transcript_id "g190.t1"; gene_id "g190"; 3 AUGUSTUS CDS 301111 302057 1 - 2 transcript_id "g190.t1"; gene_id "g190"; 3 AUGUSTUS CDS 302157 302478 0.48 - 0 transcript_id "g190.t1"; gene_id "g190"; 3 AUGUSTUS start_codon 302476 302478 . - 0 transcript_id "g190.t1"; gene_id "g190"; # protein sequence = [MRFLRSSGLPIPEVYDYSPSSDNAAKTEYIFMEFIRGTNFSDVWLDLEEAEINSVLRQLVQLESRMMSIHFPAGGSLY # YTEDLEKMTGRKGILLNDERFCVGVDARVHESAEAALEAVARKEIAYLRQFGQPMLPFQRERREYYEYKEQLPSDHIKNLERYLLMAPLLIPKDPALH # HFCIRHPDLQPSNIIVSRSPESNQLKVVSLLDWQHASILPPFLLAGIPDRFQNYNDPISEALIPPSLPVNLNKLNESEQNRERSLYHSRLFHLHYVKN # TKEYNRRHLDLIIDPISMFLCRLFDGAGAPWEGETHTLKTALIKATEVWARLVGQGEAVPCPVVFDPEDLRQTKELSEKLQAVDEAFEECQAMIGLGP # ETWVTNEQYEMAVALGELVKQKVLARIPEEDRARTEAHWFLDDMDEKDYF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g190 ### # start gene g191 3 AUGUSTUS gene 312266 312718 0.71 - . g191 3 AUGUSTUS transcript 312266 312718 0.71 - . g191.t1 3 AUGUSTUS stop_codon 312266 312268 . - 0 transcript_id "g191.t1"; gene_id "g191"; 3 AUGUSTUS CDS 312266 312718 0.71 - 0 transcript_id "g191.t1"; gene_id "g191"; 3 AUGUSTUS start_codon 312716 312718 . - 0 transcript_id "g191.t1"; gene_id "g191"; # protein sequence = [MLLVSVFRNNAMRVSMNSLSLPPSTISSIINNPSLLQYSSDFTNFGLTSSQADYILVQGFNKGFKDVFFLNTALTVLA # FVASVVMIRHKELLRGDEEALKKEAKEALVSEKVPGTRKDVVALNIEQGRISEMDDVRREDVEMGSVSSPER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g191 ### # start gene g192 3 AUGUSTUS gene 323455 324694 0.46 + . g192 3 AUGUSTUS transcript 323455 324694 0.46 + . g192.t1 3 AUGUSTUS start_codon 323455 323457 . + 0 transcript_id "g192.t1"; gene_id "g192"; 3 AUGUSTUS CDS 323455 323946 0.46 + 0 transcript_id "g192.t1"; gene_id "g192"; 3 AUGUSTUS CDS 323999 324694 0.76 + 0 transcript_id "g192.t1"; gene_id "g192"; 3 AUGUSTUS stop_codon 324692 324694 . + 0 transcript_id "g192.t1"; gene_id "g192"; # protein sequence = [MNDSILFAGILFALSFILSVRLNRRRTEDSTHPLWSLILIQLCGSDIGRLQPTPQYRLYYSEEDITNLDPNKTISGCD # VEVIPDFCILLHCAARDQQGTLKSILANTMPIRLPSHSRAIEITSSFVPLLVELKRPVSRNCMHIDQFMSGLGTMMNSAQFQAMDQANCLFSIPNFRR # QQEVVLIAAVGEWWSFRFVPRSGFVDTFDGEAYVLDRAEYLKKEQRNNPEAEEYKTKLMDPADIQGMEHYDVQAAQETAQQTKARHDQERNERQRRRV # AQRTILHQDALNLQHFVDETQAKLDGIYGNNDINNYSRLRSACDKDWQDVWHLGIVDFMEPEVKEKSMLALNHRAEWSGVMRLGSQTSDSYLNQIQEY # LRQFVQDHPTVDVGSNANVNQSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g192 ### # start gene g193 3 AUGUSTUS gene 329138 329447 0.69 - . g193 3 AUGUSTUS transcript 329138 329447 0.69 - . g193.t1 3 AUGUSTUS stop_codon 329138 329140 . - 0 transcript_id "g193.t1"; gene_id "g193"; 3 AUGUSTUS CDS 329138 329375 0.69 - 1 transcript_id "g193.t1"; gene_id "g193"; 3 AUGUSTUS CDS 329428 329447 0.7 - 0 transcript_id "g193.t1"; gene_id "g193"; 3 AUGUSTUS start_codon 329445 329447 . - 0 transcript_id "g193.t1"; gene_id "g193"; # protein sequence = [MSSKSEKFLQVFPMVFDVDQLPPVVNSVIDGYRAPHYALGWVIPVDEAKELFGETPEDRRTLNYYNTVVLAEGWRNVK # EKDLYVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g193 ### # start gene g194 3 AUGUSTUS gene 329844 330296 0.54 + . g194 3 AUGUSTUS transcript 329844 330296 0.54 + . g194.t1 3 AUGUSTUS start_codon 329844 329846 . + 0 transcript_id "g194.t1"; gene_id "g194"; 3 AUGUSTUS CDS 329844 330296 0.54 + 0 transcript_id "g194.t1"; gene_id "g194"; 3 AUGUSTUS stop_codon 330294 330296 . + 0 transcript_id "g194.t1"; gene_id "g194"; # protein sequence = [MITVLLDTFNGKAYVLDRAEYLKKKQRNNPEAEEYKTKLMDSTDIQETEHYDVQAAQQTKARHDKEQNERQRRRMAQR # TSLHQDHMHTTLDFSYVIWNCMELHRIAWIGAAGVTEQILCSVDPIQLYTVLIPTSPTTSPVQVQHVSPNEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g194 ### # start gene g195 3 AUGUSTUS gene 331207 331563 0.8 - . g195 3 AUGUSTUS transcript 331207 331563 0.8 - . g195.t1 3 AUGUSTUS stop_codon 331207 331209 . - 0 transcript_id "g195.t1"; gene_id "g195"; 3 AUGUSTUS CDS 331207 331442 0.84 - 2 transcript_id "g195.t1"; gene_id "g195"; 3 AUGUSTUS CDS 331488 331563 0.81 - 0 transcript_id "g195.t1"; gene_id "g195"; 3 AUGUSTUS start_codon 331561 331563 . - 0 transcript_id "g195.t1"; gene_id "g195"; # protein sequence = [MVDPRVNHLSEEEEIIMQTAGTLYEVCLSILPEIPAGADTGKTALRTFILAMTCFPKAQRDAQEEIDCVIGQERLPDY # EDIVDDSDASVSLPYFRAVVLECFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g195 ### # start gene g196 3 AUGUSTUS gene 341745 342266 0.36 + . g196 3 AUGUSTUS transcript 341745 342266 0.36 + . g196.t1 3 AUGUSTUS start_codon 341745 341747 . + 0 transcript_id "g196.t1"; gene_id "g196"; 3 AUGUSTUS CDS 341745 341799 0.69 + 0 transcript_id "g196.t1"; gene_id "g196"; 3 AUGUSTUS CDS 341917 342266 0.36 + 2 transcript_id "g196.t1"; gene_id "g196"; 3 AUGUSTUS stop_codon 342264 342266 . + 0 transcript_id "g196.t1"; gene_id "g196"; # protein sequence = [MHYSVLQQSDNDPVHHINVAFCIATDVCLAMYAGVLYLQSSQWLSLKPLPSPIATLERSTYIRFDELYANRSRSIVYD # PIINLPRVSVQTSSRQQGKSIHYPDETLITDNGLVPVYSVKLQVSSEVNLIIHELL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g196 ### # start gene g197 3 AUGUSTUS gene 343670 345154 0.98 - . g197 3 AUGUSTUS transcript 343670 345154 0.98 - . g197.t1 3 AUGUSTUS stop_codon 343670 343672 . - 0 transcript_id "g197.t1"; gene_id "g197"; 3 AUGUSTUS CDS 343670 345154 0.98 - 0 transcript_id "g197.t1"; gene_id "g197"; 3 AUGUSTUS start_codon 345152 345154 . - 0 transcript_id "g197.t1"; gene_id "g197"; # protein sequence = [MHSPFDRILAPVSSGAGTMAPRASSSQIASRTLLDDPFATQSIPTPSKYDNNNKPSIHDPFSDPFATPTTSSPQQSQQ # PKQLPSKLTNRKPKKGCEITPNPLRPNVRAADRIHAWNTPYSIQKRLEESNSLPAKVIELGEQVMAKGTVKSTKEVYAAGLLRYNQFGDLMGISEDDR # MPASDRLIIGFIGHYAGKVSGKSISNWLSGLRLWHETMGAPWPADSRRIRQARRGANIEGSHHKRSPRHPITIEHMRALHKALNFSIHFHCAVWALAC # TAFLACRRLGELTIPSQNAFNPKFHVSRNTNSITFTSKPASVHFHIPWTKTTKEEGASVVATSPLGDNMEFMCPSKAIQRHLAKNADIPEDSSLFGYI # DENGKPQHMVKKVFLEFCFDIWNHAALQSVLGHSFRIGGAVWLLLAGVPPEIVAATGGWTSLAFLLYWRRLESIIPQHITKAYEKSQWNTLRDKVDSF # RKTNKISNKFIEACVTGNDIEIEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g197 ### # start gene g198 3 AUGUSTUS gene 346443 348474 0.56 - . g198 3 AUGUSTUS transcript 346443 348474 0.56 - . g198.t1 3 AUGUSTUS stop_codon 346443 346445 . - 0 transcript_id "g198.t1"; gene_id "g198"; 3 AUGUSTUS CDS 346443 347290 0.62 - 2 transcript_id "g198.t1"; gene_id "g198"; 3 AUGUSTUS CDS 347391 348474 0.86 - 0 transcript_id "g198.t1"; gene_id "g198"; 3 AUGUSTUS start_codon 348472 348474 . - 0 transcript_id "g198.t1"; gene_id "g198"; # protein sequence = [MKGFQTYPSLARENRARKTHKTDEISSLFKKMDIGLKLKLNFRIDKENRKRREKSLEFQLGNSVDDASDIASFVTIDT # ISLDNVRKDPTTFERLKDFLTTDTLDFFRQRNEEEGDRRSRVRGREEEAEEGARKKRKSGKVTLVPRSAGPRVTTFDTLLFDTIDAFPIFPLFLFTNK # NLDLINTHMPELKRAKISHIEGKPHVLDLKEIAKWVKETGGIFRDEDLDFIQWSQAAKNFYQFECLRDEDLGKEAPRALFYVEHFAFFLNQQDSEDFF # AYWLKVEVKLRKEHQSKLYAFDSDTYEREWTLVRAERISDAKYTSSSSAPPPTQTPSSKMTSQKPGTLPSTIQKPFPSGNKERTAAPSRQQERLYAGT # GTFEDNVEAATRNTAAHSAAAPPTTHSNGNVLSSPLSPREDLRDFPTSPPLIFHNFADSIITRQAFPGTSAEHAELYERIVTPYNADAFEHELKTNNI # FDRHPLLVNILRNGAPLGEMPQLTKSVIIPNHTSVAKFPQVVKDYLAEEKLKGRMSGPFPITEIEFIMRGPIVSSPLIVAEQIQAPGIPTKYRVCRHL # SKDGKDEDGNRFPSVNSFIAKDLFPTSFDTASKVAELVSPILLHIPHLTLPNSIPIFQYLFRIFQNDSFLIPHSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g198 ### # start gene g199 3 AUGUSTUS gene 354090 354608 0.99 + . g199 3 AUGUSTUS transcript 354090 354608 0.99 + . g199.t1 3 AUGUSTUS start_codon 354090 354092 . + 0 transcript_id "g199.t1"; gene_id "g199"; 3 AUGUSTUS CDS 354090 354608 0.99 + 0 transcript_id "g199.t1"; gene_id "g199"; 3 AUGUSTUS stop_codon 354606 354608 . + 0 transcript_id "g199.t1"; gene_id "g199"; # protein sequence = [MKIFLVRTWRHPEEVGSTYLDSDTRDEEELIPALIDAPNEMWTLSIDRVPYYTTFQDGKWVKGGSERYNADVGILMGS # FVMPESGKNLLHDSLKSSPSADMDVLWIYNTMRSLELNIRKHFDINIDLVANYLPYMKVMLEKKGSGAYGLITRNEEGRYMQTLKHLFPGNSGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g199 ### # start gene g200 3 AUGUSTUS gene 366239 367456 0.33 - . g200 3 AUGUSTUS transcript 366239 367456 0.33 - . g200.t1 3 AUGUSTUS stop_codon 366239 366241 . - 0 transcript_id "g200.t1"; gene_id "g200"; 3 AUGUSTUS CDS 366239 367456 0.33 - 0 transcript_id "g200.t1"; gene_id "g200"; 3 AUGUSTUS start_codon 367454 367456 . - 0 transcript_id "g200.t1"; gene_id "g200"; # protein sequence = [MIGVGGNNGTTLCATILANRHNIVWHTKQGIQQPNYIGSLLRASTVRIGTEASTGKDVHVPVSDVLPMVHPNDLVLGG # WDISGVPLEKAMQRAQVLDYDLQRQVAPHMALLGKPLPSIYYPDFIAANQETRADNLIPGQDKQAHLEHIRADIRKFKKDNGLDRAVVFWTANTERYS # DIIPGVNDTAENLLSSIKSSHPEVSPSTLFAVAAILEGEPFINGAPQNTFVPGVIALAELHKSFIGGDDLKSGQTKLKSVLAEFLVNAGIKPLSISSY # NHLGNNDGRNLSAEKQFRSKEISKSSVVDDMVDANRVLYKAPEVGEKGVPVGKGEHPDHIVVIKYVPAVGDSKRAIDEYYSEIFCGGRNTISIFNECE # VYFTSCSTFTELTPVDIGLPPRYTTHSRPYHSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g200 ### # start gene g201 3 AUGUSTUS gene 370873 371382 0.97 - . g201 3 AUGUSTUS transcript 370873 371382 0.97 - . g201.t1 3 AUGUSTUS stop_codon 370873 370875 . - 0 transcript_id "g201.t1"; gene_id "g201"; 3 AUGUSTUS CDS 370873 371382 0.97 - 0 transcript_id "g201.t1"; gene_id "g201"; 3 AUGUSTUS start_codon 371380 371382 . - 0 transcript_id "g201.t1"; gene_id "g201"; # protein sequence = [MYSGGEQGSILYDDTVDEADLVPSLIDPHNEMWALNLDGIGYASKPSKDKWIEGGPKEFSAKAGILLGKLEVDSSKKK # EARTKLIEALNKVSPAEMDVLYIYNLLALIETQALALPSFKQKIALREEYLPYMKVMLEKNGSGARVRITQEEEQRYKRTLGHLFPKSGGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g201 ### # start gene g202 3 AUGUSTUS gene 372569 373141 0.8 - . g202 3 AUGUSTUS transcript 372569 373141 0.8 - . g202.t1 3 AUGUSTUS stop_codon 372569 372571 . - 0 transcript_id "g202.t1"; gene_id "g202"; 3 AUGUSTUS CDS 372569 373141 0.8 - 0 transcript_id "g202.t1"; gene_id "g202"; 3 AUGUSTUS start_codon 373139 373141 . - 0 transcript_id "g202.t1"; gene_id "g202"; # protein sequence = [MKPKRQPVDWEEVVEYTFLSEFDILRDTREDIRECPWAVPANRVIITQFFKVIGAEDELSHVHQEIRRLITYMQREKD # ELTTRERELMPTNPTLALQVRNFCRERGRFHEVHRKRLLSITKLPGFDWSTNRKYFLPGTPVERRNDHTSYGAEDLTAERQVDEDNTDDDEDEELVRR # IDTFLSVATDVLEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g202 ### # start gene g203 3 AUGUSTUS gene 378507 379573 0.94 + . g203 3 AUGUSTUS transcript 378507 379573 0.94 + . g203.t1 3 AUGUSTUS start_codon 378507 378509 . + 0 transcript_id "g203.t1"; gene_id "g203"; 3 AUGUSTUS CDS 378507 379117 0.94 + 0 transcript_id "g203.t1"; gene_id "g203"; 3 AUGUSTUS CDS 379222 379573 1 + 1 transcript_id "g203.t1"; gene_id "g203"; 3 AUGUSTUS stop_codon 379571 379573 . + 0 transcript_id "g203.t1"; gene_id "g203"; # protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVTHVFSKHGVPNHVTSDRGSEFVSAFFRALGKA # LSMELHYTSGNHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPITEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDEL # HVFLREEILLAQSRYKEQADRKRISHPDRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKR # CPLCYYIQWAGYKGTEDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g203 ### # start gene g204 3 AUGUSTUS gene 387063 388904 0.27 - . g204 3 AUGUSTUS transcript 387063 388904 0.27 - . g204.t1 3 AUGUSTUS stop_codon 387063 387065 . - 0 transcript_id "g204.t1"; gene_id "g204"; 3 AUGUSTUS CDS 387063 388630 0.54 - 2 transcript_id "g204.t1"; gene_id "g204"; 3 AUGUSTUS CDS 388755 388791 0.31 - 0 transcript_id "g204.t1"; gene_id "g204"; 3 AUGUSTUS CDS 388884 388904 0.7 - 0 transcript_id "g204.t1"; gene_id "g204"; 3 AUGUSTUS start_codon 388902 388904 . - 0 transcript_id "g204.t1"; gene_id "g204"; # protein sequence = [MRYPENLLCGWNNPQGGVPTALSSEIVQSGAEGGTEELERGVNIKKIHEGTFQPPPEVPQQPPEAPLKAPRMKVKLEE # VKDKEYKSRQPGPHELFPSEKDLGPDDPILMGINEWLVFASESMEQEVEENLEAGQSAMEARTPQPAKDSEEAYQKWKSRDTERSSSWPGAKQKVRWR # KKRREHGPYPNLPTLDIESLSIPRIPSRSGLTPKGSIRHNNFRRKQLIVGIHVVERKSDPTIQGKPISLIGAAGIDRLLREGTPAYFLHISPTKEESP # TKEMLRASDSSSSEGVQQPKDSESGNPSPEQGGIVKGLDKEASKRQETEELKKSIPVQYQDYLDVFSPGEARTLPLHRPYDIKIEMEGDAIPPIGKLY # NMSEKELKSLKEYIDEMLGKGFIQSSSSPAGAPVLFAKKKDGTLQLCVDYRVLNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLHAEYNKVRVAQGH # KWKTAFRTWYGSFEYLVMPFGLTNAPSAFQFFMNEIFHNMVDVCVVIYLDDILIYSDDEESHVEHVRKVLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g204 ### # start gene g205 3 AUGUSTUS gene 389614 391500 0.61 - . g205 3 AUGUSTUS transcript 389614 391500 0.61 - . g205.t1 3 AUGUSTUS stop_codon 389614 389616 . - 0 transcript_id "g205.t1"; gene_id "g205"; 3 AUGUSTUS CDS 389614 391500 0.61 - 0 transcript_id "g205.t1"; gene_id "g205"; 3 AUGUSTUS start_codon 391498 391500 . - 0 transcript_id "g205.t1"; gene_id "g205"; # protein sequence = [MDGEQHSARISGQDLTARLVPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGAENQRGPNQRRMLAVHEEAVPPQGAPFG # TPFVTGAQMNQPGMAVELARSQQLVVMIQQQARVIKMLQEQLREVRKGFAAGGIPTGGPPSKTGNTAGLFGQVPMEMIENTRGGPSPIVPQPRSWQAT # EPIPFTRRTPMGVREGNPREEQSAPLPATPSMDRRRIQEWGAHVQRAELGEYVRPEGGRYTLEDGGIAANRGDRGGFKPPNRAPPPHLSNHSRDRERP # PSQGEWDHRGQVGRSGGGAPPPPPSGGPGDNDSEGSNEGEHTGSSREGGRNEDDRRELPTGAPEVPPTRYDPDQPWYYDPRQGWHRKVAPRPPNEGRN # MWESNEEKNWITIESKLDVGKIKSFAGDDWSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQQMRGEYTCLEDWTEFKREF # SSKFGPIDEADEARRRLAWMKQMPEESFANFFICFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDKWTRVFMKLDGAVRAQAESLRN # LHGEKTLQGWLNRFPRLELAPEAPYKSPLHRERDPADIWTSNPRPAVTGGFQNRSNWKDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g205 ### # start gene g206 3 AUGUSTUS gene 397131 398570 0.42 + . g206 3 AUGUSTUS transcript 397131 398570 0.42 + . g206.t1 3 AUGUSTUS start_codon 397131 397133 . + 0 transcript_id "g206.t1"; gene_id "g206"; 3 AUGUSTUS CDS 397131 398570 0.42 + 0 transcript_id "g206.t1"; gene_id "g206"; 3 AUGUSTUS stop_codon 398568 398570 . + 0 transcript_id "g206.t1"; gene_id "g206"; # protein sequence = [MLWATRLPKKEIDVTLKTVEHGITLLRDIDEKRSQRELLGEIKGAVESSFAKLDIEKQLQHQLTQVRNEFNERLDSIA # ANINGTEEKIDSIAKKSQSATPEISYADITRTNGKRTMAPTQAMTRQRMRAHVEVKHRQILILNTGNDAGKEIISKNPGEMLEYLNNMLIKMGALNKG # TFVSATKLKNTDNLLTEVSSPELADWIHRVEQMIQFTTLSGQALTIADKEYEIILHFVPTTFGADDAFELRRLEDINDLPTCSIARAKWAKAVQRRKE # GQRVASLLLYLNNANAANRLLLSGAVIGNKRVEAEKTVREEKRCYKCQRFGHIARQYTEEVENICGKCGEHHNTANCSSEKRYCINCKTDEHASLDRE # CPIFRQKCESLNKRSPTNLLPFFPSDEEWTWVEEPDNAPRMGSPPKITFHQDRHRQRQTQLTGWQQSNQLNVNTLPLGGPLRWGSQDPTGSQNEIADI # RDENQGSLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g206 ### # start gene g207 3 AUGUSTUS gene 399161 400425 0.34 + . g207 3 AUGUSTUS transcript 399161 400425 0.34 + . g207.t1 3 AUGUSTUS start_codon 399161 399163 . + 0 transcript_id "g207.t1"; gene_id "g207"; 3 AUGUSTUS CDS 399161 399332 0.34 + 0 transcript_id "g207.t1"; gene_id "g207"; 3 AUGUSTUS CDS 399416 400425 0.73 + 2 transcript_id "g207.t1"; gene_id "g207"; 3 AUGUSTUS stop_codon 400423 400425 . + 0 transcript_id "g207.t1"; gene_id "g207"; # protein sequence = [MILPPTIPTYRVASTGIWTRPDNVFLSEATVQALVSCDVTPEAMTNGADHIPISTVLKELEKIPLPHEITTQQLLNTA # VQDITRTIQLAIEKAIPLSQPYPASKRWWTSELSEMKKALNRLSAKSYKYRAIPDDDSHRELRELRTQYKALIFKEKEEHWKDFLDNVDTDSIFTAAK # YATTPNIDQDTTTVIPELKALDENGAVRRIASTNEKKAALLAETFFPPAPRNYSLDCNPCRDQLPSPPPITQQRIIDVLQRLKSYKAPGPDGIPNIIL # KKCAGMLVPYLCKIYNAIGYLKAYPKEWLNSTTVVIRKPARKSYSLPKSYRPIALINMLAKGYTSIIAEDITFLATQHNLLPDTQFGGRPCRMTTDGI # HMVIDKIKNAWRNKERLPCYP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g207 ### # start gene g208 3 AUGUSTUS gene 404321 404740 0.53 - . g208 3 AUGUSTUS transcript 404321 404740 0.53 - . g208.t1 3 AUGUSTUS stop_codon 404321 404323 . - 0 transcript_id "g208.t1"; gene_id "g208"; 3 AUGUSTUS CDS 404321 404740 0.53 - 0 transcript_id "g208.t1"; gene_id "g208"; 3 AUGUSTUS start_codon 404738 404740 . - 0 transcript_id "g208.t1"; gene_id "g208"; # protein sequence = [MSIRLSSSTSGSIVPTNKMTGRLYFRLPNYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHA # FLREEILLAQSRYKEQADRKRILHPEFLIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g208 ### # start gene g209 3 AUGUSTUS gene 405716 408206 0.32 - . g209 3 AUGUSTUS transcript 405716 408206 0.32 - . g209.t1 3 AUGUSTUS stop_codon 405716 405718 . - 0 transcript_id "g209.t1"; gene_id "g209"; 3 AUGUSTUS CDS 405716 408027 0.65 - 2 transcript_id "g209.t1"; gene_id "g209"; 3 AUGUSTUS CDS 408095 408206 0.34 - 0 transcript_id "g209.t1"; gene_id "g209"; 3 AUGUSTUS start_codon 408204 408206 . - 0 transcript_id "g209.t1"; gene_id "g209"; # protein sequence = [MFHKILFLRPKSLLLIFVSLMVHYLLNPLPIWQTSPFVLGYSFLSCYNPLIDWASRNITFRNTSHFDSPQTSVPSAIN # PVVAKVAVPLLEPSPSVSLTILETPLGDSLHSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHS # EVAARAADRSSTAPTVPPLHHSIPEEYAEFADVFNEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHSS # PVLFVPKKDGKLWLCVDFRGLNRITKKDRYPLPLISDLLDAPKQAKIYTKLDLTHAYHLVRIAEGDEWKTTFRTHYGSYEWKVMPFGLTNAPAAFQCF # VNDIFSDMLDVCVIVYLDDILIYSNTPEEHREHVKEVLRRLRKHRLYANPDKCKFNMDTIEYLGYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFL # GFANFYRCFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETNTSDYAIAAILSIQTVDGEIHPLAFLSRTLHA # AELNYDTHDKELLAIFEAFKAWRHYLEGPGDPVDVVTDHKNLEYFSTTKILTRRQVRWSEYLHQFNMVIRFRPGKLGEKPDSITRRWDIYPKEGDIGY # VQVNPHNFRPIFTNEQLTTSLRATFLEGPMLRASIVMDIEALHQAIILALPKDPSSIVGLELAKDPSNECWSLGSDGLLRLDDRIYVPNHGDLCLQVL # LLRSCIPCNRAKATGCLSAEDKWDSSEVINNTAVTPLVPGERE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g209 ### # start gene g210 3 AUGUSTUS gene 408447 409840 0.47 - . g210 3 AUGUSTUS transcript 408447 409840 0.47 - . g210.t1 3 AUGUSTUS stop_codon 408447 408449 . - 0 transcript_id "g210.t1"; gene_id "g210"; 3 AUGUSTUS CDS 408447 409775 0.86 - 0 transcript_id "g210.t1"; gene_id "g210"; 3 AUGUSTUS CDS 409835 409840 0.49 - 0 transcript_id "g210.t1"; gene_id "g210"; 3 AUGUSTUS start_codon 409838 409840 . - 0 transcript_id "g210.t1"; gene_id "g210"; # protein sequence = [MGENDRGCVLYDSDPPPPFDLDTGDHDNQDPAVDPEDLGADNNNDDLDDDSGGLPRGEPGEPGDPSGPGGPGGPGGPG # GPRSPLSPDIPNEQRAMLELLLGFKGSIETLGTVLAALGRPSDSSESKSKVKKPEVFDGSDPRKLKTFFVNLALAFNDRPKYFTNQRKVNYTLSYLSG # SAKEWFVPDILDPDLDLLPAWTSSFKALVKELQDNFGVYDAQGKAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMA # HLPEPATLTDYCQEVLRIDNRYWKREETRKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGG # QRPAFNHLGADRKVLPSEQERRMKNNLCLFCGGKHQIAVCNKQKARESKGHAAKVEETPEATIEVVEEELEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g210 ### # start gene g211 3 AUGUSTUS gene 410502 411668 0.87 + . g211 3 AUGUSTUS transcript 410502 411668 0.87 + . g211.t1 3 AUGUSTUS start_codon 410502 410504 . + 0 transcript_id "g211.t1"; gene_id "g211"; 3 AUGUSTUS CDS 410502 411668 0.87 + 0 transcript_id "g211.t1"; gene_id "g211"; 3 AUGUSTUS stop_codon 411666 411668 . + 0 transcript_id "g211.t1"; gene_id "g211"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPKVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g211 ### # start gene g212 3 AUGUSTUS gene 411719 415435 0.92 + . g212 3 AUGUSTUS transcript 411719 415435 0.92 + . g212.t1 3 AUGUSTUS start_codon 411719 411721 . + 0 transcript_id "g212.t1"; gene_id "g212"; 3 AUGUSTUS CDS 411719 415435 0.92 + 0 transcript_id "g212.t1"; gene_id "g212"; 3 AUGUSTUS stop_codon 415433 415435 . + 0 transcript_id "g212.t1"; gene_id "g212"; # protein sequence = [MFTTSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAASHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESTSERLPAYQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNQYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRHFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDHIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCSRK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGTYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g212 ### # start gene g213 3 AUGUSTUS gene 418777 420435 1 + . g213 3 AUGUSTUS transcript 418777 420435 1 + . g213.t1 3 AUGUSTUS start_codon 418777 418779 . + 0 transcript_id "g213.t1"; gene_id "g213"; 3 AUGUSTUS CDS 418777 420435 1 + 0 transcript_id "g213.t1"; gene_id "g213"; 3 AUGUSTUS stop_codon 420433 420435 . + 0 transcript_id "g213.t1"; gene_id "g213"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPCRHNRGFGPATVPTTSTLPEAMEEGQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIESPILQAIARRAASESPRDPPPPFDLDTGDHDNQDPAVDPEDLGADNNNDDLDDDSGGLPRGEPGEPGDPSGP # GGPGGPGGPGGPRSPLSPDIPNEQRAMLELLLGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALAFNDRPKYFTNQRK # VNYTLSYLSGSAKEWFVPDILDPDLDLLPAWTSSFKALVKELQDNFGVYDAQGKAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRG # LAERIKDEMAHLPEPATLTDYCQEVLRIDNRYWKREETRKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQ # NSSNSGQSGGQRPAFNHLGADRKVLPSEQERRMKNNLCLFCGGKHQIAVCNKQKARESKGHAAKVEETPEATIEVVEEELEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g213 ### # start gene g214 3 AUGUSTUS gene 420768 423167 1 + . g214 3 AUGUSTUS transcript 420768 423167 1 + . g214.t1 3 AUGUSTUS start_codon 420768 420770 . + 0 transcript_id "g214.t1"; gene_id "g214"; 3 AUGUSTUS CDS 420768 423167 1 + 0 transcript_id "g214.t1"; gene_id "g214"; 3 AUGUSTUS stop_codon 423165 423167 . + 0 transcript_id "g214.t1"; gene_id "g214"; # protein sequence = [MANIAIRFPSGKLLLLPFYVTHLDSSCKAVLGYSFLSCYNPLIDWASRNITFRNTSHFDSPQTSVPSAINPVVAKVAV # PLLEPSPSVSLTILETPLGDSLHSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAARAAD # RSSTAPTVPPLHHSIPEEYAEFADVFNEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHSSPVLFVPKK # DGKLWLCVDFRGLNRITKKDRYPLPLISDLLDAPKQAKIYTKLDLTHAYHLVRIAEGDEWKTTFRTHYGSYEWKVMPFGLTNAPAAFQCFVNDIFSDM # LDVCVIVYLDDILIYSNTPEEHREHVKEVLRRLRKHRLYANPDKCKFNMDTIEYLGYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFYRC # FIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETNTSDYAIAAILSIQTVDGEIHPLAFLSRTLHAAELNYDTH # DKELLAIFEAFKAWRHYLEGPGDPVDVVTDHKNLEYFSTTKILTRRQVRWSEYLHQFNMVIRFRPGKLGEKPDSITRRWDIYPKEGDIGYVQVNPHNF # RPIFTNEQLTTSLRATFLEGPMLRASIVMDIEALHQAIILALPKDPSSIVGLELAKDPSNECWSLGSDGLLRLDDRIYVPNHGDLCLQVLLLRSCIPC # NRAKATGCLSAEDKWDSSEVINNTAVTPLVPGERE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g214 ### # start gene g215 3 AUGUSTUS gene 424143 424562 0.44 + . g215 3 AUGUSTUS transcript 424143 424562 0.44 + . g215.t1 3 AUGUSTUS start_codon 424143 424145 . + 0 transcript_id "g215.t1"; gene_id "g215"; 3 AUGUSTUS CDS 424143 424562 0.44 + 0 transcript_id "g215.t1"; gene_id "g215"; 3 AUGUSTUS stop_codon 424560 424562 . + 0 transcript_id "g215.t1"; gene_id "g215"; # protein sequence = [MSIRLSSSTSGSIVPTNKMTGRLYFRLPNYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHA # FLREEILLAQSRYKEQADRKRILHPEFLIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g215 ### # start gene g216 3 AUGUSTUS gene 425431 425796 0.21 - . g216 3 AUGUSTUS transcript 425431 425796 0.21 - . g216.t1 3 AUGUSTUS stop_codon 425431 425433 . - 0 transcript_id "g216.t1"; gene_id "g216"; 3 AUGUSTUS CDS 425431 425796 0.21 - 0 transcript_id "g216.t1"; gene_id "g216"; 3 AUGUSTUS start_codon 425794 425796 . - 0 transcript_id "g216.t1"; gene_id "g216"; # protein sequence = [MQEQEDLLPDAGWQEEFCHLQTLPRRQGMVLVLWAALDSEAGGGRKSVRRAPGGSGEPGGSATRQQPAASRWSGEGEH # LPSSHEPEAGLVGHGCLKEEKNATRIAGGWAVGFAEETMETCG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g216 ### # start gene g217 3 AUGUSTUS gene 425919 426347 0.4 - . g217 3 AUGUSTUS transcript 425919 426347 0.4 - . g217.t1 3 AUGUSTUS stop_codon 425919 425921 . - 0 transcript_id "g217.t1"; gene_id "g217"; 3 AUGUSTUS CDS 425919 426347 0.4 - 0 transcript_id "g217.t1"; gene_id "g217"; 3 AUGUSTUS start_codon 426345 426347 . - 0 transcript_id "g217.t1"; gene_id "g217"; # protein sequence = [MSTSQTTTTTTTKSSTTGPSRSRPAPQPPIDLTVPDGHREGDDEAIWQAEEKVCQMKARKAAAAAKKKAEEEAARKAA # EEAQRKKEVAARELEERRRRMAEAATARSRCGSSLGGSSVSPQRPVVEIRKDKGKGKGKAQVSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g217 ### # start gene g218 3 AUGUSTUS gene 427958 428449 0.33 - . g218 3 AUGUSTUS transcript 427958 428449 0.33 - . g218.t1 3 AUGUSTUS stop_codon 427958 427960 . - 0 transcript_id "g218.t1"; gene_id "g218"; 3 AUGUSTUS CDS 427958 428449 0.33 - 0 transcript_id "g218.t1"; gene_id "g218"; 3 AUGUSTUS start_codon 428447 428449 . - 0 transcript_id "g218.t1"; gene_id "g218"; # protein sequence = [MNYPNFRTKISAKYKVKIIGWPIDVPLVSPRDITDPSKLDTLYDAWRSGSAYWSTMDKQEYKRFIQQLDNDKAAGLQI # EIPRKGRSDIGGTHQKATAKHSRENDTEEPPAKCKRTSLSTSKTAVIVPEEDQNENDDDEENVEGENMEEENVEEEDEGEDELDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g218 ### # start gene g219 3 AUGUSTUS gene 429130 430653 0.25 - . g219 3 AUGUSTUS transcript 429130 430653 0.25 - . g219.t1 3 AUGUSTUS stop_codon 429130 429132 . - 0 transcript_id "g219.t1"; gene_id "g219"; 3 AUGUSTUS CDS 429130 430653 0.25 - 0 transcript_id "g219.t1"; gene_id "g219"; 3 AUGUSTUS start_codon 430651 430653 . - 0 transcript_id "g219.t1"; gene_id "g219"; # protein sequence = [MANHSFQHLLSSPDIPPLLFPQHPSRPLQENTGHYNPPSLRHPIQNPHFLRGFPAPPYSASQSRTNLRQIPAQSSMPG # PIAYSQPTSRIGFSSREAYTQPTPQIDFPSTGIEFSSGRSASLRDNIHQPRPDIMQRFQPANSRHYAPGSFSSDYDLPPHSDLSAVTSQQGRLGYSQR # GALQWKETVICSNVDASRLHSPISPHLSYSSPSLPTQNLGRSFSPGRSHHVVSILNNDINPTKTFSVPQSPQNPFPSREPSPTLAPLAGPCFGGRPLS # HEPLLTPLTSSSPQLSSHSPTLNSPSSLAHTAGPQLSSHSVSCGPLLFGEGSPSSICGRPGEADSSLVHSESNVIQSTLVSTGRPGEAESSLVHSESN # VIQSTPVSNGRPGEADSSLVHSESNVIQSTPVSTGQAEQVQHPIVNLGISEKSLAKATSALKTKLLNQAISQLQAEQEEKVVDLADTHGVAVSRLKKL # AGTSKHHRKRRVNSVQDAILHAKSKELNQGMITPRRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g219 ### # start gene g220 3 AUGUSTUS gene 432921 436628 0.99 - . g220 3 AUGUSTUS transcript 432921 436628 0.99 - . g220.t1 3 AUGUSTUS stop_codon 432921 432923 . - 0 transcript_id "g220.t1"; gene_id "g220"; 3 AUGUSTUS CDS 432921 436628 0.99 - 0 transcript_id "g220.t1"; gene_id "g220"; 3 AUGUSTUS start_codon 436626 436628 . - 0 transcript_id "g220.t1"; gene_id "g220"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTETDLEENEVITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLMRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQV # LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ # RHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLA # RLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE # ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNP # INGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g220 ### # start gene g221 3 AUGUSTUS gene 436679 437836 0.92 - . g221 3 AUGUSTUS transcript 436679 437836 0.92 - . g221.t1 3 AUGUSTUS stop_codon 436679 436681 . - 0 transcript_id "g221.t1"; gene_id "g221"; 3 AUGUSTUS CDS 436679 437836 0.92 - 0 transcript_id "g221.t1"; gene_id "g221"; 3 AUGUSTUS start_codon 437834 437836 . - 0 transcript_id "g221.t1"; gene_id "g221"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHISTGNSREAFLARMRGRCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPATPSPANQDFSTQIGQIRELLDRAN # AMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g221 ### # start gene g222 3 AUGUSTUS gene 438627 439514 1 - . g222 3 AUGUSTUS transcript 438627 439514 1 - . g222.t1 3 AUGUSTUS stop_codon 438627 438629 . - 0 transcript_id "g222.t1"; gene_id "g222"; 3 AUGUSTUS CDS 438627 439514 1 - 0 transcript_id "g222.t1"; gene_id "g222"; 3 AUGUSTUS start_codon 439512 439514 . - 0 transcript_id "g222.t1"; gene_id "g222"; # protein sequence = [MEPILLRAIHSEVAARAADCSSIAPTVPPLPPSIPAEYAEFADVFDEIAADSLPEHRPYNLKIDLEEGASPPLGRIYP # LSEKELVALKDFIDKQLATGAITPLSSPHGAPVLFVPKKDSKLRFCVDFRGLNRITKKDRYPFPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDE # WKTTFRTHYGSYEWKVMPFGLTNAPAAFQCFVNDIFSDMLDVCVIVYLDDILIYSNTPEEHREHVKEVLRRLRHHRLYANPEKCKFNMDTVEYLGYIL # SPDGLTMSKEKVQTVLEWPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g222 ### # start gene g223 3 AUGUSTUS gene 440341 441296 0.5 - . g223 3 AUGUSTUS transcript 440341 441296 0.5 - . g223.t1 3 AUGUSTUS stop_codon 440341 440343 . - 0 transcript_id "g223.t1"; gene_id "g223"; 3 AUGUSTUS CDS 440341 441048 0.82 - 0 transcript_id "g223.t1"; gene_id "g223"; 3 AUGUSTUS CDS 441168 441296 0.51 - 0 transcript_id "g223.t1"; gene_id "g223"; 3 AUGUSTUS start_codon 441294 441296 . - 0 transcript_id "g223.t1"; gene_id "g223"; # protein sequence = [MTQAQKSNQAASSTVITVAAGQCLMSIPEQSFGEETASNVRTPDNFSVYDAQGEAEDSLGNLKMKETENIQKYNIRFN # TLAASTNWDSGALKWAYGRGLAEHIKDEMARLPEPATLAAYRLEVLCIDNRYWKREETKKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAP # FTPKPKPFAGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIAVCNKQKARESKGHAAKVEETPEATIEVVEE # ELEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g223 ### # start gene g224 3 AUGUSTUS gene 455289 455639 0.97 + . g224 3 AUGUSTUS transcript 455289 455639 0.97 + . g224.t1 3 AUGUSTUS start_codon 455289 455291 . + 0 transcript_id "g224.t1"; gene_id "g224"; 3 AUGUSTUS CDS 455289 455639 0.97 + 0 transcript_id "g224.t1"; gene_id "g224"; 3 AUGUSTUS stop_codon 455637 455639 . + 0 transcript_id "g224.t1"; gene_id "g224"; # protein sequence = [MSTPVPPTPNTSAEDLMAQLIRQVASLATAMEEHSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPICYTSVQRIPLSEEIGIRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g224 ### # start gene g225 3 AUGUSTUS gene 456496 457617 0.99 + . g225 3 AUGUSTUS transcript 456496 457617 0.99 + . g225.t1 3 AUGUSTUS start_codon 456496 456498 . + 0 transcript_id "g225.t1"; gene_id "g225"; 3 AUGUSTUS CDS 456496 457617 0.99 + 0 transcript_id "g225.t1"; gene_id "g225"; 3 AUGUSTUS stop_codon 457615 457617 . + 0 transcript_id "g225.t1"; gene_id "g225"; # protein sequence = [MFATSSYDLLPSCTISSIWELNSSSPHFRIHAKLRGRNRSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGQITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIKEVEDEQTSRPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILKEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSDSA # SEQLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQG # A] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g225 ### # start gene g226 3 AUGUSTUS gene 463536 464183 0.57 + . g226 3 AUGUSTUS transcript 463536 464183 0.57 + . g226.t1 3 AUGUSTUS start_codon 463536 463538 . + 0 transcript_id "g226.t1"; gene_id "g226"; 3 AUGUSTUS CDS 463536 464183 0.57 + 0 transcript_id "g226.t1"; gene_id "g226"; 3 AUGUSTUS stop_codon 464181 464183 . + 0 transcript_id "g226.t1"; gene_id "g226"; # protein sequence = [MRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIAR # PLNNLTKKDTSFNWTGTQQEAFDTLREAFISAPILALWVPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEA # LKDFHNHSTLSPTTPTSNSGAQHKTSPVDKPDGPLSITV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g226 ### # start gene g227 3 AUGUSTUS gene 464242 465600 0.55 + . g227 3 AUGUSTUS transcript 464242 465600 0.55 + . g227.t1 3 AUGUSTUS start_codon 464242 464244 . + 0 transcript_id "g227.t1"; gene_id "g227"; 3 AUGUSTUS CDS 464242 465600 0.55 + 0 transcript_id "g227.t1"; gene_id "g227"; 3 AUGUSTUS stop_codon 465598 465600 . + 0 transcript_id "g227.t1"; gene_id "g227"; # protein sequence = [MAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDHIRKASERDAQVLEGLETVKKHGLQCLANGIAEWEEDNGLV # YYRGRVHVPADDNLRTKVLRQCHDHPIAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQWHPRAVTQPLDVPSGLWEEVGVDLITQLP # NSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVANIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEK # YICLYVGRRQDDWAEHLPMAEFVINSQTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIQILREARQDAGAALHLGKKQQKEGYERGKRKAHQ # FKVGDPVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPGILRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g227 ### # start gene g228 3 AUGUSTUS gene 467178 467600 0.53 + . g228 3 AUGUSTUS transcript 467178 467600 0.53 + . g228.t1 3 AUGUSTUS start_codon 467178 467180 . + 0 transcript_id "g228.t1"; gene_id "g228"; 3 AUGUSTUS CDS 467178 467600 0.53 + 0 transcript_id "g228.t1"; gene_id "g228"; 3 AUGUSTUS stop_codon 467598 467600 . + 0 transcript_id "g228.t1"; gene_id "g228"; # protein sequence = [MGLGPTLVNSETRPKTSSGQILAGLDKASVDFEPSFYSSTTSEETNFGLSTESGKDFKDLELMSMDPGPTFFGWLSSG # PMSMVQNYCDGFRNVTSPESMLMGSGPMSASPESIDIGFELLSMGLGMSTSPEPLSMGSGLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g228 ### # start gene g229 3 AUGUSTUS gene 468203 469005 0.72 - . g229 3 AUGUSTUS transcript 468203 469005 0.72 - . g229.t1 3 AUGUSTUS stop_codon 468203 468205 . - 0 transcript_id "g229.t1"; gene_id "g229"; 3 AUGUSTUS CDS 468203 468480 0.91 - 2 transcript_id "g229.t1"; gene_id "g229"; 3 AUGUSTUS CDS 468579 468704 0.87 - 2 transcript_id "g229.t1"; gene_id "g229"; 3 AUGUSTUS CDS 468753 469005 0.74 - 0 transcript_id "g229.t1"; gene_id "g229"; 3 AUGUSTUS start_codon 469003 469005 . - 0 transcript_id "g229.t1"; gene_id "g229"; # protein sequence = [MAQVGLTMGARHIPASMRKVGYGTSYYRKLSDESKQLHDEDAIAASGIFWSMALSTMPAEVTAPMVETLSNCNIPHMA # TQYVAPGKGFHLQIGERHMIYPNVNRAPPELYMISGYSAYVLSDIICLSRQNINIPAYGGANFVNANLLVVVVGAVGTIFAFDPSHVHGTTVTGGTQN # LNLTFAFSKKVGDSFAELDAQDRLAFGESNWGAGKGNLDYET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g229 ### # start gene g230 3 AUGUSTUS gene 473767 474399 0.96 + . g230 3 AUGUSTUS transcript 473767 474399 0.96 + . g230.t1 3 AUGUSTUS start_codon 473767 473769 . + 0 transcript_id "g230.t1"; gene_id "g230"; 3 AUGUSTUS CDS 473767 474399 0.96 + 0 transcript_id "g230.t1"; gene_id "g230"; 3 AUGUSTUS stop_codon 474397 474399 . + 0 transcript_id "g230.t1"; gene_id "g230"; # protein sequence = [MEYVRTRTTIPVPAILDCVEITNWTLNGSNRRIFQILQIFGRTEPFHRWLIVMQASPGKPLQGPEGSRLAVASNEQLQ # NVRDGLTDWVNQLRTLSPPHPQRVSGFLGGGIYSFRIDEAFRPVGPFLTPAEFHSQVYCTAYPDFPDEADENLKRLIAERPSKEYKIVFTHGDILPHN # ILADEDFRLTGLVDWECAGWMPDYWEKAMSLRAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g230 ### # start gene g231 3 AUGUSTUS gene 475133 475711 1 + . g231 3 AUGUSTUS transcript 475133 475711 1 + . g231.t1 3 AUGUSTUS start_codon 475133 475135 . + 0 transcript_id "g231.t1"; gene_id "g231"; 3 AUGUSTUS CDS 475133 475711 1 + 0 transcript_id "g231.t1"; gene_id "g231"; 3 AUGUSTUS stop_codon 475709 475711 . + 0 transcript_id "g231.t1"; gene_id "g231"; # protein sequence = [MRTLPGKPFSEWEGPKLGNAPKEQLQNLQDGLADWVNQLRALAPPDPHRVSGFLGGGVESFRINDSFTPVGPFRNPAE # FHGQIFCKAYPDYPEPGDERLKRLIAERPHKDYKLCFTHGDILPFNILADDELRLTGLIDWECAGWMPEYWEKAASLRSAWIRAEPWSKIIRDGFPEY # EDDMILEKRIQLWFQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g231 ### # start gene g232 3 AUGUSTUS gene 481006 481455 0.89 - . g232 3 AUGUSTUS transcript 481006 481455 0.89 - . g232.t1 3 AUGUSTUS stop_codon 481006 481008 . - 0 transcript_id "g232.t1"; gene_id "g232"; 3 AUGUSTUS CDS 481006 481455 0.89 - 0 transcript_id "g232.t1"; gene_id "g232"; 3 AUGUSTUS start_codon 481453 481455 . - 0 transcript_id "g232.t1"; gene_id "g232"; # protein sequence = [MAQKPPKSAGSVSSSPPPPPPAQNSDKESEQIEQPVLTRSSVPSLDFSPPDPTEQRTGASSRDNLSSADRQRRAFARI # AFGLFTLGFGLHVAYMGREWEQEELQEKKLVCSLMLHVLNPLLNHFTDSGKCASRSMGTNKKPILGDVFCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g232 ### # start gene g233 3 AUGUSTUS gene 486756 487232 0.96 - . g233 3 AUGUSTUS transcript 486756 487232 0.96 - . g233.t1 3 AUGUSTUS stop_codon 486756 486758 . - 0 transcript_id "g233.t1"; gene_id "g233"; 3 AUGUSTUS CDS 486756 487232 0.96 - 0 transcript_id "g233.t1"; gene_id "g233"; 3 AUGUSTUS start_codon 487230 487232 . - 0 transcript_id "g233.t1"; gene_id "g233"; # protein sequence = [MHFRSFSFRHKFGDKKKISSSSSESEPELEPISPPDPFLPHKPLPPTSIANIVLDPGNLTALYQTASTPNTPNTPNTS # DTVSSSDASNPITDTTSLGSGLGSDSFPSSPHNQPKKSISDLVFNTTTLSALYDTREAERNVAAVESERSFGKDGAPERR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g233 ### # start gene g234 3 AUGUSTUS gene 489904 490942 0.28 + . g234 3 AUGUSTUS transcript 489904 490942 0.28 + . g234.t1 3 AUGUSTUS start_codon 489904 489906 . + 0 transcript_id "g234.t1"; gene_id "g234"; 3 AUGUSTUS CDS 489904 490111 0.69 + 0 transcript_id "g234.t1"; gene_id "g234"; 3 AUGUSTUS CDS 490187 490329 0.32 + 2 transcript_id "g234.t1"; gene_id "g234"; 3 AUGUSTUS CDS 490634 490942 0.77 + 0 transcript_id "g234.t1"; gene_id "g234"; 3 AUGUSTUS stop_codon 490940 490942 . + 0 transcript_id "g234.t1"; gene_id "g234"; # protein sequence = [MVFAVNPPDASSNHSFAAFQALAIELNGTQTSALSVSTPPPQSWATATATVSDASSTWVSTYTSYSGTPEPTYAAGGP # VTHNITVGINGQLAFGPANISAAIGDIVEFTFLAKNHSVTSPIWGYCAQTNPVSHCGSGMVFSINAVETGPNNFAAFLALAEATLANSTVKDTSGATA # SSGSSSPSSTSGSNGALSVVGDVNMGGIGMVLATVAAVIVGML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g234 ### # start gene g235 3 AUGUSTUS gene 493761 494186 0.71 - . g235 3 AUGUSTUS transcript 493761 494186 0.71 - . g235.t1 3 AUGUSTUS stop_codon 493761 493763 . - 0 transcript_id "g235.t1"; gene_id "g235"; 3 AUGUSTUS CDS 493761 494186 0.71 - 0 transcript_id "g235.t1"; gene_id "g235"; 3 AUGUSTUS start_codon 494184 494186 . - 0 transcript_id "g235.t1"; gene_id "g235"; # protein sequence = [MVQLKNLAYAPKNEETQQESIIPLRDSPLLACIGNGSTRPTAALQEGSSMPIGPEGLKIGPLPEDWFDVPSDIDAKFQ # SLLDWMRAGYAKGKDAHAIAYDRDARYIYVEFPAPIYAMYFVDNWSTTRPEGLGKVKATFFAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g235 ### # start gene g236 3 AUGUSTUS gene 501043 501548 0.57 - . g236 3 AUGUSTUS transcript 501043 501548 0.57 - . g236.t1 3 AUGUSTUS stop_codon 501043 501045 . - 0 transcript_id "g236.t1"; gene_id "g236"; 3 AUGUSTUS CDS 501043 501327 0.73 - 0 transcript_id "g236.t1"; gene_id "g236"; 3 AUGUSTUS CDS 501446 501487 0.64 - 0 transcript_id "g236.t1"; gene_id "g236"; 3 AUGUSTUS CDS 501540 501548 0.7 - 0 transcript_id "g236.t1"; gene_id "g236"; 3 AUGUSTUS start_codon 501546 501548 . - 0 transcript_id "g236.t1"; gene_id "g236"; # protein sequence = [MIEGLQYMHENNVAHRRKKRYNWSGRALHHSRTRCPPRYYFIDFGRSEMYDPSEPRPLEYALKSGGYTPPEGDADIPC # DPFATDVYILGTMIRASLLDVSSDAQSESRFPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g236 ### # start gene g237 3 AUGUSTUS gene 505576 506232 0.3 - . g237 3 AUGUSTUS transcript 505576 506232 0.3 - . g237.t1 3 AUGUSTUS stop_codon 505576 505578 . - 0 transcript_id "g237.t1"; gene_id "g237"; 3 AUGUSTUS CDS 505576 506232 0.3 - 0 transcript_id "g237.t1"; gene_id "g237"; 3 AUGUSTUS start_codon 506230 506232 . - 0 transcript_id "g237.t1"; gene_id "g237"; # protein sequence = [MKQNKKSNTSENTTTSPAPLVPPDISKFEVKSKKRNLSDVYGSTDIPLPSAVRQRTTNQHIVPLSNELRRSSAARQAS # QKRARKNRITSGNQRQLAILPTGLTWSNNSCAFDSVLLILLYIWMELNITGDEYSNLPQLIKGFSEYKQGKHTLETVRDDLRISLNSRRPREFNLTGF # CSSTAILEEMLKMESPFMTTKLQSFSAAPRTAVPDSESQYFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g237 ### # start gene g238 3 AUGUSTUS gene 506382 510260 0.28 - . g238 3 AUGUSTUS transcript 506382 510260 0.28 - . g238.t1 3 AUGUSTUS stop_codon 506382 506384 . - 0 transcript_id "g238.t1"; gene_id "g238"; 3 AUGUSTUS CDS 506382 510260 0.28 - 0 transcript_id "g238.t1"; gene_id "g238"; 3 AUGUSTUS start_codon 510258 510260 . - 0 transcript_id "g238.t1"; gene_id "g238"; # protein sequence = [MQSEIWSLINHIGGPSWYITVSPCDFKHPICIYYADTKEKFDVPLRTSSECRLLISNNPVAGARFFHLLVNLFLKHIV # DIESSDGGLFGPTSGYYCTVEQQGRLALHLHGLIFNRKTLSPQEICDKILDPASSFQSQLVSFLESVRIGEFLTGSHTCVKEAVALQTESNPNYVSPE # RTLPTPPPPYCDCEIADCHKCSTFIQWFEQFKLTVDDLLLKSNVHDCFCGISPDGSVLNQDKFETSCLNNVHKKCKARFPRECFQQTLVDPENGHINL # KKLEEWLNDISPGLTYLVRGNTDVSSILSGTAIKSAVIYIADYITKTGLKTHVVFDSIKTIFDKSTEIIDGSFSTKEKSRRLISRIVNLLSTKLELGS # PIISLYLLNNSDHYTSHHFIPFYWRTYVSTARSVFEENDATSEPKVILTKRWGKIIGLSSSLDYTHRPVQHAHYNLYDWICCFYKTAKNKSKEVIEHD # PELISSRSSKSNKQLLFLPGHPLVDTHAIGTRQDSSMTVPNFVGSLPRPDKDDREYYCCTMLTLFKPWRSGEDLKNKNQSWHEAFEAYVFSDQSLLYM # KNMNIRFECLDARDDFRAQLRSGKLDVTKLPSSIPIQLHENLVNKLDGSQLDVNSSVIEDTDYSYDQYTQDKKGSFFLKRESAMKAMKDILFNSGWVT # PLTSNIQPKPIPICSPIPLPKEKPQHWDLILKGMRDHVLAAREKSRGLPPADNNTNKNNEPGKYRPNIVEICDKYYFDKLGLEYGSIKELTLNIVKCH # NLNNEQERAFRIIAQHSACLVSEPLQMYIGGMGGTGKSQVIKALLQFFAERNSSFAIVTSAPTGNAAALLGGSTYHFLLGLNNKVEEVGRGTMAQVCA # RLEHIQYMILDEVSMLSCLDLYRISVQLCEAKNKHDIAFGGMNMIFAGDFAQLPPVGGESVSLYSYRKPTDANKYNGQCAAMGKSLWHNVTHVVILRK # NMRNTGSSKMDISFRLALDNMRYKSCTKEDILFLNTLVSSKLPDRPFVGKSPWRDAAIIVDENKYKDEINRLGCLRFAADTKQKLTNFYSDDLVSGNA # DQGAPAKSKNKKRSMSSISKDLQQHLWELPTCAHEYHAPPVLSLCIGLPIIIHHNIATELSITKGQRGTVYAWHESTGAFGQCTLDVLFVLLDDPPTP # IQVPDLPPNVVPLTRRKTKGIVTLKNDVKISVTRFQVDVLPGFSMTAYASQGQGLIPNATDLNTLSDHHAMYTALSRSRSAASTVILQGFDSRAITGG # ASGPLRKEYRELEILDEITHLKYEGTLDSSVVGLPGIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g238 ### # start gene g239 3 AUGUSTUS gene 510317 511903 0.61 - . g239 3 AUGUSTUS transcript 510317 511903 0.61 - . g239.t1 3 AUGUSTUS stop_codon 510317 510319 . - 0 transcript_id "g239.t1"; gene_id "g239"; 3 AUGUSTUS CDS 510317 511903 0.61 - 0 transcript_id "g239.t1"; gene_id "g239"; 3 AUGUSTUS start_codon 511901 511903 . - 0 transcript_id "g239.t1"; gene_id "g239"; # protein sequence = [MAHCLFSVKLIILCFFVTFKVEYCILKIVYLRPLSKQRHFGGGRPPHNKSESGIVSTLITEAFTFKCPIPKTSTVPPN # TVDNITFNFPPPPITRSHMALVIDKWCKSSSPVNFEEAGCAVCGQLTLCTDLSALKNMKNYLHVLEAQSVTRAFRSSPDESISEIEGPVLDKSAGDNI # CNNCRSSLRAGNVPKLALCRGLWLGVIPDELKGLTFYEKMLIARVRHTKCFVRVQKGSTNYSKLVSNVIAFENPIPKIYDTLPPPKEEIEEVLAVMFS # GSTKPTQDDYARALLLVRRNVVAKALQILILNHFDYNDVVFSSANLESYAEDAPIVSVEYFQKGSNRNAEGISVHDDLNDDGTEEGDCVFTVHGIVGP # SIKNMTRDQMIGIAAMHLDNEGKFMRTSHAENPESLWNNPQLYPKMFPWLFPFGLGGIGASDIKAFFESSHLKFLLLYHDKQFQLDSNFPLIAFSHQQ # IKANSSQSYLLAESKNSVKLVTGFCQWIDPFCKILQPVWLMENMSSLPMSLKYNALSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g239 ### # start gene g240 3 AUGUSTUS gene 515687 517564 0.31 - . g240 3 AUGUSTUS transcript 515687 517564 0.31 - . g240.t1 3 AUGUSTUS stop_codon 515687 515689 . - 0 transcript_id "g240.t1"; gene_id "g240"; 3 AUGUSTUS CDS 515687 516833 0.34 - 1 transcript_id "g240.t1"; gene_id "g240"; 3 AUGUSTUS CDS 517287 517564 0.87 - 0 transcript_id "g240.t1"; gene_id "g240"; 3 AUGUSTUS start_codon 517562 517564 . - 0 transcript_id "g240.t1"; gene_id "g240"; # protein sequence = [MVIILICTFLTVPSPSLPRTARSTPQVIGSPDMSQSAGHFAEVEAAASDDDCSDRVYDTNANDCETDSVVVGKQVCDQ # SPIEWSPTPPRGQALFFSTRSSQFFCSPTIPESSSTSPTYPPPPRNLTSIVVNGRTYYASDDPEFTNLVLSPLSSQHPSSPIRPHPLPTSSASADVGA # GLQMDDDSFDLCYPPEDPEVSTPVETSSRGLSVDEYDDLDIDLPADFWSIRALRTPSPHLPSNPLDGWSPTPRAQSTLGSLARRGLFPNSSTNPHISP # SKLRRDTSPLKVLSGSSPSPPRSLLSSPSHSYSGTSTANTSPSKASAQGSPKSRGKDRVRFHPFKQLTHNHHVPSSLIVGTSPVKSPSKSSAAGKRLR # DDLIRHALCDGQPSPSTTSTREIRNALIQEALGESDLTNDVSSSGTAVVQEHDPQEVPPFVDNNLGDTGVLNSAWIDHRFAVSFRSVTNLPLVSVNLY # VIFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g240 ### # start gene g241 3 AUGUSTUS gene 538625 539730 0.88 - . g241 3 AUGUSTUS transcript 538625 539730 0.88 - . g241.t1 3 AUGUSTUS stop_codon 538625 538627 . - 0 transcript_id "g241.t1"; gene_id "g241"; 3 AUGUSTUS CDS 538625 539158 0.93 - 0 transcript_id "g241.t1"; gene_id "g241"; 3 AUGUSTUS CDS 539251 539730 0.89 - 0 transcript_id "g241.t1"; gene_id "g241"; 3 AUGUSTUS start_codon 539728 539730 . - 0 transcript_id "g241.t1"; gene_id "g241"; # protein sequence = [MTIPVHDGDLLLVVQNPITDSSSTGSRPSSLVRSRPPSSDIDPSSLLDGKSDKPIGRTPSIRVKPGSSANLERKSSVA # RRSSLPSLSQRQPLTLAENSSEPPLRVLVQAGTLDRLVDVLVHGLHNVSVSVADDNGEMSLRVGMTRELLLDHKEFTRVWWNLLRKIYIKSQPAGSPP # LPDQYLAAISSKSQVLDAMKLWLTKGGGAQDVLDDSQLLQALRAFFASSSDHIIHSSAATFENPSVRQAWDNMTESRQALEELLLSQTMRPSTSRTQT # VSRNTVITTESRVRNLSTREPPDMDRMSPEEFVDNIDGMAFAAFNNVTEEVSILSTIPCLATN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g241 ### # start gene g242 3 AUGUSTUS gene 540036 543126 0.47 - . g242 3 AUGUSTUS transcript 540036 543126 0.47 - . g242.t1 3 AUGUSTUS stop_codon 540036 540038 . - 0 transcript_id "g242.t1"; gene_id "g242"; 3 AUGUSTUS CDS 540036 542526 0.47 - 1 transcript_id "g242.t1"; gene_id "g242"; 3 AUGUSTUS CDS 542819 543126 0.49 - 0 transcript_id "g242.t1"; gene_id "g242"; 3 AUGUSTUS start_codon 543124 543126 . - 0 transcript_id "g242.t1"; gene_id "g242"; # protein sequence = [MAPRRETSTANTLSPQDITTTSSGQPTATLGFPRSTSPSNGFTNFLSKPSRWFGRSASNPKISTVAAASEPRMSSSSG # RKHKISRPTDPRPILDSYGAAPGASNTSPSSPGGPPSAPPFFERSLSHGTGVQPFPSLPRINTPSSATPTVSISISAPVIDEAAHKPAPSPTHVHTRS # YSFTPKLASKLSAPRFMPPSPKRKGSAGSEMEGTSTPPVPTRGAFPFSSSSRTLLPDSSSSSSTSQPVHRSTTLLAPPNIVEPFNESSESSSPKRASQ # IVYHSGFINKFADGTASPHQLGTAKAWKPFKLELKGSKLYFYKPPSDRAAAIKELFPTELVPVNQQDEDEIGNIGGVEGELEDDPFASATATNTRMDM # RPTRQENSIAQRKKRAFWGRRTHPDLSKDAEGIIEKGTFEALTHEAVFGTTFFGLVEGEVTAAEISSGIGKAKIGSMEQWKDFAASILLCMPHLVDQT # KFETELMRCCEFLVSGAEEEKKSAEKQRVVWLAAEYLRYHGRPLEFPDWPEWKAEIAPEAITVPPPAMPLPRSTSTQALYNPTPVASPNIGMFSPRPG # ESSNMSLVNALIENGREATATPQPGSGNSYFDPTTPGALSLSTPFGTPSSPTVNRTPWASALDREGLSRDVLLLIDPNTIARSLTVFHLAVLQQLPEN # LTANFVLGPEGSESHPWSTQQPLSSLSATSLFGSDDHPHWLTKLLLVQILGADTSTGYATLRGAQLSSPSRRSEDRGPTSRTHSRSEVISAWIKIGEL # CRLNGDECSWRAILHAICAAPVARLEKAWKRVNPVAIATVESWVQPVKDGDPVNGIREPRITFWGGNMRSIIREHLSQASVPGSTGDVLMLATLDRVR # MLFEGFRTSVSLCPRKTTILEEGSNEEVQKLVSYWKDIVADGGASSGLGIKFHRYAISTHSTLDCELTSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g242 ### # start gene g243 3 AUGUSTUS gene 553403 554365 0.66 + . g243 3 AUGUSTUS transcript 553403 554365 0.66 + . g243.t1 3 AUGUSTUS start_codon 553403 553405 . + 0 transcript_id "g243.t1"; gene_id "g243"; 3 AUGUSTUS CDS 553403 554365 0.66 + 0 transcript_id "g243.t1"; gene_id "g243"; 3 AUGUSTUS stop_codon 554363 554365 . + 0 transcript_id "g243.t1"; gene_id "g243"; # protein sequence = [MGYEEDDEWDSQEDESDIDELELELDTNPRMGRRANRNQYLGFYDRPSIGQRSVLPPSVASRILPSKTRVNPASLPRG # SHTTYHPNFLNLIRFSTGQILEKHYTIVDYDIQPYELLEVHRLGVVTKLPREITSKYIEPYWEGWVKALRLVFREPHVVTEVRSLAREGSSRRKDASV # EEVSKAASSHAETARRTMEVLAGGPVKVASFSPADVALGLRPPPSSRVKMKKDRHSVGNDLDIHTSMWKSTKLSNSNYHDMASLSRNATAPTSKSSLT # QNISNNRHRSKGKGGKLEWRERWVFIKDGVLHLKKENSVSFYTSFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g243 ### # start gene g244 3 AUGUSTUS gene 554794 558119 0.46 + . g244 3 AUGUSTUS transcript 554794 558119 0.46 + . g244.t1 3 AUGUSTUS start_codon 554794 554796 . + 0 transcript_id "g244.t1"; gene_id "g244"; 3 AUGUSTUS CDS 554794 555538 0.46 + 0 transcript_id "g244.t1"; gene_id "g244"; 3 AUGUSTUS CDS 555592 558119 0.71 + 2 transcript_id "g244.t1"; gene_id "g244"; 3 AUGUSTUS stop_codon 558117 558119 . + 0 transcript_id "g244.t1"; gene_id "g244"; # protein sequence = [MLQIKPLPPPPPTSKVILNKEPSSSMIISDRDKGKGETPLDSLSSPRLLSASERRVLFHPEVISGRTSENLSEVHTEE # EGAASDDEADAVDLVGGRKKLPVVSSPHISDRKHPHIIMESDADSDRSGSTLSSPVFAHTENDSPFSDGPARSYGYSNGQFGGTSEWRRKGIKINSST # TLKRGGMWYKEEDEGNTEVDTSYVVVSGADDNAEGPSSTKGSNTRQNLTSQNSGKKLDPESEWVVLDLGDDFAFKSFLRVIHRHAPHVVDSSFLSNLP # PFQMPKSSNVPAAPAPTPTFPSSFPIPEQAMPPSFARWSWSTQNQERRSSPDEVSPITLSAKELNQSSSSPLARIEAPTEVISNPNSSWVNDTPAGTQ # SLVSPITAPKDSRQFRLPPSPRLLATMSNTQNSSTHTSSLLNSTLGRRQSETKQLNILSSQQKNSLGTFGALPYPEWRLEVVTKAQRAGMGELTKAMD # QFLWGDNPGLAQLTRELGLRIAPMELIRSPSIQSAAGDRIFDNEEGDSAEDAISMRRQRKRKDRKLTLEQENIAIGLKFPGGGNLSSRTLIDSGQQIA # LVSTTNISTSSSDILRPSLRLDYVDIDSSESGEESSDAEWVGWMADLHRQARLHREENARLDRLETESLASSTDTNDYWDYQQQDDHRRYQEERRALE # PTGVVTSSSPYTIPTSPNTILTSPLVRQKEVGLPQYASSTSIPSETTINCVPGSTASVGTSAVTPTFQRPATPDNILVVGGPSFLTSPSSNESLNRPH # GRRLSFGLSPSDPPSSATSPSLSQAGHSVEMTLLEHQQLNSRSNKHTRQISGMVRDGPNLSHYASTGLIGTTSELLELELQNSSLTSARRPSMPILGS # TSFATQPDKPPTPPLIPDFHHTGTTLGGLSAESSRLAAGAKLARLIGSDKSYDHTVAVTIPRRSSITGSVSSVSLGRSSSKAPGLLRKKGSENAKGRN # IMEKREAGHNQDREMLFVQQKEKSRKGKGKEREIDKIVQDHSGEDKSRRQRLSLPLSNSLTHTHVSTSKILSPLPTSPVLPSRDIRRTKSGQRLREEI # PVIKKEKKRGLVREKAERLLQNLESKLDFVDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g244 ### # start gene g245 3 AUGUSTUS gene 558862 559616 0.87 - . g245 3 AUGUSTUS transcript 558862 559616 0.87 - . g245.t1 3 AUGUSTUS stop_codon 558862 558864 . - 0 transcript_id "g245.t1"; gene_id "g245"; 3 AUGUSTUS CDS 558862 559061 0.97 - 2 transcript_id "g245.t1"; gene_id "g245"; 3 AUGUSTUS CDS 559139 559616 0.87 - 0 transcript_id "g245.t1"; gene_id "g245"; 3 AUGUSTUS start_codon 559614 559616 . - 0 transcript_id "g245.t1"; gene_id "g245"; # protein sequence = [MLTALQKHHDGFSLFDTGNTTNRSAVVLGPKRDLLKELFDAAAEKPHIHRGTYYSLPEWFNPDYAKYGFGEWPGGLAR # NPFNTTPAFEPYTGHLNISDYIEDLQYPQMLNLATQYNTEIMVRSAKSKNTVSKCGTQWCDIGGPNNTLEFAAEFYNHAFASCGAVPDFNTPEYETFN # SIQTSSWESSEGMDPFSYGLNTATNANEYKNGTTIVQTLVDIVSKNGNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g245 ### # start gene g246 3 AUGUSTUS gene 564994 565386 0.93 - . g246 3 AUGUSTUS transcript 564994 565386 0.93 - . g246.t1 3 AUGUSTUS stop_codon 564994 564996 . - 0 transcript_id "g246.t1"; gene_id "g246"; 3 AUGUSTUS CDS 564994 565386 0.93 - 0 transcript_id "g246.t1"; gene_id "g246"; 3 AUGUSTUS start_codon 565384 565386 . - 0 transcript_id "g246.t1"; gene_id "g246"; # protein sequence = [MASDFNAVKLNASLHTTNGVLNVTMPRMPFLDPDYKFIIDASTTNAASSVFLSPDFAGTFDLRTSHNGKTQVRWDSGM # RDPWGKGRKHKLDMAHYEDVHKSGKVYWGDEAPETMGDIRVKTTQENVWLYT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g246 ### # start gene g247 3 AUGUSTUS gene 565694 566681 0.22 - . g247 3 AUGUSTUS transcript 565694 566681 0.22 - . g247.t1 3 AUGUSTUS stop_codon 565694 565696 . - 0 transcript_id "g247.t1"; gene_id "g247"; 3 AUGUSTUS CDS 565694 566284 0.29 - 0 transcript_id "g247.t1"; gene_id "g247"; 3 AUGUSTUS CDS 566340 566681 0.38 - 0 transcript_id "g247.t1"; gene_id "g247"; 3 AUGUSTUS start_codon 566679 566681 . - 0 transcript_id "g247.t1"; gene_id "g247"; # protein sequence = [MHFSIPFLTRSKNLTVTDQSEDSGVTIDDDARTMDELLENDDNVFEELPVETRRRLLRWKLAVYFFTGVIFILLVTLV # VIGIQPRSGKELEEPGDDEPVWDDDSEHIADDPRLEKYQTPSDTTFCAPWPLTAAESRSSLNLDTKTSQVSFDIPANSDLIFFISRGQPTKGHLTVTS # NRMRRLETIAVNVTAEYDHRGHLEQTKACYSENDTEGGIMIWVCVHRHSLCDIRNKTLLFTQAKDIDSSLLPSFNISIELPWSSFRDFSTDLSGGAYT # QSFGDFFDLWSPNGFAVVRLKGGNETIRSLVSMFAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g247 ### # start gene g248 3 AUGUSTUS gene 567160 567549 0.41 - . g248 3 AUGUSTUS transcript 567160 567549 0.41 - . g248.t1 3 AUGUSTUS stop_codon 567160 567162 . - 0 transcript_id "g248.t1"; gene_id "g248"; 3 AUGUSTUS CDS 567160 567549 0.41 - 0 transcript_id "g248.t1"; gene_id "g248"; 3 AUGUSTUS start_codon 567547 567549 . - 0 transcript_id "g248.t1"; gene_id "g248"; # protein sequence = [MIKMAKTKSRHNGADEEEIDVEDSKIDVESPEVERKRKRTAGDEDPYDPNPEKTPDQSPSRGLSNSKKKAKGRQEIFP # GGGRRGVSSGLSTIVRKGGGGSTTDSDRPKTQWWKELGNAGSSGLKGSLRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g248 ### # start gene g249 3 AUGUSTUS gene 569240 570493 0.96 + . g249 3 AUGUSTUS transcript 569240 570493 0.96 + . g249.t1 3 AUGUSTUS start_codon 569240 569242 . + 0 transcript_id "g249.t1"; gene_id "g249"; 3 AUGUSTUS CDS 569240 570493 0.96 + 0 transcript_id "g249.t1"; gene_id "g249"; 3 AUGUSTUS stop_codon 570491 570493 . + 0 transcript_id "g249.t1"; gene_id "g249"; # protein sequence = [MSPTTTSSSSSNAASTVTSTISPTSSNSSTPDITTEVIVGGLIAGILVALIVAGLVYFLCQRNKGRKSSKGGGGGSRK # DGRGRSMDGSDPLLYPTISQLGQGDYNPYVETVSIPARPMHPEISLNYTEIDMLEPLPSSSSVMQEVPMSLSPPRPSLPPLVIPPLSIAPFAIRYPAK # LPSIAPTAVPAVGHNSNNPASAVSIDDAASESSMSAYSQASASARIHKAWEDDTQIPPIPKIPSYLYNAYIAPEVADENTSLARGNTTKVAALLKSRA # RRAQRGKPLTRSSTKISRIERSDSLEYIPFTPRTKHTEAERLHCDASTLGTKSPAPSEAASLTIRNPFADTSSSSRSTSVTTSIASHTIHTVDPPYYA # HRLSVIDNEEAETESLYADEVPTFPATIDTPPLRISKNQVSNARS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g249 ### # start gene g250 3 AUGUSTUS gene 577528 578557 0.4 - . g250 3 AUGUSTUS transcript 577528 578557 0.4 - . g250.t1 3 AUGUSTUS stop_codon 577528 577530 . - 0 transcript_id "g250.t1"; gene_id "g250"; 3 AUGUSTUS CDS 577528 578442 0.98 - 0 transcript_id "g250.t1"; gene_id "g250"; 3 AUGUSTUS CDS 578555 578557 0.4 - 0 transcript_id "g250.t1"; gene_id "g250"; 3 AUGUSTUS start_codon 578555 578557 . - 0 transcript_id "g250.t1"; gene_id "g250"; # protein sequence = [MKKRKGDEYEPDTSIGRSTSSLKKLKTDDAAVGKSCSSISYPGIWLIYRPLAPAPATKSRKSSKSAKSEDAKKLDVSK # DLKSPLPKPAKKSIQDTTSSSSSMNQSKSKSSPTTSQPLNSRVRSVPTPIGQSISTPSQSNAVFHVPPTQKAPASEKGSVSSNSGPRPSVKPSTGSQG # SNPTAPTAQLTQVPISNVKPSAQSVIPRAGLLPVSMHHPRHHYSDGSIIVIISHTEFKLYRGALVRAGGWFRARFGEGSSLSTSNAQEKGNFDANANT # TNDRTVPICALDGVVSEEDFVALLDAMEDAM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g250 ### # start gene g251 3 AUGUSTUS gene 593289 593480 0.83 + . g251 3 AUGUSTUS transcript 593289 593480 0.83 + . g251.t1 3 AUGUSTUS start_codon 593289 593291 . + 0 transcript_id "g251.t1"; gene_id "g251"; 3 AUGUSTUS CDS 593289 593480 0.83 + 0 transcript_id "g251.t1"; gene_id "g251"; 3 AUGUSTUS stop_codon 593478 593480 . + 0 transcript_id "g251.t1"; gene_id "g251"; # protein sequence = [MGFIQSGKDQGATVVLGGDRNGTEGYFINPTIFTDTTPDMKIVQEEIFGPVGVVIKFEDEEGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g251 ### # start gene g252 3 AUGUSTUS gene 594638 596139 0.62 - . g252 3 AUGUSTUS transcript 594638 596139 0.62 - . g252.t1 3 AUGUSTUS stop_codon 594638 594640 . - 0 transcript_id "g252.t1"; gene_id "g252"; 3 AUGUSTUS CDS 594638 594809 0.65 - 1 transcript_id "g252.t1"; gene_id "g252"; 3 AUGUSTUS CDS 595520 596139 0.7 - 0 transcript_id "g252.t1"; gene_id "g252"; 3 AUGUSTUS start_codon 596137 596139 . - 0 transcript_id "g252.t1"; gene_id "g252"; # protein sequence = [MAAPTSSKEPPSTSDRRASRKSAGQTNTNAKKDSKRASGVRNTKAAVMGSNDEEEGNSDEVSDSEEQPAKKKGPRKRN # ARKRAKDYDSDALDDDSEFDEADEEDEEEPRKPKRKRANSGKQDKTHSPRKRRRKANKDDEEDDFDLKEGQEVVGEVVQAPKTGRGIYPSRLNEQSRL # PCLAVPPGQISKNTFDFLQKLTDPECNDRECSNIARSSDRLRQVISDPEFVKLFGEPKPMKDGGRRNIFGAEDELKVAPKGFAKDHK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g252 ### # start gene g253 3 AUGUSTUS gene 598196 598507 0.76 - . g253 3 AUGUSTUS transcript 598196 598507 0.76 - . g253.t1 3 AUGUSTUS stop_codon 598196 598198 . - 0 transcript_id "g253.t1"; gene_id "g253"; 3 AUGUSTUS CDS 598196 598507 0.76 - 0 transcript_id "g253.t1"; gene_id "g253"; 3 AUGUSTUS start_codon 598505 598507 . - 0 transcript_id "g253.t1"; gene_id "g253"; # protein sequence = [MEKVSSVYQRNVGFGHEILNRTIDRNRTKDEQDDHYSSSPRSKQSQREYSSAANLMGDIKVSGPNAFTYANNFKIHGG # DVSAVGGNQTVSELASNISDPNDNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g253 ### # start gene g254 3 AUGUSTUS gene 600841 601197 0.66 - . g254 3 AUGUSTUS transcript 600841 601197 0.66 - . g254.t1 3 AUGUSTUS stop_codon 600841 600843 . - 0 transcript_id "g254.t1"; gene_id "g254"; 3 AUGUSTUS CDS 600841 601197 0.66 - 0 transcript_id "g254.t1"; gene_id "g254"; 3 AUGUSTUS start_codon 601195 601197 . - 0 transcript_id "g254.t1"; gene_id "g254"; # protein sequence = [MSSSHYSKSVHSTRSHRDSDIESWGTAYSDSRTPTPTHTSSNYAQPSGAYSHRSNPSYPSPSYGPSSPFGGFSASLAS # YPQTPGTPYLGSVPLPQQYVDTAAPQTPYLSTIPLPGGKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g254 ### # start gene g255 3 AUGUSTUS gene 605728 610109 0.6 - . g255 3 AUGUSTUS transcript 605728 610109 0.6 - . g255.t1 3 AUGUSTUS stop_codon 605728 605730 . - 0 transcript_id "g255.t1"; gene_id "g255"; 3 AUGUSTUS CDS 605728 608909 0.95 - 2 transcript_id "g255.t1"; gene_id "g255"; 3 AUGUSTUS CDS 609032 610109 0.6 - 0 transcript_id "g255.t1"; gene_id "g255"; 3 AUGUSTUS start_codon 610107 610109 . - 0 transcript_id "g255.t1"; gene_id "g255"; # protein sequence = [MLLSSIASPPLNSADYNSRNTSTFLLSDRQRTTHPLNEERQAPGTYSRSATPTFGGLLAPPTQFDGLDPSQGNPNQNS # IALRAMRSIARIGSWAQLKNGTGPGDETFPKELEKKGKPKSKEKEETKKKSKKDKSEKEDRNKTQRIRNSTSSFEAGALTTSPEVKALLGKKKRSILG # LGLPSTMRLPAVRSGSTTSSIGATGGSDNNRLSVDSAVAIAARMRSGSTMSTGSSLRPMSTTSSTSCISSGSSAASVRWDEAGLETVKELRRKEKETK # RQSIEDAEADAKRKKANHESRRHSEGRRRTPITDVFPDAQEDFPGPAAFVRTVSDGAPLLTLEEATSDGHERMSEDELSTPMKCARVISILSAATNDL # AQLINHLDLEATPGATPGKSPDASPWRRTAGFQSSDTNQDSPTKKTLRGTMTSISSLRPYAQYRELTTAKPANSQDLLDQQIAPWPVLNSYLPQNEVP # AKEASSVTTSKVRGMHKRTMSPSGYLPEASPPPPLRPLRPAKSRNVVASFNLLPLGPPPSIDLPVQPLSPVNAGRAPSSLTFGSRSSSRGGESSISSL # NDIHSRNPVFKPTHGHNRNRSSLLSSQPGGGSQGSIPEENFTTSRPLSVEARRQLGMKGTMGGSDVSAYAVDDLDTSDPDSDIPDELQVILANQSPRT # SVHSIEDHTSFRSLDSPDAPQDVSSLVDPESEFESTGGREVVDLPVFHLIDVDDNHADLDDMLDVDEDDTKKSFDFTGELEKLNESGGSDRASFVEQL # EKAFKTPAKIDLRYDFGGQGGLLQVDVPPLPVLPSMIAMDSSKSVELTNSSISSQEAHYGGSTQATSSSLEIFPISRLLDAKEPTLLPGSDSISSTDS # RDLPDTFAPKVLESSVSSASRPSDGELNKSFKFGGFTKSLSQEVELEKPISFSDIIPSPSRVRALSNASSYVDDSVINSIIAKASEVPAARQLNDSTG # KRNARDNSINAITRNITYRHSRHDSTNSFNGFDSFEEVRRGFEFHDYRPSFYPPPVSNSTGSRRNNHSKQESMMSFASISSYGHVVNAGVPDPFDYGL # PSLRERPSSEEMTSTSFSMSIDDTFSFLKHAPPRKRVESDASSFYFNASGPSSRGHCRRESNMSVVSQGPPISLYNRSFGHRRNDSSTSVSSMAHSYV # IHGANGGRAAWAHHRQDASIDSVDSQFSARQLGRPGIGDKMFDTAANFGAPLTSISASPPGSSYSQSCSSFDSIMDDEPRSSVDDSLFDKTGHRTSLC # SESVFGYDGSSRYAQGHLLPQNAFRPVSYLSINSIHSPSKDDDTMISVRVSFICLSRLTDMLQMIGGGHVRRRSVGSVIEASPIVRAVGHLGKRKHVA # FGSVKDGSDKGHVRIIEKASIDSTSSSKFGGERMIRATKGLLERQSLEESCLIAEGEDLSASCEFST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g255 ### # start gene g256 3 AUGUSTUS gene 610217 610864 0.95 - . g256 3 AUGUSTUS transcript 610217 610864 0.95 - . g256.t1 3 AUGUSTUS stop_codon 610217 610219 . - 0 transcript_id "g256.t1"; gene_id "g256"; 3 AUGUSTUS CDS 610217 610864 0.95 - 0 transcript_id "g256.t1"; gene_id "g256"; 3 AUGUSTUS start_codon 610862 610864 . - 0 transcript_id "g256.t1"; gene_id "g256"; # protein sequence = [MRNTLPSLSRPTDAPSHPSDVPSIRLVAATPSASGFSSEASTSLEFSWTAVPSVPSPLAPKTDAEPRKRLVPKKSKLG # LLGGSSKDRQKDRGKDLSDVVRRVGGGSTSRRAGGFEIYVDPTDPEIGEIVMVKKKKSRAGLDGLRWGSGGGALGEVTNVPSVPQPMTAVTKIKAEEK # EKWWTLGRGRKDSKEKEKEKAREKSETRPQPPRSKSRLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g256 ### # start gene g257 3 AUGUSTUS gene 618189 619571 0.39 + . g257 3 AUGUSTUS transcript 618189 619571 0.39 + . g257.t1 3 AUGUSTUS start_codon 618189 618191 . + 0 transcript_id "g257.t1"; gene_id "g257"; 3 AUGUSTUS CDS 618189 618446 0.42 + 0 transcript_id "g257.t1"; gene_id "g257"; 3 AUGUSTUS CDS 618611 618778 0.91 + 0 transcript_id "g257.t1"; gene_id "g257"; 3 AUGUSTUS CDS 618828 619571 1 + 0 transcript_id "g257.t1"; gene_id "g257"; 3 AUGUSTUS stop_codon 619569 619571 . + 0 transcript_id "g257.t1"; gene_id "g257"; # protein sequence = [MGLTRYKATKKRLFCMKMAIPPKKTYVALAFIPFWGFDIIFRKGQGSDVESTLEYIAQAAKIIESKTNATVFVWIDGK # EILESCRKDDSLMSPMEQELARIRIILETQHGNDYDLTYTYIDPTTAEKFALSPNAIDEWTRAIYSGLADKFRPPSNNDSPNFGAANRQSSIQPFGPL # RSSSAHHHQLAPAAVNPGEKSDLAHFATIMSMIVPPRPMQSPIPSSSSLAPLLSPAKNTPTKLHRFLEYAESDAGVKNATYHLFALENKGYGPDILEC # VEDKDLVDLGIKHGDAMCLKRAAPIWFNGPEAKRKQPLAPLAQPDQHQNRTRFEKRWIDGGRFSTSGRSMRRLDDGEKLDPSYSWFYFSELAHSMIPV # PENFVPVIDGESELEEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g257 ### # start gene g258 3 AUGUSTUS gene 621890 623028 0.34 + . g258 3 AUGUSTUS transcript 621890 623028 0.34 + . g258.t1 3 AUGUSTUS start_codon 621890 621892 . + 0 transcript_id "g258.t1"; gene_id "g258"; 3 AUGUSTUS CDS 621890 622498 0.34 + 0 transcript_id "g258.t1"; gene_id "g258"; 3 AUGUSTUS CDS 622600 623028 0.81 + 0 transcript_id "g258.t1"; gene_id "g258"; 3 AUGUSTUS stop_codon 623026 623028 . + 0 transcript_id "g258.t1"; gene_id "g258"; # protein sequence = [MTNSHSMSPIWSVMKERQDIFNGFGAQESCDTLFLALIHPLMPAQFVCSSKETWTRFRSTVIEQHMFRIQRILHPDML # GVSPLAYLSKESDPFKMNKHAHEAYAATISCYRKKTVLLSSSQLDLAHKLGLFNKDGVLGEDGIAQGQFIFYDNDFAEFAIVPATSFPPASSEIKDVP # STPRSGYQSCKLPNYIHRFNIGSRFQHELWGGVIDFKHCVNETTLGPYSFKVFVDCTWSKEHIEVAGGETVLIGRRPILKDGTGNSKQPKKGQIPSGK # EKSRVVQKNRMWHLNYGTVENQEWNDEDIVGESELLEAEMEGEDHSGAIGTSGPIRPLRSQRLLRKDHNPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g258 ### # start gene g259 3 AUGUSTUS gene 630431 631588 0.84 + . g259 3 AUGUSTUS transcript 630431 631588 0.84 + . g259.t1 3 AUGUSTUS start_codon 630431 630433 . + 0 transcript_id "g259.t1"; gene_id "g259"; 3 AUGUSTUS CDS 630431 631588 0.84 + 0 transcript_id "g259.t1"; gene_id "g259"; 3 AUGUSTUS stop_codon 631586 631588 . + 0 transcript_id "g259.t1"; gene_id "g259"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMCGRCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPATPSPANQDFSTQIGQIRELLDRAN # AMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g259 ### # start gene g260 3 AUGUSTUS gene 631639 635346 0.97 + . g260 3 AUGUSTUS transcript 631639 635346 0.97 + . g260.t1 3 AUGUSTUS start_codon 631639 631641 . + 0 transcript_id "g260.t1"; gene_id "g260"; 3 AUGUSTUS CDS 631639 635346 0.97 + 0 transcript_id "g260.t1"; gene_id "g260"; 3 AUGUSTUS stop_codon 635344 635346 . + 0 transcript_id "g260.t1"; gene_id "g260"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVICAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKQPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEIITAMEESPIHRIQANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDCIRKASEREAQV # LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ # RHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLA # RLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE # ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNP # INGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g260 ### # start gene g261 3 AUGUSTUS gene 636467 636909 0.54 + . g261 3 AUGUSTUS transcript 636467 636909 0.54 + . g261.t1 3 AUGUSTUS start_codon 636467 636469 . + 0 transcript_id "g261.t1"; gene_id "g261"; 3 AUGUSTUS CDS 636467 636471 0.58 + 0 transcript_id "g261.t1"; gene_id "g261"; 3 AUGUSTUS CDS 636582 636909 0.91 + 1 transcript_id "g261.t1"; gene_id "g261"; 3 AUGUSTUS stop_codon 636907 636909 . + 0 transcript_id "g261.t1"; gene_id "g261"; # protein sequence = [MFREKAINQGYWTGDPGNDVRTASHPFYGQEDGDLPPLDELANDPTQPNYTPYNSKDEEKADGIFVNDDDEIQDVKDF # LVAEGFDYDREDGNWGIDVYCEAVMKIQQLLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g261 ### # start gene g262 3 AUGUSTUS gene 640269 641312 0.92 - . g262 3 AUGUSTUS transcript 640269 641312 0.92 - . g262.t1 3 AUGUSTUS stop_codon 640269 640271 . - 0 transcript_id "g262.t1"; gene_id "g262"; 3 AUGUSTUS CDS 640269 641312 0.92 - 0 transcript_id "g262.t1"; gene_id "g262"; 3 AUGUSTUS start_codon 641310 641312 . - 0 transcript_id "g262.t1"; gene_id "g262"; # protein sequence = [MITTPVIKPTVRLNTPSAVKIASNAWGSQGKPVATPPSTTHGPTPASVPVKPPQGAWGSRRPAVTTPVFTKAWGLPKS # FAVSPSSTSSAPLSAPPAISTAVPSVPPGLIRDSASGSSSGSSSFDWASEVEAELPIHSFSPNLNNLAGNTDPLDIANTMAKVLGFDEDEDIDPEDQI # ASTFVDVDVPPGLGLPTPAVQYDTTQETVKQNLWEDVSPVEESKEDECPVHGVLCSKGICQVAKKKKRQQANEQKNKDGRTGSSRNRGRGRGWRRNGG # ERNSRSNEGDHDDNNNNGMCCSQTKERPTELMMIQITGRPATTTATRMVTFAILIVLRTRAPLGVVLYLERTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g262 ### # start gene g263 3 AUGUSTUS gene 648462 649571 0.93 + . g263 3 AUGUSTUS transcript 648462 649571 0.93 + . g263.t1 3 AUGUSTUS start_codon 648462 648464 . + 0 transcript_id "g263.t1"; gene_id "g263"; 3 AUGUSTUS CDS 648462 649571 0.93 + 0 transcript_id "g263.t1"; gene_id "g263"; 3 AUGUSTUS stop_codon 649569 649571 . + 0 transcript_id "g263.t1"; gene_id "g263"; # protein sequence = [MPPTARKRRNSDSDYAPTRHFSRETKKLRHRQSTPEEDQEGEEEDVDIFQQTSSAPSSPIAHLEPADSDMLGLNLLDK # PYTLPSQQASISNITSLSPIEDNTASGSTLFPFTTLHSSTSPTRNLSTPTLPDSSPGPLDTPVHRRHIGRPQTRRVRKGLGGETNTPQTSVYFQNQQK # KLTERIRSNSSAKLAQRKATRELSAAQRKEMALELKHQNLIKKRDKALQFIANLTKPEGEEDGLVFDSLIDFFDSLQIPGGDRQVRANITRLHKARGS # QIIQGVLEDAPDVIPQVLQTLFEKEGKDLQALLTRSMETPISEHLRSFSMMELSNKIQEIAPNIWKALNTITDNPEKTAAPRHEKLVRLSQFYRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g263 ### # start gene g264 3 AUGUSTUS gene 649610 650392 0.54 + . g264 3 AUGUSTUS transcript 649610 650392 0.54 + . g264.t1 3 AUGUSTUS start_codon 649610 649612 . + 0 transcript_id "g264.t1"; gene_id "g264"; 3 AUGUSTUS CDS 649610 650392 0.54 + 0 transcript_id "g264.t1"; gene_id "g264"; 3 AUGUSTUS stop_codon 650390 650392 . + 0 transcript_id "g264.t1"; gene_id "g264"; # protein sequence = [MFARLRSQKANNFQAVIALFLIGSGSAKREMEVLAHAGLSLSYVAAIRYLNQLSREATRKYQELIKQCMMMIVWDNLN # IAFRVAAQRHDSKDHFDNGTTSTVLPIWDPINCSTRTPYGTLPLDMKPPRTTTDPTFQWSAMQVLPTRTDINQLHDCLIWQLKHLAMEHIGGLEHLKS # SFEACPTVDPIAVHVTEQYPLPALHEEESSIEGTITVYVSILRNLGMTNEDLKAHGLLFNDGDLLTDSLVEKVGLYFDHVHIVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g264 ### # start gene g265 3 AUGUSTUS gene 650448 651781 0.38 + . g265 3 AUGUSTUS transcript 650448 651781 0.38 + . g265.t1 3 AUGUSTUS start_codon 650448 650450 . + 0 transcript_id "g265.t1"; gene_id "g265"; 3 AUGUSTUS CDS 650448 651015 0.39 + 0 transcript_id "g265.t1"; gene_id "g265"; 3 AUGUSTUS CDS 651348 651781 0.61 + 2 transcript_id "g265.t1"; gene_id "g265"; 3 AUGUSTUS stop_codon 651779 651781 . + 0 transcript_id "g265.t1"; gene_id "g265"; # protein sequence = [MQASVRRFGLFHGKMAGCRLTVNEHWGKPNSKHPGSGLWWENNRLGRKNMVAGWQASKATPWKPAHELLQISLAAHVK # DAYRVSCGEALLADWAQSATMEEFDHVSNEVYQNLFSTKAYDEFTRKPYRDTTIENAILFNRDGLLYIELVHAVRTGDIGRVVNVLKMWMIMMRRKKT # MPKYADAIFETLGLQHAFNISSLGTKHTIPDMTQDINILATALEENKIQVYIMNRPSNEFIDPVRDLLGEGAKYPNSRTAFQRFRADHRIPVNLGFVE # PTVGDGASGEPEEEGESYQEEYETSREDLAVDEEEEYDKMDDAFENMVTFMSSNGMDAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g265 ### # start gene g266 3 AUGUSTUS gene 651893 653371 0.38 - . g266 3 AUGUSTUS transcript 651893 653371 0.38 - . g266.t1 3 AUGUSTUS stop_codon 651893 651895 . - 0 transcript_id "g266.t1"; gene_id "g266"; 3 AUGUSTUS CDS 651893 652150 1 - 0 transcript_id "g266.t1"; gene_id "g266"; 3 AUGUSTUS CDS 652239 652780 0.99 - 2 transcript_id "g266.t1"; gene_id "g266"; 3 AUGUSTUS CDS 652870 653371 0.38 - 0 transcript_id "g266.t1"; gene_id "g266"; 3 AUGUSTUS start_codon 653369 653371 . - 0 transcript_id "g266.t1"; gene_id "g266"; # protein sequence = [MDFRGIKRVILWIEPRTFNSLVQKIGRCVRIFSELGEAIVFITKASLKRFLIEFDLDSVDGVNDSDGAPAGEEPEWEE # PSYRDQTEEEEPRDDDEVEDEDEEEGEFIGDFLEDHFEDIGKDAMNASDNLVEPIPTRRKVTKRKKVLTHIEARDRWFLLWFLTTEKCRLPSPFPAPL # GSRCCDNCEPLQFPVEAIRLTDPDQLRLPGRAQKSSPEVAEAVRSQLLVLREKLVADIYGSDQYMVTGKMILPAEIINVLAKRARFVDSVEALKQCVY # WHFAHEFGNDVVLVLTDVLANFPDSVQKTQELQQRERALRALLKMEKRDLKNQISSISESCFVAVKNEMDGTRQVYPDYYNIIKTPISMANIAANVKR # GNVYESVAQYSSDWDLMFENAREYNEDVSTIYNDTYILQHVFQNALEAATRIHGIILNDPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g266 ### # start gene g267 3 AUGUSTUS gene 655139 656845 0.99 - . g267 3 AUGUSTUS transcript 655139 656845 0.99 - . g267.t1 3 AUGUSTUS stop_codon 655139 655141 . - 0 transcript_id "g267.t1"; gene_id "g267"; 3 AUGUSTUS CDS 655139 656845 0.99 - 0 transcript_id "g267.t1"; gene_id "g267"; 3 AUGUSTUS start_codon 656843 656845 . - 0 transcript_id "g267.t1"; gene_id "g267"; # protein sequence = [MSLPSPEVVRHPADYSPFLNILQNKDVPESTAQRQHLRDIIKKSTEEDIPAIDEEIQELLARIRELELTKKGILLNVS # KFQEILTPNPIHRLPTEILLEIFFIHRDTTEGYITTISNGVWPLSHVSREWRSITLSLPKLWSNIAISAIESPAKNQLQLLNTALNRSGSHPLYVVAH # FSWSTGFDDDDGLFSTYGYPQTRNDTSNLGIPSWPSERQLSEAMIKSVVGHSNRWKTADISVLDPSLLRPIYGQLSSLEKLTFAGDLDDFPQILSIAP # KLRDIEFHNSDSSSLQLPWTQIFRFRESQWNPSMDLLPRYLRILRQNTQFEDFGVEYESIRSGNTPQLLTHTKLKAFMCTDIRLIRCLTLPNLQSLHL # KAPFMRMCPSDMIPASSDLLSRSRCASNMRVLRLEGVVLNRDVLSLLESTASLTELNFTFDKWVISNDTFLKVFIQRLSTHGKSRKDMARILLPKLES # LTIDIEAINSHEWFACNIQFIDDSFVEMVEARWKKSGNGISQLRVVKFEGYTPATLSAFTVSGVTRMKKMRDEGLETYIATMDINSTDDDRKEKTYIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g267 ### # start gene g268 3 AUGUSTUS gene 665145 666164 0.78 - . g268 3 AUGUSTUS transcript 665145 666164 0.78 - . g268.t1 3 AUGUSTUS stop_codon 665145 665147 . - 0 transcript_id "g268.t1"; gene_id "g268"; 3 AUGUSTUS CDS 665145 665773 1 - 2 transcript_id "g268.t1"; gene_id "g268"; 3 AUGUSTUS CDS 665891 666164 0.78 - 0 transcript_id "g268.t1"; gene_id "g268"; 3 AUGUSTUS start_codon 666162 666164 . - 0 transcript_id "g268.t1"; gene_id "g268"; # protein sequence = [MGKGGIDTIPSDERTAPAPPPHLANIQDNPESLLRESPQDDIEDIENVLTAPTKLLPRETGEDIGMGSPVPLSSEAVG # VITRLRNMKVSSISLKKPPPGNKKQKNKGEFVNEQLNAAMKGIDVNDEFPVTSATGQLKGTTSADCLLSELTSEVSTPLEGVDPTPIGTESFAAPSDD # KIEKFRPAAAPFVKSKPKLIPLVRIPDPAEPVQLTTPEAVSIAGELIAAASDANAGPEQFPQGPAADPNEKQSYCPECYLPLHPDPVPEKLYIFLHAL # RYTTSLGTFETEMPAWSAEGFTWDIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g268 ### # start gene g269 3 AUGUSTUS gene 688984 689330 0.35 + . g269 3 AUGUSTUS transcript 688984 689330 0.35 + . g269.t1 3 AUGUSTUS start_codon 688984 688986 . + 0 transcript_id "g269.t1"; gene_id "g269"; 3 AUGUSTUS CDS 688984 689047 0.35 + 0 transcript_id "g269.t1"; gene_id "g269"; 3 AUGUSTUS CDS 689194 689330 0.59 + 2 transcript_id "g269.t1"; gene_id "g269"; 3 AUGUSTUS stop_codon 689328 689330 . + 0 transcript_id "g269.t1"; gene_id "g269"; # protein sequence = [MALNKGVGKKYIKEMFEEFDHKEISKAQMEGYTYDPNWKDSLNSGNEPIRSPKLPRASVQDSEKIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g269 ### # start gene g270 3 AUGUSTUS gene 692658 693095 0.59 - . g270 3 AUGUSTUS transcript 692658 693095 0.59 - . g270.t1 3 AUGUSTUS stop_codon 692658 692660 . - 0 transcript_id "g270.t1"; gene_id "g270"; 3 AUGUSTUS CDS 692658 693095 0.59 - 0 transcript_id "g270.t1"; gene_id "g270"; 3 AUGUSTUS start_codon 693093 693095 . - 0 transcript_id "g270.t1"; gene_id "g270"; # protein sequence = [MGSLIQTTYHCADQGKSVTVTVADRCTGCAMYDLDFTPTGFEALSDLSVGRISGVTWTFDDSASEPAVSGNGTTPDPD # SDSSSGTSTNSSSGDTADSTDLDSSSAVNITTQPGTTVNTTTTSSDIGSAPPSTKRRIWARETSLVF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g270 ### # start gene g271 3 AUGUSTUS gene 700742 703078 0.28 - . g271 3 AUGUSTUS transcript 700742 703078 0.28 - . g271.t1 3 AUGUSTUS stop_codon 700742 700744 . - 0 transcript_id "g271.t1"; gene_id "g271"; 3 AUGUSTUS CDS 700742 703078 0.28 - 0 transcript_id "g271.t1"; gene_id "g271"; 3 AUGUSTUS start_codon 703076 703078 . - 0 transcript_id "g271.t1"; gene_id "g271"; # protein sequence = [MHGICLEQMPVYSSSTNGVAERKHGVTFAKVRTVLHESKLRENLWAMAAAYVVYTENLLPSTRNGLRIPAEVFWGTRQ # DISHLHPFGARGWATIVNGTLSKTDMRAQEGKMVGYGERGVYLLYLLSGKVITSRDVMFEEGLPQRTLTPGGGEMEEDQGNEDHDHLFPPNATAASDA # TLPEKSDMNTLDTPTEVSARWTRTKSKPDPNIPLRRSTRLASSASSSTSMRTLETQPHANLASVIQSFDEVTAEFNTALTAIGIAPVPKSYSKAMEDP # EQWSPAIDKEIQRMEEFGVFGPLQDPPAGATILVPLWVLAHKFNGNRNIIEEKARLVVNGKTQEEGRDYYQTFAAVLRFESLRILIALWVTLGYHIWQ # IDFASAYLNAELNEEIYAWPPEGFPGKGTGKVMRIRKSIYGMMQARRNWWRTLDGTYKELGYSCSQADQCVRSRVSSTGETMTGTYTDDTLGGNEEME # KAKREIGSRYRIKETDSVQFALGMKLTHDRKKGTAALSMPAYWENLLDHHGLRDVKPKSTPLPSGANLSLGSTPPTTDDIDFMREKPYREILGAIQFG # AAACRPDIAHAANILSRFAHDPRKAHWQGLMHLVRYISGSRDLGITYTRDTRRGLSPVTYADADYASCIDPRRSTSGVITIMAGGPTFWMSKCQDVVA # LSTTEAEYIALAKAVQQAKWVHSFLTELGHNIPQPLLIKCNNQEAIAISENPKFHSRVKHIDVRYHFLRDAVERGEVVIEYIPSEDNPADILTKSLGS # TLHGRQVSLLHLEH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g271 ### # start gene g272 3 AUGUSTUS gene 703896 705020 1 - . g272 3 AUGUSTUS transcript 703896 705020 1 - . g272.t1 3 AUGUSTUS stop_codon 703896 703898 . - 0 transcript_id "g272.t1"; gene_id "g272"; 3 AUGUSTUS CDS 703896 705020 1 - 0 transcript_id "g272.t1"; gene_id "g272"; 3 AUGUSTUS start_codon 705018 705020 . - 0 transcript_id "g272.t1"; gene_id "g272"; # protein sequence = [MASNGAVPPPIPEVSADLKFDGGIKVSWTPVKQRIVNSLKTQGLLGYTNGTISKPPPIIIIISPPARTLTTDPTITST # ISPSPSQDPPKATAIFSLMPSLEEWIFRNDQAKGIIELHVEDLPSLMPNVDARMAKEVLDTLEKKFARKDGMRKVLTERNLQSLTFRETIPIDEFLNQ # LRALRKDAIEGGNSITDAQFREIIIAAFPTSAFDNIIQNITANPLLYTTAASVIQQILFQYSRVENRLNAVVAGNHISQAHSVAAPISPQAALMLRIE # QLESMIVSKMVRSGNSDKKCHNCGRVGHLKDECFRKGGGKEGQYPSWWRGKRDDTIVSTNPSSSSMAISEPMLHYAMTASDVTQKAGELYADSGATDD # FF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g272 ### # start gene g273 3 AUGUSTUS gene 711493 712212 0.85 - . g273 3 AUGUSTUS transcript 711493 712212 0.85 - . g273.t1 3 AUGUSTUS stop_codon 711493 711495 . - 0 transcript_id "g273.t1"; gene_id "g273"; 3 AUGUSTUS CDS 711493 712212 0.85 - 0 transcript_id "g273.t1"; gene_id "g273"; 3 AUGUSTUS start_codon 712210 712212 . - 0 transcript_id "g273.t1"; gene_id "g273"; # protein sequence = [MDFIEQLPMSNGYTAILVIVDRSSKQAIFIPTFDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKA # LSMELHYTSGYHPEADGQTEHVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKRYHPNITVRPEVDMKSDLARDFVVNLDEL # HVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTCPTEKFSEKYLGPFKVIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g273 ### # start gene g274 3 AUGUSTUS gene 712591 714699 1 - . g274 3 AUGUSTUS transcript 712591 714699 1 - . g274.t1 3 AUGUSTUS stop_codon 712591 712593 . - 0 transcript_id "g274.t1"; gene_id "g274"; 3 AUGUSTUS CDS 712591 714699 1 - 0 transcript_id "g274.t1"; gene_id "g274"; 3 AUGUSTUS start_codon 714697 714699 . - 0 transcript_id "g274.t1"; gene_id "g274"; # protein sequence = [MANITVRFPSGELLLLPFYVTHWDSSCKAVLGYSFLSRYNALIDWASQNITFRNTSHFDSPQTSVPSAINPVVAKVAV # PLPEPSPLVSPTILETPPGDSPCSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVNIALVSAAVFNRACKDAGMEPILLHAIHSEVAACA # ADRSSTTPTVPPLHPSIPEEYAKFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVP # KKDGKLRLCVDFRGLNRITKKDCYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPVAFQRFVNDIFS # DMLDVCVIVYLDDILIYSDTPEEHREHFKEVLRRLRHHRLYANPEKCEFNMDTIEYLGYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFY # RHFIYNYSDIVVPMTRLTQKGAPWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIHADGEIHPLAFLSRTLHAAELNYDT # HDKELLAIFEAFKAWRHYLEGSGDPVDIVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSIPRRWDVYPKEGDIGYAQVNPHN # FRPIFTNEQLTASLRATFLEGPVLQVSIIMDIEALH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g274 ### # start gene g275 3 AUGUSTUS gene 715122 716677 0.42 - . g275 3 AUGUSTUS transcript 715122 716677 0.42 - . g275.t1 3 AUGUSTUS stop_codon 715122 715124 . - 0 transcript_id "g275.t1"; gene_id "g275"; 3 AUGUSTUS CDS 715122 716302 0.96 - 2 transcript_id "g275.t1"; gene_id "g275"; 3 AUGUSTUS CDS 716386 716677 0.42 - 0 transcript_id "g275.t1"; gene_id "g275"; 3 AUGUSTUS start_codon 716675 716677 . - 0 transcript_id "g275.t1"; gene_id "g275"; # protein sequence = [MPPKTRAQSRANSKENTFFTTAQSFAPFSNSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEGQQFEYSTLYTGDGQP # VQVLTPRRGQPPWSLRIRAESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHNDLDDDSSGLLRGEPGDPSGPGGPRSPLSPDIPNEQRAMLELLS # GFKGSIETLGTVLATLGRPSDSSESKSKVKEPEVFDSSDPRKLKMFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWT # SSFKALVKELQDNFGIYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTHWDSAALKWAYGRGLAERIKDKMARLPEPATLADYRQEVLRIDNRY # WKHKETKKREAGKPFIAWNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTLKPKPFSGGKPNNNGKPQNSLNSGQSGGQRPAFNHLGADGKVLPSERERR # MKNNLCLFCGGKHQIADCNK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g275 ### # start gene g276 3 AUGUSTUS gene 718414 721168 0.14 + . g276 3 AUGUSTUS transcript 718414 721168 0.14 + . g276.t1 3 AUGUSTUS start_codon 718414 718416 . + 0 transcript_id "g276.t1"; gene_id "g276"; 3 AUGUSTUS CDS 718414 720535 0.16 + 0 transcript_id "g276.t1"; gene_id "g276"; 3 AUGUSTUS CDS 721119 721168 0.35 + 2 transcript_id "g276.t1"; gene_id "g276"; 3 AUGUSTUS stop_codon 721166 721168 . + 0 transcript_id "g276.t1"; gene_id "g276"; # protein sequence = [MEDDHQHEHDQHTRHRGDEQHTTHRDQHTRGKFFMENTGSDSEVESMSTTRVGRRSGTPTTPTPTATTTPSATTTPTP # TPTPTATTARRRSFPIPIPPETRTTEGTRTLPTSAPPPSSYTYPFQPYPFQAYPGNPDPGTPIPNTGYYGGYSRRSSSMESLSNRRRSGGFSEDSAHS # NSGVGVGVPAVQAGEEEVLGRPVAPFMTNGGGGSPRNTLYRNSAAAATVTTKGSSQNLSEGTTTTSRPGSMIFRAPFLSPASRNSSTVWTPPAYTPQQ # AHSQQHQSISPSGSTTALSSLVRKGKPPVPSTLLPNGKLTNADKPWLGAPHPRDRLAKILTYGCILLGLAGAALLCFFDLRGLDLLDESHLCVVFQDD # FSGDALDTGNWKRTVALGGFGNGEFEIMTNKDENLKIQNSNLYIIPTLTSADIGGTSSIFDGYTYDLGDACTSTNTSQCSVTSSSNTTSVIPPVQSSM # ISTNGTHSITYGRVQVRAKLPLGDWLWPAIWMLPVNNTYGPWPLSGEIDIMEARGNAPTYPAQGTNFVRSSLNYAPLPSSLLTQIFGWWSMKQGGFDR # GFHTYTLEWSPQFIRMYVDSRLQAMVELETKTRGQSFWSKGGYPSVAMNDVGVEVPVTDIWGSGDGSDSSTTSTSSSTDAPDTDDNNNWSAPFNQEFY # LIISLAAGGTSGWFPDNVGGKPWADGDPGAMKAFAEAQVGFFVPDSEIGFEISGFRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g276 ### # start gene g277 3 AUGUSTUS gene 726024 727850 0.54 - . g277 3 AUGUSTUS transcript 726024 727850 0.54 - . g277.t1 3 AUGUSTUS stop_codon 726024 726026 . - 0 transcript_id "g277.t1"; gene_id "g277"; 3 AUGUSTUS CDS 726024 727850 0.54 - 0 transcript_id "g277.t1"; gene_id "g277"; 3 AUGUSTUS start_codon 727848 727850 . - 0 transcript_id "g277.t1"; gene_id "g277"; # protein sequence = [MMAEKQTGKVLRAIRINRGGELNNGLVDMYCTEHGITIEKVPHDSSAANGVAERSFHMVMEGTRTLLEEVGLPYSFWG # EASATFIYVNNLVPSSRFPDTVPVEAWTNKHHDVSHLRPFGCDCWATLPRRQTDGKLGRQAVKGKLLGYIGRRGYRIWVPESKKIEESHDVTFEEGRA # HRTRSTQGMEDASDEGIQGELTGTTTPESSKPDDTNTTNTTSSHHQTQGTHNAKQTPDPIQDPVPNQTEALKPQIAPNPPIATRHSSRGHVPSRRYIE # SEEYEERERVANNRGKQWTMDTAPAEHPFALLTQTPCSFAATSGDLWVPQSFKQAIKNADLWWEPMEKEFATLISKECWDLVPLPPNANLTSGHWTYA # IKFDASGNLLKRKARYVAQGYTQVQGQDYDKTYGGVARMESVRLVLAIIAVLKLSIFQVDFTAAFLNNPIAHVYLKQLEGFIAPGTEHLVCKLKRSIY # GTMQGSHDWQETLAAGYQADGYVTSRADPCIRYRRNGNEYTITSTYGDNVCGGSSTTTGRDKAVADLGKRWEANEVTSQVLLGMTIRQDPASKAYFQR # MLAHFGLENVRRRTTPLPPGIKLHESPNPLPEEEQQFMKE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g277 ### # start gene g278 3 AUGUSTUS gene 740356 741945 0.9 + . g278 3 AUGUSTUS transcript 740356 741945 0.9 + . g278.t1 3 AUGUSTUS start_codon 740356 740358 . + 0 transcript_id "g278.t1"; gene_id "g278"; 3 AUGUSTUS CDS 740356 741945 0.9 + 0 transcript_id "g278.t1"; gene_id "g278"; 3 AUGUSTUS stop_codon 741943 741945 . + 0 transcript_id "g278.t1"; gene_id "g278"; # protein sequence = [MARYLSQSRIEGPVWLSPHEKTILQSYISKAEQEIESLDSQIEKLTRDKDIQFAVRASVKNILSPVRQMPNEILSKVF # ELVCYPDGGEFHAGFGIVRRTTSLSQVCIAWRRAAHDTPSIWSRLSLSIPYHRDLIKGGGKCVVEWLLRSQELPLEFYLDFPENDESYWPEEDESKQH # PEIEPLIKEVHSLLNHILSRPPFLERIRLLKLTGYPCFFTPLFVLEPFSLCSLEMISIRITRNFAENHWPVDTFSLAKNLRHVEIIDFYPKSQLETIM # LPADQLVKLNIAGIIYSSNFEPSVYTDFLRRCSSLVTLEISPPASLKFRSPPAPISLLVLKSLRLTFFSSFYGLQGVSSLLRLLVVPLLEDLTFSLRH # VGFQEFVTGITALQNNLPTSNLKSLTLEMGYMANADMTLVLALFPAITSFRLSDIGFDTNHLFQAMTYKKNLNDDFVLLPKISNLELEYREKTSYPSE # LISMMLSRVDGHQPQGFIDVARLRRVCIRQAKFLEKTDEDRARIAEVPVSIVYTESWGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g278 ### # start gene g279 3 AUGUSTUS gene 743069 744646 0.98 + . g279 3 AUGUSTUS transcript 743069 744646 0.98 + . g279.t1 3 AUGUSTUS start_codon 743069 743071 . + 0 transcript_id "g279.t1"; gene_id "g279"; 3 AUGUSTUS CDS 743069 744646 0.98 + 0 transcript_id "g279.t1"; gene_id "g279"; 3 AUGUSTUS stop_codon 744644 744646 . + 0 transcript_id "g279.t1"; gene_id "g279"; # protein sequence = [MELYLSQSGTEEPLRFSPVEKFILAEGEIESLDSQIEKLTHNEDEVALLALVSDILPPAHRLPIEILSEIFELVCYPN # HGRFYPQFDVVRTTTSLSQVCVVWRQVAHDTPRIWSNLCLSIPEHMSLFNAGGKWVNEWLSRSGVLPLGLYLDFPTDNSNWSTEEEMETYSEYKYLVQ # EVHYLLDQILDHRHYLLDRIRSIKLIGDPIFFTPVFVLGPTSFRGVERISMQMTRSLDENLRVNSFSSANNLRHLEIVEPYFRSQLRAFLLPAGQLIN # LQIRTRNYSHFDTSVYADFLHRCSSLVSLEINPACSPAFNSPTDNVFLPMLKSLHFTFHLPSEGDETPGVNLLHILAVPLLEEMTLILGYVEFHDFSR # DLTALQGNSPTSNLKSLTLEMNWTFKAIDATDLASVLLLFPTITSFRLFGIQSDMNLLFQAMTYHNLNDDSVTLLPMILNLELEYRKKTRYPSELISM # ILSRSWQNGHQPQTGAGLVARLQQVSILRAGYLQKTDEYSVRIAEVPDSVVYSES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g279 ### # start gene g280 3 AUGUSTUS gene 745133 746722 0.91 + . g280 3 AUGUSTUS transcript 745133 746722 0.91 + . g280.t1 3 AUGUSTUS start_codon 745133 745135 . + 0 transcript_id "g280.t1"; gene_id "g280"; 3 AUGUSTUS CDS 745133 746722 0.91 + 0 transcript_id "g280.t1"; gene_id "g280"; 3 AUGUSTUS stop_codon 746720 746722 . + 0 transcript_id "g280.t1"; gene_id "g280"; # protein sequence = [MAHYLSQTQIQGPVWLSPVDKAILQSHVTTAETEIKNLDSQIEKLTRDKDTQIASLAFIKNILTPVRRIPNEILSEIF # EFVCHPDKGEFYAQFDTVRRTTVLSQVCAVWRRVAHDTSRIWSRLCLSIPENRGLFKREGQWVVEWLSRSRELPLELYLDFPRDNYEWVIEEEEELTT # YSDDKSLVQGIRGLLNQILGHYPYLNRIRSLVLSGDPLFFTPLFLLPSLSLQGLERACMQMTDYFHGIQPAIKNFLLGSKLRYVEIVDSYLESYLETF # MLPAEQLVDLQIVTTGSDSDFDPCVYADFLRRCSSLVRLDINPPSCSKYNSPSTARVSLPMLKSLSFIFHPSYDDEFPGVSILHILAVPLLEEMTLDV # QRIELLDLATDMTALQGNSPTPNLKSLTLEMGRMHNDPDDLTSALALFPTITSLRLNGILFDMNPLFKAMTSTQSNVNFVLLPRIVNLELECRRDTAY # PSELISMILSRSSIADAGLVSVLQSVSILQAHYMEKTDEDLTRIAELPDSVIYSELRDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g280 ### # start gene g281 3 AUGUSTUS gene 747305 748681 0.54 - . g281 3 AUGUSTUS transcript 747305 748681 0.54 - . g281.t1 3 AUGUSTUS stop_codon 747305 747307 . - 0 transcript_id "g281.t1"; gene_id "g281"; 3 AUGUSTUS CDS 747305 748681 0.54 - 0 transcript_id "g281.t1"; gene_id "g281"; 3 AUGUSTUS start_codon 748679 748681 . - 0 transcript_id "g281.t1"; gene_id "g281"; # protein sequence = [MHWSVSCASRIDTQEFSSMSFDCQQVAHLDKQEAQLKEQQVQLQAEKELIDTRYNKLLQKKAEVEDLERKVEMLHDIQ # REERILLDMRKKELEAQKDAQWENGKDIRRKELTVLEHEKELQIKEQKMIFQDTALQQKLSRLQQREEAVWEREGRVKTREEDVKLKYCAVKEYQGEL # DHTEKERQKQAEKILRQAERKMKQVEEDSKLVEEESNLVEEQVKLVEEQSREVEEKSKKMEKKMKEAEEKLKHAEARSKEVDLKLEMCSESLSKHSAM # LTGKENYLQGQEKGLAQEKTHLEEQKRIFEKEKANFHQEQKQLQISQATLMTWRKETAARSFAIHIKEQNFIRKDEAWNKRDIELKIGQKELQKQLDN # ILEKNRWLDEELKKIHDLQGQLQIDKEKIGLLESQVQAKEKEVRDSESILQTVKKNIASGLEKLGTFDGSRVTAVVCILCTRASTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g281 ### # start gene g282 3 AUGUSTUS gene 751417 753395 0.21 - . g282 3 AUGUSTUS transcript 751417 753395 0.21 - . g282.t1 3 AUGUSTUS stop_codon 751417 751419 . - 0 transcript_id "g282.t1"; gene_id "g282"; 3 AUGUSTUS CDS 751417 752411 0.97 - 2 transcript_id "g282.t1"; gene_id "g282"; 3 AUGUSTUS CDS 752523 752950 0.23 - 1 transcript_id "g282.t1"; gene_id "g282"; 3 AUGUSTUS CDS 753082 753395 0.28 - 0 transcript_id "g282.t1"; gene_id "g282"; 3 AUGUSTUS start_codon 753393 753395 . - 0 transcript_id "g282.t1"; gene_id "g282"; # protein sequence = [MSLQPQPSHTSLSSVTSLSRYASAKSPSIDPYNGNPSRDFCNSFWGGDGDAGVNVLFARMRGGVRTIEGLKGFWKERA # AIEEDYAKRMGELAGVDLGRDEIGWVTEMEDPAAAMLNKLSDHKRLVMSAVEKRHKAKLQAEVYVAKAREKYYGDCVRIGVCRQQLQQLQENPNSGDL # DKVRSKLKRLEQTVAANEKDYAAFTKSLADSLPAWESEWRSFCDGCQDLEEERLDFMKDNLWAYANSVSTVYRDILAFVQEYGTGSSIPNPPEFVPFP # ASTMDPSSNPTSSQLSTTISTHPATFSRKSRKSGVPPAAPPYVAAQTGSSANPSSHPASHSGHSGPSASSITTAPTTAPPVPPPNVPPPSIPAPTMPT # SSIQQRGGGATPSSTSSPARVSPGSQQPATTNMNNAVSSPPRNTSSSPQQQRDQRDQREPNHQQRDQRNGYSNLNPNGHGNAARERGDQQSDSLSSRQ # QQTIQPTASTPATLEQRRLTLPPQPTDNEVAAPIPPVPTMGTGGSTGGGAGGERNKILFYGEFRGLFLSNVCPSLSSLLYLPLHSLISFNSFHSQRVS # LSNSMAIRMK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g282 ### # start gene g283 3 AUGUSTUS gene 761102 761419 0.78 + . g283 3 AUGUSTUS transcript 761102 761419 0.78 + . g283.t1 3 AUGUSTUS start_codon 761102 761104 . + 0 transcript_id "g283.t1"; gene_id "g283"; 3 AUGUSTUS CDS 761102 761419 0.78 + 0 transcript_id "g283.t1"; gene_id "g283"; 3 AUGUSTUS stop_codon 761417 761419 . + 0 transcript_id "g283.t1"; gene_id "g283"; # protein sequence = [MVELYFAEQSAIQASPTASGSMSVGSASTPDDMLQAPIDINSPTTSSGLSVSSNLGAIPESPLYHPSIHQPTTIGSQK # ITTAEQTYTSDFLDYFAGGTSWLNSSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g283 ### # start gene g284 3 AUGUSTUS gene 763410 765261 0.73 + . g284 3 AUGUSTUS transcript 763410 765261 0.73 + . g284.t1 3 AUGUSTUS start_codon 763410 763412 . + 0 transcript_id "g284.t1"; gene_id "g284"; 3 AUGUSTUS CDS 763410 763935 0.74 + 0 transcript_id "g284.t1"; gene_id "g284"; 3 AUGUSTUS CDS 764684 765261 0.83 + 2 transcript_id "g284.t1"; gene_id "g284"; 3 AUGUSTUS stop_codon 765259 765261 . + 0 transcript_id "g284.t1"; gene_id "g284"; # protein sequence = [MLHSSGPAPVPPPSQKARPKPIPVYKGTPAYEQMQILHPKTPCETDIAAAEQLMAFQNQTLSQTAQCVHRSKPLTADQ # LPLTLNEQVFAGAMGLSKADMLQQREFERQYGLEDMSSEPEEDEDTSQRVSTQRTKQRKRFKSISPAEDNPPSMDLEDFEGVGHTFDDDHDGVSSDTV # NDPPSCILARLGEKLGHQKRRNAPTLPPPPSVPSVPPQTPLAPAPATDAIAQAMTMVGTVTPLLAMLMNGNRGSREHSPPRTSSSKRHNADSSPAPAL # SPYKASTSRNEELLIWLPKVDADVERGKRNASYVQYGGILTEKGIFDLDDLVRLTSEHLEAFTGMAYGFCDRLLHYTREDMGIKLPKKARIGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g284 ### # start gene g285 3 AUGUSTUS gene 767932 774687 0.27 - . g285 3 AUGUSTUS transcript 767932 774687 0.27 - . g285.t1 3 AUGUSTUS stop_codon 767932 767934 . - 0 transcript_id "g285.t1"; gene_id "g285"; 3 AUGUSTUS CDS 767932 774687 0.27 - 0 transcript_id "g285.t1"; gene_id "g285"; 3 AUGUSTUS start_codon 774685 774687 . - 0 transcript_id "g285.t1"; gene_id "g285"; # protein sequence = [MVLCLLSIKLIVHCFFVVTFKVLDCILEIVYLRSLSKKRHFGGGRPPTNSESGIVSTLVTEAFTFKCPIQKTSTVPPK # TGDNIAFNFPPPPISESHMALVIDKWCKSSSPVNFEEAGCAVCGQLTLCTDLSALKNMKNYLHVLEAQSVTRALRTSPDELISEIEGPVLDKSAGDNI # CNNCRSSLRAGNVPKLALCRGLWLGVIPDELKGLTFYEKMLIARVRHTKCFVRVQKGSTNYSKLVSNVIAFENPIPKIYDTLPPPKEEIEEVLAVMFS # GSTKPTQDDYARALLLVRRNVVAKALQILILNHFDYNDVVFSSANLESYAEDAPIVTVEYFQKGSNRNAEGISVHDDLNDDGTEEGDCVFTVHGIVGP # SIKNMTRDQMIGIAAMHLDNEGKFMRTSHAENPESLWNNPQLYPKMFPWLFPFGLGGIGTSDIKAFSESSHIKFLLLYHDKRFQLDSNFPLIAFSHQQ # IKANSSQSYLLAESKKFSEISDQFLSVDKSILQNIATRMANGEHIKPANESEIQCFKLLGDLTHAGAKTQGSISSKKTMQSEIWSLINHIGGPSWYIT # VSPCDFKHSICIYYADTKEKFDVPLRTSSECRLLISNNPVAGARFFHLLVNLFLKHVVDIESSDGGLFDPTSGYYCTVEQQGRLALHLHGLIFNRKTL # SPQEIRDKILDPASSFQSQLVSFLESVRIGEFLSGSHAYVKETIASQTKSNPNYVSPERTLPTPPPPYCDCGTSDCHKCSTFIQWFEQFKLTVDDLLL # KSNVHDCFRGISPDGSVLNQDKFETSCLNNVHKKCKARFPRECFQQTLVDPENGHINLKKLEEWLNDISPGLTYLVRGNTDVSSILSGTAIKSAVIYI # ADYITKTGLKTHVVFDSIKTIFDKSTEIIDGSFSTKEKSRRLISRIVNLLSTKLELGSPIISLYLLNNPDHYTSHHFIPFYWRTYVSTARSVFEENDA # TSEPKVILTKRWGKIIGLSSSLDYTHRPVQHAHYNLYDWIYCFYKTAKNKSKGVIEHDPELISSRSSKGNKQLLFLPGHPLVDTHAIATRQDSSMTVP # NFVGSLPRPDKDDREYYCCTMLTLFKPWRSGEDLKNKNQSWHEAFEAYVFSDQSLLYMKNMNIRFECLDARDDFRAQLKSGKLDVTKLPSSIPVQLHE # DLVNKLDGSQLDVNSSVIEDSDYSYDQYTQDKKGSFFLKRESAMKAMKDILFNSGWVTPLTSNIQPKPIPICSPIPLPKEKPQHWDLILKGMRDHVLA # AREKSRGLPPADNNTNKNNEPGKYRPNIVEICDKYYFDKLGLEYGSIKELTLNIVKCHNLNNEQERAFRIIAQHSACLVSEPLQMYIGGMGGTGKSQV # IKALLQFFAERNSSFAIVTSAPTGNAAALLGGSTYHFLLGLNNKVEEVGRGTMAQVCARLEHIQYMILDEVSMLSCLDLYRISVQLCEAKNKHDIAFG # GMNMIFAGDFAQLPPVGGESVSLYSYRKPTDANKYNGQCAAMGKSLWHNVTHVVILRKNMRNTGSSKMDISFRLALDNMRYKSCTKEDILFLNTLVSS # KLPDRPFVGKSPWRDAAIIVGENKYKDEINRLGCLRFAADTKQKLTNFYSDDLVSGNADQGAPAKSKNKKRSMSSISKDLQQHLWELPTCAHEYHAPP # VLSLCIGLPIIIRHNIATELSITKGQRGTVYAWHESTGAFGQCTLDVLFVLLDDPPTPIQVPDLPPNVVPLTRCKTKGIVTLKNDVKISVTRFQVDVL # PSFSMTAYASQGQGLIPNATDLNTLSDHHAMYTALSRSRSAASTVILQGFDSRAITGGASGPLRKEYRELEILDEITHLKYEGTLDPSVVGVTRNLLI # ESFLVWKGTSYVPSQIHSAVSWSAKDPYIQQSEQPLSWSRVQKKAVKRLMKQNKKSNTSENTTTSPAPLVPPDISKFEVKSKKRNLSDVYGSTDIPLP # SAVRQRTTNQHIVPLSNELRRSSAARQASQKRARKNRITSGNQRQLAILPTGLTWSNNSCAFDSVLLILLYIWMELDITGDEYSNLPQLIKGFSEYKQ # GKHTLETVRDDLRISLNSRRPREFNLTGFCSSTAILEEMLKMKSPFMTTKLQCEQGHLSRRRPHNVKVSLLEEPRLVLPSSTNEWISVNGPASSSIMC # NVCNLPLRKLFHIKCAPNILAFACDGRPQLKIDYSVHLQCNNEDVHYVLKGVIYYIPMREHFISRIVASDNMVYVYDGMFNNGVPILESSDYSVLDWA # QCQSGSASAVIYSRTDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g285 ### # start gene g286 3 AUGUSTUS gene 777946 779637 0.98 + . g286 3 AUGUSTUS transcript 777946 779637 0.98 + . g286.t1 3 AUGUSTUS start_codon 777946 777948 . + 0 transcript_id "g286.t1"; gene_id "g286"; 3 AUGUSTUS CDS 777946 779637 0.98 + 0 transcript_id "g286.t1"; gene_id "g286"; 3 AUGUSTUS stop_codon 779635 779637 . + 0 transcript_id "g286.t1"; gene_id "g286"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSESISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFNLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGSGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTFSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLAAYRLEVLRIDNRYWKREETKKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPLTPKPKPFS # GGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g286 ### # start gene g287 3 AUGUSTUS gene 779970 783233 0.98 + . g287 3 AUGUSTUS transcript 779970 783233 0.98 + . g287.t1 3 AUGUSTUS start_codon 779970 779972 . + 0 transcript_id "g287.t1"; gene_id "g287"; 3 AUGUSTUS CDS 779970 783233 0.98 + 0 transcript_id "g287.t1"; gene_id "g287"; 3 AUGUSTUS stop_codon 783231 783233 . + 0 transcript_id "g287.t1"; gene_id "g287"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINPVVAKVAV # PLPEPSPSVSPTILETPPGDSPRSRSRSRSRTLRAKPLSSKFPFELIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSNIVVPMTRLTRKGAPWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRMLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g287 ### # start gene g288 3 AUGUSTUS gene 783897 785000 0.92 - . g288 3 AUGUSTUS transcript 783897 785000 0.92 - . g288.t1 3 AUGUSTUS stop_codon 783897 783899 . - 0 transcript_id "g288.t1"; gene_id "g288"; 3 AUGUSTUS CDS 783897 785000 0.92 - 0 transcript_id "g288.t1"; gene_id "g288"; 3 AUGUSTUS start_codon 784998 785000 . - 0 transcript_id "g288.t1"; gene_id "g288"; # protein sequence = [MSASRTTTTTTSATAGPSRSRPVPPPPPPASDSAAQEEEDLEDEDEDDIIRKAQARVERVRARKAAEAARKKAEEEAA # RAAAEKKRKAQEAQERAKRARQQEEEVVERRRLLAAAATARSQRGTSPSEVSASPRRPVVEIRRTKSKGKGKARAEVCASTFNFASTNLRILQPVGGD # PDDGDEGDDDDDDDKEPCERCRAKKISCQMQAGKRSSVICKPCHDAKVRCSYSGRPPTVKREGGSNPTGEHLAVLESQVAQLLADNRQLRDGQVKANT # YHRHMNRKLDWLVTDAARRRRTPPELPEAGPSGLPRKRRRVLDSDEEEDREREKEVEEQGMEEDGEGDEEEMVEEEPAPAKAQSEKGKERAVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g288 ### # start gene g289 3 AUGUSTUS gene 786451 787326 0.4 - . g289 3 AUGUSTUS transcript 786451 787326 0.4 - . g289.t1 3 AUGUSTUS stop_codon 786451 786453 . - 0 transcript_id "g289.t1"; gene_id "g289"; 3 AUGUSTUS CDS 786451 787326 0.4 - 0 transcript_id "g289.t1"; gene_id "g289"; 3 AUGUSTUS start_codon 787324 787326 . - 0 transcript_id "g289.t1"; gene_id "g289"; # protein sequence = [MQESQRLFACFGSLIGSTKFGCPVSEGVIDFRSNQRFDSDVWKDDPDNLSPLEPGLSSSSLFDVSSQIIFLLSVTPGK # KREVSNIPKNIHCKDPMPFCRAGNRMRFPHSSILTQATVPIFDGRGSFVASAAQLNQISSRTYPLYLDSQEEAPPDSIVCIGYTAHTWQSSGSSKAPP # LCLSLGLQFVVVLALPPGYDGPAPPSSGSSGPFPKPIYNTPTRTKDFPGPPRRNHSRTQASSSRVSPEAARPLRVTRRNQADSEDESPYLSAGRLKEG # YEYHEDLMATKSISRAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g289 ### # start gene g290 3 AUGUSTUS gene 788810 789427 0.86 - . g290 3 AUGUSTUS transcript 788810 789427 0.86 - . g290.t1 3 AUGUSTUS stop_codon 788810 788812 . - 0 transcript_id "g290.t1"; gene_id "g290"; 3 AUGUSTUS CDS 788810 789427 0.86 - 0 transcript_id "g290.t1"; gene_id "g290"; 3 AUGUSTUS start_codon 789425 789427 . - 0 transcript_id "g290.t1"; gene_id "g290"; # protein sequence = [MYYASDDPDFTKLVSSPSSSQHHGGNLLSGVANTPTSHGHPHPSSTSSASADVSVGLQVDEDSFELCYPPEDPVVPTA # VETFSRRLSVDEYDDMDIDLPADFRSIRALRTPSPDLPSNPLEGWSPTPRSQSTLGSLTRPGLFANSSTNPHISPSKLKRGMSPLKALSGCQVHAAGL # HSAARCSEDLLLIVISLLLFFLATHTLSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g290 ### # start gene g291 3 AUGUSTUS gene 794031 795092 0.39 - . g291 3 AUGUSTUS transcript 794031 795092 0.39 - . g291.t1 3 AUGUSTUS stop_codon 794031 794033 . - 0 transcript_id "g291.t1"; gene_id "g291"; 3 AUGUSTUS CDS 794031 794861 0.86 - 0 transcript_id "g291.t1"; gene_id "g291"; 3 AUGUSTUS CDS 794940 795092 0.39 - 0 transcript_id "g291.t1"; gene_id "g291"; 3 AUGUSTUS start_codon 795090 795092 . - 0 transcript_id "g291.t1"; gene_id "g291"; # protein sequence = [MPVPETNGEEWDRLEAASALDVLVELGLNGEYNGMDSARRSMIGLELRTAANFVRKEETKYAIVSAMVASEGNGSFLL # RLPTYSMLTLSTDPSKLPPTPLLQALSMSPESSTPIDHVLVSSIHFSSLLFSHLLRSSPRCKALARSIKPQTPQTSAHHPSDGGGQFFVPADGPAPAP # EPEPATGAEEDDDDPQTLIQILAENLSLAFLSRSRTDTSDMESREWERLIVGYLALLSQWLWEDPAAVRDFLNSGGLGIVSPSLHETSTVHWNDWTIG # FLQLVEPINQVSETDFLISSLCVFLLGILYEYNREPGEITRYGYVLVTRSYCG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g291 ### # start gene g292 3 AUGUSTUS gene 799057 799544 0.28 + . g292 3 AUGUSTUS transcript 799057 799544 0.28 + . g292.t1 3 AUGUSTUS start_codon 799057 799059 . + 0 transcript_id "g292.t1"; gene_id "g292"; 3 AUGUSTUS CDS 799057 799155 0.28 + 0 transcript_id "g292.t1"; gene_id "g292"; 3 AUGUSTUS CDS 799269 799544 0.84 + 0 transcript_id "g292.t1"; gene_id "g292"; 3 AUGUSTUS stop_codon 799542 799544 . + 0 transcript_id "g292.t1"; gene_id "g292"; # protein sequence = [MSLEQNITLSTGASLRQIGLGTWLSKPKEVENAVEIAVRNGYRHLDLAMIYENQDEVGAALKKVIPSVVKREELFMTS # KLWNSSHQPAEAEKELDQTLSQLGTDYLDLYCALTVSLCTLIQSIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g292 ### # start gene g293 3 AUGUSTUS gene 800119 800529 0.94 + . g293 3 AUGUSTUS transcript 800119 800529 0.94 + . g293.t1 3 AUGUSTUS start_codon 800119 800121 . + 0 transcript_id "g293.t1"; gene_id "g293"; 3 AUGUSTUS CDS 800119 800529 0.94 + 0 transcript_id "g293.t1"; gene_id "g293"; 3 AUGUSTUS stop_codon 800527 800529 . + 0 transcript_id "g293.t1"; gene_id "g293"; # protein sequence = [MYCHCTTVVGKPKLTDYPAIVEIAKAKNATPAQILIAWGAYRGYSVIPKSVQEERIKSNFQQVNLTKEEYEAISAVGK # GNHTRYVLSGRHISTMSLVTDPTFARFNIPYNYQPRWDINIFGEPEEKDASNPVNIGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g293 ### # start gene g294 3 AUGUSTUS gene 807378 807749 0.54 - . g294 3 AUGUSTUS transcript 807378 807749 0.54 - . g294.t1 3 AUGUSTUS stop_codon 807378 807380 . - 0 transcript_id "g294.t1"; gene_id "g294"; 3 AUGUSTUS CDS 807378 807749 0.54 - 0 transcript_id "g294.t1"; gene_id "g294"; 3 AUGUSTUS start_codon 807747 807749 . - 0 transcript_id "g294.t1"; gene_id "g294"; # protein sequence = [MKLTNFAVLASLVALTAQSVSAANVKVADPVDASPATDVTTTVAPSPVASSTYVDVELLDPSASNGTVNVKVPLPGFS # KELYSSLVAGAESTLSSAACIPRVHSAHGATGTAAELRAASCSRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g294 ### # start gene g295 3 AUGUSTUS gene 810799 812457 0.73 + . g295 3 AUGUSTUS transcript 810799 812457 0.73 + . g295.t1 3 AUGUSTUS start_codon 810799 810801 . + 0 transcript_id "g295.t1"; gene_id "g295"; 3 AUGUSTUS CDS 810799 812457 0.73 + 0 transcript_id "g295.t1"; gene_id "g295"; 3 AUGUSTUS stop_codon 812455 812457 . + 0 transcript_id "g295.t1"; gene_id "g295"; # protein sequence = [MSSSHNSSSHLMRRLVPKTLRGSRQNRTQIRTESPTTNASATLPFVSHTPTLPAAAAAMPALFPSEVQSDIFKNEPRS # APHPPIRPPRPPTLSTGDPIVTYHTNFLGLFSGDGETPIATTVPPKLTDLVPPMQVHPAEHDYDTSVPGETPATSRDNRAPGVPRAKVIEDFDYVGGW # IADAGGKQQYVSRGHIEEIEEDAERDVGIPSGSYPAGLSAIAGPSSRFLDALSLPASTTPPPRPMLSTKRDLPLSQSDSGSNNHPFHHPFFTKHKPLA # TTRQFAASPLSQSVSSLAHMPLRGFTSLHHTGGQGPTGPEQNTFFGPSASHDTDVDMQYEPLPVGSPPFDPLADSLSSLPGLRGFAPFTPNTERISEE # NITSTPEPFEHSTYPAFESLGHSLDSISPAQQADRSEKELPLPPSPTSQIPLPHPVLGTEAEGPMNPTLPTPAPLPHIGDLGDPIIILPLHESTPPRN # PNRNGRTSGKNNAQPGDARNRNKKEKENRNDEPIEETEQRISTSIKEIVGIVRGVRGVSSETYFNHDTLPSSLLFLLLIALR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g295 ### # start gene g296 3 AUGUSTUS gene 814849 816126 0.9 + . g296 3 AUGUSTUS transcript 814849 816126 0.9 + . g296.t1 3 AUGUSTUS start_codon 814849 814851 . + 0 transcript_id "g296.t1"; gene_id "g296"; 3 AUGUSTUS CDS 814849 816126 0.9 + 0 transcript_id "g296.t1"; gene_id "g296"; 3 AUGUSTUS stop_codon 816124 816126 . + 0 transcript_id "g296.t1"; gene_id "g296"; # protein sequence = [MSALVGDLEWVEEWLMRSKGLPLDVYLILPQNIKHWPGCESWFNKTCDSLVDRLHKFLEKIINEPAHHRNRVSSLILI # GHSTFFSPLLKLPASSLPGLKRVFLQVTKDFSASLTQVKPFLGAPKLREVEIIEPYEESQLKTILLPAGQLINLKLMPGPGVVNSMFDPLIYKSFLQQ # CRNLVSLEILPPMNPVLPRYNFPTEGYIFLPVLKSLIFACSSSIWYSGISFLQCFIVPLLEDLDLDYGDIEFHDFCEIITKFQRQSGYIPNLRSLTVK # LGSMDNTVLIPVLDFFPRINSLQLVGINFDVNFLFEAMTYNPSTEQNSLPVPKISTLELVFKMNNWDNSYPSKLLSMILSRTLPDGPGELQVDTGAAT # RGKKIRHEVGVGVHRLQRVSVCGSELEKAAEDVAHIAEIPSTTIYSECWDCVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g296 ### # start gene g297 3 AUGUSTUS gene 818051 819454 0.99 + . g297 3 AUGUSTUS transcript 818051 819454 0.99 + . g297.t1 3 AUGUSTUS start_codon 818051 818053 . + 0 transcript_id "g297.t1"; gene_id "g297"; 3 AUGUSTUS CDS 818051 819454 0.99 + 0 transcript_id "g297.t1"; gene_id "g297"; 3 AUGUSTUS stop_codon 819452 819454 . + 0 transcript_id "g297.t1"; gene_id "g297"; # protein sequence = [MSSPVPPDSETPVASIDCSALPHALDPRDQAHAHNNDDTWCDCQSQPCPNALSNSIREPLTVSNITFLPIPQPRLPTP # IMSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERLSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATP # HLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMESRSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIA # PTLKEAIKRAISVDVYLHDPIMTGQNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPHRETTCRYCGRRGHL # EAVCQDKFMGLRRDRGRRQQPRRQQISATGPAPFSLFPNESVQIAFSTPTSASAPVAATRSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g297 ### # start gene g298 3 AUGUSTUS gene 819505 822459 0.87 + . g298 3 AUGUSTUS transcript 819505 822459 0.87 + . g298.t1 3 AUGUSTUS start_codon 819505 819507 . + 0 transcript_id "g298.t1"; gene_id "g298"; 3 AUGUSTUS CDS 819505 822459 0.87 + 0 transcript_id "g298.t1"; gene_id "g298"; 3 AUGUSTUS stop_codon 822457 822459 . + 0 transcript_id "g298.t1"; gene_id "g298"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQEQWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVCWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRQM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYQRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISALILALWTPDRPTRIEVDASGFAMGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYNREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHTFPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g298 ### # start gene g299 3 AUGUSTUS gene 825850 826560 0.98 + . g299 3 AUGUSTUS transcript 825850 826560 0.98 + . g299.t1 3 AUGUSTUS start_codon 825850 825852 . + 0 transcript_id "g299.t1"; gene_id "g299"; 3 AUGUSTUS CDS 825850 826560 0.98 + 0 transcript_id "g299.t1"; gene_id "g299"; 3 AUGUSTUS stop_codon 826558 826560 . + 0 transcript_id "g299.t1"; gene_id "g299"; # protein sequence = [MPPRTRAQSRANSEENTFFTTVQSFAPFSESISAIGQPRCRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGGGQP # VQVLTPRRGQPPVVAPAQGRSITRIDSPILQAIAHCTGKQPQRRATSQSPGDPPPHFNLGAGDHDDQDPPVEPDNPDNDNLDDDSGGLPRGEPGDPSG # PGGPGGPRSPISPDIPNEQRAMLDLLSGFKGSCHALSLKSSPCYLLDIPEPRTSSFPPPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g299 ### # start gene g300 3 AUGUSTUS gene 827599 830951 0.33 + . g300 3 AUGUSTUS transcript 827599 830951 0.33 + . g300.t1 3 AUGUSTUS start_codon 827599 827601 . + 0 transcript_id "g300.t1"; gene_id "g300"; 3 AUGUSTUS CDS 827599 829498 0.47 + 0 transcript_id "g300.t1"; gene_id "g300"; 3 AUGUSTUS CDS 830056 830951 0.71 + 2 transcript_id "g300.t1"; gene_id "g300"; 3 AUGUSTUS stop_codon 830949 830951 . + 0 transcript_id "g300.t1"; gene_id "g300"; # protein sequence = [MSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQGPP # PVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAVSEQ # SRASSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVVRIQECIPEDVAMVLREVLESMGIEILGD # GLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMNPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRILYRA # SNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRSGQTVYTYTPMRHMH # QLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCEPESVGEFPPEQFDQKRQLHGSDGRFLAQKHSSP # RSIEVPEFFNPGNSATRSPQLRSGTSPTVHALAQNSTPPPRVNLQTKPVTPVSTQRYQFGEVRMDGAKDGNPQVEQAGQIPDTPSVDRRRIHEWGARV # QRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGLGDSNSEGSDEGEQNQS # SRNGGRREEDRGELPTGAPEVPPTCYDPDQPWYYDPRQGWHRKAAPRPPNKGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMF # GVRPTIYAREKDKCASTASHLTGAALSHFDTLNRQRLKGEYTCLEDWTEFKREFGSKFGPIDEADEARR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g300 ### # start gene g301 3 AUGUSTUS gene 832106 836404 0.82 + . g301 3 AUGUSTUS transcript 832106 836404 0.82 + . g301.t1 3 AUGUSTUS start_codon 832106 832108 . + 0 transcript_id "g301.t1"; gene_id "g301"; 3 AUGUSTUS CDS 832106 836404 0.82 + 0 transcript_id "g301.t1"; gene_id "g301"; 3 AUGUSTUS stop_codon 836402 836404 . + 0 transcript_id "g301.t1"; gene_id "g301"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQQPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPLDKDLGPDDPILMGINEWLAFANESTEEEVEEILEAGRSTMEKVTLNPAKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGNHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESHTEEMLRASDSNA # PEGVQQPKDPESGNPSPEQGGIVKELDEEALKRQETEELKKSIPVQYQEYLDVFSPGEARTLPPHQPYDIKIETEGDAIPPIGKLYNMSEKELKSLKE # YIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGS # FEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDNILIYSDDEESHVEHVKKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEK # VKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFREAPVLGHYNPDLPVVLECDASDLAIAGILS # QLNPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFSTTKQLTARQAWWAELLSGYDFVINYRPGRLG # AKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTMMIEALKRIARNEEESLVWEDGLIKRGGRIYVPDVGTLR # REVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHPCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPVTAGPEKYDAILVV # VCRLTKQAIYVPCHTTNNAEDFANLFITHVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCAYDQD # DWDLLLPIAEFVYNNTTNTTTGVSPFFANKGYHPKLSITLERVQGAEVNKYAANLKELHTYLQERIRTANEVYTKYANQKRQEAPDWKEGNRVWLNME # NVKTRRPMKKLDHKWTGPYSILSQVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFPDKFRRQNSPPPPIFVKGESEHFVESILDSKPIKGKPEEVEYLV # KWEGYDEDFNSWVGWEGMAGSLELMKQWHREHNRKRKPKRDQWELLEKQAEDDRGEAVGSTGGTGNERENKDGWRRRNTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g301 ### # start gene g302 3 AUGUSTUS gene 836614 839389 0.87 - . g302 3 AUGUSTUS transcript 836614 839389 0.87 - . g302.t1 3 AUGUSTUS stop_codon 836614 836616 . - 0 transcript_id "g302.t1"; gene_id "g302"; 3 AUGUSTUS CDS 836614 837864 0.87 - 0 transcript_id "g302.t1"; gene_id "g302"; 3 AUGUSTUS CDS 837995 839389 1 - 0 transcript_id "g302.t1"; gene_id "g302"; 3 AUGUSTUS start_codon 839387 839389 . - 0 transcript_id "g302.t1"; gene_id "g302"; # protein sequence = [MTAPRTSTSADALGGPPSSPNRRDSDVDEIVSNVEEPSLGQLSLFKSVFGVGVSLARYIVDDPLWSTLAAAGLPCPTC # VRGKKEASCSLVPHLARCSNCDDKKPCVLGRLAHFRYFSRKCSCDLAFARRFLEVHGDPGQRTRYSLPTEQWRILYDRVEQSTNSTSALLELNPLDDQ # DQRELDRQELREFRQRQPLVPVPSTSVPHTSQLAGSSSLLPPAPVTKKRKRPAKVDPGFTPKRRRPEPAVDRSSPIAPPVPQVEGESGYRRVVLVLRP # PHVPDSEIPTLPGSGHLVPEDSSHRSVVEQSRSQGYAEIPHRVPQAGSFEQSVPPSEVEDFSRGRIKTPPVQQVSNWFSFFSLLSDMPIQRSREPMHP # YPRSQASSALRVENDRLKTEVEELRTLLAQSRGQVSTLTSLLRDTSSSLDLRSQELEASRRSLEEVARDRVEYQRVLSQFQAIEAELPEPVSEQEIGE # LRKQVDDASSRSSDAYAELDSANARALRQRDRLEELEEMVCSYRDRAHVAEGLIRQYPEDEGLIRQYPEDEGLYEVELPSLSEVQRKLDASEALVRWL # ATFAHRLYRADPANLLHYHNRYVGGLLEAITLLLYRGLHHTPERLSSIVDFVLGYLSQARFTHGELHLRSTSSLLYYYSNAADRVEGLYQEMLTHSRF # PSHDAFLTAAQHAGYVDARPGSLEPPLHRRFFSFDHPIPIAPSPTSDHLPAVPAMDSIMVSWERLIANYIRDMIDTPGPHYFFPTSADLTVVGGGSSP # LEGSIVAEEDDENAPREVAEVAGEVGANVATPAEEDDRGLPVGGSETPAMARTPLFLLASRSPSSPLLPPSVPVVPHIIDLTMIDDDGEDLYESREEF # EARMQGEVAVKNERSSPAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g302 ### # start gene g303 3 AUGUSTUS gene 843840 844997 0.93 + . g303 3 AUGUSTUS transcript 843840 844997 0.93 + . g303.t1 3 AUGUSTUS start_codon 843840 843842 . + 0 transcript_id "g303.t1"; gene_id "g303"; 3 AUGUSTUS CDS 843840 844997 0.93 + 0 transcript_id "g303.t1"; gene_id "g303"; 3 AUGUSTUS stop_codon 844995 844997 . + 0 transcript_id "g303.t1"; gene_id "g303"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRAN # AMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g303 ### # start gene g304 3 AUGUSTUS gene 845048 848755 0.99 + . g304 3 AUGUSTUS transcript 845048 848755 0.99 + . g304.t1 3 AUGUSTUS start_codon 845048 845050 . + 0 transcript_id "g304.t1"; gene_id "g304"; 3 AUGUSTUS CDS 845048 848755 0.99 + 0 transcript_id "g304.t1"; gene_id "g304"; 3 AUGUSTUS stop_codon 848753 848755 . + 0 transcript_id "g304.t1"; gene_id "g304"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTTFHWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSNDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQV # LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ # RHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLA # RLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE # ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNP # INGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g304 ### # start gene g305 3 AUGUSTUS gene 849494 850180 0.54 + . g305 3 AUGUSTUS transcript 849494 850180 0.54 + . g305.t1 3 AUGUSTUS start_codon 849494 849496 . + 0 transcript_id "g305.t1"; gene_id "g305"; 3 AUGUSTUS CDS 849494 850180 0.54 + 0 transcript_id "g305.t1"; gene_id "g305"; 3 AUGUSTUS stop_codon 850178 850180 . + 0 transcript_id "g305.t1"; gene_id "g305"; # protein sequence = [MAEFVINSWTHSALGMSPFKLTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGATLHLGKKQQKEGYERGKQKA # HQFKVGDLVWLSAEDINLQLSSEKLGDQQLGPYRILEKVGPLDYRLDLTLSLDCLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEDI # LDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g305 ### # start gene g306 3 AUGUSTUS gene 857241 857884 0.57 + . g306 3 AUGUSTUS transcript 857241 857884 0.57 + . g306.t1 3 AUGUSTUS start_codon 857241 857243 . + 0 transcript_id "g306.t1"; gene_id "g306"; 3 AUGUSTUS CDS 857241 857267 0.57 + 0 transcript_id "g306.t1"; gene_id "g306"; 3 AUGUSTUS CDS 857372 857884 0.65 + 0 transcript_id "g306.t1"; gene_id "g306"; 3 AUGUSTUS stop_codon 857882 857884 . + 0 transcript_id "g306.t1"; gene_id "g306"; # protein sequence = [MLPPQAALSLDGLGALFDQARQSFLRSFLDLQQAGQDPIVVLEALKAAEPQRESISIEDWTLLATLFQWSSPFNLNGL # KFDNRTPAEWIDLLRSIHSGATSATVTVDGHLVDTSQPPEAAVEVSEALDPQGSLPNTVVEKASGVEDLVSLSEGSPIQTELDLPQIESLTESALAPE # KGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g306 ### # start gene g307 3 AUGUSTUS gene 858989 860442 0.53 + . g307 3 AUGUSTUS transcript 858989 860442 0.53 + . g307.t1 3 AUGUSTUS start_codon 858989 858991 . + 0 transcript_id "g307.t1"; gene_id "g307"; 3 AUGUSTUS CDS 858989 859156 0.77 + 0 transcript_id "g307.t1"; gene_id "g307"; 3 AUGUSTUS CDS 859798 859933 0.86 + 0 transcript_id "g307.t1"; gene_id "g307"; 3 AUGUSTUS CDS 860015 860442 1 + 2 transcript_id "g307.t1"; gene_id "g307"; 3 AUGUSTUS stop_codon 860440 860442 . + 0 transcript_id "g307.t1"; gene_id "g307"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKEEKS # AVNDVSPRLSKVHSHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKS # RQDSGSDSSVSDASFATAQSIPTTGSEDTVVTPTEMAVPVPKAVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g307 ### # start gene g308 3 AUGUSTUS gene 860704 863991 0.76 - . g308 3 AUGUSTUS transcript 860704 863991 0.76 - . g308.t1 3 AUGUSTUS stop_codon 860704 860706 . - 0 transcript_id "g308.t1"; gene_id "g308"; 3 AUGUSTUS CDS 860704 863991 0.76 - 0 transcript_id "g308.t1"; gene_id "g308"; 3 AUGUSTUS start_codon 863989 863991 . - 0 transcript_id "g308.t1"; gene_id "g308"; # protein sequence = [MMCKQEAGFAWEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASY # RSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDFYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIF # HDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSM # PEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVG # WYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRKLYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHV # KGATHGPDGLSRITPGGWQTKRPELNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNH # MLESKDATCEVFSRNLFPTFDEEFVQNNPYPEVHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHINTDQPDQP # QLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIH # GRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGLRISAYNSQANGKIERAHLDIRQALIKATGGDVSK # WFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHT # IKNWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVED # EDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g308 ### # start gene g309 3 AUGUSTUS gene 864763 866436 1 + . g309 3 AUGUSTUS transcript 864763 866436 1 + . g309.t1 3 AUGUSTUS start_codon 864763 864765 . + 0 transcript_id "g309.t1"; gene_id "g309"; 3 AUGUSTUS CDS 864763 866436 1 + 0 transcript_id "g309.t1"; gene_id "g309"; 3 AUGUSTUS stop_codon 866434 866436 . + 0 transcript_id "g309.t1"; gene_id "g309"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDNSGGLPRGEPG # DPSGPGSPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYF # TDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKW # AYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPLTPKPKPFSGGKPNN # NGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g309 ### # start gene g310 3 AUGUSTUS gene 866769 868763 1 + . g310 3 AUGUSTUS transcript 866769 868763 1 + . g310.t1 3 AUGUSTUS start_codon 866769 866771 . + 0 transcript_id "g310.t1"; gene_id "g310"; 3 AUGUSTUS CDS 866769 868763 1 + 0 transcript_id "g310.t1"; gene_id "g310"; 3 AUGUSTUS stop_codon 868761 868763 . + 0 transcript_id "g310.t1"; gene_id "g310"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHFDSPQTSVPSAINTVDAKVAV # PLPEPSPSVSPTILETPPGYSPRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSATPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGISATPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g310 ### # start gene g311 3 AUGUSTUS gene 869248 870329 0.46 + . g311 3 AUGUSTUS transcript 869248 870329 0.46 + . g311.t1 3 AUGUSTUS start_codon 869248 869250 . + 0 transcript_id "g311.t1"; gene_id "g311"; 3 AUGUSTUS CDS 869248 869735 0.47 + 0 transcript_id "g311.t1"; gene_id "g311"; 3 AUGUSTUS CDS 869858 870329 0.52 + 1 transcript_id "g311.t1"; gene_id "g311"; 3 AUGUSTUS stop_codon 870327 870329 . + 0 transcript_id "g311.t1"; gene_id "g311"; # protein sequence = [MDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFR # ALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFLLTKDTTQTSPFSPRISHPEFPIGSEVF # VLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLCRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRC # PLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g311 ### # start gene g312 3 AUGUSTUS gene 872776 875093 0.98 - . g312 3 AUGUSTUS transcript 872776 875093 0.98 - . g312.t1 3 AUGUSTUS stop_codon 872776 872778 . - 0 transcript_id "g312.t1"; gene_id "g312"; 3 AUGUSTUS CDS 872776 873587 0.99 - 2 transcript_id "g312.t1"; gene_id "g312"; 3 AUGUSTUS CDS 873662 875093 0.99 - 0 transcript_id "g312.t1"; gene_id "g312"; 3 AUGUSTUS start_codon 875091 875093 . - 0 transcript_id "g312.t1"; gene_id "g312"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVDESDDEDTIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGIIWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDDQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKP # KPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKK # GKAQDSKDKKENVQADVVTEPPTNKLEERIKSNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g312 ### # start gene g313 3 AUGUSTUS gene 875123 878111 0.39 - . g313 3 AUGUSTUS transcript 875123 878111 0.39 - . g313.t1 3 AUGUSTUS stop_codon 875123 875125 . - 0 transcript_id "g313.t1"; gene_id "g313"; 3 AUGUSTUS CDS 875123 877092 0.49 - 2 transcript_id "g313.t1"; gene_id "g313"; 3 AUGUSTUS CDS 878096 878111 0.43 - 0 transcript_id "g313.t1"; gene_id "g313"; 3 AUGUSTUS start_codon 878109 878111 . - 0 transcript_id "g313.t1"; gene_id "g313"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDKAKVRLALEWTSYITRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ # SHFKEGADIMTQLTTVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLR # DNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g313 ### # start gene g314 3 AUGUSTUS gene 879219 879740 1 + . g314 3 AUGUSTUS transcript 879219 879740 1 + . g314.t1 3 AUGUSTUS start_codon 879219 879221 . + 0 transcript_id "g314.t1"; gene_id "g314"; 3 AUGUSTUS CDS 879219 879740 1 + 0 transcript_id "g314.t1"; gene_id "g314"; 3 AUGUSTUS stop_codon 879738 879740 . + 0 transcript_id "g314.t1"; gene_id "g314"; # protein sequence = [MLALSTALPYSDGAGRWDDIVPALPGIDQLTADWEQLMLRYIHHITDTSLSGTDTQGPMSSVEPGTDSLAEVIVERSL # EVPVAPESTSSVGSHPQVPLFLPEQESPTSPSPPPPSPTLPPLFGSIANLAIDLTGGNDELYETEESRVGRLSVMREVVDPAAGQGVVKEESLSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g314 ### # start gene g315 3 AUGUSTUS gene 883767 884369 0.33 - . g315 3 AUGUSTUS transcript 883767 884369 0.33 - . g315.t1 3 AUGUSTUS stop_codon 883767 883769 . - 0 transcript_id "g315.t1"; gene_id "g315"; 3 AUGUSTUS CDS 883767 884369 0.33 - 0 transcript_id "g315.t1"; gene_id "g315"; 3 AUGUSTUS start_codon 884367 884369 . - 0 transcript_id "g315.t1"; gene_id "g315"; # protein sequence = [MRHPKNLVDLTNSIPLELFDRQPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLHMHNPVINWKE # LCLTFQDRNVRISAALVSEIVQPGAKGGTEELERGVNGEKIHEGTLQPPPEVLQPPPEAPQQPQGLSMDPEKVKAVMDWPKPRTVKELQAFLGFANFY # RRFIDNYSGITKVFTKLLRKDPTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g315 ### # start gene g316 3 AUGUSTUS gene 887697 888623 0.49 - . g316 3 AUGUSTUS transcript 887697 888623 0.49 - . g316.t1 3 AUGUSTUS stop_codon 887697 887699 . - 0 transcript_id "g316.t1"; gene_id "g316"; 3 AUGUSTUS CDS 887697 888623 0.49 - 0 transcript_id "g316.t1"; gene_id "g316"; 3 AUGUSTUS start_codon 888621 888623 . - 0 transcript_id "g316.t1"; gene_id "g316"; # protein sequence = [MSAMSTERPSSSKLESKKQKSALSRGNTTQAQKLNQAASSTVITVAAGQRMMSIPEQSFGDEPDSDVRTPEGCQPAVQ # EPPPVDAGMGPPQRRYTSMGYAQPASSPMGGFAYSPTWGTRGPPPGLIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAA # SEQSRATSRRLLTPPVQSLNPPPPRRGSSLSSLLKSPAMNTPSWERTHAIHHSRTNFPVQRHVTGDRSETQGEYFPSSLILMEGRRSSAAKWEYRYCT # EHLITDQEPYDLNLPRRGLTSRTTRLSKYFEMRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g316 ### # start gene g317 3 AUGUSTUS gene 892932 893162 0.56 + . g317 3 AUGUSTUS transcript 892932 893162 0.56 + . g317.t1 3 AUGUSTUS start_codon 892932 892934 . + 0 transcript_id "g317.t1"; gene_id "g317"; 3 AUGUSTUS CDS 892932 893162 0.56 + 0 transcript_id "g317.t1"; gene_id "g317"; 3 AUGUSTUS stop_codon 893160 893162 . + 0 transcript_id "g317.t1"; gene_id "g317"; # protein sequence = [MDGDVGATVLMLVWMGRYRYSKASGTAGVMDDDDDETMDMRIKAEEWVKGQFGSSEHAKKRQGELKEGVSRMVGLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g317 ### # start gene g318 3 AUGUSTUS gene 898372 899109 1 + . g318 3 AUGUSTUS transcript 898372 899109 1 + . g318.t1 3 AUGUSTUS start_codon 898372 898374 . + 0 transcript_id "g318.t1"; gene_id "g318"; 3 AUGUSTUS CDS 898372 899109 1 + 0 transcript_id "g318.t1"; gene_id "g318"; 3 AUGUSTUS stop_codon 899107 899109 . + 0 transcript_id "g318.t1"; gene_id "g318"; # protein sequence = [MASESGERSDVHIQYQVSVELGSPFTANKFLNFHSDSMFDRRIDIRTTFPLNFSSSLYDSPESDTNSQLDDSEEDITE # DVNEDTQCIYIPSTSPFYHPPPKARPFASSSSNVSFSCDALAEDGSFQKQPVTSFCESLSQASDEWSEDEESKNAVCLHQKHDQDLRFSPVEIFEENR # FGPANPVAIYLKVSEIASFKPLPDVPRGIEFEYDYEEYDSESLCSSSDMEEESKEVGMPSYHYLETMLM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g318 ### # start gene g319 3 AUGUSTUS gene 900497 900748 0.93 - . g319 3 AUGUSTUS transcript 900497 900748 0.93 - . g319.t1 3 AUGUSTUS stop_codon 900497 900499 . - 0 transcript_id "g319.t1"; gene_id "g319"; 3 AUGUSTUS CDS 900497 900748 0.93 - 0 transcript_id "g319.t1"; gene_id "g319"; 3 AUGUSTUS start_codon 900746 900748 . - 0 transcript_id "g319.t1"; gene_id "g319"; # protein sequence = [MSDSPSIETDQARDEVKTWIRDQMAAGILPTTPEDTQHSRRNAKQTDWGEKFQTKFKEKEILGDMDDGKDDFFEEDEG # EEEEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g319 ### # start gene g320 3 AUGUSTUS gene 902130 902852 0.64 + . g320 3 AUGUSTUS transcript 902130 902852 0.64 + . g320.t1 3 AUGUSTUS start_codon 902130 902132 . + 0 transcript_id "g320.t1"; gene_id "g320"; 3 AUGUSTUS CDS 902130 902184 0.64 + 0 transcript_id "g320.t1"; gene_id "g320"; 3 AUGUSTUS CDS 902254 902852 0.65 + 2 transcript_id "g320.t1"; gene_id "g320"; 3 AUGUSTUS stop_codon 902850 902852 . + 0 transcript_id "g320.t1"; gene_id "g320"; # protein sequence = [MTLTFDVISEAPLETTEFDVPINVGWGSKQTQFHGSLGKTAAQASTSNMLVGCSPDEDNIPRISWRGDGACFAVSSIT # TAGSYPHRILRVYDHQAVLQSTSESVPGLEHSLSWRPSGNLIASTQRFGFDGGGAGRDGRHDVVFFERNGLRHGDFELRPADGLVPLPSQALNLRWGY # KVKDIKWSSDSNVLAIWIGRDHASDLGESAFCYDVGTHCGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g320 ### # start gene g321 3 AUGUSTUS gene 906432 906686 0.97 + . g321 3 AUGUSTUS transcript 906432 906686 0.97 + . g321.t1 3 AUGUSTUS start_codon 906432 906434 . + 0 transcript_id "g321.t1"; gene_id "g321"; 3 AUGUSTUS CDS 906432 906686 0.97 + 0 transcript_id "g321.t1"; gene_id "g321"; 3 AUGUSTUS stop_codon 906684 906686 . + 0 transcript_id "g321.t1"; gene_id "g321"; # protein sequence = [MQRELSEFEAELSATVEEVWSTPTDAMGIDSQTQTTQPLQDTWAVRMDDAQRQQKRNPMERIAKPQVDGNGDEKDWRM # KLFDLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g321 ### # start gene g322 3 AUGUSTUS gene 908838 909395 0.89 + . g322 3 AUGUSTUS transcript 908838 909395 0.89 + . g322.t1 3 AUGUSTUS start_codon 908838 908840 . + 0 transcript_id "g322.t1"; gene_id "g322"; 3 AUGUSTUS CDS 908838 909395 0.89 + 0 transcript_id "g322.t1"; gene_id "g322"; 3 AUGUSTUS stop_codon 909393 909395 . + 0 transcript_id "g322.t1"; gene_id "g322"; # protein sequence = [MSHPKPTPPAVDTFHHFENPEDLAVENLSQNPEYDGEATPQYESDPESDFIDPATVQGRNWIADTNDDATTWEMHSNE # IFRTGSVTYHRPRIHQSRHGRRRDIEEQPSIGNIRAEINKYSTPPGSGKDPSAAVIVVPRISRVDPTRPLVMEEPSASHSSDVVHPYVRSMFLIAWHL # LTDEFVHRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g322 ### # start gene g323 3 AUGUSTUS gene 918720 919148 0.61 + . g323 3 AUGUSTUS transcript 918720 919148 0.61 + . g323.t1 3 AUGUSTUS start_codon 918720 918722 . + 0 transcript_id "g323.t1"; gene_id "g323"; 3 AUGUSTUS CDS 918720 919148 0.61 + 0 transcript_id "g323.t1"; gene_id "g323"; 3 AUGUSTUS stop_codon 919146 919148 . + 0 transcript_id "g323.t1"; gene_id "g323"; # protein sequence = [MNITFDSNPKHLPLAGVANVEQFVLSKTSAMTKILQEKSGVPKSRMERPFFTLLEDHMGLGESDIRAITNAKPNYKWY # HKFRRVEGWEDHLKWLAMPREGEEETVTEDTLVILNAGAHVRLQSVSLVDNKVANQVVYSVVAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g323 ### # start gene g324 3 AUGUSTUS gene 923893 925083 0.81 + . g324 3 AUGUSTUS transcript 923893 925083 0.81 + . g324.t1 3 AUGUSTUS start_codon 923893 923895 . + 0 transcript_id "g324.t1"; gene_id "g324"; 3 AUGUSTUS CDS 923893 925083 0.81 + 0 transcript_id "g324.t1"; gene_id "g324"; 3 AUGUSTUS stop_codon 925081 925083 . + 0 transcript_id "g324.t1"; gene_id "g324"; # protein sequence = [MLGFSSPVPISPSIQQYPSLHDVESRWDEREGVADLQASVNGSPITFPPSNPLANHSSTIPLPPSEDERTPRSSSVVV # PMRSPDTEINQVSFIPMTYIPTLEQPQPTDPLQSTNAVDNHERPSPHHAGPEERAGFRPSHDHDRISDSSSSPLSHSEKPPYRVRWGSSLPSHSSSNA # LPGRWDTPLPHPPLHTSSSINPPPTTNPPSTIPPPPMYPFNMTPLWSSNGPPLRSLPNPPLYYSNQSTPWYYTPHPLPANPVTPYTLPPMTPNPIIAF # TPRSTYGPETETAFSMNHTPSRMHQTPSGFDTPANATPSTHNSMYRPTPEAPRRRTQSLEPEETTYERYQPRDNNDRRGPPNNSASATPFYQRSVNDQ # PHNRFYLIDGNVEFRVSIIVFRGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g324 ### # start gene g325 3 AUGUSTUS gene 928169 928888 0.96 + . g325 3 AUGUSTUS transcript 928169 928888 0.96 + . g325.t1 3 AUGUSTUS start_codon 928169 928171 . + 0 transcript_id "g325.t1"; gene_id "g325"; 3 AUGUSTUS CDS 928169 928888 0.96 + 0 transcript_id "g325.t1"; gene_id "g325"; 3 AUGUSTUS stop_codon 928886 928888 . + 0 transcript_id "g325.t1"; gene_id "g325"; # protein sequence = [MAPSNSKGKKPEITPSDVNSGKRRREEDDKLRKYHAASGSVAAFLQEPSRSDSPPPNVRRRLNKSTEGSHDNISDTNI # RVVQSPTLDSNVEAPDVSLGDDARNARSAHANDNTDSSNAPFDADPFGYLEERNSSGYPGRSNLQSTSRTLYDSWGSGSRSIGSSVAITTAPAVLHSI # PSQTQAIHTHAYVTFGAGMRQKEIDTFTANNPLRAQLISGGQDTVPYHVPLCVSCGIFCRTSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g325 ### # start gene g326 3 AUGUSTUS gene 929399 929757 0.74 + . g326 3 AUGUSTUS transcript 929399 929757 0.74 + . g326.t1 3 AUGUSTUS start_codon 929399 929401 . + 0 transcript_id "g326.t1"; gene_id "g326"; 3 AUGUSTUS CDS 929399 929546 0.74 + 0 transcript_id "g326.t1"; gene_id "g326"; 3 AUGUSTUS CDS 929600 929757 0.78 + 2 transcript_id "g326.t1"; gene_id "g326"; 3 AUGUSTUS stop_codon 929755 929757 . + 0 transcript_id "g326.t1"; gene_id "g326"; # protein sequence = [MCYVGSREKGQEYLAALASWDGEKSLLNEVNEKSFLHQQDSVAQVLRGKAGRQWFIRSALINSLPDDIIHQTVLKFDD # TPVGCSKQQYFLQNRQKFLITNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g326 ### # start gene g327 3 AUGUSTUS gene 930619 933719 0.97 - . g327 3 AUGUSTUS transcript 930619 933719 0.97 - . g327.t1 3 AUGUSTUS stop_codon 930619 930621 . - 0 transcript_id "g327.t1"; gene_id "g327"; 3 AUGUSTUS CDS 930619 933008 0.97 - 2 transcript_id "g327.t1"; gene_id "g327"; 3 AUGUSTUS CDS 933146 933719 0.99 - 0 transcript_id "g327.t1"; gene_id "g327"; 3 AUGUSTUS start_codon 933717 933719 . - 0 transcript_id "g327.t1"; gene_id "g327"; # protein sequence = [MASVEDTFQVQPRSRRVGTVRPQSTYDPPFTSSSPSIVDSALLRPTIPTRSPLRPPPTKSVISASSTESALSSAFIKL # STPTPSEDDFDPSTMPLSFQIRNRSFPSLNGLVDGFPDDAELSKALPLRPESPFALSPMEDEVASSSSASSHGQQTTPTFTKRQHALHELLASERAYA # SDLALVREIYIPLAIAGSFNAPMSTEDAKIIFNNIAELALFSDMFCDRLQDALGAVVEGGIGEDCVGDLFRRIVSFSMYVSSFRLHLLMKIPEMERPY # KQYITKQGTADEHLQSLPKTPALEAYFAQTRTYSTSVSHAWDLHSLLIKPVQRLLKYPLLLGTILDETPDSHSDKENLRVAKAEIEELARSVNEERRR # AEVIKGVLSGDPKKKLSTSNITIAASVNLSKMKSLRRAQPSDSGSIEAAKVELMEGELKKVDLFAQQFAKDVLSWGKSMTSVMQNLMIWAVSFGKVIG # LSEDQGSEAFDAFKGLLDQYLGPLCVELEKVINERLLKEIVLLLATMQQPIKLLESMNEQEPFHYHLLTMNVTAKNRPPPALLEASTNYLALRGQLFK # ELPRYLNLLHRGIALSVRRLADIQTQFWQDVRDRWAELWEMLRVEGEMNAGADETIAVWVARWSDVDEVVRSLAITNERKIYQEPLKPIVSPQTPPAS # ASTFSFSPHSPSLKSSRSSGANSVANIIHSLDPSHSQVSHPFALSSPPPAYQSRGRGYSDASKRSRESNENLKAAASIKLGKKEKEQKEKKSRSLQPH # EDWSEILGGLDIAGAGVPTLPIPRTKSMPLTKIAKTTSMSSSSSSSASKPPVIDLSPIDDASFFPPLEDDRGRNDRKPSFRRKISETLRSNSKPRNGR # PVSSKGLSSSLTSPPTSSSRDDSSFPVQMSLRRDSWSSAQAKYACRVVHPCRPPAVVSYFGFPFFTLVEGDVYQILQEAGHPSIHPKLPLYVDDGEDC # LLLCRNEVGTVGWALASFLEPIGVSIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g327 ### # start gene g328 3 AUGUSTUS gene 936470 937249 0.61 - . g328 3 AUGUSTUS transcript 936470 937249 0.61 - . g328.t1 3 AUGUSTUS stop_codon 936470 936472 . - 0 transcript_id "g328.t1"; gene_id "g328"; 3 AUGUSTUS CDS 936470 937249 0.61 - 0 transcript_id "g328.t1"; gene_id "g328"; 3 AUGUSTUS start_codon 937247 937249 . - 0 transcript_id "g328.t1"; gene_id "g328"; # protein sequence = [MAISGVHLDSTTGAGGREMCYLKGSIEALLERCKYYYVNEDSTPPLDVNMRNAILGKAQAVASRGLRVITIAYGYGSV # ETIAPSKDSSRSGSPAMSRSSSPSMTASNMVFVGFQAMYDPPRPGVRNSIADLQQGGVKVVMITGDAEQTALSIAGKLGLNVGPRHGHGGSVDRVTRM # GGHGRTGSVATALSPSTYCLTGKAIDQLSEAQLRERIGNVSVFARTTPRHKMAIIKAFQSRGEVVAMTGDGGKLPLLGRMRKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g328 ### # start gene g329 3 AUGUSTUS gene 937335 938152 0.31 - . g329 3 AUGUSTUS transcript 937335 938152 0.31 - . g329.t1 3 AUGUSTUS stop_codon 937335 937337 . - 0 transcript_id "g329.t1"; gene_id "g329"; 3 AUGUSTUS CDS 937335 937828 0.67 - 2 transcript_id "g329.t1"; gene_id "g329"; 3 AUGUSTUS CDS 937879 938152 0.44 - 0 transcript_id "g329.t1"; gene_id "g329"; 3 AUGUSTUS start_codon 938150 938152 . - 0 transcript_id "g329.t1"; gene_id "g329"; # protein sequence = [MVCSESGISQAVSFLLSTGRGTGVVIATGTSTEFGIIFSMMQDVEEKRTPLQLSMDELAQKLSILSFGVIGMICLIGV # LQRRSWLDMFTIGVSLAVAAIPEGLPIVTTVTLALGVLRMSKRKAIVKKLHSVESLGSVSVICSDKTGLCSICLVIRSIEDGYSGTLTKNEQTVTEAY # AVDETIVLDPTSSKFVNGPWSPALLKILDIGALCNNAQVTRNDDNAPVVVGQSTDVALLNILSVVGLTDKRNVSPSIPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g329 ### # start gene g330 3 AUGUSTUS gene 940356 941837 1 - . g330 3 AUGUSTUS transcript 940356 941837 1 - . g330.t1 3 AUGUSTUS stop_codon 940356 940358 . - 0 transcript_id "g330.t1"; gene_id "g330"; 3 AUGUSTUS CDS 940356 941837 1 - 0 transcript_id "g330.t1"; gene_id "g330"; 3 AUGUSTUS start_codon 941835 941837 . - 0 transcript_id "g330.t1"; gene_id "g330"; # protein sequence = [MTDCGRPDFCDSASATSSSLVITPASGHDIFKPPTQSGSIVHRFQQPKNVDLSNSPQQLRLQQLPPYLQSTMYQPQST # GKGPIQPHVSNLPRRKPRQRSVGTFPKESPTLATPDAVKALSSASIRTNAARSPSPSRSSSSSLSISQPRGPRAYFVDDEPSPSVAPIYIKPSVSAFE # LGHVIPQSKGHIQPHITNMPRRRPRRPHSLLSRIETSAKQRKLRDRERWEKARCLQEVIKGSEVWVAFWDWENASEESDDEDQSDDSLAEELLRADRV # IQIISREQEDQGYTEDSTASSGGVEDALKNVLKLFLSPQVVRVRDDGVPHTSLEQMSLARAFLSNIHPRRTDNSARATSTLISSVPPTPRTASTPSLS # RSSSSSTSPSPSSYTLTPSSTSSESRSNKRLLITVPSKEFAVDALALVVIAFSLLGDITSLATSADETESSVSPILEFLNSLNDLEGLDPHWRGTLSC # DGIDWLDGVLGMIKSSGGSNLEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g330 ### # start gene g331 3 AUGUSTUS gene 942588 944105 0.34 - . g331 3 AUGUSTUS transcript 942588 944105 0.34 - . g331.t1 3 AUGUSTUS stop_codon 942588 942590 . - 0 transcript_id "g331.t1"; gene_id "g331"; 3 AUGUSTUS CDS 942588 944105 0.34 - 0 transcript_id "g331.t1"; gene_id "g331"; 3 AUGUSTUS start_codon 944103 944105 . - 0 transcript_id "g331.t1"; gene_id "g331"; # protein sequence = [MASACNGLTWLAAVLCGIAGCFGVAETAELRLVHVFRDDTDVAEQEQEETEVNERTPLVGRKHLRVIKNKSKSGVDPV # ENPRPYVLWILVLLIYVPFPLILISHIAIFLITSVSQTMIDGSPAVTVYAVISLISLIASLPAIPFIGARRVHRYLFWILGLVWVVCIALAWIPWSGP # WAGSVEGFEGGLFPFSEDAPLKVFFQQKVHLSPSGTDVNPTVRIVTTLTGATPFVHDLILPLIPSYLHSLANGRLVGCSDNNVDERKIGLANCNWETY # NSNLPSFDALNMVPVAADTLVVHAQKNHSSWDWASTINPWFEAYGKSMSFNETLGARFSIMGNNSRACRIYFDQPVEKFRVRTVDVESDVEVNNEVND # EASWGVQRGFESDHYNMLRLWTRAWGKKFVVDVQWSNQFSFAGQYTTETNSSQKSFFGETTTHTGRVACEWAEYESGMVGMGLSTSPVPSSSGERFPS # AKIPAFEEVLTYLPKWAVASKLTDGLVEVEEKFVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g331 ### # start gene g332 3 AUGUSTUS gene 944383 946075 0.14 - . g332 3 AUGUSTUS transcript 944383 946075 0.14 - . g332.t1 3 AUGUSTUS stop_codon 944383 944385 . - 0 transcript_id "g332.t1"; gene_id "g332"; 3 AUGUSTUS CDS 944383 944645 0.18 - 2 transcript_id "g332.t1"; gene_id "g332"; 3 AUGUSTUS CDS 944770 946075 0.34 - 0 transcript_id "g332.t1"; gene_id "g332"; 3 AUGUSTUS start_codon 946073 946075 . - 0 transcript_id "g332.t1"; gene_id "g332"; # protein sequence = [MCNINSGTCVLSTTVIMYLTDKIRPAFARTTGFLTIPVTILLVLVYLAVALSTLITDQLPSVPSASTLHSHYGGLNVT # EAYRDLQIIAARPHPYHSHANDIVREYLLQRLRNVRLQSGSRDNFIIDDDVITNGSWSSSFGVSGSGNYFEGNNILVKIRGTAETESSNLPHPPLPAV # LFSAHYDCVSTASGAVDDGIGVVTLLQLIQYFVTHPPRRDVLFNINNGEEDGLNGAHILLEHPWIKNTSHIEYTNLFGSTFLNLEGAGSGGRPLMFRG # TDHGSVKSWRNVETPHANIISAEAFNLGLIRSSTDYTVYNSRFAAPDPLDAAKFAPLRGLDFAFYRGRSKYHTKYDALPYIEGGEKALWAMLQPASAG # GIALANGNNVSPDVNEKAVYFECTSSVDLWDTFVILKSNISVQFRPYPFTTRRSSYNQYHRTHQSAASQMLSPGGTVVEDTPSENEEDEPHESETGWT # KAKRRFNTSSRVLWKHGRYWVALIIAIGAQIALVVGFVNLNPFVSFEQGCLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g332 ### # start gene g333 3 AUGUSTUS gene 950466 950930 0.47 + . g333 3 AUGUSTUS transcript 950466 950930 0.47 + . g333.t1 3 AUGUSTUS start_codon 950466 950468 . + 0 transcript_id "g333.t1"; gene_id "g333"; 3 AUGUSTUS CDS 950466 950930 0.47 + 0 transcript_id "g333.t1"; gene_id "g333"; 3 AUGUSTUS stop_codon 950928 950930 . + 0 transcript_id "g333.t1"; gene_id "g333"; # protein sequence = [MSLAIRLNTVPFPSESIPSPLVLRPGPLHRRRGVDLGMTLQMPAPAQFGYGYAVGNETHTVAVTAAAAVFNTTERGIN # NNTSSTTIAGNNLYNPGTGRLGYASSSSGLFGSTASANASTTLFWSPASAAVGTKGPLQPHVSNLPRRKPTVKRRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g333 ### # start gene g334 3 AUGUSTUS gene 951535 953788 0.42 + . g334 3 AUGUSTUS transcript 951535 953788 0.42 + . g334.t1 3 AUGUSTUS start_codon 951535 951537 . + 0 transcript_id "g334.t1"; gene_id "g334"; 3 AUGUSTUS CDS 951535 951933 0.92 + 0 transcript_id "g334.t1"; gene_id "g334"; 3 AUGUSTUS CDS 952000 952503 0.51 + 0 transcript_id "g334.t1"; gene_id "g334"; 3 AUGUSTUS CDS 952590 952997 0.9 + 0 transcript_id "g334.t1"; gene_id "g334"; 3 AUGUSTUS CDS 953091 953362 0.9 + 0 transcript_id "g334.t1"; gene_id "g334"; 3 AUGUSTUS CDS 953425 953788 1 + 1 transcript_id "g334.t1"; gene_id "g334"; 3 AUGUSTUS stop_codon 953786 953788 . + 0 transcript_id "g334.t1"; gene_id "g334"; # protein sequence = [MEPVGGPDAKKARWSPTFPQQNSSSNANSNRDAYANYGYGPQASISQSGYASSPIAPSPLYSTPSLSINTQAGGSMNP # QMSPNTANFPQQQQPSPNGSSPYGFGSYNMLGMGMPGMNMMGGFAYNGQMGGFPQQRLPSLTIPQGNPNGPQSAYSPVALSAALSASNNTTGRTVYVG # NLPATASVDELLNLVHFGPLESIRVLPEKSCVFLSFLDGATAAAFHADATIKKLTLHGQELKIGWGKPSPVPAQVALAISQSNASRNVYLGGLEENTT # EEQLRDDLSRFGLIDQVKIVRDKNIGFVVNTLPTEPAWAGKRVNYGKDRCAYIPKSQQAAAQQAQAAAAQSLVAQSAAAAAAAAAASSPQSAHPNNMG # NGVSSPFNPYAPFGAGDALQQAMAAASAVGMSGMGMSQGINRTVYLGNIHPETTTEDLCNAIRGGFVTFIDPAAAFTFFQVASYQGMTLNNRRLKIGW # GKNSGPLPPTLALAVHAGATRNVYIGNIEDFETFTEERLKRDFGEYGDIELVNFLKEKNCAFVNFTNISNAIKAIDGVKNKPEYGNLRIAHGKDRCAN # PPRSGPQGASGGRRTASGAGATGGEPVSAIDGAGFDAELTDAMVQQAADEEAMVAAGVVIAAPDEAQQMHVDGGEVSAPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g334 ### # start gene g335 3 AUGUSTUS gene 955137 955388 0.56 - . g335 3 AUGUSTUS transcript 955137 955388 0.56 - . g335.t1 3 AUGUSTUS stop_codon 955137 955139 . - 0 transcript_id "g335.t1"; gene_id "g335"; 3 AUGUSTUS CDS 955137 955388 0.56 - 0 transcript_id "g335.t1"; gene_id "g335"; 3 AUGUSTUS start_codon 955386 955388 . - 0 transcript_id "g335.t1"; gene_id "g335"; # protein sequence = [MIGRKNPSPTPATPLPTSIQTKSGETHSMTDPAQNMAAPRDMVKIRDILSARIPEHTPDIVDVIKIILFKLWSVKTLA # FPLPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g335 ### # start gene g336 3 AUGUSTUS gene 957452 957751 0.5 - . g336 3 AUGUSTUS transcript 957452 957751 0.5 - . g336.t1 3 AUGUSTUS stop_codon 957452 957454 . - 0 transcript_id "g336.t1"; gene_id "g336"; 3 AUGUSTUS CDS 957452 957751 0.5 - 0 transcript_id "g336.t1"; gene_id "g336"; 3 AUGUSTUS start_codon 957749 957751 . - 0 transcript_id "g336.t1"; gene_id "g336"; # protein sequence = [MQSSGSRSASASLLAPIDSAAAFDDLWKGLSSSGSFAAVMGFSIDSTVQQADEFAYQQPSPVLESESGANSHEPGAFP # RPGNDEFQQPVQTQHEQLTMY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g336 ### # start gene g337 3 AUGUSTUS gene 957805 959401 0.33 - . g337 3 AUGUSTUS transcript 957805 959401 0.33 - . g337.t1 3 AUGUSTUS stop_codon 957805 957807 . - 0 transcript_id "g337.t1"; gene_id "g337"; 3 AUGUSTUS CDS 957805 959117 0.56 - 2 transcript_id "g337.t1"; gene_id "g337"; 3 AUGUSTUS CDS 959215 959401 0.33 - 0 transcript_id "g337.t1"; gene_id "g337"; 3 AUGUSTUS start_codon 959399 959401 . - 0 transcript_id "g337.t1"; gene_id "g337"; # protein sequence = [MYDDSADDSSATLFPPSSTPAPPPRRRRAPPGKRRSLGYIPRPPNAFMLFRADFVKQKHVPNRSCWRSLPTEEKAIWE # KRARAEKAEHKRKYPEYRFRPVHNKNKTKSADSPSANKKTKTDSLPPPLASIEALRTEREGFIAQSLLDGLKGDALKEKVSWWDDAHGWDESAEGMAA # LEARAMTPHVQSNSDAFPARSAVPIARYPARRPSSVPLPNDFLPFQGGYQQTQQYLSQYSDAPFSHATETSHGLSMDLAGYNGTHVAQSSFHMLPPLN # ALRPPSPSPTNFNVGSISRQQRMVLGGRRASSAQAFVNYGRPEDSWAIPHTNWPDVHGQWVGANWQTGYGEGTGSSPSTSASSLPLQTETDELPEVDT # SLFQPGFAFGGSTFSIPSSQQPQPSPFDVQQQCNPFENYSMEQSNDFELVQQFLQEQQNQFHNPHNLSLPALDTHSYSPLDTSPLSSSSVQSYSPRIL # ALHPLPRKSRSLYSMRHNLYIPLLWRMWV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g337 ### # start gene g338 3 AUGUSTUS gene 962600 962807 0.6 + . g338 3 AUGUSTUS transcript 962600 962807 0.6 + . g338.t1 3 AUGUSTUS start_codon 962600 962602 . + 0 transcript_id "g338.t1"; gene_id "g338"; 3 AUGUSTUS CDS 962600 962602 0.62 + 0 transcript_id "g338.t1"; gene_id "g338"; 3 AUGUSTUS CDS 962661 962807 0.89 + 0 transcript_id "g338.t1"; gene_id "g338"; 3 AUGUSTUS stop_codon 962805 962807 . + 0 transcript_id "g338.t1"; gene_id "g338"; # protein sequence = [MGAMTFGKEGTMGARVHDLKDVEAIIDVFVAHGHTEVRIFQSPHPADPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g338 ### # start gene g339 3 AUGUSTUS gene 964694 966055 0.62 + . g339 3 AUGUSTUS transcript 964694 966055 0.62 + . g339.t1 3 AUGUSTUS start_codon 964694 964696 . + 0 transcript_id "g339.t1"; gene_id "g339"; 3 AUGUSTUS CDS 964694 966055 0.62 + 0 transcript_id "g339.t1"; gene_id "g339"; 3 AUGUSTUS stop_codon 966053 966055 . + 0 transcript_id "g339.t1"; gene_id "g339"; # protein sequence = [MLSLIFTEYCLMSISPNKKPSPQSVLTQVCSTWRQVAHGTPRLWSRFQALLGDNGFEVHGDAMTTWLGRSGEVPLEIA # IRPKDITFSPPSNILECMGSFCHRLRILHLAIPLHAVIPLSLLPGFPLLTALNLSLIRDESTRSGPNKIGANDIGQLEPGYHQLSILRNSPRLTDLKF # VGWELSKEMVPKVLSLLLPVSQLNTVQLLVAAEACHILMDPLPYLKILEGSCASLVQCTLRCPQWMSGIIVPGITFPLLQILDLVDWHDECESRFLNA # ITVPSLRYFRTNHTYHGGFVNESFASDMIDLQERSSAPLRTFELLGMHELPVDDLLSILAVFPMLHNLGLNQCDLDTAPLMQGLEYCANKPLLVPRLQ # SFSFKNAQLKPKGSDRYIADMVESRNLIGDHDEQRPVDLHRISKLTVIFEKQSLSHTVTKRLRNSGIRELTLADKAKKKVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g339 ### # start gene g340 3 AUGUSTUS gene 968514 971781 0.86 - . g340 3 AUGUSTUS transcript 968514 971781 0.86 - . g340.t1 3 AUGUSTUS stop_codon 968514 968516 . - 0 transcript_id "g340.t1"; gene_id "g340"; 3 AUGUSTUS CDS 968514 969817 0.86 - 2 transcript_id "g340.t1"; gene_id "g340"; 3 AUGUSTUS CDS 970569 971781 0.87 - 0 transcript_id "g340.t1"; gene_id "g340"; 3 AUGUSTUS start_codon 971779 971781 . - 0 transcript_id "g340.t1"; gene_id "g340"; # protein sequence = [MSIVRGVLFACSSLSTQGHHLPKAALRLKAKADKLLVHITDRKERADPYIPYDFSSSGALHPKINGINGRAHTRSPSV # ASPSSSKLPTITIKASSLAKAVTKVPRRDTSFEESPALIRTPEGMSMFRDLDRSLQEAGPSSSTSDIRTRMRELVPSEHEDEYDESAQLGDKRKVING # VNDHRAHKRIRFATPLPLSDSSPGSPTTISKDDELTQLWWSTVQSDALLPNGLPEFPSSASSSSSPRHPFLRPPIPKSPAQTAKKKKCRKKLPHSYRP # EDKPKALLTLMNNNVRTIKRVRHTHARFAALGLTKDSGVGNEDGEGAEAAPSFNAQTSSAVGPGPGLGTGGLGSDPMDVDEAIDDRVDERPWEVPTRR # GRKISGIEIGSENADDCLRWMNGKVLEHAGFQVPDALPLSSGEFADTLGVDYFGLRELGIAEEFGMSSLMIPKRLLRGKKKRTNLLPVYVSFFSCLVS # LLHLIYVVGHSTKPTEPPPPFPPPPAFIPLTAGRIPEQIGLLQKFYHDRLQAVATPPAPAIPPLVPPLSHLPVPPLAPPPLLGPSLSNPYPSIPSLPK # PYIPPLLGPPKLPGGQPVPAHTPTPISNSLPPMHNTATHLPSNSLLPPSGLPQEPSLSLQPPAQPFSPPPETIIPDDSPTPAQAKMSPLGHIVKTGSS # YPAAKKKAKGASSAAAGAASNSNNGNKANTNAYSANVNTDFNNPLSATPNPLSAGETSNNRLVNGIVKPEFGSGPMNLNGNATSKPGASTMSMTIATG # DPVIGPAPSPKKKKGATGVGSGNGRKKRMLDAAQGQTQAQAQAQAHTHPSQNQPGQGHGQDPRPPFPPFVAASA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g340 ### # start gene g341 3 AUGUSTUS gene 975606 976591 0.36 - . g341 3 AUGUSTUS transcript 975606 976591 0.36 - . g341.t1 3 AUGUSTUS stop_codon 975606 975608 . - 0 transcript_id "g341.t1"; gene_id "g341"; 3 AUGUSTUS CDS 975606 976104 0.69 - 1 transcript_id "g341.t1"; gene_id "g341"; 3 AUGUSTUS CDS 976380 976591 0.36 - 0 transcript_id "g341.t1"; gene_id "g341"; 3 AUGUSTUS start_codon 976589 976591 . - 0 transcript_id "g341.t1"; gene_id "g341"; # protein sequence = [MCGLEHMADAVVGTLGVEHRKRTTIAVELAAKPKLLLFLDEPTSGLDSQSAWAIMDFLRSLAKNGQAILCTAEFMLDV # IGAGATATTDRDWHEIWRKTPEAKVVQDSIQQIYEDGKNRPPVAATYHSEFATGWLNQFGQLVKRDMLFRWRDPTYLLAKLVLNIFGGLFIGFTFFKA # KDSQQGTQNKLFVSFFSPLHSNKKKKLIIAPFAGDLHGDYHLGSGCQPASSSFHKYAQDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g341 ### # start gene g342 3 AUGUSTUS gene 976826 977731 0.3 - . g342 3 AUGUSTUS transcript 976826 977731 0.3 - . g342.t1 3 AUGUSTUS stop_codon 976826 976828 . - 0 transcript_id "g342.t1"; gene_id "g342"; 3 AUGUSTUS CDS 976826 977521 0.37 - 0 transcript_id "g342.t1"; gene_id "g342"; 3 AUGUSTUS CDS 977573 977731 0.67 - 0 transcript_id "g342.t1"; gene_id "g342"; 3 AUGUSTUS start_codon 977729 977731 . - 0 transcript_id "g342.t1"; gene_id "g342"; # protein sequence = [MKAWFRAIAAIFKSEATAQAVAGLILLALVIYTGYTIPKSSMIGALRWISYINPLRYGFESVLTNEFHTLDGTCASLV # PQGPGYENVSLTNQVCTAVGSVPGQDTVNGNTFVSLSYSYSFSHTWMNFGILIAFGVAFLCALFIASELNTTLSEDTTRTLFQRGSKPSAIVTESGSD # EEKGPSEHVTENVSQDVQEALHDAPAMTEIFSWQSVNYTVPVSDGHRKLLDDVSGFVVPGKLTALMGESGAGKTTLLNVLAQRVSTGVVTGDMFVSGQ # PLPRDFQAQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g342 ### # start gene g343 3 AUGUSTUS gene 978338 979021 0.71 - . g343 3 AUGUSTUS transcript 978338 979021 0.71 - . g343.t1 3 AUGUSTUS stop_codon 978338 978340 . - 0 transcript_id "g343.t1"; gene_id "g343"; 3 AUGUSTUS CDS 978338 978824 0.78 - 1 transcript_id "g343.t1"; gene_id "g343"; 3 AUGUSTUS CDS 978876 979021 0.71 - 0 transcript_id "g343.t1"; gene_id "g343"; 3 AUGUSTUS start_codon 979019 979021 . - 0 transcript_id "g343.t1"; gene_id "g343"; # protein sequence = [MLMTIFGLKHARRTPVGDASIRGVSGGEKKRVSIAEALATRMRLGSWDNSTRGLDSSTALEFGRALRIATDIDRLTTI # VSIYQAGETLYNLFDKVCIIYEGRMAYFGPANQARQYFIDLGYEPANRQTTPDFLVAVTDPLGRIPRQVVANRPRTAEEFAMRFKESHLGIANRKEIA # SYKQSAVLGHKSEKADAYRSSAAMEKAKHTRAQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g343 ### # start gene g344 3 AUGUSTUS gene 980791 981714 0.9 - . g344 3 AUGUSTUS transcript 980791 981714 0.9 - . g344.t1 3 AUGUSTUS stop_codon 980791 980793 . - 0 transcript_id "g344.t1"; gene_id "g344"; 3 AUGUSTUS CDS 980791 981714 0.9 - 0 transcript_id "g344.t1"; gene_id "g344"; 3 AUGUSTUS start_codon 981712 981714 . - 0 transcript_id "g344.t1"; gene_id "g344"; # protein sequence = [MKLPPAKRSAPKPKIARKSYKKPVLMSTVDNRVFSPSPAAYNQEPDVQVTASAEEDLSPENETNILEPGISFDSDVDA # VTNAATLAVMEQQPCFYSEDAYVTSGPSTPSLVDDSSSCKSPSPSLEEESFSAAEFAAEFLNLPEDLDCQDQSMDTIFDCSFAPSIIGDLMRPSDRKN # MYEHIDTNIVSNGTSFALDLSALEHETSSLNPLFADTALPSFYPSLSLASYLSALQNLSAGVVPTFSTSLPAPMPSSSTSEGYCIPSAVLSKSTRVFT # PGDFLIPGLRQVESVPCSVPAVPFTVNAYYPAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g344 ### # start gene g345 3 AUGUSTUS gene 982801 983434 0.24 + . g345 3 AUGUSTUS transcript 982801 983434 0.24 + . g345.t1 3 AUGUSTUS start_codon 982801 982803 . + 0 transcript_id "g345.t1"; gene_id "g345"; 3 AUGUSTUS CDS 982801 982864 0.24 + 0 transcript_id "g345.t1"; gene_id "g345"; 3 AUGUSTUS CDS 982914 983434 0.63 + 2 transcript_id "g345.t1"; gene_id "g345"; 3 AUGUSTUS stop_codon 983432 983434 . + 0 transcript_id "g345.t1"; gene_id "g345"; # protein sequence = [MKDYIDELEIVIEVGAVSRAREETSLEHGGDVKGKMKAKDTPVVSPSSGRETVKPKSKSFNGPTTTVDSSRPLSTSSS # SGKPKSIPVPPSPSTRTDPHDLFNDDMPVEYASPKKKKTTKPQETPNTILRHVHNVDADEDEVPATPQPAGSKSKSAHSNSKGSSSEWEELALQSKSS # QEEGNTLGECSYLIELYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g345 ### # start gene g346 3 AUGUSTUS gene 985058 986361 0.23 + . g346 3 AUGUSTUS transcript 985058 986361 0.23 + . g346.t1 3 AUGUSTUS start_codon 985058 985060 . + 0 transcript_id "g346.t1"; gene_id "g346"; 3 AUGUSTUS CDS 985058 985127 0.35 + 0 transcript_id "g346.t1"; gene_id "g346"; 3 AUGUSTUS CDS 985177 985419 0.33 + 2 transcript_id "g346.t1"; gene_id "g346"; 3 AUGUSTUS CDS 985507 985670 0.74 + 2 transcript_id "g346.t1"; gene_id "g346"; 3 AUGUSTUS CDS 985726 986361 0.83 + 0 transcript_id "g346.t1"; gene_id "g346"; 3 AUGUSTUS stop_codon 986359 986361 . + 0 transcript_id "g346.t1"; gene_id "g346"; # protein sequence = [MEQELSTPSKKNRIIPSESDALKEQANALFSSILHTEVTPPSPHRPSSPTRPPVASTSAAPPSTPTRRRLFAYSSPSR # SNPSTPSRRLDTPTDEAYSMSPVRAQKDFYLNLVDWSSTNVLGVGLGSCVYLWTAHNAAVSKLCDLAESRDTISSVSWVQKGSTLAVGTLSGTLHVYD # ASTLQLIRTYPQAHGQRIGAIAWNAHILSSGSRDRMVHHRDVREADTRPFKRCQGHKQEVCGLKWSGDGGPSSANLASGGNDNKVCIWDLRGSRRAAA # GLPNAGRPVPGTSSGDDAGAGDIPLWKFHEHTAAVKALAWDPHVSGVLATGGGTQDKHIRFWNTGTGTMLNELDTGSQVRFLVSGCCSVLTYDLSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g346 ### # start gene g347 3 AUGUSTUS gene 990298 993566 0.59 + . g347 3 AUGUSTUS transcript 990298 993566 0.59 + . g347.t1 3 AUGUSTUS start_codon 990298 990300 . + 0 transcript_id "g347.t1"; gene_id "g347"; 3 AUGUSTUS CDS 990298 991311 0.59 + 0 transcript_id "g347.t1"; gene_id "g347"; 3 AUGUSTUS CDS 991524 993566 0.97 + 0 transcript_id "g347.t1"; gene_id "g347"; 3 AUGUSTUS stop_codon 993564 993566 . + 0 transcript_id "g347.t1"; gene_id "g347"; # protein sequence = [MLGQQDPTSGSGETQFEKLLIGPLGSVNGTTLLVIDGLDECKGLLDHAFEVLNTLLINVSRVTALKVLISSRSNSPIF # EQLFLKVSENPSGYRCFSLDEDVSLPELRHDLRLLLAVELKTRGFGQKDIISLQNVINNANCSFFVALTACQELISPFGNSSKQADSFKDLLSRGTNK # IYESVIERALSVVDSNDDSGDPIQRRGLYAALIMVAFGQDSLSLIELAPLLGIPIDELRGFFSGFPENILSVKDETVLILHSSFQDHLKSGQLAQPDG # SLQDCMHLYITRLLLCLMNKYLHRHISGPGGFRLHANTTRQSPRQDSKITPDLSYACRYWPEHLVWQDNCDSGLGDHSSLEGTVSDALKSFKLFRTAI # ESSPHQVYHSFLLPWTPSGRRVAELYRHVEASVTVAEVTCHRRQLITIEPSIDNVQEPLKIKLSQDASRVAVVKKDRIEIGENAKDTFEVFLDDSGSQ # SYIDALFVGKDNILVTTLSRSSYVEVHLWNVVSKKFEKTLLQQYQATGSKMLPILVFHSERGTPSLVALLTSSKVKVWEARTWKERLIIQCRRDQNPQ # NRLLALSSHHILVGLHLKKLPAGGTTKTLDLNFAESPRCATFSSDGDTLAIASDTGISLFTHILEGTALKMSPSMVLPVSHQISALALSPVGRYLAAT # GQSFLWAWKLGDEQPLMRLQNEQKRTVSSVVFSKDGKYLHCAHICPGSRTALFDMRIMEAPISVQMPVTALAMSCSGKIATGSSNGTVTIWDSSMTNV # SRYWKRERHPSAVKFVAFSLDGKFVASISPERVYIRSTGSDLGSNELAQRLPVQSLPESYSYSFSQCVFSGDSSLFLCIMKADARPTFAQVWQMATWK # LLAEFELDSRDYSPDEDIQSISLSQEGDLFAISSRTNTRLAVYTLAYNESSICIKHTQRISVVGRPPLLLSFTQDKKYILSTAGAFDIERGLEQVNEI # PRTDAFFQDGWIVDSDGQQRCWIPFEKDIRDWASCRSLLVFCTKALGNVVLIGVRPIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g347 ### # start gene g348 3 AUGUSTUS gene 996809 997003 0.36 + . g348 3 AUGUSTUS transcript 996809 997003 0.36 + . g348.t1 3 AUGUSTUS start_codon 996809 996811 . + 0 transcript_id "g348.t1"; gene_id "g348"; 3 AUGUSTUS CDS 996809 997003 0.36 + 0 transcript_id "g348.t1"; gene_id "g348"; 3 AUGUSTUS stop_codon 997001 997003 . + 0 transcript_id "g348.t1"; gene_id "g348"; # protein sequence = [MDSGFKVDIDSGANRPAALRQSDAALGCVIENRVLTAPGHPVKRHIEFKLPEGSTYRAGDYLAM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g348 ### # start gene g349 3 AUGUSTUS gene 1000569 1001186 0.31 + . g349 3 AUGUSTUS transcript 1000569 1001186 0.31 + . g349.t1 3 AUGUSTUS start_codon 1000569 1000571 . + 0 transcript_id "g349.t1"; gene_id "g349"; 3 AUGUSTUS CDS 1000569 1001186 0.31 + 0 transcript_id "g349.t1"; gene_id "g349"; 3 AUGUSTUS stop_codon 1001184 1001186 . + 0 transcript_id "g349.t1"; gene_id "g349"; # protein sequence = [MDGLQISNWVYHDGTYANTSIVQDLLHNVQAQRVENEDYSLQDTIHLPFSWPADANNKFPSYDSNSSSDPNSISLAGA # ELWPSQPTPDVPLPKTSMICAEDNFRLTKYSAEMPQWRYLTPERVAAFHSHLTAIRRVVDDNARAGVDLSRVEGKIQENIALILEDDVDMEVDIKERM # SVLLPMLPYDWDMLFLGVLYKLFSSILYH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g349 ### # start gene g350 3 AUGUSTUS gene 1005901 1008333 0.54 + . g350 3 AUGUSTUS transcript 1005901 1008333 0.54 + . g350.t1 3 AUGUSTUS start_codon 1005901 1005903 . + 0 transcript_id "g350.t1"; gene_id "g350"; 3 AUGUSTUS CDS 1005901 1006557 0.81 + 0 transcript_id "g350.t1"; gene_id "g350"; 3 AUGUSTUS CDS 1006661 1006984 0.55 + 0 transcript_id "g350.t1"; gene_id "g350"; 3 AUGUSTUS CDS 1008009 1008161 0.68 + 0 transcript_id "g350.t1"; gene_id "g350"; 3 AUGUSTUS CDS 1008313 1008333 0.67 + 0 transcript_id "g350.t1"; gene_id "g350"; 3 AUGUSTUS stop_codon 1008331 1008333 . + 0 transcript_id "g350.t1"; gene_id "g350"; # protein sequence = [MSILTRILSNVSSSSNQPVEAIPGVLWSGSRDTAHAELDPVDLDDPSLGRLPKFSSSPPLTDDLGITDAERIRARLRD # LQNHQNELDKAADMTDLRALLSTALNAKNDFDMQKVLQVAGKDMPKAIRTLLGTLEGKGPHWKPTPGSAMRSANLKLPHTRAFTWPLDEKQGSVLDGE # HIESDIARLVQRTDTDLPSWTIGKYVYESISWDLSKAKYSSKQTTSRDTFLSELNVWKSLNHPNILRLYGASDSHSESIGPWFFISPYMRNGTLSEYL # KRLEWDGGMDMGTSMVSEVYGDSSVPDLLRFMEEIAIAMEYMHSAEVVHGDLKLSFVEEMLMAIRYLLRIRRQIKTSAPNQALLDFPHKVGAPQLMLE # TMSALVSSINIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g350 ### # start gene g351 3 AUGUSTUS gene 1008401 1008700 0.99 + . g351 3 AUGUSTUS transcript 1008401 1008700 0.99 + . g351.t1 3 AUGUSTUS start_codon 1008401 1008403 . + 0 transcript_id "g351.t1"; gene_id "g351"; 3 AUGUSTUS CDS 1008401 1008700 0.99 + 0 transcript_id "g351.t1"; gene_id "g351"; 3 AUGUSTUS stop_codon 1008698 1008700 . + 0 transcript_id "g351.t1"; gene_id "g351"; # protein sequence = [MSPIHGDAATGTHDSYDGVHGDDSYLASDGHEDIDDVQAYPLIKPYHDADNYIHQIKNNDNDSPKDSGRDVNEFKVDN # NEAMIGHGEFFDADGDGIFSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g351 ### # start gene g352 3 AUGUSTUS gene 1010070 1010663 0.88 + . g352 3 AUGUSTUS transcript 1010070 1010663 0.88 + . g352.t1 3 AUGUSTUS start_codon 1010070 1010072 . + 0 transcript_id "g352.t1"; gene_id "g352"; 3 AUGUSTUS CDS 1010070 1010663 0.88 + 0 transcript_id "g352.t1"; gene_id "g352"; 3 AUGUSTUS stop_codon 1010661 1010663 . + 0 transcript_id "g352.t1"; gene_id "g352"; # protein sequence = [MALPRVLSVIGAGQMGIGIALVASLRAKIPTVLLYDRDPSQITKGLEFMDKLLAKDVSKGKTNEDDAKAARGRIISIT # SSSASSSTSNNDEFGWARELGERGSDMAVEAASERLSIKEGIFRTLAKNLSRDAVLASNTSSISITKLAGAAVEGLGSTISKASEEGKSCAGRVVGVH # FFNPVPVMVSRHDLVDFRERR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g352 ### # start gene g353 3 AUGUSTUS gene 1012775 1014079 0.79 - . g353 3 AUGUSTUS transcript 1012775 1014079 0.79 - . g353.t1 3 AUGUSTUS stop_codon 1012775 1012777 . - 0 transcript_id "g353.t1"; gene_id "g353"; 3 AUGUSTUS CDS 1012775 1013188 0.93 - 0 transcript_id "g353.t1"; gene_id "g353"; 3 AUGUSTUS CDS 1013435 1014079 0.88 - 0 transcript_id "g353.t1"; gene_id "g353"; 3 AUGUSTUS start_codon 1014077 1014079 . - 0 transcript_id "g353.t1"; gene_id "g353"; # protein sequence = [MLSVNVLLVLVVVYWMGLYLNNPASVQESSPKDCLARNTLNDLIDCLDAFSVSPDFYDASSYAAAQPTDEENSAWTSV # IYSMLNANANDCADITLPSALEHIYAVTTFPDVDINRTFCVLSETTASVYSNYTKGWGLMVVPASARDISRHIHLSAPHPQADINTPQQAGAIFTLSG # AHSLLISGRFRSAYAVQTDCIIPVGAKKVFYKTDPAHDVALLADHLHSPWPGNSDSSLSWYEDHSLNIPARRLRDIARTIFPNWNASLPSDDPTCVLT # ATSNVFGRLINGVPGGSVCTTDADSLIATGEFIHIEQAIASRQSDVYDQWGEILRRAFRTSCAEGTVEDSKIGLCVLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g353 ### # start gene g354 3 AUGUSTUS gene 1019834 1021696 0.64 + . g354 3 AUGUSTUS transcript 1019834 1021696 0.64 + . g354.t1 3 AUGUSTUS start_codon 1019834 1019836 . + 0 transcript_id "g354.t1"; gene_id "g354"; 3 AUGUSTUS CDS 1019834 1021696 0.64 + 0 transcript_id "g354.t1"; gene_id "g354"; 3 AUGUSTUS stop_codon 1021694 1021696 . + 0 transcript_id "g354.t1"; gene_id "g354"; # protein sequence = [MMIPQAKPESTASHSTLKGPSLPPSRPESSDYDWFTSFIQRKGAMTPLESSPLSDYDCVLLSSPSSARSHISVRTPSP # SAESQRPIDRSTTIYQPLTAIRPSSGHRSSDSNPESLLEDVERGRRLHGQPVTSRMRSPVPIVLPSPEHTWSPVLIRPPSYTSLDNRLTGLTATTDQR # GASPISRLSTPQSLYESRPSTAMQELPPPNEERTNEASIHSSSVHSSRLPTSILAVRSPSPVYTRSSSGSARSQSPPPVIPVLSNIPSTRTCSPSSIR # AWSPPPFGNNVPRPFVYTPIPPSPSQSFMRYHSPRIAPFSNLPAVFTPSSAPELTPRLLGEPSRVIPPLCSGVPSLVSRMHDGTGVGTTKNDHTDSDP # NFIPWVPPTPPPITPSVTSTILHRPHDHTWTGANWGPGQKGRFDPNHNSPWVPLRPPIAQTQGVVNASSSPNLHHQSSQFPQVTPYGSWNSPLQPFIP # PVIPPPPPDTPKVNDSRCVCGPRGGVGDSSVGGVFGVGGYSGFGNGPSGAVWPVPPSFPAPTHPFPSTFHTIPSVPPSLPGFSHVSPSFPPGFIPTSQ # VSRIPDQPAAPNVVPLSPKYHHRYYFYDGSVLILVSLHLWVTSSPAEVISLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g354 ### # start gene g355 3 AUGUSTUS gene 1031704 1034006 0.55 - . g355 3 AUGUSTUS transcript 1031704 1034006 0.55 - . g355.t1 3 AUGUSTUS stop_codon 1031704 1031706 . - 0 transcript_id "g355.t1"; gene_id "g355"; 3 AUGUSTUS CDS 1031704 1033656 0.67 - 0 transcript_id "g355.t1"; gene_id "g355"; 3 AUGUSTUS CDS 1033722 1034006 0.55 - 0 transcript_id "g355.t1"; gene_id "g355"; 3 AUGUSTUS start_codon 1034004 1034006 . - 0 transcript_id "g355.t1"; gene_id "g355"; # protein sequence = [MRINSYTAQSTLVQGRDLEKIQFKLDKAQATVQTNERDFANFARTFQDTAAKWEQDWKMFCDTCQDLEDDRMEFMKDS # MWAYANAVSTVCVSDDEVRVALEGMDSEKEMENFVRDYGTGPQIPAPPAFFTYNSPEAASASVARTKPANFVRSSQRTSPLRMPQPIPPEEEDEPPVN # TAGRGAGGGHSAKSSMADARPSSRGPNGVNGQNGQLSSSPSHVSSSTAAQPLSRRSTHRNPPPHDPLAEPIDPNAETYIKVGGSAYKVDLNNDPQRQG # SMGYNAPRSASPSKLNSANSAADDPLAKQLEELQNQVSSVGSVRRNSIWRGQQNTEGSSSGTPSRKGTADALAAPRAGSSAPRDYRNSAEMIVGQHPS # LSRPASPNPNPSAPTAAFMVPKKPVSPGAEILDGILTDYHQSLPGERKAINRSGSRSRSRPGSYAASNGFNEQQQQRGRNLDRPPSVGHAGIGAHGSR # SNSPQPMSRSTSPAPSPGQFMSPPPGSTIMRAGSTGSQRSPSPNPLGISLDANNARVTVDEMAQRYQQQAQSQYRQPPPQQQQQQQQQPQYTGRSQGY # TAPAAQPQYAPPPAPYQAPHHQQQPSYSQVPPPPQPSYNAPPPVHYQVPPPPQQQPMYQQTAPPPTVSPGYGQMERALTGPGYYGNGNGQLVQQQQPQ # QTMSQQQQRNMHPQQQNSSPGYQQQMSMYGGPMRRSPSPQPPAGAMVAAPTRQVTEDGAGILFYGTLLQLAYLLSNSSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g355 ### # start gene g356 3 AUGUSTUS gene 1039025 1040314 0.9 - . g356 3 AUGUSTUS transcript 1039025 1040314 0.9 - . g356.t1 3 AUGUSTUS stop_codon 1039025 1039027 . - 0 transcript_id "g356.t1"; gene_id "g356"; 3 AUGUSTUS CDS 1039025 1040314 0.9 - 0 transcript_id "g356.t1"; gene_id "g356"; 3 AUGUSTUS start_codon 1040312 1040314 . - 0 transcript_id "g356.t1"; gene_id "g356"; # protein sequence = [MSDILIACLFPAMLLYLGLRLSVFDKAFLHSIWFDFLALFKSGRTPNTNSGNGPFSVQTSSTAYSRYRSLSLDELSRM # RASYTLIGRTHKHIGYELGYTKKLDRLAELIQVNAKATDGIVTVMRRRYAQELSVSTATLWSGFPSTVRETSIDSHSLSRIREALKHFVRDWSDAGSS # ERSVIFQPILSALSTLPAPSRSRNRVLVPGSGLGRLAYEISQLGYDVTACELSAYMNGAFRFLLDSEMTTTINQHEIHPYAHWWSHSRNTADLFRGIR # FPDVIPRLAEEETVGLHLTEGDFLALKAPKPLAGSDLSRANGYDFIVTLFFIDTSVNILSTLEQIHKLLKPGGTWVNLGPLLWCSSAQARLELTLEEL # FDAMEAVGFAVAGGRDGNDDDEPDCMKRRTIPCEYTHDDKAMMRWIYEAEFWVARKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g356 ### # start gene g357 3 AUGUSTUS gene 1046534 1047265 0.99 - . g357 3 AUGUSTUS transcript 1046534 1047265 0.99 - . g357.t1 3 AUGUSTUS stop_codon 1046534 1046536 . - 0 transcript_id "g357.t1"; gene_id "g357"; 3 AUGUSTUS CDS 1046534 1047265 0.99 - 0 transcript_id "g357.t1"; gene_id "g357"; 3 AUGUSTUS start_codon 1047263 1047265 . - 0 transcript_id "g357.t1"; gene_id "g357"; # protein sequence = [MSLDTLNVTSTYHRDTYPAISPTNPSLSQAGRAILITGGGGGIGFEIARSFAKAAASKIIIVGRRSAVLEAAAVKLRE # EFKDSTTEFIAHQGDIGDDASISSLWDFLNSRNIFVRVLVLNAAHFTPWGPDTLKMDKRELMEGFDINVGGNFLMTVKFVNQPLRPAGQQLNLINVST # ASIQMIPAPNQTPYSTTKSAFTALIGRIADEHPVEDIQIISYHPGALYSEGAAKHVDKNLLKWDESE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g357 ### # start gene g358 3 AUGUSTUS gene 1047985 1049513 0.39 + . g358 3 AUGUSTUS transcript 1047985 1049513 0.39 + . g358.t1 3 AUGUSTUS start_codon 1047985 1047987 . + 0 transcript_id "g358.t1"; gene_id "g358"; 3 AUGUSTUS CDS 1047985 1048702 0.91 + 0 transcript_id "g358.t1"; gene_id "g358"; 3 AUGUSTUS CDS 1048759 1049513 0.39 + 2 transcript_id "g358.t1"; gene_id "g358"; 3 AUGUSTUS stop_codon 1049511 1049513 . + 0 transcript_id "g358.t1"; gene_id "g358"; # protein sequence = [MRSVVLFGSLYALLALPHALAVKSQDFKTCSQSGFCRRGRALAARAQEAQSSWKSPYTVDPSSIVISPEDSTVKAAVK # SSLYPEIKFGLELRIHDDGVVRVLLDEVDGLKKRYDEAASWALVSEPKLSKGIRWAAGKKELRAVFGEKNDIEVAVDYDPLRVRLRRGGEDQIVLNGR # GLLHMEHFRSQTLKETIEEVASDENAEGQEVLQVENVRAWFEGGSEDAYWEEKFSSWTDSKPKGPESLSLDITFPNHGTVYGIPQHATNLSLPSTTGD # SPSYTDPFRLYNADVFEYLASSPMSLYGSIPVMHAHSADTTVGVFNAVGSETWIDISYPTKKSTHTHWISESGIMDVFLLPGPTPEEVFAQYARLTGT # TALPAHWSLGYHQCRWNYVSSDDVRTVQRRFDEEDMPVDVFWLDIEYAQDHKYFIWDHKTFPDPVEMTNDVAAAGRKVNCQNKFVFSCSHSCFTDGRH # RRPSFEKNFRLPSVSGSFRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g358 ### # start gene g359 3 AUGUSTUS gene 1050347 1051275 0.29 + . g359 3 AUGUSTUS transcript 1050347 1051275 0.29 + . g359.t1 3 AUGUSTUS start_codon 1050347 1050349 . + 0 transcript_id "g359.t1"; gene_id "g359"; 3 AUGUSTUS CDS 1050347 1050408 0.29 + 0 transcript_id "g359.t1"; gene_id "g359"; 3 AUGUSTUS CDS 1050459 1051275 0.46 + 1 transcript_id "g359.t1"; gene_id "g359"; 3 AUGUSTUS stop_codon 1051273 1051275 . + 0 transcript_id "g359.t1"; gene_id "g359"; # protein sequence = [MLPIWYTAFRENSVTGMPIVRPHYVVFPQDTAGFAIDDQFFVGSSGILVKPVTEKDKTEATVYIAEDQVGDLYMLSFY # GIHSRFSLYQVYYDYFTQYAYRGSSKGKHITVAAELHQVPVFIRGGSIIPTRERPRRSSPLMKLDPFTLRVALSKTGTARGDLYLDDGITYSHQQGEF # VWREFVAEQSHKKTTRISSKDLASHNPGKAVDGIALTTFDPKNAFAKEIEEVRVEKIVVLGLNSKPRSVNVEGGAELKWEFVPGVAASDKKEGVSSVL # IIKDPKVLITTDWAIVIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g359 ### # start gene g360 3 AUGUSTUS gene 1051684 1053612 1 - . g360 3 AUGUSTUS transcript 1051684 1053612 1 - . g360.t1 3 AUGUSTUS stop_codon 1051684 1051686 . - 0 transcript_id "g360.t1"; gene_id "g360"; 3 AUGUSTUS CDS 1051684 1053612 1 - 0 transcript_id "g360.t1"; gene_id "g360"; 3 AUGUSTUS start_codon 1053610 1053612 . - 0 transcript_id "g360.t1"; gene_id "g360"; # protein sequence = [MLDSAARNVDDDEWQVVLADWPRIHFEAISWTHNPPGSHGAPCKAICRPPTKSHYLVKQTDGNSADLEQELNAELVGV # SIAFDVLTAYEATSGFHYNSCLDVRGVESTSANVADISCQIDEKDVAACKKNWNEIVQSLTGDFAEDRDTSSSSGSDSGSLASSLMFDSSDCLYPNYV # SMPSTPKPHAPSSCGAARSSPSVSPHSKLNAFASSFTPSGSSVPSLTFSNNASPLTTRSSPSPTLHDFVFPSLNSTKVSSYPKLKIEKDDQGFYTNME # AETELVTPKSHMHPSTLLPAFLQDDHIRRKGLSSKTRALVDRLRSRQSTTTHEESGYNLSPSPVDSELHDSQGTTFDVDDNASSSFSESRSISGVPSL # TSTNLSSDTDGWIGLEELHRSSPPKSRKRNGPNLSLSTTPMHRRTGSGPAALETEPQVRSPSSSSSQGPALSSSSSSSSSSILSPPTPPVITNNDGWI # EVSEISRKKSLSFVPTKKPSRVSNRKMETEPLTFPTLNATPQANSRSHTRNASSAGSSKSTKAYKSAPAGVLPLSPPAPASNYGYYVPPALPVAPTVS # YAPYAVNPMTPYATMMPQYYPHQYAYQQQHTHPQQYPYHHRGHSVAVPSIGTMPASYVIPNATASPMTIRLGMW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g360 ### # start gene g361 3 AUGUSTUS gene 1056141 1056737 0.45 + . g361 3 AUGUSTUS transcript 1056141 1056737 0.45 + . g361.t1 3 AUGUSTUS start_codon 1056141 1056143 . + 0 transcript_id "g361.t1"; gene_id "g361"; 3 AUGUSTUS CDS 1056141 1056737 0.45 + 0 transcript_id "g361.t1"; gene_id "g361"; 3 AUGUSTUS stop_codon 1056735 1056737 . + 0 transcript_id "g361.t1"; gene_id "g361"; # protein sequence = [MCFYFFIPDELKSTVAATSPPGTNLGLLASTGTVKANGNLPAYRMGSQRSKYDIYDLEAPRNGNGRAGAAVGGRGIMA # EAAAEFDLAESEDDFASETGDGERHPGDEEDITYRPTMQKAAGNKPNGKNKSEIVAGGANGHRHTASIARLIRGPDARGSIDGGDEGWRSPMSAGFVF # PPRNGRGKEADGKRSPIRETFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g361 ### # start gene g362 3 AUGUSTUS gene 1060297 1060950 0.4 + . g362 3 AUGUSTUS transcript 1060297 1060950 0.4 + . g362.t1 3 AUGUSTUS start_codon 1060297 1060299 . + 0 transcript_id "g362.t1"; gene_id "g362"; 3 AUGUSTUS CDS 1060297 1060950 0.4 + 0 transcript_id "g362.t1"; gene_id "g362"; 3 AUGUSTUS stop_codon 1060948 1060950 . + 0 transcript_id "g362.t1"; gene_id "g362"; # protein sequence = [MHVMPPYSSFDLAHDQHPDLEHGHGEGEGPSATPTSSKPLIGRLTTKAWDTASTTAATFTSVASSAASLAGGRHKSKD # VEKGLAPATSTAEGEVVVEVEEEEEKPQMNLTTTIVLLAVVTAVSQFSSFLRILVFQDSTDRLSSLSFTQLVSVTAEWLVDSIDGLTDTGAISQEFVG # IILLPIVGNAAEHVTAVTVSVKDKLTLSLGVAVGSTLVSAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g362 ### # start gene g363 3 AUGUSTUS gene 1064590 1067536 0.94 + . g363 3 AUGUSTUS transcript 1064590 1067536 0.94 + . g363.t1 3 AUGUSTUS start_codon 1064590 1064592 . + 0 transcript_id "g363.t1"; gene_id "g363"; 3 AUGUSTUS CDS 1064590 1065885 0.94 + 0 transcript_id "g363.t1"; gene_id "g363"; 3 AUGUSTUS CDS 1065968 1067536 1 + 0 transcript_id "g363.t1"; gene_id "g363"; 3 AUGUSTUS stop_codon 1067534 1067536 . + 0 transcript_id "g363.t1"; gene_id "g363"; # protein sequence = [MGSAAADFRQSKQSQFRYPSSTSSQPISSPRSASFLSEISGKWPRTSPGSHLSSSRQRLNGDGTDSDGYLTEKSSSHR # RKHSVAGKSRALTLPPTAGQIKLSPSRPIFRRTRSPSTGSSSSSSSSTSAPAVPLPTHPSTSGIGRKVAATLQLFKETEDDSQTNDVQPSTDHHERSA # SLGNGGDVAEAKFEFVKRSEWPDREAVVLRREKSTVTLHRVRTRESLASSDHKQQEDKKAQERKLSVTDLNQWRKDVGKWDDGIDRGRRRERAEDEII # SPLPSPRLLEQLEPPDVIRRSSSRSQPSTGVQSPHPYLSAVPHYDSSTLSPWSTDDESGWDSASGTTSTTSHSTAFTHHQNLSSSIPPLDDASSPTIS # FPSPDTPYHHYTDADDGDENTYLLDMGLNISQDTLPHIPLRPFRNQVGGHSAIYKFTKRAPLVSRENLFYEMVEREAPPLLAYIPRYLGVMLVSYRRV # LKSATLQLKPSADGHGEAKTPRPPLQKAATDRPSAGGKHNEEYTDTDESEMPEVVLDRNRHIVPEWMLRGSRSRSASQYTAAGVPSAIRRFQRQTLHR # GTASSPDLASPDSGSGILKPSPLARYPPFVSSEMTAPTPANSPKILTNGLRPGFPEGEKRRIFLVKSASDEDDGFGCRPELPSFHSEHMHSPLFGGRG # STMVNTKLKDHVFSTVLRRLKRRPGGRWLGGTRIVDDDGEVADAEGDDPSDFDNSSSKVRRRRGRKIAGDSLGRLRDSDHSQLRRVQSEAMIASPSKL # QAIAYEQQNQDHRGQEQFDHDVVGLFDMDVEGSPPPLRSHKWPNLTSSDLDTTELPPSLRKRSRSRSLDERPHRMTLTSPIRMPPLKEPELTTDDVHP # KQHDDGEAEPKHDLDSEFSRQNHFILMEDLTGRLKHPCVMDLKMGTRQYGMDATPVKKKSQRKKCDRTTSRTLGVRMCGMQVRIVNQSFTSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g363 ### # start gene g364 3 AUGUSTUS gene 1067957 1068391 0.58 + . g364 3 AUGUSTUS transcript 1067957 1068391 0.58 + . g364.t1 3 AUGUSTUS start_codon 1067957 1067959 . + 0 transcript_id "g364.t1"; gene_id "g364"; 3 AUGUSTUS CDS 1067957 1068391 0.58 + 0 transcript_id "g364.t1"; gene_id "g364"; 3 AUGUSTUS stop_codon 1068389 1068391 . + 0 transcript_id "g364.t1"; gene_id "g364"; # protein sequence = [MQKGSVDKDRRKRGAVDVRLVDFAHTTTGRDWLPYPEDFDKHLPHEVTTSSQGYNADIDPETGLIYARFPPHYPEDAD # MGFIWGLKNLTLALEQMWNDERKLRFKLLRENPDCGVKKLPALPTEGKEIFDEIFGEEDDPGMLST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g364 ### # start gene g365 3 AUGUSTUS gene 1071944 1073626 0.14 - . g365 3 AUGUSTUS transcript 1071944 1073626 0.14 - . g365.t1 3 AUGUSTUS stop_codon 1071944 1071946 . - 0 transcript_id "g365.t1"; gene_id "g365"; 3 AUGUSTUS CDS 1071944 1072713 1 - 2 transcript_id "g365.t1"; gene_id "g365"; 3 AUGUSTUS CDS 1072834 1073626 0.14 - 0 transcript_id "g365.t1"; gene_id "g365"; 3 AUGUSTUS start_codon 1073624 1073626 . - 0 transcript_id "g365.t1"; gene_id "g365"; # protein sequence = [MQYAQQQPPPPQQLLNPYGGGHTGYGTPPARPYSAPAPPGFPHPASSPYPSPYPSPYPIPGSSPAYTPQYPMQPPPST # SAPNFFPTPHQPPQHAGRPLPSSPSGAPPLPSSPTRPVLNTQFNSPSAGLKQHGAPGRRRASSTPPTPTAGATGVSGQIQCSGVTKAGKRCTRLVKGG # PALVNVWGTNSPTSGDVERFCHQHAKELLGPSGFYARKQHRDGRQGQGLQEWIDFNGRVQFMSVKYTILCGHRLYTSLLTSGHSSRPPNPNDPSPPTI # SLKVGRAVNVVKRLNQWGKQCGSKEQVLRGWYPGEVDNDSEEANDTVGQSLMKGRVKAGGRGVWCHRLERLIHLELADLAVHGPYLQPGWEAFTKGSG # RGKLYADAHPDYASSVNTAATGTHSSASASVISLSSSSSSSSSSPSTPAKGKTGKTKSGTPAKSKSSPKSKKDRFLANGLGNGGGGAPCKDCGQIHKE # IFEYMRVPKRPKGPKGKKGSSKNVDYYGMEWEGIVKKVIDEWGSFVENYV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g365 ### # start gene g366 3 AUGUSTUS gene 1077377 1078087 0.4 - . g366 3 AUGUSTUS transcript 1077377 1078087 0.4 - . g366.t1 3 AUGUSTUS stop_codon 1077377 1077379 . - 0 transcript_id "g366.t1"; gene_id "g366"; 3 AUGUSTUS CDS 1077377 1077955 0.4 - 0 transcript_id "g366.t1"; gene_id "g366"; 3 AUGUSTUS CDS 1078079 1078087 0.43 - 0 transcript_id "g366.t1"; gene_id "g366"; 3 AUGUSTUS start_codon 1078085 1078087 . - 0 transcript_id "g366.t1"; gene_id "g366"; # protein sequence = [MLWDIINALQKAKPNGGSAADHSTISSCSKDPWEGLFPLTVSSSWSSSPYTSEDPWEGPLPDDLFPNYDEVEGESESG # FADEETDGNPAGPAYEEGYDSVIDEEECNNLAYYEDMYGIPSDEEKEEWYNHFEEMYGHLVDEEEDDCIGDEEEYESPADGDDNSAADGGYDSAADGG # YDSAADGECAEEEEDDMFW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g366 ### # start gene g367 3 AUGUSTUS gene 1081110 1081526 0.91 + . g367 3 AUGUSTUS transcript 1081110 1081526 0.91 + . g367.t1 3 AUGUSTUS start_codon 1081110 1081112 . + 0 transcript_id "g367.t1"; gene_id "g367"; 3 AUGUSTUS CDS 1081110 1081526 0.91 + 0 transcript_id "g367.t1"; gene_id "g367"; 3 AUGUSTUS stop_codon 1081524 1081526 . + 0 transcript_id "g367.t1"; gene_id "g367"; # protein sequence = [MITNSGSQRFDLYAGTFDKNDQIAASPFLDAFMYIPNVQLGTAQQVLSALNAAGADERRKRDLGSVLQQREDELWKRG # YVDRRYMNWLDEMDRRHDGAVKRASQNLTLGYVTSDVRILSELSLGVVLSEIISSSPALV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g367 ### # start gene g368 3 AUGUSTUS gene 1084975 1085301 0.83 + . g368 3 AUGUSTUS transcript 1084975 1085301 0.83 + . g368.t1 3 AUGUSTUS start_codon 1084975 1084977 . + 0 transcript_id "g368.t1"; gene_id "g368"; 3 AUGUSTUS CDS 1084975 1085301 0.83 + 0 transcript_id "g368.t1"; gene_id "g368"; 3 AUGUSTUS stop_codon 1085299 1085301 . + 0 transcript_id "g368.t1"; gene_id "g368"; # protein sequence = [MYTNFVPALDGKYLSSNVNITVFDANNNTIDVPVGNRFRKFTTRKGRKITSLGVLYDFTGNDVNTTVQSVADMVKEQW # VSNMKPISSIELTGSFSSQKLLPKNQMYFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g368 ### # start gene g369 3 AUGUSTUS gene 1087847 1088865 0.63 - . g369 3 AUGUSTUS transcript 1087847 1088865 0.63 - . g369.t1 3 AUGUSTUS stop_codon 1087847 1087849 . - 0 transcript_id "g369.t1"; gene_id "g369"; 3 AUGUSTUS CDS 1087847 1088344 0.69 - 0 transcript_id "g369.t1"; gene_id "g369"; 3 AUGUSTUS CDS 1088407 1088865 0.63 - 0 transcript_id "g369.t1"; gene_id "g369"; 3 AUGUSTUS start_codon 1088863 1088865 . - 0 transcript_id "g369.t1"; gene_id "g369"; # protein sequence = [MKRQAQSKSTKVIAVDITRKEKLQYLYSMGIDLPLTTRLPDDAIEKKFRSAIDASQSFATLIAKSPFDPSTLPLWSKK # TSKTTLLKTVSRGNFEEAFANIRARREGKESAWPLFENTFMDARQTIMGLADGIDKGVKTALIQDKDTKYAICLRVVEVRMLNEETPVMVVLCRRGTR # DAPALETIRWAQEIISNKKLSLLKVTATPEEQKLLLTVLNMNARRLPPAYSVKRNSSGSEATFALSFLLPLGPINQKDIGKLTHHTGCVVCGKKTVSK # CSRCLSMEYCGVGKPLVQIGVLQAQQISFLVERIRMSTDTLEGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g369 ### # start gene g370 3 AUGUSTUS gene 1090101 1090706 0.32 - . g370 3 AUGUSTUS transcript 1090101 1090706 0.32 - . g370.t1 3 AUGUSTUS stop_codon 1090101 1090103 . - 0 transcript_id "g370.t1"; gene_id "g370"; 3 AUGUSTUS CDS 1090101 1090706 0.32 - 0 transcript_id "g370.t1"; gene_id "g370"; 3 AUGUSTUS start_codon 1090704 1090706 . - 0 transcript_id "g370.t1"; gene_id "g370"; # protein sequence = [MSVMRNDDTAIEVIEGKGKDKGLHEASKVVRKTAVYPLPAEGQPENVPRVLGGAESSKSHSLSSTTSSSSTTLIPTTT # TSTPTVTTRSWSPGYYLFTSTTIYGTFEHLASMSRDLPRQVARQKMMESMKREWVEYQEWAERIQRGEIQGVEGSFRTQREENAVTASETETQPEEAS # EIMSTGRKRPPQPLPDYLYVFLCIH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g370 ### # start gene g371 3 AUGUSTUS gene 1093989 1094876 0.96 - . g371 3 AUGUSTUS transcript 1093989 1094876 0.96 - . g371.t1 3 AUGUSTUS stop_codon 1093989 1093991 . - 0 transcript_id "g371.t1"; gene_id "g371"; 3 AUGUSTUS CDS 1093989 1094876 0.96 - 0 transcript_id "g371.t1"; gene_id "g371"; 3 AUGUSTUS start_codon 1094874 1094876 . - 0 transcript_id "g371.t1"; gene_id "g371"; # protein sequence = [MSNRLALGDPSYAVEDLGFCHDVYVGLREFAASSSNTSELDDFADALRNSEAYWRNAFTLMHIKNSDKSTHTEKEVSV # AVLNLALKLILQRPVPEVAQLMRTWIQTGLFSVLDETMEELIRVPGATSKSVVSKARRSLFANSNLTKTFFLYAGLLTFFYTTIKESCLSPSFPVNVL # RALKDEFPRQRAVGAVMRYETEQKGNQQNNTTEKNANEDDIPDAEDPIWINGLWQAMGWLEGVCHRDHPEHEGAQGIENRLVVTTGSTLCARRSCGKK # AVSKCSSCKQFWYCGVECQRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g371 ### # start gene g372 3 AUGUSTUS gene 1095422 1096030 0.76 - . g372 3 AUGUSTUS transcript 1095422 1096030 0.76 - . g372.t1 3 AUGUSTUS stop_codon 1095422 1095424 . - 0 transcript_id "g372.t1"; gene_id "g372"; 3 AUGUSTUS CDS 1095422 1096030 0.76 - 0 transcript_id "g372.t1"; gene_id "g372"; 3 AUGUSTUS start_codon 1096028 1096030 . - 0 transcript_id "g372.t1"; gene_id "g372"; # protein sequence = [MSRSHSALDRTITTKSSKWIKLVSQNPTRTVAALYIGPTGATNSHGDNGQDFIFAMDAVRRVAEELSRVTVQPSSSGE # GSGGSLGEGKDLRKDLEGLVNAGVVEALCRNVIELKGDTMADDVSAQPDEILRYSILIINEWCPFQAMSSFYPPFVILYFVVIGMNNGDRDERSGNQR # STVDKRAMNAIMDNWEEMVDRVSCCN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g372 ### # start gene g373 3 AUGUSTUS gene 1098896 1101114 0.42 + . g373 3 AUGUSTUS transcript 1098896 1101114 0.42 + . g373.t1 3 AUGUSTUS start_codon 1098896 1098898 . + 0 transcript_id "g373.t1"; gene_id "g373"; 3 AUGUSTUS CDS 1098896 1099913 0.42 + 0 transcript_id "g373.t1"; gene_id "g373"; 3 AUGUSTUS CDS 1099985 1101114 0.98 + 2 transcript_id "g373.t1"; gene_id "g373"; 3 AUGUSTUS stop_codon 1101112 1101114 . + 0 transcript_id "g373.t1"; gene_id "g373"; # protein sequence = [MDESTEQRESLINLILPFLTVPFRYPSSLAPANHFRLPLRSSAPSSSSTSFSIPTPHGPYPIYLQPSRYTWVIPHFER # WTPLCTPLAADAAKLVYFSRRETIPFGILNILPRNREEHRDRVRARLASQGNGEVDEDQVETVFRSELPRPTQEDFEELNAGLLGGDMFSSSSFSKGG # GTLLPRTHDPWDDIRKTMSNILDARSNIGDFSDDNLVDQNFGGEIDESACSSRCWDADWWRLRLCRSAWVSQGGPESEDSIVASNAYGTEDFNSDGEP # DEETTSEFNDELLQDVDMEVGEETECQGQVEQADDDMQRNSTMFNGYPQQGTVYTPGSLNGLWTGQTNLRALLLPPDPTTNQEELLLHANEPPAPAAA # PPHDHPPPLPNNGNNEGGPHANNANPAPHPHQEAQEAGHRPVPFTEDTLGLAAVPLYLRLSEYVVYFGGQTIPCANDTKVDFDSDDGMHSITHTNNDT # GHRGAGAAGMNLDDAFDQGIKDSWFPPNTTLSTKGDRVIATVPSFGTNNVEEYEYVAIQNNDINADDVTSSVASFSTPTLSRGMGSEVEARSKRKPGT # FHDQERCPGCISRERALLAARTQDMNIEVEHYADGSEELIEDLPPYVPSDKTIPPCNGVLDVIITGGTDPRHAAAWGNWVWRGRVRKWDGLVGLVGSV # DSGVSYSIFVLRCLLPTLFEPFVDPRKFMFTDYITFLCSFPSAYWIPPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g373 ### # start gene g374 3 AUGUSTUS gene 1104988 1105296 0.83 + . g374 3 AUGUSTUS transcript 1104988 1105296 0.83 + . g374.t1 3 AUGUSTUS start_codon 1104988 1104990 . + 0 transcript_id "g374.t1"; gene_id "g374"; 3 AUGUSTUS CDS 1104988 1105296 0.83 + 0 transcript_id "g374.t1"; gene_id "g374"; 3 AUGUSTUS stop_codon 1105294 1105296 . + 0 transcript_id "g374.t1"; gene_id "g374"; # protein sequence = [MQRQLGCEGDLPHDTQELSMSRHAWSNRPRHLPQPESDRSSNTDVDCEIHTPINYTELSDDKDEIAFDSLIRTWDCAF # SDCDKFGHCKLIEKTGLVQVGEHY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g374 ### # start gene g375 3 AUGUSTUS gene 1107374 1107988 0.5 - . g375 3 AUGUSTUS transcript 1107374 1107988 0.5 - . g375.t1 3 AUGUSTUS stop_codon 1107374 1107376 . - 0 transcript_id "g375.t1"; gene_id "g375"; 3 AUGUSTUS CDS 1107374 1107988 0.5 - 0 transcript_id "g375.t1"; gene_id "g375"; 3 AUGUSTUS start_codon 1107986 1107988 . - 0 transcript_id "g375.t1"; gene_id "g375"; # protein sequence = [MLLHRSTILITRCSLLHTSTMASGIQVLNPSSPDLASPTEPRWYLAYGSNLSATGFVVKRNITPIDTKVVIVDGLALT # FDNPGVPYIEPRFANCRLVEQTEQWSPGSAWTGGHGSLMGVAYLLSPADFLTILRSEGGGTSYQPLITPAVALSADGARTQQVINAYTLLTPTTRRGT # GYASLRYMNLLRNGARGKPLLFTNFYFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g375 ### # start gene g376 3 AUGUSTUS gene 1123452 1125722 0.88 - . g376 3 AUGUSTUS transcript 1123452 1125722 0.88 - . g376.t1 3 AUGUSTUS stop_codon 1123452 1123454 . - 0 transcript_id "g376.t1"; gene_id "g376"; 3 AUGUSTUS CDS 1123452 1125722 0.88 - 0 transcript_id "g376.t1"; gene_id "g376"; 3 AUGUSTUS start_codon 1125720 1125722 . - 0 transcript_id "g376.t1"; gene_id "g376"; # protein sequence = [MAKSHVEPSLLFFRTSPVSRSTPRFLNESRIIPPLSYPVAIHTLLELKTSHPEHIDIHFADEEGDPYAVELAGRLGAY # VVANDSDFAILNTEGYRGFIPLQAMVWHAIDEETDNEEFDEWIQASKKKRPSRNPNLGRGIIPPNAASSDLTLSFTVHSPEALSSFLDIPITLLPLLG # ALAGNDFSNQSAGAGKQVQQLFFEQRMTPSARINRVATTLRSILSLAQKHTQKQAKYHVDSVMDLISKTVKALLIRSLDSLGSGEVEEIVERIVNSTL # QYAIPKYHAPTELENGLWPSPLCALHEPDLCSMLPLFSRNIAATEWTEEEHLENPISSDKFSQLVEVRSKLMKAYRSGKLSPNIINCLNSSSLWTRLF # LENPDMETTATITRPIRIWYCAILDDAVGLPGKEDEEEEAGVDGSAAVDDDDEDELVDVVEVDSDDEGRDILAPLKGALRRLHEPNSDSGDSSPDYSL # TMSPVKHCSITEYYRRGTRVVDEAVEIPSLSELLSETTNSKSESYTPSHNHTNHTVKLPIRPLLTQPPDERLAVLLRALNESDDILRKIHSLSPEQLL # TALAFRWLLRFLCEKVAENPISKERQQARWTEKELRCALAAFTWDARNQARDALYESYPPITDRHVQLTSQILQCLDGVHQLAEVLLLSDLVSTSAHL # FSGRRFHAYLTGDLSPVPVNAFSGELWDACVHKLGDAFAEERMSRKEKKSKKSQNQNVPHVADTPKKANANNKTDGRRGGLYDMLGDVEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g376 ### # start gene g377 3 AUGUSTUS gene 1126394 1127098 1 + . g377 3 AUGUSTUS transcript 1126394 1127098 1 + . g377.t1 3 AUGUSTUS start_codon 1126394 1126396 . + 0 transcript_id "g377.t1"; gene_id "g377"; 3 AUGUSTUS CDS 1126394 1127098 1 + 0 transcript_id "g377.t1"; gene_id "g377"; 3 AUGUSTUS stop_codon 1127096 1127098 . + 0 transcript_id "g377.t1"; gene_id "g377"; # protein sequence = [MSSSTKSTIIDLTHPLDPDRITIYPGDHNFSCCPTSTVARDGYSVHSLSLGTHTGTHIDAPSHFILNGATIDQIPLDA # LISRPAIVVDLTYKKAGTKILWDDDLAKYESKMKEGTMLLLYTGCSAHWATPAYMKYPYLDRDAAERIISTGLKIIGSDTLSPDEIDGPEGYGVHLAI # LGAGGLIVENMTNLKALVELEAEGGTDSELSVSIIPLSLPKCDGSPVRAFGWKRRSSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g377 ### # start gene g378 3 AUGUSTUS gene 1129912 1130148 0.72 - . g378 3 AUGUSTUS transcript 1129912 1130148 0.72 - . g378.t1 3 AUGUSTUS stop_codon 1129912 1129914 . - 0 transcript_id "g378.t1"; gene_id "g378"; 3 AUGUSTUS CDS 1129912 1130148 0.72 - 0 transcript_id "g378.t1"; gene_id "g378"; 3 AUGUSTUS start_codon 1130146 1130148 . - 0 transcript_id "g378.t1"; gene_id "g378"; # protein sequence = [MAHSITPKDRHRPSNLRTISAASSIMGAEGIMTPHSEQSEREQLLETDIERLGGISRDSQYGSTSARAIGELMSSRNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g378 ### # start gene g379 3 AUGUSTUS gene 1130345 1131424 0.99 - . g379 3 AUGUSTUS transcript 1130345 1131424 0.99 - . g379.t1 3 AUGUSTUS stop_codon 1130345 1130347 . - 0 transcript_id "g379.t1"; gene_id "g379"; 3 AUGUSTUS CDS 1130345 1131424 0.99 - 0 transcript_id "g379.t1"; gene_id "g379"; 3 AUGUSTUS start_codon 1131422 1131424 . - 0 transcript_id "g379.t1"; gene_id "g379"; # protein sequence = [MSLYLCVDCGGSKTSAVVSDISGNIVGRASGGPSNIAYLTIDSFIETIRATVGDALKTCTSPASVDTVALPPPAGLEF # VAVWFGISGADSPSIIESVVNPLSTLLGVPKGPRLSVANDAHLLAAPIRMHEDVISAVTVIGGTGSIVVSFKEKEDGELEELGRVGGWGWILGDEGGG # YSIGREAVRQVLIEQDKHSVMKSPPPEGPLRTLLKNYFGIKDVMEVLTEVYVPDPIPSTVVNSDRGAHKYMSREKRLSSLSPSVFAAAFEDKDPLALK # VLCICAKDLAEQISIVVGDASEEAPRLVKASESVICFGGSVVGLEVYRNMVLDELVAKGHVFKHVEFVDDCAAVGAAGLRLKFKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g379 ### # start gene g380 3 AUGUSTUS gene 1136553 1138081 0.3 - . g380 3 AUGUSTUS transcript 1136553 1138081 0.3 - . g380.t1 3 AUGUSTUS stop_codon 1136553 1136555 . - 0 transcript_id "g380.t1"; gene_id "g380"; 3 AUGUSTUS CDS 1136553 1137079 0.62 - 2 transcript_id "g380.t1"; gene_id "g380"; 3 AUGUSTUS CDS 1137196 1138081 0.3 - 0 transcript_id "g380.t1"; gene_id "g380"; 3 AUGUSTUS start_codon 1138079 1138081 . - 0 transcript_id "g380.t1"; gene_id "g380"; # protein sequence = [MLTSETVGVRLKEDAERRIILLPDDFNWVPGVKKTDGKKHIPGLTAFEDLLKLGRLDREEQFQGVDAEQETVFLCYSS # GTTGKPKGVETTHQNLTTVLDIVQSGFPILSPTGDRMLAVLPFYHIYGLVKLLLFPFICGVSTIVMPHFDPLAFCESIQRYKVTITLIVPPVLVVIAR # HDCVEQYDMSSLRIMFSGAAPLGGELVKAVKSRLRPTNQPPLHIVQGYGLTETSPTTHLLPILPAQQWGNITEESKYGSIGFLLPNLEARLVVDDKDG # HAQTDDEVIDAAEGERGELWIPNTNAFFPYSSLPPSDPTPGSRWFKTGDIGIIDKDGFFWIVDRKKELIKYKGFQVPPAELESVLLTHPKVADAGVIG # VESAKESTEFPRAYIVPADSSIVSSDRAAELSREVQDWVKTKVSRHKFLRGGVVVVPVIPKSASGKILRRYLKEQAMKELAGRDPADIHAVEKVRTKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g380 ### # start gene g381 3 AUGUSTUS gene 1138153 1138539 0.88 - . g381 3 AUGUSTUS transcript 1138153 1138539 0.88 - . g381.t1 3 AUGUSTUS stop_codon 1138153 1138155 . - 0 transcript_id "g381.t1"; gene_id "g381"; 3 AUGUSTUS CDS 1138153 1138539 0.88 - 0 transcript_id "g381.t1"; gene_id "g381"; 3 AUGUSTUS start_codon 1138537 1138539 . - 0 transcript_id "g381.t1"; gene_id "g381"; # protein sequence = [MAPKIFRSALPDKPIVQRSIFTHQFPEPPLYPPEYPAYVDAQTGVTLNRGHIKDLALTFACALRNKKHAKRGDTIMMF # SPNSICWPVVVFGGMLSQLTGSLMINDPILQPSLLDYDAHSPTLPTLLTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g381 ### # start gene g382 3 AUGUSTUS gene 1139026 1139595 0.69 + . g382 3 AUGUSTUS transcript 1139026 1139595 0.69 + . g382.t1 3 AUGUSTUS start_codon 1139026 1139028 . + 0 transcript_id "g382.t1"; gene_id "g382"; 3 AUGUSTUS CDS 1139026 1139076 0.73 + 0 transcript_id "g382.t1"; gene_id "g382"; 3 AUGUSTUS CDS 1139179 1139595 0.82 + 0 transcript_id "g382.t1"; gene_id "g382"; 3 AUGUSTUS stop_codon 1139593 1139595 . + 0 transcript_id "g382.t1"; gene_id "g382"; # protein sequence = [MASLLERMNVSNSGSGPARSARGDVDSAWSHDLYAQHNSLSARLNLPASKPTLPPDATHASKSLAQKAFRDALSFSSP # STSRGARGGEELNIKGAGSSGNVVEVSGLVDGTTADDVSAIFKRCGDILQSKLISRRNEEVRCPLSITTWLPTEKFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g382 ### # start gene g383 3 AUGUSTUS gene 1147425 1149274 0.56 - . g383 3 AUGUSTUS transcript 1147425 1149274 0.56 - . g383.t1 3 AUGUSTUS stop_codon 1147425 1147427 . - 0 transcript_id "g383.t1"; gene_id "g383"; 3 AUGUSTUS CDS 1147425 1147938 1 - 1 transcript_id "g383.t1"; gene_id "g383"; 3 AUGUSTUS CDS 1148055 1149274 0.56 - 0 transcript_id "g383.t1"; gene_id "g383"; 3 AUGUSTUS start_codon 1149272 1149274 . - 0 transcript_id "g383.t1"; gene_id "g383"; # protein sequence = [MCRDVLNDEWVSHPTWALNSSSYGSASTSNNSSGNITYPDPFDDPTFFWAVSRKNVYEEALHRSEEERHEYDFHIEAI # SRTIAILEPINNKISQLSPEERGGFRLKPNLGGSAKAIHQRVVRKIYGREVGTEVLACMQESPAHAVPVVINRLKQKEEEWKRAQREWNKVWREVDAR # NYAKSLDHQSVNFKAADKKLLTAKAFVNEIEAAREEQMASRASLVDPLFSRTRPRHQLEIDFEDLNVLQDSLKLVLSFLDRTQGQIHWTERRRIEAFL # RGLVPLVFMLDAGAFNAAFAVVLELGGADGEIDLEGLGLPDVEAPLTTGSRSGGGRSKKGGGGNGVSGGDLRKKLLKSEQAKSGRKTRGGVTLQASPS # VSRFASPAPHTTLEGTPKIVPTTSRKRGVFFTNTTAQLHEEVRQSSSGSYSPVHYQPISTYDTTSSIISNLRGHEDSTVSEQPGDIDVHTEVVPSLSF # VPAGQTNEESESFQMERERLDPTAAQSYDILLQNCERLFDNEIEQSAFEDQMRSMFGVKVKAPLISNSKTMVNIASLSRMLTRSSQSTSSSEPSSNRL # ARTEITRST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g383 ### # start gene g384 3 AUGUSTUS gene 1149871 1150392 0.45 - . g384 3 AUGUSTUS transcript 1149871 1150392 0.45 - . g384.t1 3 AUGUSTUS stop_codon 1149871 1149873 . - 0 transcript_id "g384.t1"; gene_id "g384"; 3 AUGUSTUS CDS 1149871 1150392 0.45 - 0 transcript_id "g384.t1"; gene_id "g384"; 3 AUGUSTUS start_codon 1150390 1150392 . - 0 transcript_id "g384.t1"; gene_id "g384"; # protein sequence = [MEPAVAYVQKIKQRCDPETYRQFLDILSRYHHSPESINEVRSHVHVFLMCPINMFFLFGFQEEVSKQISQLFKDAPDL # RSDFRIFMPDGSQSLLDDNAAAEEGRHHHHHRERDHHDSKSRRKADVADSASASVLPQKRKRKAGERESIRVEREKIPVKPITSSKVYIRTYPRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g384 ### # start gene g385 3 AUGUSTUS gene 1150834 1151280 1 - . g385 3 AUGUSTUS transcript 1150834 1151280 1 - . g385.t1 3 AUGUSTUS stop_codon 1150834 1150836 . - 0 transcript_id "g385.t1"; gene_id "g385"; 3 AUGUSTUS CDS 1150834 1151280 1 - 0 transcript_id "g385.t1"; gene_id "g385"; 3 AUGUSTUS start_codon 1151278 1151280 . - 0 transcript_id "g385.t1"; gene_id "g385"; # protein sequence = [MDDAEILDNANDAPVTQINTAPTPASVEPDAENTKISDPAPPVPSPSIQTDELPQKVPVTTAEGALEAPKSSTNSQEV # EMADEPAVVSVSSVVLSVNDHEEDNAMQVDRPLNVTDALSYLDAVKNKFSTRPDVYNHFLDIMKEFKSQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g385 ### # start gene g386 3 AUGUSTUS gene 1151801 1152253 0.54 + . g386 3 AUGUSTUS transcript 1151801 1152253 0.54 + . g386.t1 3 AUGUSTUS start_codon 1151801 1151803 . + 0 transcript_id "g386.t1"; gene_id "g386"; 3 AUGUSTUS CDS 1151801 1152253 0.54 + 0 transcript_id "g386.t1"; gene_id "g386"; 3 AUGUSTUS stop_codon 1152251 1152253 . + 0 transcript_id "g386.t1"; gene_id "g386"; # protein sequence = [MTGRNTSRNPPPLKIDPTTPPASNPLPPKTSSVTGTTPSSTGASASSTSSFPMTSLDTTTSIPTSIPSGATQRSPGAK # PEGIFTRLQHTDTAVFSESQAFTQLLSRMGQVIGALHSTCDFLEKSTKFVVAAGPAIKAAEEASVSPIHLPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g386 ### # start gene g387 3 AUGUSTUS gene 1165075 1165704 0.67 + . g387 3 AUGUSTUS transcript 1165075 1165704 0.67 + . g387.t1 3 AUGUSTUS start_codon 1165075 1165077 . + 0 transcript_id "g387.t1"; gene_id "g387"; 3 AUGUSTUS CDS 1165075 1165704 0.67 + 0 transcript_id "g387.t1"; gene_id "g387"; 3 AUGUSTUS stop_codon 1165702 1165704 . + 0 transcript_id "g387.t1"; gene_id "g387"; # protein sequence = [MPSCLNDEKGAEVNRGQNDPREKENSRTDSEVQAEQSNLSEVHAIDPACLRPIVRFDYACLEDLDEELILRPRSAFAE # MCWSTAVQNIPRTSNQGKFSAQSLPFISKCCQPCSALNRRSPSHSSRSPLNFKVSEGLSAADEGGQSECHSGSESDRSLSNAWYGSIEESSVMVVTGR # LNVLENHDGVKLFEKTSSPGTVVVPSDSIVSED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g387 ### # start gene g388 3 AUGUSTUS gene 1171650 1172852 0.3 + . g388 3 AUGUSTUS transcript 1171650 1172852 0.3 + . g388.t1 3 AUGUSTUS start_codon 1171650 1171652 . + 0 transcript_id "g388.t1"; gene_id "g388"; 3 AUGUSTUS CDS 1171650 1172852 0.3 + 0 transcript_id "g388.t1"; gene_id "g388"; 3 AUGUSTUS stop_codon 1172850 1172852 . + 0 transcript_id "g388.t1"; gene_id "g388"; # protein sequence = [MAENQTGKTLRTIRIDGGGELNNSLVDAYCAEHGITIEKVPHDSSAANGVAERSFRTVMEGTRTLLEDAGLPYSFWGE # ASSTFIYTNNFVPSSRFPDTIPVEAWTRKRQDVSHLRPFGCECWATLPRRRTDGKLGRQAVKGRLLGYMGHRGYRIWIPETKKVEESHDVTFEEGIPH # RTRKPETNDEVDNEEISQEPAPSEPIGPTSDPINSANRDICDTQPRETHEPAHRPEDTHRDIPQRQPIPEPTRRSERGHIPSCRLIDSEEYEEWEWEA # QQRGEEWSTNLPVAGGHLTFIAQTPFSFAATTGDLWVPQSFKQAMKRANLWKEPMNREFDTLMEKGCWELVTLPPNANLTGGRWTLTSLPRFCVKEKG # RNLMGTPTNQSNTQYASSLLSNLFNSKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g388 ### # start gene g389 3 AUGUSTUS gene 1178463 1179293 0.51 + . g389 3 AUGUSTUS transcript 1178463 1179293 0.51 + . g389.t1 3 AUGUSTUS start_codon 1178463 1178465 . + 0 transcript_id "g389.t1"; gene_id "g389"; 3 AUGUSTUS CDS 1178463 1179293 0.51 + 0 transcript_id "g389.t1"; gene_id "g389"; 3 AUGUSTUS stop_codon 1179291 1179293 . + 0 transcript_id "g389.t1"; gene_id "g389"; # protein sequence = [MISRPLFMDKSNDTNNESKLDAIDALQCDLPMLTTLRTKSAYYDDLHTLSAYGELPIPLCHLPSFSPAPAPHTTDVQN # PSNKACVSIDSARSPTSPTGRLFDVAKPPAMAKRRRYTIATSKPSMAKEKENPQGTRPSLGSDGPEEMKEERLSSVLEKNDGESATSSTSWATQVPRP # SPIRTCSISCVPLASCSPAVEPVKNQVRASDPVQLTPASLKSPAPPSPITPLPARRMNVNVRYIKHYPYMITEPANSPRIEGEIEEEGVLSRMKYHLV # RL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g389 ### # start gene g390 3 AUGUSTUS gene 1185533 1188584 0.09 - . g390 3 AUGUSTUS transcript 1185533 1188584 0.09 - . g390.t1 3 AUGUSTUS stop_codon 1185533 1185535 . - 0 transcript_id "g390.t1"; gene_id "g390"; 3 AUGUSTUS CDS 1185533 1186154 0.37 - 1 transcript_id "g390.t1"; gene_id "g390"; 3 AUGUSTUS CDS 1186632 1186996 0.43 - 0 transcript_id "g390.t1"; gene_id "g390"; 3 AUGUSTUS CDS 1187253 1188584 0.3 - 0 transcript_id "g390.t1"; gene_id "g390"; 3 AUGUSTUS start_codon 1188582 1188584 . - 0 transcript_id "g390.t1"; gene_id "g390"; # protein sequence = [MVPPSNFTPAIPYYPVSGSTQVPTLLPSQTTNQHHLSSEQQISNQIPMEVHLPSPTLDKNTLQLQTHLSPEKNQTLAF # TPTFSNQVGSAQPDIPLTGPYVNRDTQYVCLSDLPEGKWNTTPQGNFALDVSHSEYEGSGKFQVDWACQTSSGRKRKGASYAFSYLENGHGTYRQCLG # TIHCGNKDCAVTIRPHTHTRAAILKQLNHSCKCGNRELIHNPCPNKAAIIQWSGGVRYMNGIHDHNHEVPSYKLHLTQDETAEFVQFVKSNPQVAPAA # LISGNTVDGKTVTDISSVLIHAPRVGRMQNQILGQAKIKGGDDFIEAFMHFQLERPGFIVANTMLGGVTVISAQTPFMASQLHDEALQVDGPFNGIIS # DAAHGWWKVQTSLLIISSVFSQILLRWIPVLISYSNGASAAHYEYHFLALFESIARIVGERNKTLVDELLAGLHFAKKVNRLLQAKDSNDFNQLAKTL # EADFPKIRPWLHWWLRPEHASMHFQAKRNMDPLLWHSLPETTNAEESIHFSMYAQQGRKHAFFAGWEALWKIVQTYEKLFNAERSKLQNLRRSTRPSE # IDRALQPNIGILTQLMNNPDSVMDSLCPAKKWQAGMKRATKAIEHSGGLTVDDCARINNWFYTVIPGASQKQHIWIGALPIAHARTLVLLHRHQSEFI # HEVEGASIVELAFNRLVAWTGKTVDGKDKLYERVDVDLEALQLLEKSVFDISEDAGVAGNQQWGLDAGSHLQNWNPWLEYGPESHCTNKREGDDEVEC # QVGKLYFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g390 ### # start gene g391 3 AUGUSTUS gene 1193073 1194107 0.76 + . g391 3 AUGUSTUS transcript 1193073 1194107 0.76 + . g391.t1 3 AUGUSTUS start_codon 1193073 1193075 . + 0 transcript_id "g391.t1"; gene_id "g391"; 3 AUGUSTUS CDS 1193073 1194107 0.76 + 0 transcript_id "g391.t1"; gene_id "g391"; 3 AUGUSTUS stop_codon 1194105 1194107 . + 0 transcript_id "g391.t1"; gene_id "g391"; # protein sequence = [MHDEAENENDRPFALKRERKQSRTFQGLIQKEPVTKSPFRQAASSSNDGDLKQRKASPPAVPPPPSRIPTHSGASPVR # PSLVTKRMHGPRLSGAKRERRKTVTFHENCEVVEFSRDEDESGEVFESDEDDNYGNAAEDDVDFFGEGKNEETPHDSYEDIELSDQEPEEQLELDADT # SITGLVDEIFAGSRQTSTPPRHHPNELPPDLETEDGVPLGRTHHADRVIKYHQEHESHPFVEPAPHTIVHTPTFPIHATAASPPPSTPSHRNRFSSPP # LGRSTHFERLQSARIEEEDIDRDVKMLPGSPSPMKPSSKTHLDEASMDGLVPKFELPGCKQTVQFDLCVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g391 ### # start gene g392 3 AUGUSTUS gene 1194376 1196019 0.93 + . g392 3 AUGUSTUS transcript 1194376 1196019 0.93 + . g392.t1 3 AUGUSTUS start_codon 1194376 1194378 . + 0 transcript_id "g392.t1"; gene_id "g392"; 3 AUGUSTUS CDS 1194376 1196019 0.93 + 0 transcript_id "g392.t1"; gene_id "g392"; 3 AUGUSTUS stop_codon 1196017 1196019 . + 0 transcript_id "g392.t1"; gene_id "g392"; # protein sequence = [MEASPIGLAREASFTQADSPASAPVRRSPLPPIPSSVPHRISSPAMRSSSPLSPRGSVSPFASPIGARPRSNRDDVHR # RFLRPRSFGSASPSGSPKINVDGGRGLRMSVDRQRIVDLSLEHSPEREDDHKEQLDSEINFERETEKDASSVMTAATENSAEMATIETAEKRKVVAVG # VVQEHEPAETEASMEVTHDVTMDFEVKGEELQEQAEPNEPVHQDQPEPIAVTQAIELRDQSFSGDEVDSGMDDDDDADDDDNGEEFGLLKAPAFTNSK # KLKFDLGSKFGLGKLGFLDLELPSEDLTTPSTSDKSDLGFDFNTKSSKVPPKSVQNMPVGSVNVRMDMRSALDRLMDDVASVGGSTLEEPHDISMTTT # EEDAPRSQLMQRAATDSVVVGSLGPPPGSSVHSAMPSRNASTSSSIAPPPPPKDNIRAREAMIIEKRRKMRRMEEGDDDDDDRPLGVARPQLSVPTGR # PSRRRSMSTGDAEDLGAKRRGVALRGQDSQLSLDVNTSPTGSDDALSDEIEKELKKNIHGSEKKKVEILFFHLDVDF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g392 ### # start gene g393 3 AUGUSTUS gene 1202739 1203669 0.28 - . g393 3 AUGUSTUS transcript 1202739 1203669 0.28 - . g393.t1 3 AUGUSTUS stop_codon 1202739 1202741 . - 0 transcript_id "g393.t1"; gene_id "g393"; 3 AUGUSTUS CDS 1202739 1203137 0.55 - 0 transcript_id "g393.t1"; gene_id "g393"; 3 AUGUSTUS CDS 1203364 1203669 0.29 - 0 transcript_id "g393.t1"; gene_id "g393"; 3 AUGUSTUS start_codon 1203667 1203669 . - 0 transcript_id "g393.t1"; gene_id "g393"; # protein sequence = [MSCHAHAHMQGGDTIWGNSTFAPDDPSEDSNVLDANDVRWRRSGHTHGELISFRRIPASVPIPEEGETETRLMDEDNG # VGVKNMTSEMAGDWILEHTPSSFQITQCPVDEDVLCLRTWEGDRGKAINLNNIFHHISVYHAHDVFVLQRSYWYTRGDFEHDESAADGISPLCIDPDT # GSNQTSPCAGSTPRNPLDMPLLRKSWIDADYTDETVNPKVCIIVLVLDTPIHNCYVSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g393 ### # start gene g394 3 AUGUSTUS gene 1209083 1210495 0.57 + . g394 3 AUGUSTUS transcript 1209083 1210495 0.57 + . g394.t1 3 AUGUSTUS start_codon 1209083 1209085 . + 0 transcript_id "g394.t1"; gene_id "g394"; 3 AUGUSTUS CDS 1209083 1210495 0.57 + 0 transcript_id "g394.t1"; gene_id "g394"; 3 AUGUSTUS stop_codon 1210493 1210495 . + 0 transcript_id "g394.t1"; gene_id "g394"; # protein sequence = [MKEPNEKVDPLRFPIIRVEKEYYDDTRGRQWLGHGNDYGYGIYREKSDDLEVQIERELERRGYGSRTFHLLFSRFFLI # TSTENPGGGHTKPPSDVEDIGHSHQPRRSWWQSIYNRISQSGTEDNGVDHTVVHSRHASQRKSKSRDPSKLRSQKSSLDHVATTESRYDMDDPPPPSL # FRSKLSSRQSKAERGAYSPVTPYGDEDMLAPLSAFNGYQKFSKRQSQYRNSVQRQEPNIMFSPPTANYPPQFSPPPASPPPQALLAPTMMMSHGDASA # DSLLGRVFPSKSSDANLTVHGTDNTHSTGYVRAVPRTSLPSRESGHDIGVAGERNPVHNQASLPPSIPQAMTAYVINPMRGANSEGNMYTELRLLDNV # DHGPTRLARLPSHPRPPPNPSPPNEFSPGLRRSSARVGHKQAQTRRSAGMSLHPRSKHHSLPAVLTIPRPLATPSANAYSDDHMAGSSFAQSYQFLGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g394 ### # start gene g395 3 AUGUSTUS gene 1210918 1211644 0.54 - . g395 3 AUGUSTUS transcript 1210918 1211644 0.54 - . g395.t1 3 AUGUSTUS stop_codon 1210918 1210920 . - 0 transcript_id "g395.t1"; gene_id "g395"; 3 AUGUSTUS CDS 1210918 1211330 0.76 - 2 transcript_id "g395.t1"; gene_id "g395"; 3 AUGUSTUS CDS 1211491 1211644 0.54 - 0 transcript_id "g395.t1"; gene_id "g395"; 3 AUGUSTUS start_codon 1211642 1211644 . - 0 transcript_id "g395.t1"; gene_id "g395"; # protein sequence = [MEKLLEGGEFNGPVHNPRPNAPNIECRQSKKYWGFELLDQNPRCSPPTMHGCQPTGTDQAISLFNIDTIKSIANKLNV # DSAQVLLSWGVQRKTAVIPKTENKARMESNMTVMHIDCINICWLTDWWLQLLQLSDEDMKNIDELHLQPNMHRTLTFIGFGERILGEGNIFGWTYEEL # GWNMIDGFVVSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g395 ### # start gene g396 3 AUGUSTUS gene 1214414 1214797 0.99 - . g396 3 AUGUSTUS transcript 1214414 1214797 0.99 - . g396.t1 3 AUGUSTUS stop_codon 1214414 1214416 . - 0 transcript_id "g396.t1"; gene_id "g396"; 3 AUGUSTUS CDS 1214414 1214797 0.99 - 0 transcript_id "g396.t1"; gene_id "g396"; 3 AUGUSTUS start_codon 1214795 1214797 . - 0 transcript_id "g396.t1"; gene_id "g396"; # protein sequence = [MGVRLYERELQESLDFCVKLFSDTAPESHIELVSNSNIAQELLDLTAPVVRPQDLEKALSVASPLRDTDDLETRRTQE # ATKMVLEKINARKVLNTEYTLNGFEAEALNGFTIRLQRGKLGLKRALDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g396 ### # start gene g397 3 AUGUSTUS gene 1219066 1219988 0.31 + . g397 3 AUGUSTUS transcript 1219066 1219988 0.31 + . g397.t1 3 AUGUSTUS start_codon 1219066 1219068 . + 0 transcript_id "g397.t1"; gene_id "g397"; 3 AUGUSTUS CDS 1219066 1219084 0.32 + 0 transcript_id "g397.t1"; gene_id "g397"; 3 AUGUSTUS CDS 1219195 1219988 0.96 + 2 transcript_id "g397.t1"; gene_id "g397"; 3 AUGUSTUS stop_codon 1219986 1219988 . + 0 transcript_id "g397.t1"; gene_id "g397"; # protein sequence = [MERGEDPKVYEETKVTNIAFDPIDPEKPVSVSWTRTCTAQSPNASQNGTTKAVHGSTTFTHLIDASGRAGLLSTRYLK # NRHFNASLENIAVWGYWHNRSDEEPDNEHDKEDHKPRVGMYGKGTSREGAPWFEALTDESGWAWFIPLHNDKTSVGIVMNQEQYNKSRPSSSDAQYEC # SLVGRYLANLRLAPGVARLLCGKDVVHNGSDSEHEIQIPIEEEILHQQAKLEPGSVRSASDFSYSAPSYAGKGFRIVGDAGGDLSEHNSVRLDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g397 ### # start gene g398 3 AUGUSTUS gene 1223768 1224453 0.56 - . g398 3 AUGUSTUS transcript 1223768 1224453 0.56 - . g398.t1 3 AUGUSTUS stop_codon 1223768 1223770 . - 0 transcript_id "g398.t1"; gene_id "g398"; 3 AUGUSTUS CDS 1223768 1224319 0.66 - 0 transcript_id "g398.t1"; gene_id "g398"; 3 AUGUSTUS CDS 1224403 1224453 0.56 - 0 transcript_id "g398.t1"; gene_id "g398"; 3 AUGUSTUS start_codon 1224451 1224453 . - 0 transcript_id "g398.t1"; gene_id "g398"; # protein sequence = [MHPLTIFHRTENSRLDPTPAPETTTSAQVTTTTSAPPPPPSTTTTTPPPPPLSTSTTPPPPPPSTTSTPPPSSTTSVT # TSKSVVSTTSTTSSSTQIAVTTSSSATAISTTSSTQVTSTASALSTTVLSAAGSSTSGFVTLPSASLSTVPAVSTSTSTIAAPSTSTTSATTNNNSAA # SVLHQGPVTAVIGILMVLGAINLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g398 ### # start gene g399 3 AUGUSTUS gene 1230069 1231172 0.93 + . g399 3 AUGUSTUS transcript 1230069 1231172 0.93 + . g399.t1 3 AUGUSTUS start_codon 1230069 1230071 . + 0 transcript_id "g399.t1"; gene_id "g399"; 3 AUGUSTUS CDS 1230069 1231172 0.93 + 0 transcript_id "g399.t1"; gene_id "g399"; 3 AUGUSTUS stop_codon 1231170 1231172 . + 0 transcript_id "g399.t1"; gene_id "g399"; # protein sequence = [MAYFETLIEQYRSRNSTTPCVTLGKRKRDPRVLPSSSTSASSLFEDNSFIGKEDNRQRISHRPRKRLCGSGSSRALDG # DAVDRAGNEYNRDEDHNKAYRRSKRLPAAPSSRSHGSDNSGEESDNEEDTSTPIEETGSLGRAGFFQREGAHTLSSLTMRFTRRHLRNSRAQDNVQDE # DDDLIEVDSYLRGCSVGSVESNMQSATDPPNSHSDKSSGARVRFASPCVSAKYTSTTIATLSPSLTEPQEFSATPIYVWRRVKILPRIQTVTSTDRPD # TMALNSPYDSDDCVSANADANNGLASVMPAHSSRRLRSNSLVRTRNVTKDSATDPRHPKTKCRVSTRLQTPSPSTYQSCRTRSMSSSAMKLGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g399 ### # start gene g400 3 AUGUSTUS gene 1235433 1238138 0.97 + . g400 3 AUGUSTUS transcript 1235433 1238138 0.97 + . g400.t1 3 AUGUSTUS start_codon 1235433 1235435 . + 0 transcript_id "g400.t1"; gene_id "g400"; 3 AUGUSTUS CDS 1235433 1238138 0.97 + 0 transcript_id "g400.t1"; gene_id "g400"; 3 AUGUSTUS stop_codon 1238136 1238138 . + 0 transcript_id "g400.t1"; gene_id "g400"; # protein sequence = [MGDSLLFEGRTRSKLTLPEASVELSRSPLKNARLAVRNRSRLELEEGSEARVEDSAEEDEMNLSPKKLGDKRSPSPST # STDWPRLKRFKSSPKGSDLEANIASKPAHSRHLSDSILIVAKTRRKRSATTSKPKSSSSSTTRRQSPAVLPPQKERARSVPVFPSFRDFPVININDIP # TSPTRRRPPSWEPKLRITSGSLFPQSQTLESIPDEAGEEPEETVGAARGVVAEISVDAPLPATPRQTDVLAVPADIHAVPLSPLTPLPETPFFKKVTE # NVDNTEDRFAASGEGQVCIPPLSGLVSLNCSQALFRKEEPKAVSETTSIEAVVPVKVSRSRLPRPTNATASSSKTNLKGVVPLQATSNRPAASRGQET # NAFDVLMRRTGKMQAKEKKSTEMTEIPIHLSGVNVDKATEIGKVTKQKKGSDMKGKGKSGTNVEVKSGSTSTIIGKMRPRTKPDVKKPAIPHIFLEDE # GEDLPGELSNIGKISGSPAYPLQPLPTRNSPSPLEFGALPPKSSSPDIEERLIGVDEAILTMDDVKMKGADEITVERHPARNDSLPAIDTNVVPRVPS # PLFSEPPTTAPSPLFSEPGHREDEYPKDGAHDEHVDTMDKPDVTARIYDEPMEIEPHSPSLTTLEVRSSPSLEINSRTRRQKVARPPLPPRTTRSASS # KVPTKESTTSGRTKKVPVSRKAGKKAANKAVASSEVADVAPSAVASSSSIDLSGHKESPADVDISNPQTLPVFTDDGEPLSELSDLPEDYLDVELPLK # GDGGEDVEMEAPSDTTESRMKPSGDEKNSIRFSPKRKSPRGLKSEEAAPEGASASFSVVSPPSPNSTSTAPLSARSTRSSKKSAIPVPITPARPKSSI # FKSPAAPGIKPGSAPSSPTKLTKSYSMFSYVPVSEYLEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g400 ### # start gene g401 3 AUGUSTUS gene 1238292 1239320 1 + . g401 3 AUGUSTUS transcript 1238292 1239320 1 + . g401.t1 3 AUGUSTUS start_codon 1238292 1238294 . + 0 transcript_id "g401.t1"; gene_id "g401"; 3 AUGUSTUS CDS 1238292 1239320 1 + 0 transcript_id "g401.t1"; gene_id "g401"; 3 AUGUSTUS stop_codon 1239318 1239320 . + 0 transcript_id "g401.t1"; gene_id "g401"; # protein sequence = [MGFNRDDPDSSIEFEGGSTDGVLEKGKRKSISTVGLGRPSTSKASTATSNGHASNSKPASSMSSSSELLAQSKMSQFL # PVGTGPGLKKKNKTAVVMRGGRLGMSMQTGTGNRFPVGPGSLGSRGKKASQRTTLPSVVASPVKGGGYVHQDNDVEMSDGEATKLDISMSGNQSDMDI # SELEAVMGGSREGKAREMGNGLNRPPVTLSQSMSALPNTTTMELMGPPPPPTSPPRRAGLRSSSSSYPSSGNTSQPQAPPKFVPELTVLEGCTVFVDV # WMSDGQDTSSLYIDIAKNLGARVCGPLKHFFASLILSCQVVKRIGPQCTHVVYTSGRERTVEQYLFVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g401 ### # start gene g402 3 AUGUSTUS gene 1240238 1240789 0.96 + . g402 3 AUGUSTUS transcript 1240238 1240789 0.96 + . g402.t1 3 AUGUSTUS start_codon 1240238 1240240 . + 0 transcript_id "g402.t1"; gene_id "g402"; 3 AUGUSTUS CDS 1240238 1240789 0.96 + 0 transcript_id "g402.t1"; gene_id "g402"; 3 AUGUSTUS stop_codon 1240787 1240789 . + 0 transcript_id "g402.t1"; gene_id "g402"; # protein sequence = [MSIIYIDEATGSDTTGQGTEAQPYQSLAFAIFTTADAKYLIRKDANTSYDEPTQSAIKKGKKGADGLEKKRKKAEELA # EREAKEKGEEREKRERLLEESKSIVLIEDTSLAKAIKVFNNYFFILNVVYHELCSRQRYHNLLNIDLNEFVSSAGSTVYDNKKTSPLLLYAMVQDIFK # LFFQAAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g402 ### # start gene g403 3 AUGUSTUS gene 1240897 1242027 0.53 + . g403 3 AUGUSTUS transcript 1240897 1242027 0.53 + . g403.t1 3 AUGUSTUS start_codon 1240897 1240899 . + 0 transcript_id "g403.t1"; gene_id "g403"; 3 AUGUSTUS CDS 1240897 1241019 0.58 + 0 transcript_id "g403.t1"; gene_id "g403"; 3 AUGUSTUS CDS 1241560 1242027 0.56 + 0 transcript_id "g403.t1"; gene_id "g403"; 3 AUGUSTUS stop_codon 1242025 1242027 . + 0 transcript_id "g403.t1"; gene_id "g403"; # protein sequence = [MLQVVPEGKTAPGGHELIVDHWQLVGAAPGAEDAFTNRLNESYLSCKRRFFSFQICESVDILLADPSSAALIKQLNPK # FQPPARPFLRLSYVDAITWLNEHGIKRPEEDKDGNAIKDENGKDIMVEHAVGDDIAEAAERQMTDIIGKPVFLYGFPAELKAFYMKRMPKKEGSNAVF # TESCDLLMPNVGEIVGKNIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g403 ### # start gene g404 3 AUGUSTUS gene 1242681 1243353 0.27 - . g404 3 AUGUSTUS transcript 1242681 1243353 0.27 - . g404.t1 3 AUGUSTUS stop_codon 1242681 1242683 . - 0 transcript_id "g404.t1"; gene_id "g404"; 3 AUGUSTUS CDS 1242681 1242953 1 - 0 transcript_id "g404.t1"; gene_id "g404"; 3 AUGUSTUS CDS 1243060 1243164 0.53 - 0 transcript_id "g404.t1"; gene_id "g404"; 3 AUGUSTUS CDS 1243309 1243353 0.46 - 0 transcript_id "g404.t1"; gene_id "g404"; 3 AUGUSTUS start_codon 1243351 1243353 . - 0 transcript_id "g404.t1"; gene_id "g404"; # protein sequence = [MLLVDSLDPQSILFPVLFIHGDADKVTSAKATQTFFKVIDAEDKQIIIYPDGLHELQNEPPSIRQKFVTDIVSFVQGR # TSTPVAQPNSTHEHTGSNDNNAGVTVALPISSSSAPNSTDPNTQSSLEIDRDGDDMKVTPKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g404 ### # start gene g405 3 AUGUSTUS gene 1257150 1258922 1 + . g405 3 AUGUSTUS transcript 1257150 1258922 1 + . g405.t1 3 AUGUSTUS start_codon 1257150 1257152 . + 0 transcript_id "g405.t1"; gene_id "g405"; 3 AUGUSTUS CDS 1257150 1258922 1 + 0 transcript_id "g405.t1"; gene_id "g405"; 3 AUGUSTUS stop_codon 1258920 1258922 . + 0 transcript_id "g405.t1"; gene_id "g405"; # protein sequence = [MTARPTTSAGGRPTTSAGGQSEFSGFSNGFEGHGDYPYDVNGQYVVGHKYSPQYPTQYEGEYMDDDEDEEEDVSEDED # VFAFGVPEVEAQPSMATSTALANMAVYPSPVSDAPYQHPPSTTQQTVSSPPSSQPLSSAEESGYRMERLNLGPTTPSTHHLSSKEEEASIFPTPSTSP # SSLSAAPSIKLSFSSYLSTASVEEDSPFPEVRASVSNIDDPEMPAMTFRMWIVGLSLCMLSAALNVFFNFRSPAPSVVPNVLLLLGYPMGKGLSFLLP # IRTFRIPLPRWPAWMKKKTADSSSMDFPSPPPSFTFSLNPGPWNIKEHGLVFIMGNVAISSPYAINAIVVSEIYYNQIWGYWFSLVLVLATQLTGFGL # AGLCRRFLVWPASMVWPQNLVACTLLNTLHAEEEGEDLEDDEESRRWEATQSGQHGVDVGGLPSSSAIPEPHKPIKRRKFASAAPITFLSKFSTSLNP # FAPQAPASSSDITNLNNLSTLPTLPTLSNLTALSSTQKRRTRRPITRYRFFLYITLFNFIFFFLPGFLFTALSIFSFICWAVPENVVVNQLFGVYSGM # GMSVVTADWTQVNSLVEVRMVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g405 ### # start gene g406 3 AUGUSTUS gene 1272664 1273188 0.43 + . g406 3 AUGUSTUS transcript 1272664 1273188 0.43 + . g406.t1 3 AUGUSTUS start_codon 1272664 1272666 . + 0 transcript_id "g406.t1"; gene_id "g406"; 3 AUGUSTUS CDS 1272664 1273188 0.43 + 0 transcript_id "g406.t1"; gene_id "g406"; 3 AUGUSTUS stop_codon 1273186 1273188 . + 0 transcript_id "g406.t1"; gene_id "g406"; # protein sequence = [MADIRELRLDSWRNAIGIVPQDPVLFTGTIASNIAFGNPTATREQIEDAAREANCEFVWGMPKGFDTESKWYPGSQFI # HMTVNGPFPVGRLSLSGGQRQRLAIARALLKKPAILALDEATSALDANSENRVNDAVDKILRKRQTTCLFVAHRLSTIARAERIVVLEGSYLAFFQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g406 ### # start gene g407 3 AUGUSTUS gene 1274524 1276264 0.26 + . g407 3 AUGUSTUS transcript 1274524 1276264 0.26 + . g407.t1 3 AUGUSTUS start_codon 1274524 1274526 . + 0 transcript_id "g407.t1"; gene_id "g407"; 3 AUGUSTUS CDS 1274524 1274648 0.26 + 0 transcript_id "g407.t1"; gene_id "g407"; 3 AUGUSTUS CDS 1275832 1276264 0.99 + 1 transcript_id "g407.t1"; gene_id "g407"; 3 AUGUSTUS stop_codon 1276262 1276264 . + 0 transcript_id "g407.t1"; gene_id "g407"; # protein sequence = [MDMIVKEEVQAYLQSSISSQLQQELRERKKELDEVHRDLHNSLAEYLESEPERLAAKAEAQKAKLEALERRLGIDSPS # TGAGPSRTGSSSTEQPAKLAGKKHRFDDTEYLEQSRELVDNVKSAVSAGKLPVPLIIIKANNIVALLKKKKKAKLSPTDAQSSKAQAPSKMPTPVAVP # AAPTEAVGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g407 ### # start gene g408 3 AUGUSTUS gene 1279430 1280577 0.38 + . g408 3 AUGUSTUS transcript 1279430 1280577 0.38 + . g408.t1 3 AUGUSTUS start_codon 1279430 1279432 . + 0 transcript_id "g408.t1"; gene_id "g408"; 3 AUGUSTUS CDS 1279430 1279991 0.43 + 0 transcript_id "g408.t1"; gene_id "g408"; 3 AUGUSTUS CDS 1280078 1280577 0.65 + 2 transcript_id "g408.t1"; gene_id "g408"; 3 AUGUSTUS stop_codon 1280575 1280577 . + 0 transcript_id "g408.t1"; gene_id "g408"; # protein sequence = [MFAGSPLNRLSWLRTSHSFLNSIIVSPKSRWLLFKSGNPLTSKSEGKSILAYLSTKDVGPFIGEAPHFGQGKESGLLT # SEEQITATEGVRHRGSPIVFLGLHENTSSGSGALPSSDFIDAEKAVAKLEGVPYFAMDVADLEMEDSAIETALKETEVTKAGTTLTWLDARSVMTNAN # LFDGAIFAEARILSRLWFTTTFTLGWLEVWMFYAHALVRQHWSQTMSVWVCLPISILPQLNHQHCFNSKGLHNFTHPRSDPVVIMLAVDETGEKILLG # QNVSHLSRSLFCCSYSPFSNLQNRFKGQFYSALAGFIEPGETFEDAVKREMWEEAGVKAWDVQYHSGQPWVRELYSPWT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g408 ### # start gene g409 3 AUGUSTUS gene 1281158 1282249 0.72 - . g409 3 AUGUSTUS transcript 1281158 1282249 0.72 - . g409.t1 3 AUGUSTUS stop_codon 1281158 1281160 . - 0 transcript_id "g409.t1"; gene_id "g409"; 3 AUGUSTUS CDS 1281158 1282249 0.72 - 0 transcript_id "g409.t1"; gene_id "g409"; 3 AUGUSTUS start_codon 1282247 1282249 . - 0 transcript_id "g409.t1"; gene_id "g409"; # protein sequence = [MQLIPIQANTNLINIANNIRNVCNATLSLLFTASLFIWGLLVNRSQAWRTDGGTAVFGASALSLAMVSTALNFLYVPK # NEEYVWLPGLIWAVILWQSFLGWWWWVGAGNGQSTEDAVEQVFRRGDKFWKKRRKAKSKKDNIKSTSQRGTDPECSDEHVASVSGRSSLSDDSTSHSR # TISAGASAESPPVRRRARRARSSGSATSMSTEESITTLPRFLPQTVHAWYNNLRQAHVTAARRQTVERVERIREIERGRMDSSGEVPSGWGLGSFGWK # VGRSQVAQYEMESNPRRRRRSDEREQRGTGSEDDFNNIHYPPSSSAKLNKQNTTTSPRHSTRVEDSRPKSIWWWGPLNRWRLQDSTTYH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g409 ### # start gene g410 3 AUGUSTUS gene 1285653 1286590 0.52 + . g410 3 AUGUSTUS transcript 1285653 1286590 0.52 + . g410.t1 3 AUGUSTUS start_codon 1285653 1285655 . + 0 transcript_id "g410.t1"; gene_id "g410"; 3 AUGUSTUS CDS 1285653 1285671 0.52 + 0 transcript_id "g410.t1"; gene_id "g410"; 3 AUGUSTUS CDS 1285752 1286590 1 + 2 transcript_id "g410.t1"; gene_id "g410"; 3 AUGUSTUS stop_codon 1286588 1286590 . + 0 transcript_id "g410.t1"; gene_id "g410"; # protein sequence = [MNFAFNVNFGSPTLFNASTAFYAIDGNTGVNFDLPGSAKSQNTGNYSNIINYPLFTASNLSTSPHNIEVATSYNGSKT # PQYLSIDYFIVKTNPANSTSLEHASNSSSIDSTSRSHSNVASIVGGVIGGVIGLAALLSLLYYLRKRKQDQYSGMMLDITGGGPGYYRSSAFGGDTLE # VTPFITSAAPPGTTHIPMKYAAAQDSTAYTGLPSASSSAAGSSSSSGHPEHSSGWDSNRFVMSKRPRILQVEDEQLQRSQIHQHDDSGVRIPPRDDGM # IDDVPPTYTES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g410 ### # start gene g411 3 AUGUSTUS gene 1287500 1289108 0.23 + . g411 3 AUGUSTUS transcript 1287500 1289108 0.23 + . g411.t1 3 AUGUSTUS start_codon 1287500 1287502 . + 0 transcript_id "g411.t1"; gene_id "g411"; 3 AUGUSTUS CDS 1287500 1287662 0.35 + 0 transcript_id "g411.t1"; gene_id "g411"; 3 AUGUSTUS CDS 1287761 1288135 0.52 + 2 transcript_id "g411.t1"; gene_id "g411"; 3 AUGUSTUS CDS 1288210 1289108 0.66 + 2 transcript_id "g411.t1"; gene_id "g411"; 3 AUGUSTUS stop_codon 1289106 1289108 . + 0 transcript_id "g411.t1"; gene_id "g411"; # protein sequence = [MTTPDTAVPRLVVVDDTDPSIQYTPSSAFSKDSAGKLDGQGYGGPVFNHTLTGLRTFVRAMVAAEGIYGWYCNVDNHL # ITSFTVDTSQVTNYIACDSEGTLSGTTSEHTLVVNFFFYPDSPTTSSLWLDSIQYQPLPSDPLDAVTLRIHNSDPSISYSNSSGGWSFQGLNSNATDL # TGTSTSTTLYSVNFGSPTEYNATTAFYTIDGKSTDFDLPGSAKTSNSGGNYTNISNWPLFTLADLSASQHNLNVATSYNSTPQPQYLSIEYFIIQTNP # SNSSSTEGSSNSTGVGSSSGGSSSSHSTPVGAIVGGVVGGVVGLAAIILALYFFFRRRRRSAHHSPGMLDLSAGTPPLGHYGPNSGGSIINSPPPMQS # VSSSGRPGSGAFSPDALYRDGTSPPHSPSAVMDSSVAGSVAGSSSRASQSGPDSGRLVSMKNAQSLKVRDEQLRRSELRLHTDSGVRLPAPNEREVID # VPPTYTED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g411 ### # start gene g412 3 AUGUSTUS gene 1289546 1289965 0.48 + . g412 3 AUGUSTUS transcript 1289546 1289965 0.48 + . g412.t1 3 AUGUSTUS start_codon 1289546 1289548 . + 0 transcript_id "g412.t1"; gene_id "g412"; 3 AUGUSTUS CDS 1289546 1289965 0.48 + 0 transcript_id "g412.t1"; gene_id "g412"; 3 AUGUSTUS stop_codon 1289963 1289965 . + 0 transcript_id "g412.t1"; gene_id "g412"; # protein sequence = [MVQKDRLESFYDKEVIVADRDLVECGSDEILKDADKEDVCLLVVGDPFGATTHTDILLRARHLGIPTRVIHNASIMNA # IGASGLQLYNFGQTVSLVFFTETWKPDSFYDRIKENTEGGLHTLLLLDIKVKEQNEENLAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g412 ### # start gene g413 3 AUGUSTUS gene 1290037 1290435 0.6 + . g413 3 AUGUSTUS transcript 1290037 1290435 0.6 + . g413.t1 3 AUGUSTUS start_codon 1290037 1290039 . + 0 transcript_id "g413.t1"; gene_id "g413"; 3 AUGUSTUS CDS 1290037 1290435 0.6 + 0 transcript_id "g413.t1"; gene_id "g413"; 3 AUGUSTUS stop_codon 1290433 1290435 . + 0 transcript_id "g413.t1"; gene_id "g413"; # protein sequence = [MTIQQAVTQLLEIEAFRKEGVLDADKTLAVAMSRVGGLDDQRILAGPLSSFLRAPPDAFGPPLHSMIIVGRRLHHLEV # EYGEVFAEALGEAIALSRFDMEGEGKEEHREKGKKEGRGRWREVASKVYGVALD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g413 ### # start gene g414 3 AUGUSTUS gene 1291249 1291683 0.74 + . g414 3 AUGUSTUS transcript 1291249 1291683 0.74 + . g414.t1 3 AUGUSTUS start_codon 1291249 1291251 . + 0 transcript_id "g414.t1"; gene_id "g414"; 3 AUGUSTUS CDS 1291249 1291683 0.74 + 0 transcript_id "g414.t1"; gene_id "g414"; 3 AUGUSTUS stop_codon 1291681 1291683 . + 0 transcript_id "g414.t1"; gene_id "g414"; # protein sequence = [MHWPSRAKNVVLVRFYTIPTPLISYRCLSVSLSATGTATTGSFSATGINTSSVTTTTSQASSTSASGSSVSAASSGSS # SGSSSGSATSSHSSGSGSSSTSSSTASTSATSSSSSGADKIAFFSTAGVMALGVVAFGFGLGNGLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g414 ### # start gene g415 3 AUGUSTUS gene 1295246 1296584 0.69 + . g415 3 AUGUSTUS transcript 1295246 1296584 0.69 + . g415.t1 3 AUGUSTUS start_codon 1295246 1295248 . + 0 transcript_id "g415.t1"; gene_id "g415"; 3 AUGUSTUS CDS 1295246 1295457 0.8 + 0 transcript_id "g415.t1"; gene_id "g415"; 3 AUGUSTUS CDS 1295762 1296584 1 + 1 transcript_id "g415.t1"; gene_id "g415"; 3 AUGUSTUS stop_codon 1296582 1296584 . + 0 transcript_id "g415.t1"; gene_id "g415"; # protein sequence = [MQGKDSLVIENAEGVRTTPSVVAFTKHGERLVGLPAKRQAVVNSANTVYAFKRLIGRMYKDQEVQDDMKHCHAVITVP # AYFNDAQRQATKDAGQIAGLDVLRVINEPTAAALAYGLDKNDSSIIAVYDLGGGTFDISILEMQKGVFEVKSTNGDTHLGGEDFDIVLVEHLLNEFKK # ESGIDLSGDRMAIQRIREAAEKAKIELSSTTQTEINLPFITADASGPKHINTKLLRSQFESLVDPLVKRTTDPCKKALSDAGVKASEINDVILVGGMT # RMPRVGETVKSIFGREPSKGVNPDEAVAKGAAIQGGVLAGSVTDILLLDVTPLSLGKLLYLLYMVSVQFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g415 ### # start gene g416 3 AUGUSTUS gene 1296725 1297144 0.42 + . g416 3 AUGUSTUS transcript 1296725 1297144 0.42 + . g416.t1 3 AUGUSTUS start_codon 1296725 1296727 . + 0 transcript_id "g416.t1"; gene_id "g416"; 3 AUGUSTUS CDS 1296725 1296827 0.65 + 0 transcript_id "g416.t1"; gene_id "g416"; 3 AUGUSTUS CDS 1296882 1297144 0.7 + 2 transcript_id "g416.t1"; gene_id "g416"; 3 AUGUSTUS stop_codon 1297142 1297144 . + 0 transcript_id "g416.t1"; gene_id "g416"; # protein sequence = [MVRDNKLLGNFNLVGIPPAPKGVPQIEITFDIDADGIVNVAAKDKATNKDQSMTIASSSGLSDKDIEKMVSDAEQFAE # SDKARRSLIEEANKADSVCADTEKGTSSLVVNILASHVFHSYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g416 ### # start gene g417 3 AUGUSTUS gene 1298741 1299148 0.3 + . g417 3 AUGUSTUS transcript 1298741 1299148 0.3 + . g417.t1 3 AUGUSTUS start_codon 1298741 1298743 . + 0 transcript_id "g417.t1"; gene_id "g417"; 3 AUGUSTUS CDS 1298741 1299148 0.3 + 0 transcript_id "g417.t1"; gene_id "g417"; 3 AUGUSTUS stop_codon 1299146 1299148 . + 0 transcript_id "g417.t1"; gene_id "g417"; # protein sequence = [MSLLVIEKLGGLLELGKPLPNGAEYVFRVLFPENMFNRSHIRSDLNDVGSDLAKLHILHSDLRWENILSVLPPSEGGL # PSLPSPFTGKIYGWRLVDFDLAKRTTHHITFAQGHYIGHMERVLSCIPMGIPVQPWE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g417 ### # start gene g418 3 AUGUSTUS gene 1301285 1302397 0.46 + . g418 3 AUGUSTUS transcript 1301285 1302397 0.46 + . g418.t1 3 AUGUSTUS start_codon 1301285 1301287 . + 0 transcript_id "g418.t1"; gene_id "g418"; 3 AUGUSTUS CDS 1301285 1302397 0.46 + 0 transcript_id "g418.t1"; gene_id "g418"; 3 AUGUSTUS stop_codon 1302395 1302397 . + 0 transcript_id "g418.t1"; gene_id "g418"; # protein sequence = [MANRNLVDGLNITNKDVRGMCEDCLYGKAVRRPFDEVLTHEAEVLERVHMDLFGPARTPTRGGATYLMLCTDGRSSFR # VPYYLNNKRKETGLKALHEYRVMAEKQTGKKLRIIRIDGGGELNNGLVDEYCKEHGIIIEKVPHDSSAANGVAEQSFRTVMDGTRTLLEEASLPYSFW # GEASNTFVYTNNFIPSARFPDTVPVEAWTQKRHDVSHLRPFGCDCWATLPRRRTDGKLGRQAVKGKLLGYMGRRGYRLWIPETKKIEESHDVTFEEGT # PHRTRPAPEDTNEQEWGEEVGQPTTPQDPRTGNPATDTANDGNGDQQQNEPNQLPAETYPEIDNQPQVRDLPEPPRRSGREPVPSRRYLESEEYRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g418 ### # start gene g419 3 AUGUSTUS gene 1303682 1306987 0.94 + . g419 3 AUGUSTUS transcript 1303682 1306987 0.94 + . g419.t1 3 AUGUSTUS start_codon 1303682 1303684 . + 0 transcript_id "g419.t1"; gene_id "g419"; 3 AUGUSTUS CDS 1303682 1306987 0.94 + 0 transcript_id "g419.t1"; gene_id "g419"; 3 AUGUSTUS stop_codon 1306985 1306987 . + 0 transcript_id "g419.t1"; gene_id "g419"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRASSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIQIQECIPEDVAMVLREVLESMGIKK # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGKAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMR # HMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKH # SSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSN # PSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVSPQGAPFGTPFVTGAQMNRPGMAFESARSQESIAMIQQQARVIETLQEQLREVKKGFTAG # EVPTGGPLFKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEY # GRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRRE # EDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYA # REKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g419 ### # start gene g420 3 AUGUSTUS gene 1307051 1307983 0.3 + . g420 3 AUGUSTUS transcript 1307051 1307983 0.3 + . g420.t1 3 AUGUSTUS start_codon 1307051 1307053 . + 0 transcript_id "g420.t1"; gene_id "g420"; 3 AUGUSTUS CDS 1307051 1307983 0.3 + 0 transcript_id "g420.t1"; gene_id "g420"; 3 AUGUSTUS stop_codon 1307981 1307983 . + 0 transcript_id "g420.t1"; gene_id "g420"; # protein sequence = [MKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLR # NLHGEKVLQGWLSRFPGLELAPEAPYKSPLRRERDPADVWTSNPKPVVTGRFQSRPNWKEGRQRASAAWGEGESYDSESREEDEDCCHCKDGGEWTEA # VLRAGVTDTGRKWTPEERAEKWRRRRQELCMRCGRKEHWAKDCPNPESLERPAEDQGSSERASKANSTRGRGTANQGGGHKDDSTRPLERIRAGIVVE # EREGMDDLWNVHILDSPKEGEQQLLDEVGNGQGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g420 ### # start gene g421 3 AUGUSTUS gene 1308400 1312374 0.88 + . g421 3 AUGUSTUS transcript 1308400 1312374 0.88 + . g421.t1 3 AUGUSTUS start_codon 1308400 1308402 . + 0 transcript_id "g421.t1"; gene_id "g421"; 3 AUGUSTUS CDS 1308400 1312374 0.88 + 0 transcript_id "g421.t1"; gene_id "g421"; 3 AUGUSTUS stop_codon 1312372 1312374 . + 0 transcript_id "g421.t1"; gene_id "g421"; # protein sequence = [MHNPVIDWKELCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTPQSPPEAPQQPPEAPQPPPEVPQ # QTPEAPLRAPRTRVKLEEVKDEEYEASQPGPHKLFPSDKDLGPDDPILMGINEWLAFTNESTEEEVEEILEAGRSTMEKVTPNPAKDSEEAYQKWKSR # DTERSSSWPGAKQKVQWRKKRREHGPYPDLPTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIVGTHVVERRSDPTIQGKPISLIGAAGMDHLLR # EGTPAYFLHISPTKEESPTEEMLRASDSSVTEGVQQPKDPESGDPSSEQGGVVRELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPY # DIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIF # TKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEASHVGHVRKVLERLRANHLHA # KPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFS # EAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTT # TKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALRRI # ARNEEESLIWEDGLIKRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHPCLRAKASRSKPYGNLRPLPIG # QRPWSSISLDHITQLPATAGPEKYDAILVVVCRLTKQAIYVPCHTTNNAEDFANLFITHVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLST # AYHPQTDGQTERVNQSVEAYLRIYCAYDQDDWDLLLPIAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLERVQGAEVNEYAANLKELHTYLQERIRT # ANEVYTKYANQKRQEAPDWKEGDRVWLNMENVKTRRPMKKLDHKWTGPYSILSQVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFPDKFRRQNSPPPPI # FVKGESEHFVESILDSKPIKGKPEEVEYLVKWEGYDEDFNSWVGWEGMAGSLELMKQWHREHNRKRKPKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g421 ### # start gene g422 3 AUGUSTUS gene 1315418 1315633 0.61 - . g422 3 AUGUSTUS transcript 1315418 1315633 0.61 - . g422.t1 3 AUGUSTUS stop_codon 1315418 1315420 . - 0 transcript_id "g422.t1"; gene_id "g422"; 3 AUGUSTUS CDS 1315418 1315633 0.61 - 0 transcript_id "g422.t1"; gene_id "g422"; 3 AUGUSTUS start_codon 1315631 1315633 . - 0 transcript_id "g422.t1"; gene_id "g422"; # protein sequence = [MAEEVGLEALESSTTLTVVLGLGSFLSTETLVEDEAREAETADGNPLKSSLSESLERVEPGDETESKIKIK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g422 ### # start gene g423 3 AUGUSTUS gene 1319845 1320690 0.75 - . g423 3 AUGUSTUS transcript 1319845 1320690 0.75 - . g423.t1 3 AUGUSTUS stop_codon 1319845 1319847 . - 0 transcript_id "g423.t1"; gene_id "g423"; 3 AUGUSTUS CDS 1319845 1320690 0.75 - 0 transcript_id "g423.t1"; gene_id "g423"; 3 AUGUSTUS start_codon 1320688 1320690 . - 0 transcript_id "g423.t1"; gene_id "g423"; # protein sequence = [MLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTG # AEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPR # YRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEE # LSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g423 ### # start gene g424 3 AUGUSTUS gene 1321127 1325624 0.17 - . g424 3 AUGUSTUS transcript 1321127 1325624 0.17 - . g424.t1 3 AUGUSTUS stop_codon 1321127 1321129 . - 0 transcript_id "g424.t1"; gene_id "g424"; 3 AUGUSTUS CDS 1321127 1323565 0.52 - 0 transcript_id "g424.t1"; gene_id "g424"; 3 AUGUSTUS CDS 1323649 1324118 0.32 - 2 transcript_id "g424.t1"; gene_id "g424"; 3 AUGUSTUS CDS 1324193 1325624 0.74 - 0 transcript_id "g424.t1"; gene_id "g424"; 3 AUGUSTUS start_codon 1325622 1325624 . - 0 transcript_id "g424.t1"; gene_id "g424"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKFIPSSRPTNQINDEHRPYDHVQPRTYRPIQSNTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIKMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDSEKSTGEHDSK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDDQAEEIIDCYLNQKKIGDKQVFCVWRDGVLGEFDDQLNNEQFNLNPIKSFFLQNGRIKP # KPVRKKVQKRRFVEPILQNFSLGENCDKSESTETAQNQCNNANTSETIRDDNWNKPKNSQRTRKRIARKKGKAQDSKDKKENVQADVVTEPPTNKLEE # RIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIKRHIHGDPLLELPELSKHPKPFVPTGRYTEERKE # IIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWF # CVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVT # YILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHLQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHI # AQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQ # IDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATH # GPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESK # DATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKYERIKFIRLIKSFRWTTKEGCTIGILINLINHN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g424 ### # start gene g425 3 AUGUSTUS gene 1325654 1328642 0.31 - . g425 3 AUGUSTUS transcript 1325654 1328642 0.31 - . g425.t1 3 AUGUSTUS stop_codon 1325654 1325656 . - 0 transcript_id "g425.t1"; gene_id "g425"; 3 AUGUSTUS CDS 1325654 1327623 0.48 - 2 transcript_id "g425.t1"; gene_id "g425"; 3 AUGUSTUS CDS 1328627 1328642 0.39 - 0 transcript_id "g425.t1"; gene_id "g425"; 3 AUGUSTUS start_codon 1328640 1328642 . - 0 transcript_id "g425.t1"; gene_id "g425"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQITTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDLEEDRIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRTVKSLQ # SHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPKSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLR # DNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g425 ### # start gene g426 3 AUGUSTUS gene 1329697 1331335 0.88 - . g426 3 AUGUSTUS transcript 1329697 1331335 0.88 - . g426.t1 3 AUGUSTUS stop_codon 1329697 1329699 . - 0 transcript_id "g426.t1"; gene_id "g426"; 3 AUGUSTUS CDS 1329697 1330914 0.88 - 0 transcript_id "g426.t1"; gene_id "g426"; 3 AUGUSTUS CDS 1331048 1331335 0.98 - 0 transcript_id "g426.t1"; gene_id "g426"; 3 AUGUSTUS start_codon 1331333 1331335 . - 0 transcript_id "g426.t1"; gene_id "g426"; # protein sequence = [MRPYPRSQASSALRVENDRLKAEVEEFRTLLAQSRGQVSTLTSLLRDTSSSLDLRSQELEASRRSLEEVARERVEYQR # VLSQFQAIEAELPEPASEEIGELRKQVDDASSRSSDAYAELDSANARALRQRDRLEELEEMVCSYRDRAHVAEGLIRQYPEDEGLYEVELPSLSEVQR # KLDASEALVRRLATFAHRLYRADPANLLHYHNRYVGGLLEAITLLLYRGLHHTPERLSSVVDFVLGYLSQARFTHGELHLRSTSSLLYYYSNAADRVE # GLYREMLTHSRFPSHDAFLTAAQHAGYVDARPGSLEPPLHRRFFSFDHPIPIAPSSTSDHLPAVPAMDSIMVSWERLIANYIRDMIDTPGPHYFFPTS # ADLTVVGGGSSPVEGSVLAEEDDENAPREVVEVAGEVGANVATPAEEDDRGLPVGGSETPAMARTPLFLLASRSPSSPLLPPSVPVVPHIIDLTMIDD # DGEDLYESREEFEARMQGEVAVKDERSSPVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g426 ### # start gene g427 3 AUGUSTUS gene 1342316 1343317 0.98 + . g427 3 AUGUSTUS transcript 1342316 1343317 0.98 + . g427.t1 3 AUGUSTUS start_codon 1342316 1342318 . + 0 transcript_id "g427.t1"; gene_id "g427"; 3 AUGUSTUS CDS 1342316 1343317 0.98 + 0 transcript_id "g427.t1"; gene_id "g427"; 3 AUGUSTUS stop_codon 1343315 1343317 . + 0 transcript_id "g427.t1"; gene_id "g427"; # protein sequence = [MRNPHSRKRYGLLQLLRLILNASVALYNQDKTEQEVSLQSQVLNRYIDHLGSSSLHSFKQEKLRSELNSLDLRRKKAE # EATKEHLKLLEICNAEDIEKRVSQVQRNVEVLETEVIPALRELLASLEPPMESERNPLNLKLDNLYINMQRIALDLGISMEGPFTQVVEGPASINLTR # ADHNYGVDDTVMDSFVNWDGGLPDTSVSDSVDGESNVNTLHLSFPSHVPPSTPKFSKTVGTMTHFNGHFSYPMVADTSTNPSVGSNLHQEEAETKETE # PDRRLEIPNCIALLLDKRKRVKNLQEETEYMKKLISKVRRVQAPHVSRIEFSRSYKNKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g427 ### # start gene g428 3 AUGUSTUS gene 1352227 1353279 0.67 - . g428 3 AUGUSTUS transcript 1352227 1353279 0.67 - . g428.t1 3 AUGUSTUS stop_codon 1352227 1352229 . - 0 transcript_id "g428.t1"; gene_id "g428"; 3 AUGUSTUS CDS 1352227 1353279 0.67 - 0 transcript_id "g428.t1"; gene_id "g428"; 3 AUGUSTUS start_codon 1353277 1353279 . - 0 transcript_id "g428.t1"; gene_id "g428"; # protein sequence = [MTRLNHVGCIPLTLARGINAGSRNRTQVATVVQEMTIGHNQFPRLRIVRRSNDLWFNLRNYACMDSGHGWRTTGGGNH # AIHSVLPLPDSPQQVNAIQSLWAWHQARCASPNTCPVENEQEVQDEVQKQLLMPLQLLLQVNLFRRWIEWVLLTGDIQTRYPMDLCLYIRQNLPIFWD # RLKHSQLTNPEVFRGVDHDTSGNYPRWGRPTIETNLGRTIYKQKSAGYSDHILYLGANKQCVAAVVEVKTFWAYDSSDMFHISELDNSQHYHPLSIFE # FGHPHYSNIFEWNGDNVSTDAIKQARKMLIQHQQMLIFQLDPCYRFGVRWCSMVANLQLGPMANISLSLPEQDMQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g428 ### # start gene g429 3 AUGUSTUS gene 1356930 1359979 0.31 + . g429 3 AUGUSTUS transcript 1356930 1359979 0.31 + . g429.t1 3 AUGUSTUS start_codon 1356930 1356932 . + 0 transcript_id "g429.t1"; gene_id "g429"; 3 AUGUSTUS CDS 1356930 1359044 0.31 + 0 transcript_id "g429.t1"; gene_id "g429"; 3 AUGUSTUS CDS 1359137 1359979 0.89 + 0 transcript_id "g429.t1"; gene_id "g429"; 3 AUGUSTUS stop_codon 1359977 1359979 . + 0 transcript_id "g429.t1"; gene_id "g429"; # protein sequence = [MSIPEQSFGDETASNIRTPEGRQPEVQGPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQL # DMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAVSEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIH # HSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEILGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLD # PERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRILYRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDA # NAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVHNGQTVYTYTPMRHMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFR # RRLVADNRGTSYMVQCEPESVGEFPPEQFDQKRQLHGSDGRFLAQKHSSPRSIEVPEFFNPGNTATRSPQLRSGTSPTVHALAQNSTPPPRVNLQTKP # VTPVSTQRYQFGEVRMDGAQHSSRIYGQDLTARLVPNPVHVPPRLSNPSVIPYQGSVSMQSHAVGAESQRDPNQRRTLVVHEEAVPPQGAPLGTPFVT # GAQTNRPGMVVDSAHSQESVAMIQQQARVIETLQEQLREGNERIYEGGPSPVVPQPRSWQATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPSVDRRR # IHEWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPPSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGS # DEGEQNQSGRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHVRQLLDLPTRDEVRGRATKKKIGLPLSRSSTSVRSKASQVTTGLHGRRG # SSVWKGCLEYGLPSMLGKRTMRFRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g429 ### # start gene g430 3 AUGUSTUS gene 1362287 1365535 1 + . g430 3 AUGUSTUS transcript 1362287 1365535 1 + . g430.t1 3 AUGUSTUS start_codon 1362287 1362289 . + 0 transcript_id "g430.t1"; gene_id "g430"; 3 AUGUSTUS CDS 1362287 1365535 1 + 0 transcript_id "g430.t1"; gene_id "g430"; 3 AUGUSTUS stop_codon 1365533 1365535 . + 0 transcript_id "g430.t1"; gene_id "g430"; # protein sequence = [MDRLLREGAPAYFLHISPTKEESPTQEILRASDSNDPERVQQPKDPESGNPSPGQGGVVKELDEEVSKRQETEELKKS # IPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDTIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALN # KITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILI # YSDDEESHVEHVRKVLERLQANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTK # LLRKDSVWSWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQ # WRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATIL # MNEDLLVNRVREAPKDTTIIEALRRIARNEEESIVWEDGLIKRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYV # RSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPATAGPEKYDAILVAVCRLTKQAIYVPCHTTDNAEDFANLFITHVFSKHGMPSDITS # DRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQAVEAYLRIYCSYDQDDWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPRLSITLEQ # VQGAEVNEYASNLKRLHAYLQERIRVANEVYAKYANQKHQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTILSKVGSHAYQLDLPGNLHKIH # NVFHVDRLKPHFHDKFKRQTSPPPPVFIKGKTEHFVESILDSKPIQGRPEEIEYLVKWEGYGDEFNSWVEWEGMAGSTDLLRSWHKTHSRKRRPLQTH # WDLLEREAQEDEEDTLEEGRGYRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g430 ### # start gene g431 3 AUGUSTUS gene 1365765 1366970 0.97 - . g431 3 AUGUSTUS transcript 1365765 1366970 0.97 - . g431.t1 3 AUGUSTUS stop_codon 1365765 1365767 . - 0 transcript_id "g431.t1"; gene_id "g431"; 3 AUGUSTUS CDS 1365765 1366970 0.97 - 0 transcript_id "g431.t1"; gene_id "g431"; 3 AUGUSTUS start_codon 1366968 1366970 . - 0 transcript_id "g431.t1"; gene_id "g431"; # protein sequence = [MVEEELRIAKKDRDAAAEQLSTSSRKIAELTTTLLYQQGIVDESNALATRQRVRLEELQEEVHRSRGRAAFVEQMIQE # YPDEGFYEVVLPPLSELEGELVSIRADLRRVATLAHRLYRSDPATVLHHHDRYIGAIIEAVVAFLRRGLDSDDPDVAAHNFRLALDYMQSARGIHGDL # YMRSISSIQWFFHNAVDQDEGLYRLVLEHSRFDNDGSFLTASQHAGFVAPPPDSLEPPLHRRMLALSTALPHREGAGRWDDIVPAIPSDDQLTIDWEQ # LMLRYIHHITDTPLPAPAVPVPMVVEPEVNSSDAVVDRPLEETGPLSSVGSSLQVPLFLPEQESPTSPSPPPPSPSLPPLFGSVASLSIDLTGDDDEL # YETGVAPMGPEAREVEASASEGLVKEEQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g431 ### # start gene g432 3 AUGUSTUS gene 1367006 1367818 0.58 - . g432 3 AUGUSTUS transcript 1367006 1367818 0.58 - . g432.t1 3 AUGUSTUS stop_codon 1367006 1367008 . - 0 transcript_id "g432.t1"; gene_id "g432"; 3 AUGUSTUS CDS 1367006 1367818 0.58 - 0 transcript_id "g432.t1"; gene_id "g432"; 3 AUGUSTUS start_codon 1367816 1367818 . - 0 transcript_id "g432.t1"; gene_id "g432"; # protein sequence = [MLDEQDEVTADQQELQKFLALQQDEASVAAKRKRVRSPLPVAGPSTKKVRLEVSKKRSRRRAPGIEVDTEPPRRVLLV # VPPSRSSVTSTIAPVPPPALSSPMEVSIRDVPVQGSSGLVQLATIAEAHSGLARRPASPPVPQVPIKGGESDLLSSNMPPLPRSTLVPRVLTAHPYRA # ENQRLAAQVRLLESQLADSRRENSSLTTALRDTSHALEARQREVEQLRSSSQEFVRNKAEYRRIIDQFLALDRALHGSPDQVSCRVTFPLLPLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g432 ### # start gene g433 3 AUGUSTUS gene 1368522 1372238 0.63 - . g433 3 AUGUSTUS transcript 1368522 1372238 0.63 - . g433.t1 3 AUGUSTUS stop_codon 1368522 1368524 . - 0 transcript_id "g433.t1"; gene_id "g433"; 3 AUGUSTUS CDS 1368522 1372238 0.63 - 0 transcript_id "g433.t1"; gene_id "g433"; 3 AUGUSTUS start_codon 1372236 1372238 . - 0 transcript_id "g433.t1"; gene_id "g433"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEWE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDTGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g433 ### # start gene g434 3 AUGUSTUS gene 1372289 1373455 0.89 - . g434 3 AUGUSTUS transcript 1372289 1373455 0.89 - . g434.t1 3 AUGUSTUS stop_codon 1372289 1372291 . - 0 transcript_id "g434.t1"; gene_id "g434"; 3 AUGUSTUS CDS 1372289 1373455 0.89 - 0 transcript_id "g434.t1"; gene_id "g434"; 3 AUGUSTUS start_codon 1373453 1373455 . - 0 transcript_id "g434.t1"; gene_id "g434"; # protein sequence = [MSTPIPPAPNTSADDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSASTPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g434 ### # start gene g435 3 AUGUSTUS gene 1380529 1380924 0.31 + . g435 3 AUGUSTUS transcript 1380529 1380924 0.31 + . g435.t1 3 AUGUSTUS start_codon 1380529 1380531 . + 0 transcript_id "g435.t1"; gene_id "g435"; 3 AUGUSTUS CDS 1380529 1380924 0.31 + 0 transcript_id "g435.t1"; gene_id "g435"; 3 AUGUSTUS stop_codon 1380922 1380924 . + 0 transcript_id "g435.t1"; gene_id "g435"; # protein sequence = [MIHLILSQQSYSDAKDTNIMMDWSPIYDIPPHGINVAMNANWSGLAKPHSRTTHPVKYYFIDWNLSGHYDPSLGTPML # RPGYGGDQSVPEFKRNEPCNPFAVDVYCMGNVIRRRFVSVSVPIYICRSLFPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g435 ### # start gene g436 3 AUGUSTUS gene 1381564 1382978 0.97 - . g436 3 AUGUSTUS transcript 1381564 1382978 0.97 - . g436.t1 3 AUGUSTUS stop_codon 1381564 1381566 . - 0 transcript_id "g436.t1"; gene_id "g436"; 3 AUGUSTUS CDS 1381564 1382393 0.98 - 2 transcript_id "g436.t1"; gene_id "g436"; 3 AUGUSTUS CDS 1382927 1382978 0.97 - 0 transcript_id "g436.t1"; gene_id "g436"; 3 AUGUSTUS start_codon 1382976 1382978 . - 0 transcript_id "g436.t1"; gene_id "g436"; # protein sequence = [MLRKGERETTALGLRTVREKLDRHNGSSQDQDVEDEDIFVPITSNDFDVEVSNTSIDNVQSSGNCRREIIWRPSTSER # KLSYISETYSDLLFSHCSSYLDENGQLQILVPLPRRSGRSRLTTLHKCKGYLREEVTFTPDAYRNAIMVFEKPSQDEVCVICGQTVPVDEPSDYTEDK # LQNHRAASLNLSLPSSNNPDSSSDLSTLGSVAHFLDLHNIPKSLPQPPYISSDSKMLQGQSMAEFEALCRNYLSMLANNPTNDGLSPASDNIFPTQPP # EFMRKEGEPVYRLPERYII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g436 ### # start gene g437 3 AUGUSTUS gene 1384053 1384931 0.9 - . g437 3 AUGUSTUS transcript 1384053 1384931 0.9 - . g437.t1 3 AUGUSTUS stop_codon 1384053 1384055 . - 0 transcript_id "g437.t1"; gene_id "g437"; 3 AUGUSTUS CDS 1384053 1384931 0.9 - 0 transcript_id "g437.t1"; gene_id "g437"; 3 AUGUSTUS start_codon 1384929 1384931 . - 0 transcript_id "g437.t1"; gene_id "g437"; # protein sequence = [MADVVSGLTIRLPPLSQVQVKKPGPKSSIDTTVHRSTSFIILSNPALTDAEKEKAIREMALRGHFPLKPNHQPGEVER # LIRFLNEGSKMIAFGPHRIICHCGQAISLDNRTYYAWGNWNKHQSGPCPGPRSNEDKENLGSFFNANEQGLSACKVDDTKGSEEYLESDVDNARMGFD # VAATTQQRPIVQINYPVPYIEPTAFHARLTLPHDTVCDTDLSRHPLELAQVLCELPTKLVIFSPIGEDMTAVSILASMRIDALEHRRAARAGRKYSPV # GAIRPRIFPSKGQYDTDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g437 ### # start gene g438 3 AUGUSTUS gene 1388090 1388872 0.97 + . g438 3 AUGUSTUS transcript 1388090 1388872 0.97 + . g438.t1 3 AUGUSTUS start_codon 1388090 1388092 . + 0 transcript_id "g438.t1"; gene_id "g438"; 3 AUGUSTUS CDS 1388090 1388872 0.97 + 0 transcript_id "g438.t1"; gene_id "g438"; 3 AUGUSTUS stop_codon 1388870 1388872 . + 0 transcript_id "g438.t1"; gene_id "g438"; # protein sequence = [MSRNPNSLTNTYHRDTYPAISPTKPSLSQAGRTILITGGGSGIGFAIARSFAQASASRIIIVGRRASVLEEAASKLRE # EFKDSNPATEFITRPGDIGDDSSISALWDYLTSQNIFVRVLVLNAAHVTPWGSDTLKMDKRDLMEAFDVNIGGNFLMTVKFVNQPIRPRGEQLNLINL # STANIHMYPLPNQTPYATSKSGFTTLIGRIADEHPVEELQIISYNPGTHYSESAAKYFEKGHYKWDESTHSVLLLADRANNSLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g438 ### # start gene g439 3 AUGUSTUS gene 1392729 1394475 0.55 + . g439 3 AUGUSTUS transcript 1392729 1394475 0.55 + . g439.t1 3 AUGUSTUS start_codon 1392729 1392731 . + 0 transcript_id "g439.t1"; gene_id "g439"; 3 AUGUSTUS CDS 1392729 1393400 0.75 + 0 transcript_id "g439.t1"; gene_id "g439"; 3 AUGUSTUS CDS 1393460 1394134 0.74 + 0 transcript_id "g439.t1"; gene_id "g439"; 3 AUGUSTUS CDS 1394215 1394475 0.82 + 0 transcript_id "g439.t1"; gene_id "g439"; 3 AUGUSTUS stop_codon 1394473 1394475 . + 0 transcript_id "g439.t1"; gene_id "g439"; # protein sequence = [MTCQWLLPFLENILAQQLDAVAKKHLLDNGDKQDNNNQEDHTVGQIQLWDEPTVVQVEDKTSDKSVTFEQWVDMDWTL # EILLYEFHLRMQSLLQGWKRQKVDHQIMVNSFSSGVFSGWHTAVCNRNLSLSIDTEYILKQCLNKSDQEFQHAIKLLENIYNNDSETETKDDDEAQDK # NAALQSTVDVLSVSVANLNNSMDELKGMIAGQKELLLNANHRSTSPFVPQSNVQISAPEPPAGFSPWSRPTSFPAVQQPAGYNPPQQQSTGYFPTGQQ # PVGYNPPQQQSAGYFPSQQQPAAYPPQQQPTAYPPQQQYTGFPLQQQPPYFPPQQSAAYFPQQQPYGYPPQPTYPTFPSQQQPAPYFPPQQPYGYPPQ # QQPAPYFPPQQPTVYTSQPQPPAYFPQQPQQYTSYSMQQPNSYSYQQPSGYSHQYSTAYPSQQQQAAPYPPPLPQFTPPPPQSTVYPPQPQFTPYLPP # QQQSTAYPPPSQPQSVAYPPQQQSTVYPPLQPQSSTYPPPSQPQPAAYPPQFMGSPFQTPVIPQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g439 ### # start gene g440 3 AUGUSTUS gene 1405621 1406655 0.64 + . g440 3 AUGUSTUS transcript 1405621 1406655 0.64 + . g440.t1 3 AUGUSTUS start_codon 1405621 1405623 . + 0 transcript_id "g440.t1"; gene_id "g440"; 3 AUGUSTUS CDS 1405621 1406655 0.64 + 0 transcript_id "g440.t1"; gene_id "g440"; 3 AUGUSTUS stop_codon 1406653 1406655 . + 0 transcript_id "g440.t1"; gene_id "g440"; # protein sequence = [MIQQRKDAIENLYSTLPVVERTLLDAEIEGTPMFSMPTTNIIVDDTNMSDSREEIPARGISSTSVRMNGVIPTASQDH # PQINGVVLPTPSASASATAVLIPRESLVPLISATAVPSSFTLTSSTGPGNRENLASSRSVTTRFGGAPILPIAGSSGDSIIAPNSSLGFGGTVDSGGR # TAHSLNGELTRLTQPSGRKSLPFSSAAFNSPNSALGLSTSGTGFGSIPTLFSSSKRKPNAFYKPPIVNNPPLSNPFSIEDPAPEFGGASRRSTTGSHS # PERPPSNEKQNRNRGVDQLAVSEGGRQNGDILQNEAMAVDEGQGAGLDYPLFVNAETLVPKTMKEKAGEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g440 ### # start gene g441 3 AUGUSTUS gene 1406751 1407284 0.87 + . g441 3 AUGUSTUS transcript 1406751 1407284 0.87 + . g441.t1 3 AUGUSTUS start_codon 1406751 1406753 . + 0 transcript_id "g441.t1"; gene_id "g441"; 3 AUGUSTUS CDS 1406751 1407284 0.87 + 0 transcript_id "g441.t1"; gene_id "g441"; 3 AUGUSTUS stop_codon 1407282 1407284 . + 0 transcript_id "g441.t1"; gene_id "g441"; # protein sequence = [MIEDIPSPPPPRQTRSRKSNVPYTSTSAATANTHTSASAKSSASASTSAPTTKPRGKKPRQTTTSSKSKRRVPGGMSD # DDDDDDEEDDGDAGQEEVEEDQDHVAPLAARRTMRKTRSSVASALWTEEPGPRRRSSRISVAGETGAGGASSKRVTKKSTAGTGGKRKQRRFMAFVLN # G] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g441 ### # start gene g442 3 AUGUSTUS gene 1410838 1411621 0.5 - . g442 3 AUGUSTUS transcript 1410838 1411621 0.5 - . g442.t1 3 AUGUSTUS stop_codon 1410838 1410840 . - 0 transcript_id "g442.t1"; gene_id "g442"; 3 AUGUSTUS CDS 1410838 1411246 0.97 - 1 transcript_id "g442.t1"; gene_id "g442"; 3 AUGUSTUS CDS 1411353 1411621 0.5 - 0 transcript_id "g442.t1"; gene_id "g442"; 3 AUGUSTUS start_codon 1411619 1411621 . - 0 transcript_id "g442.t1"; gene_id "g442"; # protein sequence = [MSAEDEHTIRLMFRHAKDSIPLLEAARSVDSNLVRNLKDAATTCDRLGASGANLYKCQGYQAPIHIEDDASRGLCAQV # WWKGIEEWNEWGSFNSSHMHGTNLPSQNSLIRSNQWAWEAVDNEESDMESEESNDDDDDDDDEQHIGTEGTLASKHTREPSSASETLINATGVKRLRG # GARARRRRIRLAGSGGFHVSTPKKNASTAQRNAGVRGRAAARRAHYDQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g442 ### # start gene g443 3 AUGUSTUS gene 1412293 1413781 0.19 - . g443 3 AUGUSTUS transcript 1412293 1413781 0.19 - . g443.t1 3 AUGUSTUS stop_codon 1412293 1412295 . - 0 transcript_id "g443.t1"; gene_id "g443"; 3 AUGUSTUS CDS 1412293 1412541 0.67 - 0 transcript_id "g443.t1"; gene_id "g443"; 3 AUGUSTUS CDS 1412598 1412786 0.47 - 0 transcript_id "g443.t1"; gene_id "g443"; 3 AUGUSTUS CDS 1412854 1413231 0.96 - 0 transcript_id "g443.t1"; gene_id "g443"; 3 AUGUSTUS CDS 1413305 1413506 0.76 - 1 transcript_id "g443.t1"; gene_id "g443"; 3 AUGUSTUS CDS 1413774 1413781 0.42 - 0 transcript_id "g443.t1"; gene_id "g443"; 3 AUGUSTUS start_codon 1413779 1413781 . - 0 transcript_id "g443.t1"; gene_id "g443"; # protein sequence = [MLKYSNPSTDPIQIAPESSEILESMLKANAAANVPNVKNPPKLTKHDSRSTFLQRQNEWATVLTSIFLSKEEEIAKDK # WLSVLDEMKGISEGTYHEIDWYLAFKVNHVNLLDYQYSQFCQESKLCGVFNALCNPNYPVRHARVNDCDNPHYRITWYGYYALAEVIGVFQEEWTPEM # IKTQWITDWEESPQENYQQQRAVKYTKFDWKNQPVKIFQAMTWENVIPLEAFPSHVYTFLSQDNFIHVWNRSIAPGLDERHVDLEGMKPSILYQVIHR # WMVSKQGKNDIDRMRIPEPFRLIATCTLEYFDFKERLGKKVWDHKIRQVNLISDVLLNTNWKLAGRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g443 ### # start gene g444 3 AUGUSTUS gene 1414658 1416042 0.27 + . g444 3 AUGUSTUS transcript 1414658 1416042 0.27 + . g444.t1 3 AUGUSTUS start_codon 1414658 1414660 . + 0 transcript_id "g444.t1"; gene_id "g444"; 3 AUGUSTUS CDS 1414658 1414775 0.73 + 0 transcript_id "g444.t1"; gene_id "g444"; 3 AUGUSTUS CDS 1414918 1415201 0.27 + 2 transcript_id "g444.t1"; gene_id "g444"; 3 AUGUSTUS CDS 1415539 1416042 0.97 + 0 transcript_id "g444.t1"; gene_id "g444"; 3 AUGUSTUS stop_codon 1416040 1416042 . + 0 transcript_id "g444.t1"; gene_id "g444"; # protein sequence = [MAEPEEYLAVPKAMNHNLTKTRLPLKKTRSSFSRIEQTNICLQVIYGPHQADHLSLVKALCDYEASAPGEFTIIEGKI # LLAFEPDDEWLLVQSTKEGGKVGYIPANYVETHVEGTEEQATEERPANQRIIVPPLAKHVHFDVEGGVSLHFNVGSKDNCEAIVAKLESSKALALQPS # EEASAPTPSGTPPPPSLGSLPARPLKASVHFAPESPLWTSSLDAENLAGEYIAKAFPDVMDYTIPLSSELDFTSQMAIDPHALHFDTQKLGLDNFPLL # NDLTPSQNYPYVHISIGNVDFSTGQET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g444 ### # start gene g445 3 AUGUSTUS gene 1416318 1417768 0.45 + . g445 3 AUGUSTUS transcript 1416318 1417768 0.45 + . g445.t1 3 AUGUSTUS start_codon 1416318 1416320 . + 0 transcript_id "g445.t1"; gene_id "g445"; 3 AUGUSTUS CDS 1416318 1416851 0.45 + 0 transcript_id "g445.t1"; gene_id "g445"; 3 AUGUSTUS CDS 1416956 1417768 0.94 + 0 transcript_id "g445.t1"; gene_id "g445"; 3 AUGUSTUS stop_codon 1417766 1417768 . + 0 transcript_id "g445.t1"; gene_id "g445"; # protein sequence = [MFTGQQAMLNNGFIQQPASPQSLRSFALSTSSEASTPPPTTPPPTESVFSNSFNASVSNVNPYANAGGTTGVMSRPKT # SHTTIERRYRTNSNSRITSLKMAVPTLRVLEDKEGCGVGGGGKKGKGKNATLGQNVVFGSKVKTEGEDGEDVVDVIDERGFVDGVKVARKCSKANVLG # KARGLKALVNGLVGAPALLSEWEREWREKFGGEEKDEVEGEGIDDGGTDDEGCGDDDDADDEGARKRKKAKITPAKKEPKEKRPLLPSPQPLVLPDGS # VVVPEKRKKGRPRKVMLPVVAAVAEPSVPLHQPGAPSSVVQPQQHPQHAQYLLAVFALFSFFNNALSSSPSYPPPNHSHTGTILVHELPLSTSGYSGW # SWHDVIQFFHPLVSILVFFSILAPWAPTLYKYVTRYASLKKLTLFNSSRPRSISLVWIASAAGRSPLKEALLHLGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g445 ### # start gene g446 3 AUGUSTUS gene 1419109 1420017 0.69 - . g446 3 AUGUSTUS transcript 1419109 1420017 0.69 - . g446.t1 3 AUGUSTUS stop_codon 1419109 1419111 . - 0 transcript_id "g446.t1"; gene_id "g446"; 3 AUGUSTUS CDS 1419109 1420017 0.69 - 0 transcript_id "g446.t1"; gene_id "g446"; 3 AUGUSTUS start_codon 1420015 1420017 . - 0 transcript_id "g446.t1"; gene_id "g446"; # protein sequence = [MSPGFGDLLSLVAQSAILEQKLMNGEYPDESVITNPIHNGATSAPPRPSMGVEERQAKEAEDQERFKDLLRRRPSTKS # MKGRGSSDSRRKPSFSLRNPLARSKSANRKEDESDLALGPAPPRSSKESSAAPNRSKSMYLTSSSQPSLSTIPPVPNIPSVVSNNNNVYSDDIPPTPP # PKSPSAKYLSSFRRFTSTRSQGASQRHSVSMSSEISSEDSVAVLTPPDNSPGFTGTGSLFQTRSRTQSGHRPGSVINVPWPSVSPKKNQGSVSRATSF # AGKMFRGRKKSGGTMSSLDSGEIVIFFM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g446 ### # start gene g447 3 AUGUSTUS gene 1420233 1421363 0.46 - . g447 3 AUGUSTUS transcript 1420233 1421363 0.46 - . g447.t1 3 AUGUSTUS stop_codon 1420233 1420235 . - 0 transcript_id "g447.t1"; gene_id "g447"; 3 AUGUSTUS CDS 1420233 1421363 0.46 - 0 transcript_id "g447.t1"; gene_id "g447"; 3 AUGUSTUS start_codon 1421361 1421363 . - 0 transcript_id "g447.t1"; gene_id "g447"; # protein sequence = [MQDMSPAAVDPSISLDSWHEESSPLIFIPPESASVVALETEVLQDTSFDNQSEVTEIPSSNVLLASVDSEAHESVHES # SRRPEAVSSEVSVDPVEPLVLSVESRTSVKEHGNPSEQIKSTSIVTVADLHTEFSTFNSSDDLPVESLSSTSVVETEKKSLDASSATLQQEIEDVGGS # HHKLSDPLSTISTSISRVEDELPSPPPQWSTENDTAALNTKEARLLPPLSLPSPPPVIRDSFLARKIDDPSPRSSYTDSPGHLTLAHKISPLTSRGVP # MFLPGIRSPINVEAEATAQPNAPIAEPQHIVDIVPSAQSDTRIGSDTVTVGRTLNRPAPVTLDVQPSPELEPQRPKTAVPSAWSDTVSPPGVEFGTVV # VGDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g447 ### # start gene g448 3 AUGUSTUS gene 1421392 1425517 0.04 - . g448 3 AUGUSTUS transcript 1421392 1425517 0.04 - . g448.t1 3 AUGUSTUS stop_codon 1421392 1421394 . - 0 transcript_id "g448.t1"; gene_id "g448"; 3 AUGUSTUS CDS 1421392 1422033 0.64 - 0 transcript_id "g448.t1"; gene_id "g448"; 3 AUGUSTUS CDS 1422260 1422351 0.92 - 2 transcript_id "g448.t1"; gene_id "g448"; 3 AUGUSTUS CDS 1422446 1422871 0.43 - 2 transcript_id "g448.t1"; gene_id "g448"; 3 AUGUSTUS CDS 1422968 1423363 0.28 - 2 transcript_id "g448.t1"; gene_id "g448"; 3 AUGUSTUS CDS 1423435 1425517 0.37 - 0 transcript_id "g448.t1"; gene_id "g448"; 3 AUGUSTUS start_codon 1425515 1425517 . - 0 transcript_id "g448.t1"; gene_id "g448"; # protein sequence = [MCELSLTKICIPLSPPQLPSADNWAFQVEWCPRNPDLLASAFFDGTVGIHSIQSTNESAVPQPATVSSTDGSDVFDVP # GFTRSSQGGTLSLKQPPKWLRRPITSSFGFGGKLVSVSNLPSAQGKNQSSVIHLRNVVTEEEIVERAKALQSAIADESVKAFAERKASQNEEIWKALL # NMYQAESRDELVTLLGFSKSEIAARIGEAVEKLKAGVEVKQEDENVVDIKPPVVSFAEPEGEPTPVGSPDVDEPDSADFEKTPSEVSASAASDATRQA # ETESTTTAPSLFGDDNGIADDGDFFSNIGVGGNGFTRQVLVPHTNYGVDSSVAATIGSRPSSIASEVTKSNTFKIYPADESETETLVTKALVLGDFTS # AVELCLSTKRFADALLLAVRGGPELLQKTQKVCFERQITVAPYLRLFQSIVANDVSDIVQNADLQEWQEIFVVLCTFASKEEFPGLAEQLGRRLEFQY # TISKSSNNPEVSHKAVEYRKYATLTYVAAARLERLVNIWSEELSEEEASLALDESLPGGSQYTAHAHALQTFIEKVTVFRSATKYTDADLASATASTA # VEADVETYKLSVLYDRYFQYADLLASQGLLKEAASILRLTPADYKGSGSADLSEERKRLLVATSIVAPVASTSTATASSSRAPYGGYAQPTAPTHNRV # PPGPAPAPSGPYGGGYQPASNYQTAPQSTVNSFTPAANAYAPAVNTFVPPAPSYNAYGQNANTGQQMPTNQAPALAPPSRGPATLPPPPKRDSNSRWN # DAPIVNPAQTSSAMANKPAAIMSPFPNSTPMPLSPPISGSYMQQAQPLAGLSPLPRPGSVTGPGGGPGGMGMPPPSRMMSPPQVHPPPTSHHGPPPSR # SSMSGQTPPPGPNQFARHPPPQAGQSHLPPSGPYAQATPPPTQPPGPYGPPPGQVPQGPQASGGMYAPPPGVRTGPAQPPPPGAVPGAGGPPPPPPGA # GLVGVAPPPPGDRSHIPEHATPAFEVISKELERLKGSVPSNVAALREKIAKFEKKGGVPVPRGSFGLGAPPSDSGQAKASRELYGNRIPAPVKPQNTG # GGSIRPQYTGGSLRQQFTGPANSTRSPSPLEGSTRSFSSPSPPLEPLRPIHTGRRATDFSKAMELARKAEIENQQVYDPRWRENSTSPPPSSPPPIIA # NRRFSFFTEDPPAIIVSPQLDVPAVPDEALSSDLVCAHLFSLYKFLVHDMFTEGYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g448 ### # start gene g449 3 AUGUSTUS gene 1439433 1439745 0.44 - . g449 3 AUGUSTUS transcript 1439433 1439745 0.44 - . g449.t1 3 AUGUSTUS stop_codon 1439433 1439435 . - 0 transcript_id "g449.t1"; gene_id "g449"; 3 AUGUSTUS CDS 1439433 1439623 0.89 - 2 transcript_id "g449.t1"; gene_id "g449"; 3 AUGUSTUS CDS 1439721 1439745 0.47 - 0 transcript_id "g449.t1"; gene_id "g449"; 3 AUGUSTUS start_codon 1439743 1439745 . - 0 transcript_id "g449.t1"; gene_id "g449"; # protein sequence = [MPFGGMNGDPTAFNPTMGPNFNAGMSLPPPVPPLPSTTSNHNSTNPTNIFAQMKSRTFANDNESSLPNPSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g449 ### # start gene g450 3 AUGUSTUS gene 1444933 1445487 0.79 - . g450 3 AUGUSTUS transcript 1444933 1445487 0.79 - . g450.t1 3 AUGUSTUS stop_codon 1444933 1444935 . - 0 transcript_id "g450.t1"; gene_id "g450"; 3 AUGUSTUS CDS 1444933 1445487 0.79 - 0 transcript_id "g450.t1"; gene_id "g450"; 3 AUGUSTUS start_codon 1445485 1445487 . - 0 transcript_id "g450.t1"; gene_id "g450"; # protein sequence = [MIAENSKILNPLSAFMQYYQDIFTASPIPSPSNVSLQRVSALSEYGGLWMVNESREVIRIGLVVQISQFGDDSKYGQY # MDMNAYNSQVRQKSHYIQAILISANLIFAIRSPLIHSEEHVQDYSFMRFIHLQNAQLKWQKSIMVIKHVSMLCLTYCNIALLSTLIKLVLLIVRFMLQ # LLALFSMI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g450 ### # start gene g451 3 AUGUSTUS gene 1458676 1465923 0.92 - . g451 3 AUGUSTUS transcript 1458676 1465923 0.92 - . g451.t1 3 AUGUSTUS stop_codon 1458676 1458678 . - 0 transcript_id "g451.t1"; gene_id "g451"; 3 AUGUSTUS CDS 1458676 1465923 0.92 - 0 transcript_id "g451.t1"; gene_id "g451"; 3 AUGUSTUS start_codon 1465921 1465923 . - 0 transcript_id "g451.t1"; gene_id "g451"; # protein sequence = [MNTFQVALNSQSLLVPHWVLPENIVACESDFQKLSLRLFPHYLQSLKKDVAVAQLIQCLIEFSHRSFKVTDYVSSSLY # SVVHDTCIALFGSDIPELLYQNYHKFNGASERIDDVIAHGDVLSITCNVFQQLSTEDLQSLRSSLRITERHHKNGRIFCCLPKYGQPELKSVHLCKLI # ARCLQRDYLHFYEMADDYLADSYLYYYHIPCSQLLSIQEVVCCVLTCLGYPLHALKNIVKLTGTVDIQHSPQKKYNEQRKDARRKSRIQRGNEEYDLL # HKSSESWPQLVPFAVSMSCIAKYRQSIQYIVPSICACCGSEDRKFTGSYLPQSQWPVMSFLTVKDPFILSHTPQARFTYICQDLDGLLLDPRGIRSLD # LGCTVFEMYLCHECILYMQRSTMPRLALNNHLYRGELPEHLQNVSWVEEMACSIYRTSAHVTRIFGSSSECDPLQLHGNTCAHPLNICYTAKRLPWSP # ADLNDLISIIFVGPRKLTNEDLQKLTPFFVRRTVIQMLLLYLQQHNRLYIELPPINEEILAMYPDNDLLPGLQDRFIYDHDTSVPDVFGIESDGFDDH # PADLLSHQNEVLLERSGVYDSESQDVPARFMTASSIHNIAQALPSTGFGTSDFIIRYGKDPIDEYNNPDLFPGMFPTLYPLGIGGFEDHCQCPAISFE # AHVQHLLDQSLRNFRYHHFFSFVALNVIQRRKAHLHTSLSISSNKYDYIASELLAVTPQILSNLAHKLKNESDNSSFTDDEQHAFRLLKEVNIIAAKI # PGSQASKTRIRQQIRSYFAYFGLPQLFVTLNPSAVHSPVFQVMYGDQNVNLSLRFPVVVQPRSERAFRVAHDPIAAADFFDFMYHVTFQDLFGWDFKN # GKSTQQGGLFGHLRAFYGCAELTERGCFHGHYLLFLRGGLNPSDVHEKMHHVEEYHKQFFSFFEDIIHHHLPNTEYSSAPQYESRSEMPPDVPELDSE # GDDSNELLLAWQKLFTDEHKKVGEQLQRHRCRPVCHKGKSANSDCRFGYPHDVVEHSSFDLNHNSIILSRKESDVNGHNPFLLVYTRHNHDVKCILSG # RAAKAAMFYISDYITKMPLNTEALLSTLSKAVASVTSEDIDETPVMNAKRLLHRCLTHFGRKQQIHSQQCARYLRGLTDSMSSHSTTPLPSASLMMFV # QNQYRHLLGKYLNQDCSDNLDIQVHFGFREGKLVHSNQVIDYWYRDSSLSDMCFYDFIKYVSLQAQSKTKTVHNSDTRIGVLRRHKLLSGHPLQSTHE # LIQHTNFKQGDVGKEFVPMMMGAVPPRKTDKLYALFVLAHFKEFSNLNPLISSNDVDSEFNCFQLHADHQQILNNWEEIHECADQRDAERLRKKASEL # AKSSHLLIGTENVLDDDEYADYNFVLPKRVQDIELNISSNMQQMQLLKTDLCSAAWLSSPPSALRLSIQKNALVSPMLPLLTIQKVDKWLKEGKLEAE # RLANIRYKHSNISNQSSSDIPNAESEVHQFSVSYSFEGIDNSSNPTSNVLTASQLKDKIANEFSLNSKQQFAFDIIASFIIFREIFKLPEWIAKEPMV # MLLTGPGGTGKTHIVQAVQKVMEYYRMDHGYRALAPTGNAASLINGRTIHSGLKIRVREHKNGKSHRPLGELNENIVVSASVKKNNNLRMEWKDVCLL # LIDEISMVDSMLLADVDASLRYAKEKPNDFFGGINVIFCGDPFQYPPVGTPLYAPIRSVSIQTDEEMMRRLGRIAWKSINTVIELDEQKRMQGDPEYA # AAVGRLRTRECIQSDVELFNTRAIRTLSNPQGVMFTAEQQYMASIIVSKNSVRQALNDFKTTAICGGEEGPELIEVVAHDQLQYKRHTNANLNGKKVY # PSLAQQHQLLAMDTSAGKLKDGLPGILKLYIGMPIIMKHENLNTELGVNNGSRGFLRKLDLSVDNNGFTYCKYALVEFPDSKVNLSGLPLHFFPVKAR # SWKCSTFIVDENEEKILVSVTRTQLPFEPLFALTGQGAQGHTLAAILCMLHLGGFGAYVAASRPRSRDGLFITKKVTLNDLNTPGIPYDLWFETQRFH # VMAYNTMVIWGFCKGELKEVVDAESEKRGNFSKVHYHFGDDRHDEQHHVSLDTEKDYVKKDEVIDGPTKSQSSFQSQSPPFAQSGPLWDHVNWSCAFD # SAFVVLYNCFVSMSLQNQHIWQNQSRSKHIFTLFNSLSGIHADSINQLLWNDMRNQWRDVLFKEHGSTCERYGRVLLSVSTILEWHVPLSHAVLTTFC # PSHQILHQYKSYIYCSNLIFPHSKPLLSQNNMNMSVQCYVDAFNEFTDHGITSCLSHSDMVFNRSCHSIVNITDDISQVIIFELNGVKTIVPSLELTV # PFHDTDIQLKYKLSGIIYFGSHHFTVRIFNESGIWKYDGQVNNGYFQQDHIISDIDLMELFGRHAHVLLYTFSSSHSNVDGNM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g451 ### # start gene g452 3 AUGUSTUS gene 1472003 1472876 0.61 - . g452 3 AUGUSTUS transcript 1472003 1472876 0.61 - . g452.t1 3 AUGUSTUS stop_codon 1472003 1472005 . - 0 transcript_id "g452.t1"; gene_id "g452"; 3 AUGUSTUS CDS 1472003 1472182 0.94 - 0 transcript_id "g452.t1"; gene_id "g452"; 3 AUGUSTUS CDS 1472259 1472876 0.65 - 0 transcript_id "g452.t1"; gene_id "g452"; 3 AUGUSTUS start_codon 1472874 1472876 . - 0 transcript_id "g452.t1"; gene_id "g452"; # protein sequence = [MIKGISLGLLALHPRHPSSPSDLRHTLWIKNTGGAGDRVVDMSVWTRPIRRHKPGKAAKNTSGIINASARSMRHLPHL # ETETLKTVTVPCIEPLNVRYDVSYQRRVDPSSYTTLNPGEGALWDRPQKPWWLDDEKDDHGDEGKGGNGYRSDTWEERVEADVEAVLGTTIVCVGGGI # ADSGGSTSGSGLTSVASLGVEVEKVVLRRKDPRSTIVRILTSEMILGSEKAVVKDEGEEQEEDGELSLFPLGKHSPSPTVIIANCSSFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g452 ### # start gene g453 3 AUGUSTUS gene 1473363 1475459 1 - . g453 3 AUGUSTUS transcript 1473363 1475459 1 - . g453.t1 3 AUGUSTUS stop_codon 1473363 1473365 . - 0 transcript_id "g453.t1"; gene_id "g453"; 3 AUGUSTUS CDS 1473363 1475459 1 - 0 transcript_id "g453.t1"; gene_id "g453"; 3 AUGUSTUS start_codon 1475457 1475459 . - 0 transcript_id "g453.t1"; gene_id "g453"; # protein sequence = [MTTSISNASNAVGPSNPPTNTSTSTTDRLALYIAHRIALTYARFPDPNRPDLRSTNSSNDTLRISKDSKNTGDPAADN # AEDLDEPGTSDNAPHELESLFAEFDSWAREFSADADEDLSESLDEGNFRGKDPEKLALAARFLARIAKSYWREGVISSSSSSSSSFSASTFSSAYPTL # PSMFPGYPSNAGFLTYPTAKYNTEDDRENDEIWGWPALLVPLLRTWSGILRELVGRGINEMRKLSKTLRTSQKLDSLYKLNSTPEKLESLEAHFDSYT # RVLISRISVDRDVEFSRKKEEMEIQRELKRVMEMWVGVQTLKEVLDKTSSDSSSTREVKVIRVDNAETQPIFDTSVVFWYGRIWISPFFPSVSSLSSS # SSSNAESIQESTPFQLTLTAPSRVAIDKLDWVELRVRVTFEYEGYDDFDEGYEKQEEEGEGRGKEEGGNEDGEEDDEEGDNREGAIRTDVEEAKIDLR # TQEIEVIIRSNSLSQGGEAIETLNEPVQMIDVGHLSFGTGFGFDKKADYDGKSSTDKIQEIISVSSSSLRWTPGQAVIITGSVRVCSSGGGDQFGQGK # IRVSDMLPDFKLFIVLLSRYLPFFSDSTPLLPRHLLRVFPTLHHSCSKSLYMSPLDEELRLRLRHMFMHLVAENLERAQELVEFTRKQCGSLGSRRFS # TGTLNMGLRLRDGSLCRDVGLRKGWDMKVLSM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g453 ### # start gene g454 3 AUGUSTUS gene 1475577 1477809 0.94 - . g454 3 AUGUSTUS transcript 1475577 1477809 0.94 - . g454.t1 3 AUGUSTUS stop_codon 1475577 1475579 . - 0 transcript_id "g454.t1"; gene_id "g454"; 3 AUGUSTUS CDS 1475577 1476789 1 - 1 transcript_id "g454.t1"; gene_id "g454"; 3 AUGUSTUS CDS 1476848 1477809 0.94 - 0 transcript_id "g454.t1"; gene_id "g454"; 3 AUGUSTUS start_codon 1477807 1477809 . - 0 transcript_id "g454.t1"; gene_id "g454"; # protein sequence = [MNSYPLELIAQLAPVMFVAGLNPASLNNANNVPNTTSPPLQSIQPPPPTHHSRNPSLTTMTTVSGADSVNYSLSLPPS # TTAPNLLRPDPFTILTSRLREILVHQRKITVWDTPTADKVFQVILIDKDVKFPPRKVESSPGAPAHSPLSPLTPSSPLHPDGLIAPIWIRKHTMLVPA # VFVLFIRLFEADDPSSIYAYSLGVEYNTEFEQRLKEFRDLADRRNDKDTDRVVERVKELERLKDTELAALIAQRKRSTNERGIKLTVVLMASRKLLDD # SASGAAGGLGLDARLTFIRRQSGLDSRAALFVLSPIPREELNDFVKSLQTALWDPAVEYYTAHSKRVRQKRNRHQAQSAQSSHRPTPSIVASSSSSNA # LGAMSALPAPLKPEGWTVRYEYKMASFAEFRGEYEVALKHYQDAYAALTMLFMAPGSSLAMASGGAGVTMPISTSISTSTMPTSTSSMSATSSTSAAS # RAGVSSPVPGNGGSRTKRWAEAKVLADTINIKIVKLYLYNNETGLALAQQRLHVRTFPVVAGFTGGSTMSTKTGSAPVGGQITPSLSAADEGSYEYWS # WVSRMWCILAEMLVEGTRTRGSPGSPPIPPSLIIPIHRPRLPPSSAAVSTTDSGSRKPSPTPESLLHSAAPGVNPAHALMHPGWYYLLAAECAERKVG # RFVEGLNFGASDEMKEQKITHLRALVGDILEVSVSLSFALSRLSYSHLLPNVHDLHLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g454 ### # start gene g455 3 AUGUSTUS gene 1479872 1480556 0.28 + . g455 3 AUGUSTUS transcript 1479872 1480556 0.28 + . g455.t1 3 AUGUSTUS start_codon 1479872 1479874 . + 0 transcript_id "g455.t1"; gene_id "g455"; 3 AUGUSTUS CDS 1479872 1479881 0.42 + 0 transcript_id "g455.t1"; gene_id "g455"; 3 AUGUSTUS CDS 1480055 1480142 0.49 + 2 transcript_id "g455.t1"; gene_id "g455"; 3 AUGUSTUS CDS 1480202 1480556 0.65 + 1 transcript_id "g455.t1"; gene_id "g455"; 3 AUGUSTUS stop_codon 1480554 1480556 . + 0 transcript_id "g455.t1"; gene_id "g455"; # protein sequence = [MPVTLVIAGELTEELSDAVKKIWITAAQQLRWPYWDWTDPSTGKEGLPALLKPHAVVLQIPNGTQRRLEYNPLATYQF # ENPRPDGFQNMENSKDDRWSPFQVGQTAYFKDWTSTYRWPTNSLHPEEQYASIDEYVVVVLSESNTSIPFEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g455 ### # start gene g456 3 AUGUSTUS gene 1481384 1482118 0.38 + . g456 3 AUGUSTUS transcript 1481384 1482118 0.38 + . g456.t1 3 AUGUSTUS start_codon 1481384 1481386 . + 0 transcript_id "g456.t1"; gene_id "g456"; 3 AUGUSTUS CDS 1481384 1482118 0.38 + 0 transcript_id "g456.t1"; gene_id "g456"; 3 AUGUSTUS stop_codon 1482116 1482118 . + 0 transcript_id "g456.t1"; gene_id "g456"; # protein sequence = [MAGYTYTLTHNQVSIDVSKPIQEADRPIYLKALQDYFGLDILASRLKYGISHPIIPALRGNGIPPYRFEEVADYRHFI # IVADILEHAYTGSYRLEILYNNINIGVVTSLARGLDTLCAGCQGRRETKNRIRGTIAVHQHVVNQIYSLVEQSDQPNQEDVFKEVFKLAFSAQLVGPT # GTVLATASNDVDPTENNALPEEKCPNITIHSTSAATHEEQGYCLFFDDTEYGQILEGKWVNIPPEQRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g456 ### # start gene g457 3 AUGUSTUS gene 1486775 1487227 0.66 + . g457 3 AUGUSTUS transcript 1486775 1487227 0.66 + . g457.t1 3 AUGUSTUS start_codon 1486775 1486777 . + 0 transcript_id "g457.t1"; gene_id "g457"; 3 AUGUSTUS CDS 1486775 1487227 0.66 + 0 transcript_id "g457.t1"; gene_id "g457"; 3 AUGUSTUS stop_codon 1487225 1487227 . + 0 transcript_id "g457.t1"; gene_id "g457"; # protein sequence = [MKYLALSLISTLFVSGGFARPSRLANREATRRLRGSRPFSGSPYVVVSSTTNGTDSQIESKTSAVTSSGTTLHDEYST # NWAGVVIESPPTGQNFTTVSGTLVVPKPTGSNGSASAWVGIDGDTASQSILQAGVDFTISGGKVSYESWYEW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g457 ### # start gene g458 3 AUGUSTUS gene 1487541 1488793 0.48 - . g458 3 AUGUSTUS transcript 1487541 1488793 0.48 - . g458.t1 3 AUGUSTUS stop_codon 1487541 1487543 . - 0 transcript_id "g458.t1"; gene_id "g458"; 3 AUGUSTUS CDS 1487541 1487781 0.48 - 1 transcript_id "g458.t1"; gene_id "g458"; 3 AUGUSTUS CDS 1488606 1488793 0.53 - 0 transcript_id "g458.t1"; gene_id "g458"; 3 AUGUSTUS start_codon 1488791 1488793 . - 0 transcript_id "g458.t1"; gene_id "g458"; # protein sequence = [MPQITCAEVQNELFNIAQAFTVASHLMEDSDDSNDDSFQLDDGFDDEEAQNFNGEFTDSVVVSIETCDGNYQYSTIEG # LHHVCFTVTELVVKLVLVNNFLFCTMFTLTPELGATVFFNVDADAFVKVTVPKFAKGTRLPFCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g458 ### # start gene g459 3 AUGUSTUS gene 1495307 1495882 0.72 - . g459 3 AUGUSTUS transcript 1495307 1495882 0.72 - . g459.t1 3 AUGUSTUS stop_codon 1495307 1495309 . - 0 transcript_id "g459.t1"; gene_id "g459"; 3 AUGUSTUS CDS 1495307 1495882 0.72 - 0 transcript_id "g459.t1"; gene_id "g459"; 3 AUGUSTUS start_codon 1495880 1495882 . - 0 transcript_id "g459.t1"; gene_id "g459"; # protein sequence = [MPTRIEVDASGFATGGALMQKQGNGQWHPVAFRLASMQPVEQNYEIYDQEMLAIIEVLKDWRNFLEGLPQPFDIITDH # SNLEFWHTAQARWALYLSRFDFHMIHRPGRVNTQADALSCMAVHHVSDSDDNQQQTVLKLGHFTKIAASILRNPLEDHIRKASEWEAQVLGGLETVKK # HGIAEWEEDNGLVYY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g459 ### # start gene g460 3 AUGUSTUS gene 1584088 1587648 1 - . g460 3 AUGUSTUS transcript 1584088 1587648 1 - . g460.t1 3 AUGUSTUS stop_codon 1584088 1584090 . - 0 transcript_id "g460.t1"; gene_id "g460"; 3 AUGUSTUS CDS 1584088 1587648 1 - 0 transcript_id "g460.t1"; gene_id "g460"; 3 AUGUSTUS start_codon 1587646 1587648 . - 0 transcript_id "g460.t1"; gene_id "g460"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRYTSHLDSPQTSAPSAINTVDAKVAV # PLPELSPSVSPTILETPPGDSPRSRSRCRSRTSWAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITSSSPHGAPVLFV # PKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIF # SDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANF # YRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNY # DTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNP # HNFRPIFTNEQLTASLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGNDKLLRLDDRIYVPNHGDLRLQVLRYFHD # HPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIP # THDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFA # YNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKF # SEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTD # DEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g460 ### # start gene g461 3 AUGUSTUS gene 1587981 1589672 1 - . g461 3 AUGUSTUS transcript 1587981 1589672 1 - . g461.t1 3 AUGUSTUS stop_codon 1587981 1587983 . - 0 transcript_id "g461.t1"; gene_id "g461"; 3 AUGUSTUS CDS 1587981 1589672 1 - 0 transcript_id "g461.t1"; gene_id "g461"; 3 AUGUSTUS start_codon 1589670 1589672 . - 0 transcript_id "g461.t1"; gene_id "g461"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLCTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDELDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWMSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g461 ### # start gene g462 3 AUGUSTUS gene 1592123 1593775 0.74 + . g462 3 AUGUSTUS transcript 1592123 1593775 0.74 + . g462.t1 3 AUGUSTUS start_codon 1592123 1592125 . + 0 transcript_id "g462.t1"; gene_id "g462"; 3 AUGUSTUS CDS 1592123 1592392 0.82 + 0 transcript_id "g462.t1"; gene_id "g462"; 3 AUGUSTUS CDS 1592474 1592867 0.85 + 0 transcript_id "g462.t1"; gene_id "g462"; 3 AUGUSTUS CDS 1592991 1593775 0.91 + 2 transcript_id "g462.t1"; gene_id "g462"; 3 AUGUSTUS stop_codon 1593773 1593775 . + 0 transcript_id "g462.t1"; gene_id "g462"; # protein sequence = [MPPRTQAQSRANSEENTFFTTAPFAPFSKSISAICQPCCRNHGFGPATIPTMSTLPEAMEEDQQFEYSTLYTGDEQPV # QVLTPCHGQPPMPQCRDTSHSPCDPPPHFDLDAGNHGDQDPPVDPNDLGADNDNPDNDNLDDNSSSLLHGEPGDPSGPGGPGGPSGPRTPISPDIPNK # QHAMLELLSGFKGSIETLGTILAALNRYSDSSESKSKVKEPEVFDAKEWFVPDVLDPDLDSLPAWTSSFKALVKKLQDNFSVYDTQGKAKDSLGNLKM # KETENIRKYNIRFNTLAASTNWDPAALKWAYGQGLIEHIKDEMARLPGPATLANYHQEVLHIDNCYWKCKETKKREAGKPFIARNPKKGSSDFKAGST # NQQNNTQPSGSSAPFMPKPKPFNGGKPQNSSNSGQSSGQRPTFNHLSADGKFLPSERERRMKNNLCLFCGGKHQIADCNKQKAGESKGHAAEVEETPA # ATLPVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g462 ### # start gene g463 3 AUGUSTUS gene 1593803 1594884 0.75 + . g463 3 AUGUSTUS transcript 1593803 1594884 0.75 + . g463.t1 3 AUGUSTUS start_codon 1593803 1593805 . + 0 transcript_id "g463.t1"; gene_id "g463"; 3 AUGUSTUS CDS 1593803 1593842 0.75 + 0 transcript_id "g463.t1"; gene_id "g463"; 3 AUGUSTUS CDS 1593929 1594884 0.8 + 2 transcript_id "g463.t1"; gene_id "g463"; 3 AUGUSTUS stop_codon 1594882 1594884 . + 0 transcript_id "g463.t1"; gene_id "g463"; # protein sequence = [MGVVLIRFIPHLETALAKSISALLKFPTLVDSGSTDSFIDTRYVSQNSILTTKISPVNLRLFDGSLSSKPITNMVNIA # VWFPSGELLLLPLYVTHLDSSCKAVLGYSFLSHYNPLIDWASRNITFHNTSHFDSPQTSVPSATNTVDAKVAILLPEPLPSVSLTILETPSGDSLCSC # SCSHSWSKQVKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDTGMEPILLHAIHSEVVARATDCSSTAPTVPPLHYSIPEEYAE # FADVFDEIAADALPEHRPYDLKIDLKEGTSPPLSNELASFLCERERKESNGHSNQPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g463 ### # start gene g464 3 AUGUSTUS gene 1597286 1597870 0.6 - . g464 3 AUGUSTUS transcript 1597286 1597870 0.6 - . g464.t1 3 AUGUSTUS stop_codon 1597286 1597288 . - 0 transcript_id "g464.t1"; gene_id "g464"; 3 AUGUSTUS CDS 1597286 1597870 0.6 - 0 transcript_id "g464.t1"; gene_id "g464"; 3 AUGUSTUS start_codon 1597868 1597870 . - 0 transcript_id "g464.t1"; gene_id "g464"; # protein sequence = [MSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKQKAHQFKVGDLVWLSAED # INLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVK # WKGYDAGHNSWEPAANLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g464 ### # start gene g465 3 AUGUSTUS gene 1599593 1601239 0.94 + . g465 3 AUGUSTUS transcript 1599593 1601239 0.94 + . g465.t1 3 AUGUSTUS start_codon 1599593 1599595 . + 0 transcript_id "g465.t1"; gene_id "g465"; 3 AUGUSTUS CDS 1599593 1601239 0.94 + 0 transcript_id "g465.t1"; gene_id "g465"; 3 AUGUSTUS stop_codon 1601237 1601239 . + 0 transcript_id "g465.t1"; gene_id "g465"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNNDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPIPPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFP # GGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKAVLPRLKKPPKQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g465 ### # start gene g466 3 AUGUSTUS gene 1601601 1602767 0.38 + . g466 3 AUGUSTUS transcript 1601601 1602767 0.38 + . g466.t1 3 AUGUSTUS start_codon 1601601 1601603 . + 0 transcript_id "g466.t1"; gene_id "g466"; 3 AUGUSTUS CDS 1601601 1602767 0.38 + 0 transcript_id "g466.t1"; gene_id "g466"; 3 AUGUSTUS stop_codon 1602765 1602767 . + 0 transcript_id "g466.t1"; gene_id "g466"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHPDSPQTSVPSAINTVDAKVAV # PLPELSPSVSPTILETPPGDSPRSRSRSRSRTSRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLL # SRRKTANFAFASISVDSIVSPKRIVTHSHSFQIFSTLRKELKYTPNWISLTLIIWSESLKVMNGKPPFGPATALTNGRLCRSALRTPLWLSSGLLMTS # SLTCSMFVSSSILTIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g466 ### # start gene g467 3 AUGUSTUS gene 1605452 1606444 0.53 + . g467 3 AUGUSTUS transcript 1605452 1606444 0.53 + . g467.t1 3 AUGUSTUS start_codon 1605452 1605454 . + 0 transcript_id "g467.t1"; gene_id "g467"; 3 AUGUSTUS CDS 1605452 1606444 0.53 + 0 transcript_id "g467.t1"; gene_id "g467"; 3 AUGUSTUS stop_codon 1606442 1606444 . + 0 transcript_id "g467.t1"; gene_id "g467"; # protein sequence = [MAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSE # IKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTP # ADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPN # ESVQIASSTPTSAPAPVAATASPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g467 ### # start gene g468 3 AUGUSTUS gene 1607273 1610209 0.98 + . g468 3 AUGUSTUS transcript 1607273 1610209 0.98 + . g468.t1 3 AUGUSTUS start_codon 1607273 1607275 . + 0 transcript_id "g468.t1"; gene_id "g468"; 3 AUGUSTUS CDS 1607273 1610209 0.98 + 0 transcript_id "g468.t1"; gene_id "g468"; 3 AUGUSTUS stop_codon 1610207 1610209 . + 0 transcript_id "g468.t1"; gene_id "g468"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGF # LGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ # PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDN # RQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPG # LHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEG # VADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSAL # GMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYR # ILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSR # APKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g468 ### # start gene g469 3 AUGUSTUS gene 1610793 1611380 0.98 + . g469 3 AUGUSTUS transcript 1610793 1611380 0.98 + . g469.t1 3 AUGUSTUS start_codon 1610793 1610795 . + 0 transcript_id "g469.t1"; gene_id "g469"; 3 AUGUSTUS CDS 1610793 1611380 0.98 + 0 transcript_id "g469.t1"; gene_id "g469"; 3 AUGUSTUS stop_codon 1611378 1611380 . + 0 transcript_id "g469.t1"; gene_id "g469"; # protein sequence = [MKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVI # SRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADEL # HADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g469 ### # start gene g470 3 AUGUSTUS gene 1612912 1613949 0.83 - . g470 3 AUGUSTUS transcript 1612912 1613949 0.83 - . g470.t1 3 AUGUSTUS stop_codon 1612912 1612914 . - 0 transcript_id "g470.t1"; gene_id "g470"; 3 AUGUSTUS CDS 1612912 1613949 0.83 - 0 transcript_id "g470.t1"; gene_id "g470"; 3 AUGUSTUS start_codon 1613947 1613949 . - 0 transcript_id "g470.t1"; gene_id "g470"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFATRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNLEIDWEKGRLSVKPPRVTIEEVPDEEISYSHLAATHTESPILELPE # PEPPAENPHIEVPPEATLEQSESVAVEELPIHQIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIIPSKSPSRIKGPEFRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g470 ### # start gene g471 3 AUGUSTUS gene 1616206 1616751 0.81 - . g471 3 AUGUSTUS transcript 1616206 1616751 0.81 - . g471.t1 3 AUGUSTUS stop_codon 1616206 1616208 . - 0 transcript_id "g471.t1"; gene_id "g471"; 3 AUGUSTUS CDS 1616206 1616751 0.81 - 0 transcript_id "g471.t1"; gene_id "g471"; 3 AUGUSTUS start_codon 1616749 1616751 . - 0 transcript_id "g471.t1"; gene_id "g471"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEAHRFMAQFQNWASEQPDLAKSQVK # LIKSTLGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDWTEMSDIDLRERFFTA # LLPEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g471 ### # start gene g472 3 AUGUSTUS gene 1617514 1618332 0.68 + . g472 3 AUGUSTUS transcript 1617514 1618332 0.68 + . g472.t1 3 AUGUSTUS start_codon 1617514 1617516 . + 0 transcript_id "g472.t1"; gene_id "g472"; 3 AUGUSTUS CDS 1617514 1618332 0.68 + 0 transcript_id "g472.t1"; gene_id "g472"; 3 AUGUSTUS stop_codon 1618330 1618332 . + 0 transcript_id "g472.t1"; gene_id "g472"; # protein sequence = [MTAPAAFQCFVNDIFSDMLDVCVIVYLDDILIYSDTPEEYREHIKEVLRWLRKHRLYANPDKCKFNMDTIEYLGYILS # PDRLTMSKEKVQTILEWPVPRKVKEIQCFLGFANFYCHFIYNYSDIVVPMTRLTQKGAPWIWDNDCQEAFENLKTAFTSAPILAHWEPNRPIIVETDA # SDYAIAAILSIQTVDGEIHPLAFLSRTFHAAELNYNTHNKELLAIFEAFKAWHHYLEGSGDSVDIVTDHKNLKYFLLPRFSPAIRSVGQNNCTNST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g472 ### # start gene g473 3 AUGUSTUS gene 1620703 1620930 0.46 - . g473 3 AUGUSTUS transcript 1620703 1620930 0.46 - . g473.t1 3 AUGUSTUS stop_codon 1620703 1620705 . - 0 transcript_id "g473.t1"; gene_id "g473"; 3 AUGUSTUS CDS 1620703 1620930 0.46 - 0 transcript_id "g473.t1"; gene_id "g473"; 3 AUGUSTUS start_codon 1620928 1620930 . - 0 transcript_id "g473.t1"; gene_id "g473"; # protein sequence = [MSTSQTITTTTNTRSRPATGPSNPPPTLPTPRTAGGDDDDQDEEGFSKGAEGEGEEGGGHSKEEKGGRRSSKESG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g473 ### # start gene g474 3 AUGUSTUS gene 1622424 1622672 0.4 + . g474 3 AUGUSTUS transcript 1622424 1622672 0.4 + . g474.t1 3 AUGUSTUS start_codon 1622424 1622426 . + 0 transcript_id "g474.t1"; gene_id "g474"; 3 AUGUSTUS CDS 1622424 1622672 0.4 + 0 transcript_id "g474.t1"; gene_id "g474"; 3 AUGUSTUS stop_codon 1622670 1622672 . + 0 transcript_id "g474.t1"; gene_id "g474"; # protein sequence = [MLQAPAYGCLRSQSQQFQDVQSLTNTGEAWADAGGRVYPLIKNGTPGHGRSKERRQQCKLAGGAQYFEVVEVLALCHM # HGEY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g474 ### # start gene g475 3 AUGUSTUS gene 1626772 1629450 0.82 + . g475 3 AUGUSTUS transcript 1626772 1629450 0.82 + . g475.t1 3 AUGUSTUS start_codon 1626772 1626774 . + 0 transcript_id "g475.t1"; gene_id "g475"; 3 AUGUSTUS CDS 1626772 1627821 0.98 + 0 transcript_id "g475.t1"; gene_id "g475"; 3 AUGUSTUS CDS 1628239 1629450 0.86 + 0 transcript_id "g475.t1"; gene_id "g475"; 3 AUGUSTUS stop_codon 1629448 1629450 . + 0 transcript_id "g475.t1"; gene_id "g475"; # protein sequence = [MSTPPTAVESTSHVVAPPMPTPPSPSHPPFATGENDIDELASTIEDPPLGHLTLFKSVFGVGVSLARYIVDDPLWPIL # AAAGLPCSFCVRSKKSESCSVVPHLARCSNCDDKKPCILGRLARFRYFARKCSRDLSFARRFLEIHGDPGQCTRFSLLPEQWKIIAEKIESSTSSTRA # LLELSPLDDQDRLEEDHLALQDFIRRQPKLSTVTEPVPSNPPSSPVPAKASLVPKKRKRAARVDEASSSKRKRSGEQDLGVGTAPDYRRVGLVLPPQA # RGRPEVVEPLTPGHGSSPHEASPPLPSPGDPVPSPPRVDTSYGVRPAQSGSFGQFVPPTLTATVPRDRLKSPPFPQDVLTRFLVSQAAVGGYREVAVN # QKQEIARLREQLAAIDKHSFEVHEELDVANARAMRLRDRMEKLEESVRHYWNRAHSAEGLIQQYPEDEGLYEIDLPSLSSMQDRLNESEALVRRLATF # AHRLYVADPANLLHYHNTYVGGLIEAVVALLSRGLTHPPEQMCPVVELALDYLSQGRLTHGKLHLRSISSLLYYYSNAADRVDGLYQEMFSHSRFSSD # DAFLTAAQHAGYVDAPPSSLEPPLHRRMFSFGHPIPFPQTPLSDHIPAVPSMDSIMLDWERMIANYVSEVLGYPVPSFVAPPAEEVSNPSVSVVATAP # PPIPEDPPVSGANAPTRSGTPLFLPGSPTPPSPHSPSSIPPSAPAPDIPRETIDLTGEDDDKLYKSREEFLVRMGEMSVVKQEPNSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g475 ### # start gene g476 3 AUGUSTUS gene 1629680 1630495 0.51 - . g476 3 AUGUSTUS transcript 1629680 1630495 0.51 - . g476.t1 3 AUGUSTUS stop_codon 1629680 1629682 . - 0 transcript_id "g476.t1"; gene_id "g476"; 3 AUGUSTUS CDS 1629680 1630495 0.51 - 0 transcript_id "g476.t1"; gene_id "g476"; 3 AUGUSTUS start_codon 1630493 1630495 . - 0 transcript_id "g476.t1"; gene_id "g476"; # protein sequence = [MAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIRVANEAYARYANQRRQEAP # DWKEGDHVWLNMENVRTRRPMKKLDHKWTGPYSILSKIGTHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQNSPPPPIFIKGESEHFVESILDSK # PIKGKPEEVEYLVKWEGYDEGFNSWVGWRGMTGSLELLKQWHKRHTRKRQPKRSHWKLLEKQAEDDEEEATEPTRGTGSGEGEQGGKGGRTRPTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g476 ### # start gene g477 3 AUGUSTUS gene 1631844 1633394 0.42 - . g477 3 AUGUSTUS transcript 1631844 1633394 0.42 - . g477.t1 3 AUGUSTUS stop_codon 1631844 1631846 . - 0 transcript_id "g477.t1"; gene_id "g477"; 3 AUGUSTUS CDS 1631844 1633394 0.42 - 0 transcript_id "g477.t1"; gene_id "g477"; 3 AUGUSTUS start_codon 1633392 1633394 . - 0 transcript_id "g477.t1"; gene_id "g477"; # protein sequence = [MGINEWLAFASKSMEEEVEEILEAGRSAMEKVTPTPAKDSEEAYQKWKSRDTERSSSWPGANQKVRWRKKRREHGPYP # DLPTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVEQKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASDS # SATEGEQQPKDPESGDPSSEQGGVVKELDKEESKHQEMEELKKSIPVQYQDYLDVFSPGEARTLPPHQPYDIKIETEGDAIPPIGKLYNMSEKELKSL # KEYINEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLCAGYNNIRVAQGHEWKTAFRTRY # GSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEVSHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDP # EKVKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYLGITKVFTKLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g477 ### # start gene g478 3 AUGUSTUS gene 1633516 1633974 0.43 - . g478 3 AUGUSTUS transcript 1633516 1633974 0.43 - . g478.t1 3 AUGUSTUS stop_codon 1633516 1633518 . - 0 transcript_id "g478.t1"; gene_id "g478"; 3 AUGUSTUS CDS 1633516 1633866 0.43 - 0 transcript_id "g478.t1"; gene_id "g478"; 3 AUGUSTUS CDS 1633954 1633974 0.44 - 0 transcript_id "g478.t1"; gene_id "g478"; 3 AUGUSTUS start_codon 1633972 1633974 . - 0 transcript_id "g478.t1"; gene_id "g478"; # protein sequence = [MRHPENLISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKELCLTFQDQNVRISAALASEIVQPGAEGST # EELGRGVNGEEIHKGTLQPPPEAPQPPPEAPQPPPEAPQQPPKPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g478 ### # start gene g479 3 AUGUSTUS gene 1635678 1638800 0.2 - . g479 3 AUGUSTUS transcript 1635678 1638800 0.2 - . g479.t1 3 AUGUSTUS stop_codon 1635678 1635680 . - 0 transcript_id "g479.t1"; gene_id "g479"; 3 AUGUSTUS CDS 1635678 1636682 0.94 - 0 transcript_id "g479.t1"; gene_id "g479"; 3 AUGUSTUS CDS 1636965 1638800 0.2 - 0 transcript_id "g479.t1"; gene_id "g479"; 3 AUGUSTUS start_codon 1638798 1638800 . - 0 transcript_id "g479.t1"; gene_id "g479"; # protein sequence = [MTLCLEDVIRIQDCIPEDVAMVLREVLESMGIEILGDGLEFSDLRVQFLTVGTQLEIDLPEKAQRWLMIPANRSDFLW # LYNVLLDPERMLELLEAEARYRRLFRNARGILPLLPHAHGNERDFCGEAGLRIFYRVSNYRSGAVRFEPPPSRVNVLNYQAIQILRNANLAAAAAKID # EESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRSGQMVYTYTPMRHMHQLLVRSEESEAMLCSQETRHRMLLAESDTLMLSEELSGSNL # ERALEFRRRLVADNRGTSYMVQCEPESVGEFPPEQFDQKRQLHGSDGRFLAQKHSSPRSIEVPELFNPGNTATRSPQLRSGTSPTVHALAQNSTPPPR # VNLQTKPVTPVSTQRYQFGEVRMDDAQHSSRISGQDLTARLVPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTENQRGPNQRRTLAVHEEAVPPQGAQ # TNRPGVAFDSARSQESAVMIQQQAQVIETLQEQLREVRKGFATGEIPTGGPIPKTGNMAGVFGQAPMVMIEGTRGGPSPVVPQPRSWQATEPISFTRR # TPIGVKEGNPQEGQTAPLPATPSVDRGRIQEWGARVQRAELGEYSSRNGGRNGDDGVELPTGAPEVPPTRYDPDQPWYYDPKQGWHRKAAPRNPNEGR # NTWESNEEKNRITIESKLDIGKIESFTGDDRSAWKMWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKRE # FGSKFGPIDEADEARRRLAWMKQMPEESFTNFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLR # NLHGEKALQGWLSRFPRLELAPEAPYKSPLRRERDPADVWTSNPKPAVTGRFPNRSNWKEGRQRASAAWGDGESYNSKNCHEVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g479 ### # start gene g480 3 AUGUSTUS gene 1638915 1639520 0.88 - . g480 3 AUGUSTUS transcript 1638915 1639520 0.88 - . g480.t1 3 AUGUSTUS stop_codon 1638915 1638917 . - 0 transcript_id "g480.t1"; gene_id "g480"; 3 AUGUSTUS CDS 1638915 1639520 0.88 - 0 transcript_id "g480.t1"; gene_id "g480"; 3 AUGUSTUS start_codon 1639518 1639520 . - 0 transcript_id "g480.t1"; gene_id "g480"; # protein sequence = [MSVTSTERPSSSKTESKKQKSTLSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGCQPEVQ # GPPPVEPGMGPPQRRYTSMGYAQPASSPMGGFVYSPTWGTRGPPPGPVPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPMPPVQSLNLPPPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g480 ### # start gene g481 3 AUGUSTUS gene 1643913 1644374 0.99 + . g481 3 AUGUSTUS transcript 1643913 1644374 0.99 + . g481.t1 3 AUGUSTUS start_codon 1643913 1643915 . + 0 transcript_id "g481.t1"; gene_id "g481"; 3 AUGUSTUS CDS 1643913 1644374 0.99 + 0 transcript_id "g481.t1"; gene_id "g481"; 3 AUGUSTUS stop_codon 1644372 1644374 . + 0 transcript_id "g481.t1"; gene_id "g481"; # protein sequence = [MPRTTKFPIKSRHNPLLAQLDDDEREARYGRISEPGRRQKPSKKFPEDDENVEVEISILRLRLSSHNFIPLFKVALDS # KTSRRIFELAKTQQDELDALDEEIVEDAPQERMAKIVNAVDDDEDEDDGSDSDMREEMEEIFVSYEFRFIHEQYG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g481 ### # start gene g482 3 AUGUSTUS gene 1649664 1650884 0.93 + . g482 3 AUGUSTUS transcript 1649664 1650884 0.93 + . g482.t1 3 AUGUSTUS start_codon 1649664 1649666 . + 0 transcript_id "g482.t1"; gene_id "g482"; 3 AUGUSTUS CDS 1649664 1650884 0.93 + 0 transcript_id "g482.t1"; gene_id "g482"; 3 AUGUSTUS stop_codon 1650882 1650884 . + 0 transcript_id "g482.t1"; gene_id "g482"; # protein sequence = [MSSDDSNNQPQASTSGSGYGEIRASIDVDALEKYLERNLKGVRLPLGVKQFKVRVHFIHQVIIRLLIVSQFGQSNPTY # FLTDANNTRYVLRKKPSGALLSKTAHQVEREYTVLHALHQYNLRPTTSSTSRVPVPEPYLLCTDTSVIGTSFYVMQFLDGRIFEDARLLGLPSPKDRE # ECWIAAIRALAALSSIDPADIGLGEYGPPGAYFPRQLRAFSKIAEVQGATRDIDTNEQVHQIPFYESMLRWFQTHLPDESRIGRRIVHGDYKLDNLVF # HPTQNIVIGILDWELSTIGSPLADFANLTQPWSIKPEYLPTDGVFRQNVRAFKGLRTNIGASEENCAPVQLELLEKEYCRCMNLEYPLKDIVFVKSWM # LFRVSLAPPIIYISTSFSTFAHRQVSYPKALPHA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g482 ### # start gene g483 3 AUGUSTUS gene 1652417 1653190 0.92 - . g483 3 AUGUSTUS transcript 1652417 1653190 0.92 - . g483.t1 3 AUGUSTUS stop_codon 1652417 1652419 . - 0 transcript_id "g483.t1"; gene_id "g483"; 3 AUGUSTUS CDS 1652417 1653190 0.92 - 0 transcript_id "g483.t1"; gene_id "g483"; 3 AUGUSTUS start_codon 1653188 1653190 . - 0 transcript_id "g483.t1"; gene_id "g483"; # protein sequence = [MSLDSFNVTRTFHRDTYPAISPTKASLSQAGKAVLITGGGGGIGFEIARSFAKAGASKIIIVGRRTAVLDAAAVKLRE # EFKNSTPTPEFIAHQGDIGDDASISSIWKFLNSQNIFVRVLVLNAAHFYPLGPDTLKMDKREIMEGFNTNVGGNFLMTVNFVNQPLRPKGQQLNLVNV # STSTIHIIPGPNSTPYAASKAAFTALTGRIADEHPVEEIQIISFHPGIIYSEGTAKFADKNLKWDESKCHQLQSLRCCSRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g483 ### # start gene g484 3 AUGUSTUS gene 1654362 1656552 0.32 - . g484 3 AUGUSTUS transcript 1654362 1656552 0.32 - . g484.t1 3 AUGUSTUS stop_codon 1654362 1654364 . - 0 transcript_id "g484.t1"; gene_id "g484"; 3 AUGUSTUS CDS 1654362 1655161 0.76 - 2 transcript_id "g484.t1"; gene_id "g484"; 3 AUGUSTUS CDS 1655433 1656552 0.4 - 0 transcript_id "g484.t1"; gene_id "g484"; 3 AUGUSTUS start_codon 1656550 1656552 . - 0 transcript_id "g484.t1"; gene_id "g484"; # protein sequence = [MPLFPNNSDDAPNTPQKRASESSPTGLLSSLSSSITSALVGSGAETGGASPPLSPRSIKSFTISGSGIVSKSALSIRR # KSRKSTGSDYPIPDLKRSASEYQGEFGRNEMKSRSMFALRSRKSGSDIRRLNDDAKMDQNLDLSRDRETKKAPNEGGVNTPPKWKHTKVPPVPSLSLH # PHLEFSSPKSPRSIPLPSSPLPSIDTSFSVLELDMAFANAGSFAVGSSDSSPLVPEHGQDNMIDVSHLTSSPTTSMMPSPRLIPLPASSSGMPSSSTT # VSQVHSDHLEGIEGLPVSMSSEATMSQLRESPLSLRIPLPPSPLPSYSKDSMASLSSSGSTSTHIALAETHRTKQARKETLPNKERCAGDPIVYSETS # VTIEQRRRKHLQKARKDTTRNMSALKGSVERESKKMKQEEEPWSGEEEEDHHHGPRSPNSPYLSNNNSSPFNIETALLASSGWSWSWALDNNEHPPPS # SLVARRDTHEALMLARVADQGVLQDEQGGGVSAAMSGNNLWSVVVGFLTPAGNGNGSGFRTGGEEHNRRERDPELSPDRRKEKPNAQSSPPSQAVSED # TEAPSTSTRNLTPSKFSSSPISSPPSKIRLLGKKPSVNALRARLASMGTSRGKSPPPPPPAAITVASSSNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g484 ### # start gene g485 3 AUGUSTUS gene 1656893 1657417 0.95 - . g485 3 AUGUSTUS transcript 1656893 1657417 0.95 - . g485.t1 3 AUGUSTUS stop_codon 1656893 1656895 . - 0 transcript_id "g485.t1"; gene_id "g485"; 3 AUGUSTUS CDS 1656893 1657417 0.95 - 0 transcript_id "g485.t1"; gene_id "g485"; 3 AUGUSTUS start_codon 1657415 1657417 . - 0 transcript_id "g485.t1"; gene_id "g485"; # protein sequence = [MPPYGFSLHKPSTLWPPPDEELAGRVRTGLKQRFRAVFKGEGDPNASVLTFGTSTSETHSNAPVNGANTDPPSSGEVP # NGMPINVGATTPLPLPNSSYDHANPFDSNKSAYDSIILQAQNGEILSIQQQIQLYTTNALLGHPLVSPALGYLGGLPPLMFVISDKEVLRDEGIYV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g485 ### # start gene g486 3 AUGUSTUS gene 1659422 1659793 0.94 + . g486 3 AUGUSTUS transcript 1659422 1659793 0.94 + . g486.t1 3 AUGUSTUS start_codon 1659422 1659424 . + 0 transcript_id "g486.t1"; gene_id "g486"; 3 AUGUSTUS CDS 1659422 1659793 0.94 + 0 transcript_id "g486.t1"; gene_id "g486"; 3 AUGUSTUS stop_codon 1659791 1659793 . + 0 transcript_id "g486.t1"; gene_id "g486"; # protein sequence = [MKFYAILSITGALLSAATNALPTRIAERQPTRQFGGSRPPPNSPHLAHYNGTGNGGDYEDEPENDTASYTFTFSSTST # SSTPMSTSTAMESSSDLPLPVETLTQIQSIVVPIPTGSIAPSSPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g486 ### # start gene g487 3 AUGUSTUS gene 1660889 1661335 0.99 + . g487 3 AUGUSTUS transcript 1660889 1661335 0.99 + . g487.t1 3 AUGUSTUS start_codon 1660889 1660891 . + 0 transcript_id "g487.t1"; gene_id "g487"; 3 AUGUSTUS CDS 1660889 1661335 0.99 + 0 transcript_id "g487.t1"; gene_id "g487"; 3 AUGUSTUS stop_codon 1661333 1661335 . + 0 transcript_id "g487.t1"; gene_id "g487"; # protein sequence = [MKFSTLLLTGAVLTSTALARPSRLAEREATRRSRSSRPFSGSSHNGTGNNTDSGVELHAGTTSTSLHDEYSTNWAGVI # IESPPSGQNFTTVTGTFVVPSPTGSDGAASAWVGIDGDTASQSILQAGVDFKISGGKVTYDSWYEWSVSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g487 ### # start gene g488 3 AUGUSTUS gene 1662355 1662714 0.9 + . g488 3 AUGUSTUS transcript 1662355 1662714 0.9 + . g488.t1 3 AUGUSTUS start_codon 1662355 1662357 . + 0 transcript_id "g488.t1"; gene_id "g488"; 3 AUGUSTUS CDS 1662355 1662714 0.9 + 0 transcript_id "g488.t1"; gene_id "g488"; 3 AUGUSTUS stop_codon 1662712 1662714 . + 0 transcript_id "g488.t1"; gene_id "g488"; # protein sequence = [MKFFAIFITSALLATVTSALPTRLAERNPAHRFQGSMPPPNSPHLAHYNGTGDGSDNENYPETDTKTDTITAASTSTT # TTAAETTLQSSTKPPLPVETITTTYSIVVPTSIGSDATALA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g488 ### # start gene g489 3 AUGUSTUS gene 1665260 1665643 0.72 + . g489 3 AUGUSTUS transcript 1665260 1665643 0.72 + . g489.t1 3 AUGUSTUS start_codon 1665260 1665262 . + 0 transcript_id "g489.t1"; gene_id "g489"; 3 AUGUSTUS CDS 1665260 1665643 0.72 + 0 transcript_id "g489.t1"; gene_id "g489"; 3 AUGUSTUS stop_codon 1665641 1665643 . + 0 transcript_id "g489.t1"; gene_id "g489"; # protein sequence = [MKFFAILIASAALATVTNALPVRLVEREPTRHFQGSMPPPNSPHLANGSGNGSDTENNTEIATESYTITTSSAIATST # FTTSIPASTPATETAIQSSSTLSLPVGSLSQTQSIVIPTSIGSNGAVLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g489 ### # start gene g490 3 AUGUSTUS gene 1667820 1668785 0.51 + . g490 3 AUGUSTUS transcript 1667820 1668785 0.51 + . g490.t1 3 AUGUSTUS start_codon 1667820 1667822 . + 0 transcript_id "g490.t1"; gene_id "g490"; 3 AUGUSTUS CDS 1667820 1668528 0.51 + 0 transcript_id "g490.t1"; gene_id "g490"; 3 AUGUSTUS CDS 1668583 1668785 0.74 + 2 transcript_id "g490.t1"; gene_id "g490"; 3 AUGUSTUS stop_codon 1668783 1668785 . + 0 transcript_id "g490.t1"; gene_id "g490"; # protein sequence = [MSLTKTHHRDTYPTISSTKPSLSQVGKTVLITGGASGIGFEIARSFAKASAARIIILSRKISSLNAAVEKLRDEFQSS # GTEFITRQGDIGDDSSIIALWDYLNSQNIFVHVLVLNAAHVTPFGPDTLSMDKQELMQTFDVNVGGNFLMSSRFVKQPLRPAGQQLNLVFVSTAGIQR # HPAPAQNPYTTSKAAFTALLGRIADERSAEDVQIISFHPGLLHTEGVVSYFGQNLPRCDEMALPADFSVWAASPEASWLHGRFVWAHWDVDELKADKD # FCMQLEQEKGFLKVAVQGLGGVSFDSYFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g490 ### # start gene g491 3 AUGUSTUS gene 1669135 1669911 0.97 + . g491 3 AUGUSTUS transcript 1669135 1669911 0.97 + . g491.t1 3 AUGUSTUS start_codon 1669135 1669137 . + 0 transcript_id "g491.t1"; gene_id "g491"; 3 AUGUSTUS CDS 1669135 1669911 0.97 + 0 transcript_id "g491.t1"; gene_id "g491"; 3 AUGUSTUS stop_codon 1669909 1669911 . + 0 transcript_id "g491.t1"; gene_id "g491"; # protein sequence = [MSLDSLNVTSTYHRDTYPAISPSKPSLSQNGRAVLITGGGGGIGFEIARSFAKAGASKIIIVGRRSAVLDAAAVKLRE # EFKDSTPAPPEFIAHQGDIGNDDSISSLWDFLNSQGIFIRVLVLNAAHVTPWGLDTLKMDKRELMEGFDVNVGGNFLMTVKFVNQSLRPVGQQLNLIN # VSTAGVHMIPAPNQTPYTTTKSAFTALIGRIADEHPVEDIQIISYHPGALYSEGAAKYVDRNLLRWDESEWHKFYKSKCSSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g491 ### # start gene g492 3 AUGUSTUS gene 1671725 1672456 0.91 + . g492 3 AUGUSTUS transcript 1671725 1672456 0.91 + . g492.t1 3 AUGUSTUS start_codon 1671725 1671727 . + 0 transcript_id "g492.t1"; gene_id "g492"; 3 AUGUSTUS CDS 1671725 1672456 0.91 + 0 transcript_id "g492.t1"; gene_id "g492"; 3 AUGUSTUS stop_codon 1672454 1672456 . + 0 transcript_id "g492.t1"; gene_id "g492"; # protein sequence = [MSLDSLNVTRTHHHDTYPAISPIKPSLSQAGRAVLITGGGGGIGFEIARSFAKASASKIVIVGRRGAVLDAAAVKLRE # EFKGTTTEFIARQGDIGDDASISSLWDFLNSQNIFIRVLVLNAAHFYPLGPDTLKMDKRELMEGFNVNVGGNFLMTVNFVNQPLRPAGQQLNLINVST # GSIHMIPAPNQTPYAANKSAFTALIGRIADEHPVEDIQIISYNPGALYSEGVAKVVDENILKWDKSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g492 ### # start gene g493 3 AUGUSTUS gene 1673393 1673812 0.89 + . g493 3 AUGUSTUS transcript 1673393 1673812 0.89 + . g493.t1 3 AUGUSTUS start_codon 1673393 1673395 . + 0 transcript_id "g493.t1"; gene_id "g493"; 3 AUGUSTUS CDS 1673393 1673812 0.89 + 0 transcript_id "g493.t1"; gene_id "g493"; 3 AUGUSTUS stop_codon 1673810 1673812 . + 0 transcript_id "g493.t1"; gene_id "g493"; # protein sequence = [MAPKRKAFEDIFGQEKRRLAPSSRPPDLELIDTQLHSSNINVSVVPEISHTVSSDSSSHTSCSPLLPNHSRSRNDQHL # AFRNFLQQNSGILAGTSTDSGANARPTMDQAASSPSAPTCPGSDPSTTNGSVNQQTNSKNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g493 ### # start gene g494 3 AUGUSTUS gene 1673847 1674137 0.49 + . g494 3 AUGUSTUS transcript 1673847 1674137 0.49 + . g494.t1 3 AUGUSTUS start_codon 1673847 1673849 . + 0 transcript_id "g494.t1"; gene_id "g494"; 3 AUGUSTUS CDS 1673847 1674137 0.49 + 0 transcript_id "g494.t1"; gene_id "g494"; 3 AUGUSTUS stop_codon 1674135 1674137 . + 0 transcript_id "g494.t1"; gene_id "g494"; # protein sequence = [MNLSFQNDSVLASNINSTSEGSSNLPRINGHNDYGMSVMAQVILNRDSLAFTPLDLSDLEVIVGAARATVLVRADFLS # PPRRSFSVTPDGKPRLPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g494 ### # start gene g495 3 AUGUSTUS gene 1680751 1681092 0.4 + . g495 3 AUGUSTUS transcript 1680751 1681092 0.4 + . g495.t1 3 AUGUSTUS start_codon 1680751 1680753 . + 0 transcript_id "g495.t1"; gene_id "g495"; 3 AUGUSTUS CDS 1680751 1681092 0.4 + 0 transcript_id "g495.t1"; gene_id "g495"; 3 AUGUSTUS stop_codon 1681090 1681092 . + 0 transcript_id "g495.t1"; gene_id "g495"; # protein sequence = [MENSSTTLASGGSGSPSSPSDTANNDSASSDSSIKPASSAHILVDIDSIHEFPMLPSGREEYLERQGGTDELVKGLDT # LHAASGKIFRAQKEEIHLRRHQISVLKEQSRVSET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g495 ### # start gene g496 3 AUGUSTUS gene 1682603 1683280 0.45 - . g496 3 AUGUSTUS transcript 1682603 1683280 0.45 - . g496.t1 3 AUGUSTUS stop_codon 1682603 1682605 . - 0 transcript_id "g496.t1"; gene_id "g496"; 3 AUGUSTUS CDS 1682603 1683280 0.45 - 0 transcript_id "g496.t1"; gene_id "g496"; 3 AUGUSTUS start_codon 1683278 1683280 . - 0 transcript_id "g496.t1"; gene_id "g496"; # protein sequence = [MARTRASPVPTHTNESHHFQETSFSSVANTSSGNRALDRIQRHPSPGPETSDPLFFATHSQGHPHIQGPQNHVHRDSS # SSSVASTPPLIVDSTVSDPSLNGVNPLDELPSKPTIPVELMTQVDQKILGYLETFHTRSQRLFNEQKATSEFTKEQISVVAQQCIVSDSHYSVIYCSE # FYFYQDLQAIIELRKKVRKLKHCCPYCKDLAWNPHMCVLTPSSNHPFCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g496 ### # start gene g497 3 AUGUSTUS gene 1691672 1692391 1 - . g497 3 AUGUSTUS transcript 1691672 1692391 1 - . g497.t1 3 AUGUSTUS stop_codon 1691672 1691674 . - 0 transcript_id "g497.t1"; gene_id "g497"; 3 AUGUSTUS CDS 1691672 1692391 1 - 0 transcript_id "g497.t1"; gene_id "g497"; 3 AUGUSTUS start_codon 1692389 1692391 . - 0 transcript_id "g497.t1"; gene_id "g497"; # protein sequence = [MSVRNALVDLDATTTSLHIVVAIIDANPSAPSESGTMNLGTMLGTSSNAELLGVDGTTTSAHITVADIDANPSAPSEY # GTMKFGMMLGTSSNNIADCPVTSPSIPIDANPPILTLAEPIVPLFQSGSTSHAFVLQFENQHLEAFMLGYLATPNPKSSIGMREFEFHFLAQLDPNSK # EKVLSVLMKAFLDLKIIDGSEQMFGKLLKLVNHDHGRKYVVVLVVAGSALLGALAMFLVLAFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g497 ### # start gene g498 3 AUGUSTUS gene 1696619 1697053 0.38 + . g498 3 AUGUSTUS transcript 1696619 1697053 0.38 + . g498.t1 3 AUGUSTUS start_codon 1696619 1696621 . + 0 transcript_id "g498.t1"; gene_id "g498"; 3 AUGUSTUS CDS 1696619 1697053 0.38 + 0 transcript_id "g498.t1"; gene_id "g498"; 3 AUGUSTUS stop_codon 1697051 1697053 . + 0 transcript_id "g498.t1"; gene_id "g498"; # protein sequence = [MQIHLHYSIALSRGGSGLTSDGGNPCRTINTNDKPARTGPLTFNYTFLPDMSLATASDGSPGARITEVASDLGGLNPE # NTTYSSFPTVSGVEYDPGAIHSVAYPTYPTPNILSPDILSSHPTTTQRFYTFPECVHPKSQDFFGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g498 ### # start gene g499 3 AUGUSTUS gene 1699326 1699784 0.66 + . g499 3 AUGUSTUS transcript 1699326 1699784 0.66 + . g499.t1 3 AUGUSTUS start_codon 1699326 1699328 . + 0 transcript_id "g499.t1"; gene_id "g499"; 3 AUGUSTUS CDS 1699326 1699784 0.66 + 0 transcript_id "g499.t1"; gene_id "g499"; 3 AUGUSTUS stop_codon 1699782 1699784 . + 0 transcript_id "g499.t1"; gene_id "g499"; # protein sequence = [MITRSKTPRTSGTDAISAPLSSISAVDSTFTSLFGSMASATTSRNNTPSSALPSSVSATSATAMDFASSVDIDPIVDP # PSGSTTSSSFIASAIPASPKVLSDDDCDDNFHGEVEIYLDYTSDILQAQAEEVKLLRWEVASAHEEKDVSNNEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g499 ### # start gene g500 3 AUGUSTUS gene 1705429 1709136 0.99 - . g500 3 AUGUSTUS transcript 1705429 1709136 0.99 - . g500.t1 3 AUGUSTUS stop_codon 1705429 1705431 . - 0 transcript_id "g500.t1"; gene_id "g500"; 3 AUGUSTUS CDS 1705429 1709136 0.99 - 0 transcript_id "g500.t1"; gene_id "g500"; 3 AUGUSTUS start_codon 1709134 1709136 . - 0 transcript_id "g500.t1"; gene_id "g500"; # protein sequence = [MFATSSYDLLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQRESDHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLKENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # ALTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTTFNWTGTQ # QEAFDTLREAFISAPILALWAPGRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSNDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQV # LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ # RHPRALTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLA # RLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE # ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVNKLYPWKGNP # INGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g500 ### # start gene g501 3 AUGUSTUS gene 1709187 1710344 0.96 - . g501 3 AUGUSTUS transcript 1709187 1710344 0.96 - . g501.t1 3 AUGUSTUS stop_codon 1709187 1709189 . - 0 transcript_id "g501.t1"; gene_id "g501"; 3 AUGUSTUS CDS 1709187 1710344 0.96 - 0 transcript_id "g501.t1"; gene_id "g501"; 3 AUGUSTUS start_codon 1710342 1710344 . - 0 transcript_id "g501.t1"; gene_id "g501"; # protein sequence = [MSTPVPSAPNTSAEDLMAQLIRQVASLATAMEECSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFWKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADSHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDCGRRQQPRRQQISATAAPFTLFPNKSVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRAN # AMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g501 ### # start gene g502 3 AUGUSTUS gene 1712889 1713350 0.51 + . g502 3 AUGUSTUS transcript 1712889 1713350 0.51 + . g502.t1 3 AUGUSTUS start_codon 1712889 1712891 . + 0 transcript_id "g502.t1"; gene_id "g502"; 3 AUGUSTUS CDS 1712889 1713350 0.51 + 0 transcript_id "g502.t1"; gene_id "g502"; 3 AUGUSTUS stop_codon 1713348 1713350 . + 0 transcript_id "g502.t1"; gene_id "g502"; # protein sequence = [MVEECRNREDQNGVKFFSFALRVFTKMGSGGMSEDEDGVDKVIIDDRELEEAVKLTMFLPFRHSNLTTIVAVVDKVSR # VEKQYFMQSGKTSKRRVRGDSRCKNSDRKPPTGWPVSFFADGYLQSLSEYERDKLHLSKKIFPLYDLEKIPEQYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g502 ### # start gene g503 3 AUGUSTUS gene 1717688 1718671 0.93 - . g503 3 AUGUSTUS transcript 1717688 1718671 0.93 - . g503.t1 3 AUGUSTUS stop_codon 1717688 1717690 . - 0 transcript_id "g503.t1"; gene_id "g503"; 3 AUGUSTUS CDS 1717688 1718671 0.93 - 0 transcript_id "g503.t1"; gene_id "g503"; 3 AUGUSTUS start_codon 1718669 1718671 . - 0 transcript_id "g503.t1"; gene_id "g503"; # protein sequence = [MSLGSLTSTYHRDTYPAISPSNDYLSQAGKTVLITGGGGGIGFETARSFAKAKASRIIIMGRRSSVLDVAAAKLREEF # NNSTTEFIAHQGDISDDSSVTSLWDSLHSRNIFVHVLVLNAAEFYPSGPDTFKMDKRELMKAFDVNVGGNFSMSVKFVSQPLRPVGQQLNLVNVSTAA # IQTYRVPNQNPYSTSKAAFTALVGRIADEHPVEDVQIISFHPGVLYSESASASFDKNAINWDESEYHLPAVLILNLKLTFAIVALPADYAVWAASPEA # SWLHGRFVWAHWDVDELKADKNILKRLEEEKGFLKVAIQGLPEVSLDGYFIKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g503 ### # start gene g504 3 AUGUSTUS gene 1732024 1732911 0.56 - . g504 3 AUGUSTUS transcript 1732024 1732911 0.56 - . g504.t1 3 AUGUSTUS stop_codon 1732024 1732026 . - 0 transcript_id "g504.t1"; gene_id "g504"; 3 AUGUSTUS CDS 1732024 1732911 0.56 - 0 transcript_id "g504.t1"; gene_id "g504"; 3 AUGUSTUS start_codon 1732909 1732911 . - 0 transcript_id "g504.t1"; gene_id "g504"; # protein sequence = [MNTSMSRTGSRRGGDRNDHQAGADGWTVTGNAPRPPAKVGDLSKFGQISKGAPMTFGPSSVFAGKKESKRESLSRTNS # NANMFQMLQNVEAAEVATKTSRPPSRKPSVDLGSGGAPEPAPQRKRLNLLPRTKPVDQDSAPQQESDSEEEEEITDEPEQEMSEDEAKKKISEDTKEF # FGVRSLDEAEVYFEKLPSMYHHSLVDKLVTLAIESKEADARLVGDFFERASSKKLCSASAFEEGFLGIAEFLDDIAIDAPKATDLLAIMIKGADLGEE # QRTNIASKSAENGDKLLKLSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g504 ### # start gene g505 3 AUGUSTUS gene 1733152 1734468 0.79 - . g505 3 AUGUSTUS transcript 1733152 1734468 0.79 - . g505.t1 3 AUGUSTUS stop_codon 1733152 1733154 . - 0 transcript_id "g505.t1"; gene_id "g505"; 3 AUGUSTUS CDS 1733152 1734468 0.79 - 0 transcript_id "g505.t1"; gene_id "g505"; 3 AUGUSTUS start_codon 1734466 1734468 . - 0 transcript_id "g505.t1"; gene_id "g505"; # protein sequence = [MSVCKEKPDNLPALDAIGLEPPSQPPFPIIRTQSGRGTRPGNIVRSTSVGLGAGFKGAPTPFGGMGNFGTAGSASKLS # SEERFQLANPGRTVSMSGAGTPFRPQGIQRTTSSGGPGSQLHTGRTRSKRGDKRPDANKAPPGAHHQQYGHAGTTYGPGGIPLEPVAPLQLSENRWDR # KAIANVDQDSPEIVDRKVKSLLNKLTMEKFDSISDQIIAWANKSEKEKDGRTLIQVIRLVFEKATDEATWSEMYARLCRKMMEQISAKVQDDGIRNAE # GKPIAGGNLFRKYLLNRCQEDFERGWFNKEATAAAAATKAIEEQAMKAANTTKEEEEVALYSDEYYAAQKAKRQGLGLIKFIGELFKLQMLTERIMHE # CVKKLLGNVENPEEEEIESLCKLLITVGQMLDTPKARAHMNVYFDRMKELTKSTNVNSRMQFMLQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g505 ### # start gene g506 3 AUGUSTUS gene 1734543 1736935 0.56 - . g506 3 AUGUSTUS transcript 1734543 1736935 0.56 - . g506.t1 3 AUGUSTUS stop_codon 1734543 1734545 . - 0 transcript_id "g506.t1"; gene_id "g506"; 3 AUGUSTUS CDS 1734543 1735847 0.72 - 0 transcript_id "g506.t1"; gene_id "g506"; 3 AUGUSTUS CDS 1735985 1736935 0.83 - 0 transcript_id "g506.t1"; gene_id "g506"; 3 AUGUSTUS start_codon 1736933 1736935 . - 0 transcript_id "g506.t1"; gene_id "g506"; # protein sequence = [MSKSSVAATSKIPATQLPSKSAWSKGPPQTASPRSQSPAPSNSAPAHATHSRRPSTLGQGIPIKDGVSIPRNNVGATK # TGMRVVFFLLCRRINNKTGSVVSFGSIDDTSAPISSSPAATPAIKSSSEGVKSFGSVPAAVSQINGKSSVSSSTKPPLSQTSSSTSISGASTSSSSTS # APTKPKVDVRKFFQSAPQSTSDSSSPSMRPSNLPPQQSSTSNAPMGAPSYNTFVPAGMRVPPNPVATGVPSTPRSPNYPRQQISNGNGPRPPNGTNAP # PGPPMQPPMGSPRLAPHPHPGQQPNVQPPQMQAPVQMGWGPYYPQQMPPPHPQQHPHPPLSHHPSSQGPPHPSMPMSPRNPPIPLQGGPPGTPTSSHA # SAAPHSPHPAPLSHLSSNSISAVSSPPPTPSSATMPGSARLNNNANPFVPRPTSKIVIKSADGSEVNLENFKKGPSHQSSPSIVTSLPTPSPSGLNSP # SRRAIPIVAPDSKKKREEKEREEMQAKAATLEKERKAKEEIEKKAKEEERLRKEKQEAERKEKEEAKRKTKEEAERKAKEEADRLAKEEAERIAKQEA # ERKAKEEEEERQRLKAEEEEKARIAEEERLRQEILEAEKHRQEEEEKKKEEEQARLVKEEEDAAAKAKAELEAEAKAEEEEGEVIEKDKPHTDGPEAK # ATEIKPDEKKALRIDTARPSEPLPKRRPGPLDLSTVAGKTNIPPPLPSALATARIIEDLGRISYPEGVQSPKVELNVNAKDGKFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g506 ### # start gene g507 3 AUGUSTUS gene 1743333 1744208 0.99 - . g507 3 AUGUSTUS transcript 1743333 1744208 0.99 - . g507.t1 3 AUGUSTUS stop_codon 1743333 1743335 . - 0 transcript_id "g507.t1"; gene_id "g507"; 3 AUGUSTUS CDS 1743333 1744208 0.99 - 0 transcript_id "g507.t1"; gene_id "g507"; 3 AUGUSTUS start_codon 1744206 1744208 . - 0 transcript_id "g507.t1"; gene_id "g507"; # protein sequence = [MSRTGSRRGGDRNDHQAGADGWTVTGNAPRPPAKVGDLSKFGRISKGAPMTFRLSSVFAGKKESKRESPSRTNSNANM # FQMLQNVEAAEVATETSRPPNQNPSVDLGSGGAPEPAPQQKQLNLLPRTKPVDQDSAPQQESDSEEEEEITDEPEQEMSEDEAKKKISEDTKEFFGVR # SLDEAEVYFEKFPSMYHHSLVDKLVTLAIESKEADARLVGDFFERASSKKLCSSSAFEEGFLGIAESLDDIAIDAPKATDLLAIMIKGADLGEEQRTN # IASKSAENGDKLLKLSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g507 ### # start gene g508 3 AUGUSTUS gene 1744436 1745269 0.97 - . g508 3 AUGUSTUS transcript 1744436 1745269 0.97 - . g508.t1 3 AUGUSTUS stop_codon 1744436 1744438 . - 0 transcript_id "g508.t1"; gene_id "g508"; 3 AUGUSTUS CDS 1744436 1745269 0.97 - 0 transcript_id "g508.t1"; gene_id "g508"; 3 AUGUSTUS start_codon 1745267 1745269 . - 0 transcript_id "g508.t1"; gene_id "g508"; # protein sequence = [MGIPLEPVAPTLWDRKAIANVDQDSPEIIDRKLKFLLNRLTIEKFDSISDRIIAWANKSEKEKDGRTLIQVIRLVFEK # ATDGENQSEMYARLCRKMMEQISAKVQDDGVRNAEGEPIVGGNLFRKYLLNRCQEDFERGWFNKEATAAAAATKAKEEQSLKAANTTKEEEEVALYSD # EYYAAQKAKRQGLGLIKFIGELFKLQMLTERIMHECVKKLLGNVENPEEEEIESLCKLLITVGQMLDTPKARAHMNVYFDRMKELTKSTNVNSRMQLM # LQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g508 ### # start gene g509 3 AUGUSTUS gene 1746124 1746615 0.48 - . g509 3 AUGUSTUS transcript 1746124 1746615 0.48 - . g509.t1 3 AUGUSTUS stop_codon 1746124 1746126 . - 0 transcript_id "g509.t1"; gene_id "g509"; 3 AUGUSTUS CDS 1746124 1746615 0.48 - 0 transcript_id "g509.t1"; gene_id "g509"; 3 AUGUSTUS start_codon 1746613 1746615 . - 0 transcript_id "g509.t1"; gene_id "g509"; # protein sequence = [MISSNPKSTTSVTASTLTPSTFSAHDKYTPDESFLSQTDTLNSPYSPSSPPSCTSSLRPLLLRSGATSPQPSSRQTSF # ADSERRAGFFAAQLRGNTSAESSRRVPLADPMSAASSVTLDPSSLENGYGHGHGRLESDGLEEIPLDWSPTKASSTYPSTQLHAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g509 ### # start gene g510 3 AUGUSTUS gene 1751975 1752223 0.41 - . g510 3 AUGUSTUS transcript 1751975 1752223 0.41 - . g510.t1 3 AUGUSTUS stop_codon 1751975 1751977 . - 0 transcript_id "g510.t1"; gene_id "g510"; 3 AUGUSTUS CDS 1751975 1752223 0.41 - 0 transcript_id "g510.t1"; gene_id "g510"; 3 AUGUSTUS start_codon 1752221 1752223 . - 0 transcript_id "g510.t1"; gene_id "g510"; # protein sequence = [MIGSDKVSISVAGQQDLNVGVATGSTDLAIQKNGLFQFDFSDFNDGNFGLNFLHKAASGDFVQGVVATVTRQNYGERW # ELVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g510 ### # start gene g511 3 AUGUSTUS gene 1755369 1755947 0.43 + . g511 3 AUGUSTUS transcript 1755369 1755947 0.43 + . g511.t1 3 AUGUSTUS start_codon 1755369 1755371 . + 0 transcript_id "g511.t1"; gene_id "g511"; 3 AUGUSTUS CDS 1755369 1755947 0.43 + 0 transcript_id "g511.t1"; gene_id "g511"; 3 AUGUSTUS stop_codon 1755945 1755947 . + 0 transcript_id "g511.t1"; gene_id "g511"; # protein sequence = [MAKPDSHHFWRGLSPQTCSLGEYAKPDIAFLIYISNNVSGFSLPDGKVFIVANNQSILYDIEAQTETILPTIPNGVHV # TNPMDGTATLLPLSPPEFIPEVLVCGGSNFSDATPSEDLSSQDPASDQCTRITLTPEGIEKGWIIERMPEGRMMPEMVLLPNGQVLITNGAGTGYAAV # ASVGDPIGNSNADHPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g511 ### # start gene g512 3 AUGUSTUS gene 1758586 1759251 0.14 - . g512 3 AUGUSTUS transcript 1758586 1759251 0.14 - . g512.t1 3 AUGUSTUS stop_codon 1758586 1758588 . - 0 transcript_id "g512.t1"; gene_id "g512"; 3 AUGUSTUS CDS 1758586 1758846 0.4 - 0 transcript_id "g512.t1"; gene_id "g512"; 3 AUGUSTUS CDS 1758901 1759251 0.32 - 0 transcript_id "g512.t1"; gene_id "g512"; 3 AUGUSTUS start_codon 1759249 1759251 . - 0 transcript_id "g512.t1"; gene_id "g512"; # protein sequence = [MVFKSSRWHPSVCDWCKNLSPSIYLTISTAPPKPKQGLAPPVLNDDIHTVRCLAQLRSKEIPLEKYIYLSALKHENPD # MFYKLCLNNMAEFTPIIYTPVVGEACQKWSAIYRRPEGMYISIKDKGKIGSVLKNWPKLDEARIAVVTDGTDYCILNIELFDLTILILGSRILGLGDL # GVNGMGISVGKLSLYVAGAGFVLSTNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g512 ### # start gene g513 3 AUGUSTUS gene 1760767 1761048 0.61 - . g513 3 AUGUSTUS transcript 1760767 1761048 0.61 - . g513.t1 3 AUGUSTUS stop_codon 1760767 1760769 . - 0 transcript_id "g513.t1"; gene_id "g513"; 3 AUGUSTUS CDS 1760767 1761048 0.61 - 0 transcript_id "g513.t1"; gene_id "g513"; 3 AUGUSTUS start_codon 1761046 1761048 . - 0 transcript_id "g513.t1"; gene_id "g513"; # protein sequence = [MFTVPVIMLVAASPIPIPAPSSSRGFVMARLPEPVDSPLAPLDNEARALDFIGTTPLAPLDAEARDIPEPASSAGSPS # DVEFRTLEVRFSLKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g513 ### # start gene g514 3 AUGUSTUS gene 1769208 1771956 0.56 + . g514 3 AUGUSTUS transcript 1769208 1771956 0.56 + . g514.t1 3 AUGUSTUS start_codon 1769208 1769210 . + 0 transcript_id "g514.t1"; gene_id "g514"; 3 AUGUSTUS CDS 1769208 1769391 0.6 + 0 transcript_id "g514.t1"; gene_id "g514"; 3 AUGUSTUS CDS 1769687 1771956 0.95 + 2 transcript_id "g514.t1"; gene_id "g514"; 3 AUGUSTUS stop_codon 1771954 1771956 . + 0 transcript_id "g514.t1"; gene_id "g514"; # protein sequence = [MQTFQSFDTTSIISSTKSTNSKRQNAPSDAQSTISLGIKNPSTLSYSNYPLNNHANHFAHPAHVTRDLVESHKVFSAT # ETVFSALPANTISNRDRSVSRQRYNISNDTSFVTFEDDSPPASPTSSPTITSGWVSGNGWISPDVRSIQSSTSGTITPTTTRRALSADSTWTRRSGGS # AVSGVVSPSPVTASKSTSIPENKISRLPLAPPAYSEVPLHITTDSTESALHRTATNEAPKSPESPESPEEAPVYTESRISFQTGVNQSRVHAPSGIHH # HGNGRRAKSTSKAALRGEPNAPLPETPTMSSSVMGNFSHPYASPTALPNVSGPSESSSSISREGNENVENADNGNVVDVAATGYEYAQAHARAHSDRL # RSQQSLGHLPSQVQSHQSPTIHDNEDEAEPTRGRKKTRSRFSFANLGLGKIVHALSRSRSRSKSTMHTESHSERSERSESPSRVSTRSGVSARSGVSG # ITTISTDTKNTKKSKRSISLPWRRRRRGSTSTTASCVSGVSTGTTGTTNTTNTMGTNNNQTDELGFLDISNGAHKNAHSPLPPPLPSPLPPSITPSNR # SYSTSSEASTSASHSTRSVSQSSRSVSHTSSASTSPSHSPRLPSSPSPPLLANRRSPSSDAQSHISFADLADYDPPSIPPTPPSPSILSSITRPSSVL # SRYSTSSKDKDRDRSQDRSRDRDASGSNISAVSGPSGPGWKEFPKGIYTYPILFSIPGHAPPSLDTATAHRKAYGQDSGNTMNAGVLGNDGLAGGTGG # TGIAGSFASENSEGHNVDALPRCTLKWQLKASVHRPGAFASKVIVVSVIYSIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g514 ### # start gene g515 3 AUGUSTUS gene 1771992 1774105 0.38 + . g515 3 AUGUSTUS transcript 1771992 1774105 0.38 + . g515.t1 3 AUGUSTUS start_codon 1771992 1771994 . + 0 transcript_id "g515.t1"; gene_id "g515"; 3 AUGUSTUS CDS 1771992 1772633 0.45 + 0 transcript_id "g515.t1"; gene_id "g515"; 3 AUGUSTUS CDS 1772711 1774105 0.52 + 0 transcript_id "g515.t1"; gene_id "g515"; 3 AUGUSTUS stop_codon 1774103 1774105 . + 0 transcript_id "g515.t1"; gene_id "g515"; # protein sequence = [MQVTHEISVVSGPSDDDGAAGGDDGANAPGGGENVIVERIWDAAAATGVTSSNDRQGMGPSALMPPPVPPLPTSPLST # PSQSFQRSRGSGRPFRPLPPPPPTASPIPPSPTSPSFLNISETSPLIAASLTPSFLSNSPPLSGSLHTPMSPYLSHSISPPLSPPPFSILTENNPGGN # GSGSLHYLITISGRSFPIGGVIPIEITLMPLEKVRVHRKIEYHSQFKRVERTDPVLTVPLLSLKHDLPSSSSSSKEKELKHILPLESDDPEALMKSPL # YSVMRKSLMRSIRREDMDFEDLENIHDLDPCDGREPSDSSEPEEEISSIDGSGDNEDEDDLDDSDDSEISDSLDDIDEFLTSDAESKPLSEYNDANVH # SQYSSQRLLRLSRNPSERSRRGHHHPRKDIRKPSPSALSSLASSLMGPGPWSMSLALPLPLAHASNLTTKQVQEYEEKMEVYRRQQQEGQQHGFGGGA # FSGYSGYTKRDSFGTRKTEKEWEKKQAQNGKANKREKKPELVDIGRGLLPSNKNKRSNVTISHLLKCVIRVERGELEEDEEVGEGEKEEGSTNSPETS # TFPPLQTRYETGDSRAFGGASAGMSASALADADRSGWADEWEYVQSTKEIRQQRESRERKVRVQEPTKPRPKQKPKKKRKLFDIVVQTPIQVLSVSVS # LPVSLSLLFFTH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g515 ### # start gene g516 3 AUGUSTUS gene 1774193 1775374 0.95 + . g516 3 AUGUSTUS transcript 1774193 1775374 0.95 + . g516.t1 3 AUGUSTUS start_codon 1774193 1774195 . + 0 transcript_id "g516.t1"; gene_id "g516"; 3 AUGUSTUS CDS 1774193 1775374 0.95 + 0 transcript_id "g516.t1"; gene_id "g516"; 3 AUGUSTUS stop_codon 1775372 1775374 . + 0 transcript_id "g516.t1"; gene_id "g516"; # protein sequence = [MSPTIPSTASTSSSFNTSSIPSTSMPSSTPSTPGAESSTRVVISTTPNASDACPCILKARLKQARRERRLRRRELKRE # LREQRMEMMKFMERRRSRMHDTEGADGARGREDGQRGASHLREEVGDRDRLRSFQDNGADGDDRDENEVEESLERTQRKERERRDRAKIRRREALVAL # SSPPAAPLPPPPPLPSPSPHPPTGLPLAPLPPPPPTAMDSFAPSSMQGTHQRTSFSSARTNSTANTATTTHSSSTSHTDASITSAPSAYLAQGPSILR # SGKTKRSSGFSGLGFGGIITARPTQGTVERRLTGGSQISHLSYQSQLSQLSHLTQSTSASASSSIPGLEIGGGAVGSGLIYSSQEFEDYVAGHMDEAG # EAPPTYDHVALVLAGRRENTW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g516 ### # start gene g517 3 AUGUSTUS gene 1782284 1783066 0.9 - . g517 3 AUGUSTUS transcript 1782284 1783066 0.9 - . g517.t1 3 AUGUSTUS stop_codon 1782284 1782286 . - 0 transcript_id "g517.t1"; gene_id "g517"; 3 AUGUSTUS CDS 1782284 1783066 0.9 - 0 transcript_id "g517.t1"; gene_id "g517"; 3 AUGUSTUS start_codon 1783064 1783066 . - 0 transcript_id "g517.t1"; gene_id "g517"; # protein sequence = [MVEAHFPSWSCPLCRSFADLEEDVEVEAEMDYDIEEKDQDQDADVELEADGIAAQPNGAAALGVPIAEDDDSAVEEMS # DDPDLHAAIAASRVTANNSNSTNPSPHSNNPFLNMVNGRSPNFSSSAREPRDGAETEVESDHIGGSTLRPARNQRRGHGRNPSAQLVDPIATEGMDEE # QDEDGRENDVEMLVDADGQPDHDLQAHPRVGHAEADAMNHDEDMEFGGVAEVRDDAELEGRSSGSGMSGEGDAAVGAAGAKRKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g517 ### # start gene g518 3 AUGUSTUS gene 1783147 1784358 0.95 - . g518 3 AUGUSTUS transcript 1783147 1784358 0.95 - . g518.t1 3 AUGUSTUS stop_codon 1783147 1783149 . - 0 transcript_id "g518.t1"; gene_id "g518"; 3 AUGUSTUS CDS 1783147 1784358 0.95 - 0 transcript_id "g518.t1"; gene_id "g518"; 3 AUGUSTUS start_codon 1784356 1784358 . - 0 transcript_id "g518.t1"; gene_id "g518"; # protein sequence = [MDPPFVSSDSPPLRSTILGSFLGRGRPRNSSQSHPNASSPNPDPLRRETSPSPNPPSPSGQAAGSINHRRGRPAGPSN # ATSAVSAEVGNGVQPSTSAPGAGLAFSMLRRRRSAGTMANANNVNTAGAPAVPTGVPSRPPTAPSASATNLRSISTNAAANRIPASLNSPPHRLRLVP # HLESRRSLRFDAITRDMRVGDPALRIGRFTDRSGNNPHGGGVNNNNPNSFKLAFKSKVVSRAHAELWTETSSPSSAASPANVKFFIKDTKSSSGTFLN # HVRLSPANTESRPFQIKDGDILQLGVDYQGGSEDIYKSVKIRVEIGREWQSGANKFKYVGFHSFLCCSLFAYNSTTAIKNLKSLAQAVSGVTGTSGPG # KSKSAGLPDCCICACLPWLLSESSSHSNRPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g518 ### # start gene g519 3 AUGUSTUS gene 1785165 1786220 0.49 + . g519 3 AUGUSTUS transcript 1785165 1786220 0.49 + . g519.t1 3 AUGUSTUS start_codon 1785165 1785167 . + 0 transcript_id "g519.t1"; gene_id "g519"; 3 AUGUSTUS CDS 1785165 1786220 0.49 + 0 transcript_id "g519.t1"; gene_id "g519"; 3 AUGUSTUS stop_codon 1786218 1786220 . + 0 transcript_id "g519.t1"; gene_id "g519"; # protein sequence = [MPTPARPSASTTSSVSASQRTRQRSTSSQMSLLETPTSAHKKSPARSQSDSVQLVVKAKTSPQHHHSTSSHSSAGLLS # PENSVPSVSVGSASNVPSMWTAGEDSFDEDFSMDLDMITEENSDTLLGGDSELLPLLNEINTLHNRKLTSYKRLLERTQHSSAAQLHALQAEVQVLRE # QLQNGGGGRRTGNRGLRIGNGQDELDGGGYLCSSCGGQGGKSKKRYRAGSRGFESAGVPGERLAVIESQVAQLLAETRALRKQMALSEQYFLQIMRKA # DEYTDRLVAMEVVLPVAQPGIVGTSRLRSGMLQLPKKRRIVEDSEEEEEREESEDEEEEGEGAPAPKKKRTAESEEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g519 ### # start gene g520 3 AUGUSTUS gene 1787424 1787975 0.56 - . g520 3 AUGUSTUS transcript 1787424 1787975 0.56 - . g520.t1 3 AUGUSTUS stop_codon 1787424 1787426 . - 0 transcript_id "g520.t1"; gene_id "g520"; 3 AUGUSTUS CDS 1787424 1787975 0.56 - 0 transcript_id "g520.t1"; gene_id "g520"; 3 AUGUSTUS start_codon 1787973 1787975 . - 0 transcript_id "g520.t1"; gene_id "g520"; # protein sequence = [MPTTVEDITYMRDKPYREAVGALQYLSVATRPDIAYAVGILAKFLQNPGITHWNAVKRVYAYLKYTRDLWLTFGGTQA # EIEGYTDADGMSQEDRHAISGYVFMLNGGAVSWSSKRQDTISLSTTEAEYIALTHAAKEAIWFRNLLSELFGPITKPIILNADNQSAIALAKDDRFHA # RTKHIDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g520 ### # start gene g521 3 AUGUSTUS gene 1788045 1791888 0.71 - . g521 3 AUGUSTUS transcript 1788045 1791888 0.71 - . g521.t1 3 AUGUSTUS stop_codon 1788045 1788047 . - 0 transcript_id "g521.t1"; gene_id "g521"; 3 AUGUSTUS CDS 1788045 1790719 0.9 - 2 transcript_id "g521.t1"; gene_id "g521"; 3 AUGUSTUS CDS 1790838 1791888 0.72 - 0 transcript_id "g521.t1"; gene_id "g521"; 3 AUGUSTUS start_codon 1791886 1791888 . - 0 transcript_id "g521.t1"; gene_id "g521"; # protein sequence = [MSLRTNPPRKADNRPTKPTAACAHREHIFDKDDVKDRYHDPDGSKYRVCKDQPCPNRYDKITTGYIPSFARLIDRKQE # DLILGRGAPPEQVASSSSQKPEGTPEAAPAPEPEYPVFPPPPSPVLDRPSSPISSLPRSSPPPPDPEDPDPGAEVSDPESDDDDDNMSKVFKAFDKVS # TLKSDGSNWDTWKNRVELATRSIGFSNHLTSNPKDDTEAWEAKKDDDGNLLNAIVGRLSDQIYRRYKNYENVFDLWKNLLSDFDSKSALTEAHLQQQL # HSMHCHEPSKVNELLDKLLEIRDSLEARKITIPEEMFNNTIIASIPNIFKPTINALVVVAARTSVPLTTRELVSMIQASPGAEEMVIEEEVRVDQILT # IPHATIAVEKGSSLKRQQANEAQDSSQKKEKTQPSGSSSNSWRSKNKEVGSSATIEEVPESSWAAVEVTTTTSQEIFNFSEIASNYETAFVASHSSGA # ILFDSGCSSHMTPLQDKLRNTRSVPTRIIQAANAETFTSNTAGNLQIDLPINEDGISKSLTLQNTLLCPNTPNTLVSLGKLDDAGYVMVIKDGTLKII # NRQGETIGIIPKTNGLYQIPSTEYAYAGKAIRMVSLYEAHCIAGHQNYAYVKHMFKSNQVHGIKLDPKQMEEPECRTCMLAKAARSPISKIRTSPRAE # KFGDVFHMDVWGPASVQTLNHYVYALTVIDEATSWLEEPLMKGKDEAFAQYVILQTGLQTQYGVTVKKLHSDRGGEFLSGEFTAYLERLGTKRSLTVH # DTPEHNGIAERSHRTLLNGVRSLMISSGLPKWLWGFMMGYTVYVWNRTPKKANGMISPWEKRFGTIPDISNFHIFGSTVYVKREKEPGKLDPQAQEGR # WVGIEPESNGYFIYWPDRHTVSTERNVQFSDRQIQPVEGEDQDLGNLETSVTESEQPIIPVPEEIAEPINPDIITGKRVRKPTKKIQDIINGLGEPNR # ELRHLTASLGQVTGEIIADPTSVAEAMRRPDWSQWQEAMNEEIRRLQQRGTYDIVIPPDDANILTSKWVFRTKRDEQGKVTGHRARLVVRGFNQIPDV # DYFPDETFASVTKLAAARAILSTGAEQNMFIHQMDVKSAYLYGKLDDNEQIYMKAPPGVDIEVKAGQVLKLKLALYGLKQAGRRWYMRFREIMTSVGL # TRSNFDHAVFYRTDPFCIIFIHVDDMTMLTKTMAVMDTLKKKIRDQIKVVDSGEIHWLLGIEIRRSLHTRSIHLSQRAYIDAILS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g521 ### # start gene g522 3 AUGUSTUS gene 1793310 1794317 0.85 - . g522 3 AUGUSTUS transcript 1793310 1794317 0.85 - . g522.t1 3 AUGUSTUS stop_codon 1793310 1793312 . - 0 transcript_id "g522.t1"; gene_id "g522"; 3 AUGUSTUS CDS 1793310 1794317 0.85 - 0 transcript_id "g522.t1"; gene_id "g522"; 3 AUGUSTUS start_codon 1794315 1794317 . - 0 transcript_id "g522.t1"; gene_id "g522"; # protein sequence = [MQDEYTITSTYGEDVCGGSSTRAGRDEAIANLGKRWEANKVTTGVLLGMTIRQDPGTKVITISQKTYFQRMLNHFGLD # CVRRRNTPLLPNVKLKESPTPLPDEEYRYMADKQYRAVVGSILWGQVCTRPELAFTASLLARYQLNPGRAHWECVEWVVGYILNTLDYAIVYKAGVEP # GLKPYAYVDSDHAGCQDTYKSTSGYVFFMAGAPVSWSSKRQATVALLTTESKYIGLSRVTQQALWISSFLSEVDLAQEGPINMLGDNFGLVCLTENSK # GHALVKHIEMRHHYVREKVQSGEVNIKRIRLGENVADIFTKALNGTTHSKFVSMLRIDRME] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g522 ### # start gene g523 3 AUGUSTUS gene 1796316 1796714 0.98 + . g523 3 AUGUSTUS transcript 1796316 1796714 0.98 + . g523.t1 3 AUGUSTUS start_codon 1796316 1796318 . + 0 transcript_id "g523.t1"; gene_id "g523"; 3 AUGUSTUS CDS 1796316 1796714 0.98 + 0 transcript_id "g523.t1"; gene_id "g523"; 3 AUGUSTUS stop_codon 1796712 1796714 . + 0 transcript_id "g523.t1"; gene_id "g523"; # protein sequence = [MLDDQDAADVNQQELRDFLALQQGEAAITAKRKRDLSPLPVAGPSSKKGRSSASKKRLRRRSPVQETAQESPRRVRLV # VPPGRSMPTSTSTLLPPRASPSLMEVPDADLPVQGHSSLVRLAAVAEAQSGLVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g523 ### # start gene g524 3 AUGUSTUS gene 1797198 1797863 0.94 + . g524 3 AUGUSTUS transcript 1797198 1797863 0.94 + . g524.t1 3 AUGUSTUS start_codon 1797198 1797200 . + 0 transcript_id "g524.t1"; gene_id "g524"; 3 AUGUSTUS CDS 1797198 1797863 0.94 + 0 transcript_id "g524.t1"; gene_id "g524"; 3 AUGUSTUS stop_codon 1797861 1797863 . + 0 transcript_id "g524.t1"; gene_id "g524"; # protein sequence = [MEKLSTSTRRNSHLMTSLLYQQGIFDESNALVTRQRRLVEELQEEVHRARSRAAFVDQMIKEYPDEGYYEVVLPPLSQ # LEGDLNKAREDLHRVATFAHRLYRSDPATVLHHHYRYLGVIIEAVVAFLRCGLDSDDLDVAVHNFQLALDYMQVARGVHGDMYMRSLSSIQWFSNNAV # NEDEGLYRMVLAHSRFDNDGPFLTAAQHAGFAPPPDNSLEPPLHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g524 ### # start gene g525 3 AUGUSTUS gene 1802773 1804299 0.18 + . g525 3 AUGUSTUS transcript 1802773 1804299 0.18 + . g525.t1 3 AUGUSTUS start_codon 1802773 1802775 . + 0 transcript_id "g525.t1"; gene_id "g525"; 3 AUGUSTUS CDS 1802773 1804299 0.18 + 0 transcript_id "g525.t1"; gene_id "g525"; 3 AUGUSTUS stop_codon 1804297 1804299 . + 0 transcript_id "g525.t1"; gene_id "g525"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPLSGPSNQSNRFERNTTPRSSNG # TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNTRMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g525 ### # start gene g526 3 AUGUSTUS gene 1804329 1805582 1 + . g526 3 AUGUSTUS transcript 1804329 1805582 1 + . g526.t1 3 AUGUSTUS start_codon 1804329 1804331 . + 0 transcript_id "g526.t1"; gene_id "g526"; 3 AUGUSTUS CDS 1804329 1805582 1 + 0 transcript_id "g526.t1"; gene_id "g526"; 3 AUGUSTUS stop_codon 1805580 1805582 . + 0 transcript_id "g526.t1"; gene_id "g526"; # protein sequence = [MRTSRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINNEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGTEIPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g526 ### # start gene g527 3 AUGUSTUS gene 1805860 1806645 0.99 + . g527 3 AUGUSTUS transcript 1805860 1806645 0.99 + . g527.t1 3 AUGUSTUS start_codon 1805860 1805862 . + 0 transcript_id "g527.t1"; gene_id "g527"; 3 AUGUSTUS CDS 1805860 1806645 0.99 + 0 transcript_id "g527.t1"; gene_id "g527"; 3 AUGUSTUS stop_codon 1806643 1806645 . + 0 transcript_id "g527.t1"; gene_id "g527"; # protein sequence = [MFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFYDQLNNEQFNLNPIKSFFLQNG # RIKPKPVRKKVQKRRFVEPILQKFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESR # QRKKGKAQDSKDKKENVQADVLNEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINSNTEEVFTKYKPVDKRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g527 ### # start gene g528 3 AUGUSTUS gene 1807639 1809956 0.08 + . g528 3 AUGUSTUS transcript 1807639 1809956 0.08 + . g528.t1 3 AUGUSTUS start_codon 1807639 1807641 . + 0 transcript_id "g528.t1"; gene_id "g528"; 3 AUGUSTUS CDS 1807639 1807789 0.91 + 0 transcript_id "g528.t1"; gene_id "g528"; 3 AUGUSTUS CDS 1808442 1808568 0.98 + 2 transcript_id "g528.t1"; gene_id "g528"; 3 AUGUSTUS CDS 1808625 1808869 0.44 + 1 transcript_id "g528.t1"; gene_id "g528"; 3 AUGUSTUS CDS 1809520 1809956 0.4 + 2 transcript_id "g528.t1"; gene_id "g528"; 3 AUGUSTUS stop_codon 1809954 1809956 . + 0 transcript_id "g528.t1"; gene_id "g528"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTTQEADDIELDVQEALDEERSYEIRRNHM # LESKDATCEVFSRSLSSEGNRLGELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDRGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDLE # STWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFEQKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRT # KGGSYIIAEMDGTVLKEKVGAFRYCRISREMNQLNCQTIFTNLST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g528 ### # start gene g529 3 AUGUSTUS gene 1810364 1810933 0.65 - . g529 3 AUGUSTUS transcript 1810364 1810933 0.65 - . g529.t1 3 AUGUSTUS stop_codon 1810364 1810366 . - 0 transcript_id "g529.t1"; gene_id "g529"; 3 AUGUSTUS CDS 1810364 1810791 0.99 - 2 transcript_id "g529.t1"; gene_id "g529"; 3 AUGUSTUS CDS 1810873 1810933 0.65 - 0 transcript_id "g529.t1"; gene_id "g529"; 3 AUGUSTUS start_codon 1810931 1810933 . - 0 transcript_id "g529.t1"; gene_id "g529"; # protein sequence = [MFSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATR # ARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVEQATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g529 ### # start gene g530 3 AUGUSTUS gene 1886516 1887946 1 - . g530 3 AUGUSTUS transcript 1886516 1887946 1 - . g530.t1 3 AUGUSTUS stop_codon 1886516 1886518 . - 0 transcript_id "g530.t1"; gene_id "g530"; 3 AUGUSTUS CDS 1886516 1887946 1 - 0 transcript_id "g530.t1"; gene_id "g530"; 3 AUGUSTUS start_codon 1887944 1887946 . - 0 transcript_id "g530.t1"; gene_id "g530"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVYIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDQSLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQMNSEHRPYDHVQPRTYCPIQINTPTKVPRDQMNQIDSHGYTPAYKIRNEVSRPGVEENIAKKIFNAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSKDGETEILDEPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVHLIMKNRQVKMIQR # EIFIPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g530 ### # start gene g531 3 AUGUSTUS gene 1887976 1890963 0.2 - . g531 3 AUGUSTUS transcript 1887976 1890963 0.2 - . g531.t1 3 AUGUSTUS stop_codon 1887976 1887978 . - 0 transcript_id "g531.t1"; gene_id "g531"; 3 AUGUSTUS CDS 1887976 1889945 0.66 - 2 transcript_id "g531.t1"; gene_id "g531"; 3 AUGUSTUS CDS 1890948 1890963 0.33 - 0 transcript_id "g531.t1"; gene_id "g531"; 3 AUGUSTUS start_codon 1890961 1890963 . - 0 transcript_id "g531.t1"; gene_id "g531"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQITTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDLEEDRIELIAPESISTSSTLIESTRLIDTLHQTISQASNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFNAEMKKLMDELKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ # SHFKEGADIITQLTAVMAQMAKENAKGMINSIPPSGSSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMDECPHLLEFTKRGWMMPEGGDSKRYKLK # DNARMPRDDPNIPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g531 ### # start gene g532 3 AUGUSTUS gene 1892916 1893613 0.53 + . g532 3 AUGUSTUS transcript 1892916 1893613 0.53 + . g532.t1 3 AUGUSTUS start_codon 1892916 1892918 . + 0 transcript_id "g532.t1"; gene_id "g532"; 3 AUGUSTUS CDS 1892916 1893126 0.53 + 0 transcript_id "g532.t1"; gene_id "g532"; 3 AUGUSTUS CDS 1893192 1893613 0.97 + 2 transcript_id "g532.t1"; gene_id "g532"; 3 AUGUSTUS stop_codon 1893611 1893613 . + 0 transcript_id "g532.t1"; gene_id "g532"; # protein sequence = [MMRSVPSKDLDAFASLRGKGSLAGASKRNPLAPPLEIKSSTSIPKAPVAPPRLIRRNRELENLKADASSFLASPRSTR # SRDSDNELLSGFPLVDAAPRASSPTKVPVSRKEPKSKTAVKVVEDSKASDPPTSALVYKRVRLPPRSRKIAPAASKGKARQTIVTEADSASSEVESED # EDEEEDSAPPPKRLKTTSSISGKSLFFIYFVLFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g532 ### # start gene g533 3 AUGUSTUS gene 1895946 1897396 0.26 + . g533 3 AUGUSTUS transcript 1895946 1897396 0.26 + . g533.t1 3 AUGUSTUS start_codon 1895946 1895948 . + 0 transcript_id "g533.t1"; gene_id "g533"; 3 AUGUSTUS CDS 1895946 1896113 0.95 + 0 transcript_id "g533.t1"; gene_id "g533"; 3 AUGUSTUS CDS 1896755 1896887 0.97 + 0 transcript_id "g533.t1"; gene_id "g533"; 3 AUGUSTUS CDS 1896969 1897396 1 + 2 transcript_id "g533.t1"; gene_id "g533"; 3 AUGUSTUS stop_codon 1897394 1897396 . + 0 transcript_id "g533.t1"; gene_id "g533"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRGTPYPTGPNKGSNKDEKSA # VNEVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSR # QDSGSDSSVSDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g533 ### # start gene g534 3 AUGUSTUS gene 1897658 1898692 0.56 - . g534 3 AUGUSTUS transcript 1897658 1898692 0.56 - . g534.t1 3 AUGUSTUS stop_codon 1897658 1897660 . - 0 transcript_id "g534.t1"; gene_id "g534"; 3 AUGUSTUS CDS 1897658 1898692 0.56 - 0 transcript_id "g534.t1"; gene_id "g534"; 3 AUGUSTUS start_codon 1898690 1898692 . - 0 transcript_id "g534.t1"; gene_id "g534"; # protein sequence = [MSIPSNGCKYIIHGRDSLSSWSEAQAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIR # ISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYHAQA # LSKHNSFIGKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRV # LPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g534 ### # start gene g535 3 AUGUSTUS gene 1898990 1899625 1 - . g535 3 AUGUSTUS transcript 1898990 1899625 1 - . g535.t1 3 AUGUSTUS stop_codon 1898990 1898992 . - 0 transcript_id "g535.t1"; gene_id "g535"; 3 AUGUSTUS CDS 1898990 1899625 1 - 0 transcript_id "g535.t1"; gene_id "g535"; 3 AUGUSTUS start_codon 1899623 1899625 . - 0 transcript_id "g535.t1"; gene_id "g535"; # protein sequence = [MLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGET # EEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLGELIPL # IGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g535 ### # start gene g536 3 AUGUSTUS gene 1899685 1902602 0.98 - . g536 3 AUGUSTUS transcript 1899685 1902602 0.98 - . g536.t1 3 AUGUSTUS stop_codon 1899685 1899687 . - 0 transcript_id "g536.t1"; gene_id "g536"; 3 AUGUSTUS CDS 1899685 1901096 1 - 2 transcript_id "g536.t1"; gene_id "g536"; 3 AUGUSTUS CDS 1901171 1902602 0.98 - 0 transcript_id "g536.t1"; gene_id "g536"; 3 AUGUSTUS start_codon 1902600 1902602 . - 0 transcript_id "g536.t1"; gene_id "g536"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVDEPDDEDTIKLIPSSRPTNQINNEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLCAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNEQFNLNPIKSFFLQNGRIKP # KPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKK # GKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDEGNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHG # DPLLELPELSKHPKPFAPTGRYTEERKEIIDKNHPEGFLWERERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIF # EDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLWRAVRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g536 ### # start gene g537 3 AUGUSTUS gene 1902632 1905619 0.21 - . g537 3 AUGUSTUS transcript 1902632 1905619 0.21 - . g537.t1 3 AUGUSTUS stop_codon 1902632 1902634 . - 0 transcript_id "g537.t1"; gene_id "g537"; 3 AUGUSTUS CDS 1902632 1904601 0.5 - 2 transcript_id "g537.t1"; gene_id "g537"; 3 AUGUSTUS CDS 1905604 1905619 0.4 - 0 transcript_id "g537.t1"; gene_id "g537"; 3 AUGUSTUS start_codon 1905617 1905619 . - 0 transcript_id "g537.t1"; gene_id "g537"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQITTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDLEEDRIELIAPESISTSSTLIESTRLIDTLHQTISQASNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDELKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ # SHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLR # DNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g537 ### # start gene g538 3 AUGUSTUS gene 1919845 1921050 0.49 - . g538 3 AUGUSTUS transcript 1919845 1921050 0.49 - . g538.t1 3 AUGUSTUS stop_codon 1919845 1919847 . - 0 transcript_id "g538.t1"; gene_id "g538"; 3 AUGUSTUS CDS 1919845 1920314 0.58 - 2 transcript_id "g538.t1"; gene_id "g538"; 3 AUGUSTUS CDS 1920423 1920722 0.53 - 2 transcript_id "g538.t1"; gene_id "g538"; 3 AUGUSTUS CDS 1920876 1921050 0.9 - 0 transcript_id "g538.t1"; gene_id "g538"; 3 AUGUSTUS start_codon 1921048 1921050 . - 0 transcript_id "g538.t1"; gene_id "g538"; # protein sequence = [MVPELPGVILPDFNVSSSPGLIDIQINGAYGFDFSVFDGDDDVYQSNLKDVAERIVETVYPKILRLLRPFATVTSATV # LGWHAEGPFIDMAKRGAHAPSFLVSAPEGIKSFEELYGAENLADSEDWLMSTGSESGVRIITAAPEVPGVMGTVEELTKRAVRHGARLITHLFNAMPQ # LHHRDPSIIGLLGASPHLYSPFSPITSKALYTGDVMSPIALTPMKPNKSSITGLKSPVGSEALDEVETPPQTPIFKAHSGKNSTLKNTQSIAGFSLDS # SEFTRPFYEMIVDGVHSHPNSVRVSSFFETTQCFGALHVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g538 ### # start gene g539 3 AUGUSTUS gene 1924149 1925920 0.14 - . g539 3 AUGUSTUS transcript 1924149 1925920 0.14 - . g539.t1 3 AUGUSTUS stop_codon 1924149 1924151 . - 0 transcript_id "g539.t1"; gene_id "g539"; 3 AUGUSTUS CDS 1924149 1924919 0.57 - 0 transcript_id "g539.t1"; gene_id "g539"; 3 AUGUSTUS CDS 1924974 1925268 0.67 - 1 transcript_id "g539.t1"; gene_id "g539"; 3 AUGUSTUS CDS 1925409 1925920 0.26 - 0 transcript_id "g539.t1"; gene_id "g539"; 3 AUGUSTUS start_codon 1925918 1925920 . - 0 transcript_id "g539.t1"; gene_id "g539"; # protein sequence = [MHRPSPLPLPMAQIIASDAPLLSPTGDSSYQQSLSNDSFTYNYYLPPSPPNSVGSLVADSPIPAERVLKMRVAVPDRH # DGQEMCISTHKLFESHGVHQPHSPSSPSFESTASRPSIDEQPVVTSPIASTATLKRSASPTPSASRKRSVGERISTKDFIPPDVSGLSKREARRVAEL # EQENARLLAISQMTESFTHPKSQSESELASEVDMLRAQLADARQRELELSQELATRSTPSDPPVKIEAAEPSFPLSSPRSQSPHKSAASLGLMVLLCA # LPTLLSMPTQSSFPTSFSLPSAFPASPSSSDFNSIFPPNFDWSRNSIMDLETDEHGRIMPAPQKLEFSNPELSKSLGALGGLDISFDAVPQENGKIRV # RIHPSSSASSRAGSPGLSNPVSNSNGHGALGLDLWGLPDSDNPTLQAAFSSDPSYYGGASSSFTTYSSSSSNGDPFLGVGGPSHNDFGGLSPFSSTSS # FGSGDMDYDFARASDYSPSLTGSDSLSGNKRRVRIALKSMPATGGEGGEWEVQFC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g539 ### # start gene g540 3 AUGUSTUS gene 1938866 1939669 0.56 - . g540 3 AUGUSTUS transcript 1938866 1939669 0.56 - . g540.t1 3 AUGUSTUS stop_codon 1938866 1938868 . - 0 transcript_id "g540.t1"; gene_id "g540"; 3 AUGUSTUS CDS 1938866 1939669 0.56 - 0 transcript_id "g540.t1"; gene_id "g540"; 3 AUGUSTUS start_codon 1939667 1939669 . - 0 transcript_id "g540.t1"; gene_id "g540"; # protein sequence = [MHLLTRYPLDDIRSAPAKKREHYLSRAAMRAFVGWAGFTDIKPLPQGTPILEQGDAVDHPLMRHAVSNYAGFLRMHNP # LELPPVPTSNPATVGLPSTPSEKVEVQADSTHAVASDLPISTASDAFEEVTPIPSAEPVVDPLVTPASDPSPLPISTVSNPTPTPKPTPAPSQLANSP # EAIAQLRMANSILKKIHNPKKAKTQVHSQSQTNRNLTPGPPPQKSRRPQKNATPSAQSGEHPVSVEVDGKAVDTSKNNATGKLRGFMGNWF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g540 ### # start gene g541 3 AUGUSTUS gene 1940467 1941664 0.74 + . g541 3 AUGUSTUS transcript 1940467 1941664 0.74 + . g541.t1 3 AUGUSTUS start_codon 1940467 1940469 . + 0 transcript_id "g541.t1"; gene_id "g541"; 3 AUGUSTUS CDS 1940467 1940931 0.78 + 0 transcript_id "g541.t1"; gene_id "g541"; 3 AUGUSTUS CDS 1941086 1941664 0.94 + 0 transcript_id "g541.t1"; gene_id "g541"; 3 AUGUSTUS stop_codon 1941662 1941664 . + 0 transcript_id "g541.t1"; gene_id "g541"; # protein sequence = [MPKLHLKRTPEEEAARRVRKLEKREAKRRRKHDHYGYGSSSSKRQQRTAVVEEDNSCDEEDGEEFIGPVPGPSNYQPD # YETIRAEIEEQRFREKMAMAFDDDERLDSIEARFNSFAHVPMHWGGKNNSKPRINYDNDQFLAVDPMTMDDEEYAEWAIRAETERLQKVAAAERWSHK # LKKENKRLELLRLEYQKRWKLLLSNTQPADIADIGFNDIPWPILLAYKHKSDKKSVSDTVSSLSLDDFTPDAISTFLFTSPPSANTSIDTDTDIGKTS # SSSSSASAQRLSEAETENPKKGRKEKLRETLLRFHPDKFEGRLMSRVRPEEKEKVTQALGIVVRVLNDLMGEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g541 ### # start gene g542 3 AUGUSTUS gene 1942410 1943102 0.41 - . g542 3 AUGUSTUS transcript 1942410 1943102 0.41 - . g542.t1 3 AUGUSTUS stop_codon 1942410 1942412 . - 0 transcript_id "g542.t1"; gene_id "g542"; 3 AUGUSTUS CDS 1942410 1943102 0.41 - 0 transcript_id "g542.t1"; gene_id "g542"; 3 AUGUSTUS start_codon 1943100 1943102 . - 0 transcript_id "g542.t1"; gene_id "g542"; # protein sequence = [MMPLLSQVYRGRIGKDQAKLDEYGGQKMEAQVVEGGIKIAAIEQRDLEYDPALYRRDRGELDWDARSIASTTLMNDAA # SIAPSQMQGGASLPGYDKYLASGPGAYELSRLDSQQEPLLSGKIYEGMYPSQNSLSMPPAMYRDASSDGLSREAPLHRPQDYFGDYPQRSNSPYMDTR # SNTPVSQYPPQPNRQYTASPQAQYSPRPSPHHDSPSQLYPPQDQNMAGRGTYRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g542 ### # start gene g543 3 AUGUSTUS gene 1947421 1948473 0.96 - . g543 3 AUGUSTUS transcript 1947421 1948473 0.96 - . g543.t1 3 AUGUSTUS stop_codon 1947421 1947423 . - 0 transcript_id "g543.t1"; gene_id "g543"; 3 AUGUSTUS CDS 1947421 1948473 0.96 - 0 transcript_id "g543.t1"; gene_id "g543"; 3 AUGUSTUS start_codon 1948471 1948473 . - 0 transcript_id "g543.t1"; gene_id "g543"; # protein sequence = [MKTFERCSRDFNLGSTSTTPHPYDPVLLQTYKHFIYILVDVCYLYTNDPHEIQYIAAARWPGFIKPVLDAHSMNVEAA # AEDDDIEFERPSTELLLRLTRHFKPSLSLALEQLYPRLTNAADWARTNESDASSLAKDGLILSDTVLDDVEEEEDTVNEMLLSSPSRPRTSKRIQEQK # VAQDLSSSDIKDTLPLSVSLPRLSQFILVAAYIASMNPQKTDLRLFGRGTDEKKRRRRATKRQMANAKPKSGPAKIPQRFSGPSPFPLERLIAILGAL # VEENDPVASEVISSQNVPADGLDFRIPGERTDYEVTRVGVYASVSVVVSLVRRILLIVHSDCTIDVSASTCEDYLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g543 ### # start gene g544 3 AUGUSTUS gene 1949280 1950242 0.44 - . g544 3 AUGUSTUS transcript 1949280 1950242 0.44 - . g544.t1 3 AUGUSTUS stop_codon 1949280 1949282 . - 0 transcript_id "g544.t1"; gene_id "g544"; 3 AUGUSTUS CDS 1949280 1950242 0.44 - 0 transcript_id "g544.t1"; gene_id "g544"; 3 AUGUSTUS start_codon 1950240 1950242 . - 0 transcript_id "g544.t1"; gene_id "g544"; # protein sequence = [MTLKVGLFIPSLHAISELSVYSIGLTSSLEPGGMMDALPQLLETLHRLQVIPSPNIPNLYDSDPKCPSNKRKRTNVPQ # SATEKVQQWQACQNQVVPEEQDNTVAEVESQNKRSRSMAPPPPSTNMIEYHEMGPDQNPVRPSQKQVRVVLRKLKEFPNARIRVKNQLEETKEMLNIV # ESVHQQTEGKLTEMRWTRYIIEEDVLRHQKQDRTLVDGTTKLGSTSLQAREWRDWIQENTISQKLQQASVGVPENLAGASSVAREPIPINAIAYRSEG # KGWGYWKNMYGPRADDEEYQEGVEEEDEEKQGEDEEEEYSESEVEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g544 ### # start gene g545 3 AUGUSTUS gene 1951111 1952672 0.15 + . g545 3 AUGUSTUS transcript 1951111 1952672 0.15 + . g545.t1 3 AUGUSTUS start_codon 1951111 1951113 . + 0 transcript_id "g545.t1"; gene_id "g545"; 3 AUGUSTUS CDS 1951111 1951361 0.98 + 0 transcript_id "g545.t1"; gene_id "g545"; 3 AUGUSTUS CDS 1951408 1951700 0.18 + 1 transcript_id "g545.t1"; gene_id "g545"; 3 AUGUSTUS CDS 1951810 1952672 0.53 + 2 transcript_id "g545.t1"; gene_id "g545"; 3 AUGUSTUS stop_codon 1952670 1952672 . + 0 transcript_id "g545.t1"; gene_id "g545"; # protein sequence = [MAIEAYDLIQEDALTQLTRAELQALGKVRVVEYPSSLHVISYSSSVFTHVPLVPQAHNVKANLKSATIISQLLKKFPD # GVPNPNPHSTNSALAPRKKGRTKRGDAKKKKAQIKKEESVIASVMFSNGDSGLEHNEGRTSASPSGNPPVTNDEVTTETVSRPTKSRPTRATSRKQTA # FKEPFKIATTPLPNEPATGEPPQIPTPQIELEAAGGEESEIVPGKTYHIGYGDALTDTRLLVEPTGDENEVDMDNLSEVSEITHNPSESSRGASPQPL # ANDATLKYVVDIIKANTEKDKQMRDEIKILQERAANAKKLLQEQNYLLTAEREHRDRIISFFLYHIRNNNRWIGQSLNPGELEANVLKEFVSNGGRGW # RDMGEWEYGEVWSGPMVVSDSNIEITASNLDEYLRDMWDIHQRERKEGKMKANHSSINRLVQHDIDVSCSCFSHSMMYSQCPAALTPCRYSRCSRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g545 ### # start gene g546 3 AUGUSTUS gene 1953854 1954869 0.51 + . g546 3 AUGUSTUS transcript 1953854 1954869 0.51 + . g546.t1 3 AUGUSTUS start_codon 1953854 1953856 . + 0 transcript_id "g546.t1"; gene_id "g546"; 3 AUGUSTUS CDS 1953854 1953971 0.52 + 0 transcript_id "g546.t1"; gene_id "g546"; 3 AUGUSTUS CDS 1954227 1954348 0.78 + 2 transcript_id "g546.t1"; gene_id "g546"; 3 AUGUSTUS CDS 1954396 1954869 0.88 + 0 transcript_id "g546.t1"; gene_id "g546"; 3 AUGUSTUS stop_codon 1954867 1954869 . + 0 transcript_id "g546.t1"; gene_id "g546"; # protein sequence = [MPFNPPGGGGGPGPGGSGGSFQFTGSPFFDATLTTLVGLGLEDPDSVPWTEHLRRREQDRIDRMVKGEEVGHYYVLLG # PKGSGKGTMIYDSMSAIKADGVAMCDAHPDLEVFRLRLGKALNYEYNEDSQTGLFQRRDPREGGAALDIERGTQPSFCVISSAQIPLALNKLEKVALR # CARRRHKPLVLIINNVHYFNNDEAGRNMLLQLQQRAEAWAASGMLFVPFLNPGFMEVSQGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g546 ### # start gene g547 3 AUGUSTUS gene 1956615 1961116 0.14 - . g547 3 AUGUSTUS transcript 1956615 1961116 0.14 - . g547.t1 3 AUGUSTUS stop_codon 1956615 1956617 . - 0 transcript_id "g547.t1"; gene_id "g547"; 3 AUGUSTUS CDS 1956615 1959252 0.36 - 1 transcript_id "g547.t1"; gene_id "g547"; 3 AUGUSTUS CDS 1960367 1960410 0.26 - 0 transcript_id "g547.t1"; gene_id "g547"; 3 AUGUSTUS CDS 1960517 1961116 0.19 - 0 transcript_id "g547.t1"; gene_id "g547"; 3 AUGUSTUS start_codon 1961114 1961116 . - 0 transcript_id "g547.t1"; gene_id "g547"; # protein sequence = [MILLSFDQLTCSVFKTTSAPESLLLSTPLPPSPYSPTSSTPSHRIDLQSFTQTRIAPRSVSRLDHNSWNSNSDESNMV # NKSDTPGSPRSDTTQHMSDISDSIASMSLDEAIQQPFQHASSILPETNIDIDCCGCLVHWEPGSVWTNYSFAMHSARKDQLPWELVRTSDDGRTIFIR # AHGCRGKLLDEREMDSGCCHICRNLYDERLYMKSNCAPRLSSKFNNSQTSGFATLLRSWSGILVNDTWLSSQDFRTGLMATGLSKDEADNLLDPADKQ # NVPKAVRLIQDLVSLGNKPMPSHPDEEKRRIATNAVAEALSYFVIPFIDVAMDLEAQCISLATYAHITAAMFLKERLNFLTSALYADSHAIGNYLFSV # LTKPITPADIYVYIVKNIFFTIAKLSLDDPDILYYIILDGTDRLERIFSNVRTQDHNRNFDTLQLAQKLSIAAEIVATLLRNTDLDSGHRRLNLHGAI # GVDHINPKSCMGNYRVGDVDIARAWRAGAHAANNILVRIFGPTGCIDFDSIFAPHDLDFLRPTRNGYVGSSFEDNEGSRLDCSVEEDVDSGYAAVIPH # GISDEEDEELPLGAQNLEDQLDLHNAMQEEEEVEGSKSFANHFLDIPDTTDPSKTRKYLKSSLVRVLCGGNHDRRKVAMRTLRAQGVTMDDLRRKVLN # EWDDDTVADSVDKMKAGDPAAVLVVIGKGDGASVSLAVVSVVGFSIPNVRGLASEAPMDWLETKGDRCPSAIVQILDLIPSDSTANRSWDWNGEYIRI # APETADQSITVSKQYQFTVPGYLMHPLAVQAIKAPASCALSATWRIAHSELLDSRDFAWSMLSPENEDFISNFDTLPSFPASAITLTHLPYRDSNGVY # PFIIEEIPANVLVSKKEGNDEVPCKLCSKKMKLTEMRTHVGAHILHMARYSDDEDVDEIIPNPCDWCGWCGHNDAGCWSKLVLDPKGKKQPKIESNCE # YHYSKMQYNRAAAWSPTSPCTNVPIHCPICSESLSGERRTFWKYNAVYHLLSEHSENDNGRVSLHAVPLEFILATFTSRREEEALGIPEDATMDFRDA # YGIPMSDDLQLQIDELSRKRGLSNADTTEHITKRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g547 ### # start gene g548 3 AUGUSTUS gene 1962549 1963902 0.77 - . g548 3 AUGUSTUS transcript 1962549 1963902 0.77 - . g548.t1 3 AUGUSTUS stop_codon 1962549 1962551 . - 0 transcript_id "g548.t1"; gene_id "g548"; 3 AUGUSTUS CDS 1962549 1963678 0.94 - 2 transcript_id "g548.t1"; gene_id "g548"; 3 AUGUSTUS CDS 1963752 1963902 0.77 - 0 transcript_id "g548.t1"; gene_id "g548"; 3 AUGUSTUS start_codon 1963900 1963902 . - 0 transcript_id "g548.t1"; gene_id "g548"; # protein sequence = [MIINNKTAGTHYKKDTRTACLFRPLSAQITSELEDCEFLMSNEYERPLTTYPSFTDWLFKEAARGSTETETTLPEPSV # ELSERPAEPAPSRTISHPANDTSRRGSNPPRNGIYQQALSQALPSSSSSQKRPASARSPSPNHPNKMRRTEPPTGPRAMHRDGQLSNNSRSLLDRVGG # PAVGGQQDEIQARIDTIVNTGDPNMMMAGGFPGMNGMDMNAMAAGMANPMMIQELMMNQMALMAHFSGIMNPGQFGGFPMQGVMPQEMGMPQQNMGVN # GFQGQSSGPNRGRGTGGRGGRGASRGRGGPLISSVTSKIEEVPTESPAISTPIAVPTPSTTIKAPMSDATPPVAPSRLAYAVPERPQSPTLCKFGLKC # TNAHCRWSHPSPVATAESGMVLSNDPCENGKHCKDKDCIKAHVSPAALKPQGMC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g548 ### # start gene g549 3 AUGUSTUS gene 1966508 1967522 0.26 - . g549 3 AUGUSTUS transcript 1966508 1967522 0.26 - . g549.t1 3 AUGUSTUS stop_codon 1966508 1966510 . - 0 transcript_id "g549.t1"; gene_id "g549"; 3 AUGUSTUS CDS 1966508 1967392 0.38 - 0 transcript_id "g549.t1"; gene_id "g549"; 3 AUGUSTUS CDS 1967448 1967522 0.26 - 0 transcript_id "g549.t1"; gene_id "g549"; 3 AUGUSTUS start_codon 1967520 1967522 . - 0 transcript_id "g549.t1"; gene_id "g549"; # protein sequence = [MDSIHNVDALKKAASRNRNFQPIPSSSVPPQSHVKDPFYGYEYIARLCARFITHLFACPEYPPTSTQSQAKLPHFIAY # AFHRTKLHESVTFAALALLQRLKARFPTARGSSGHRLFISAFMIASKVICDDTYSNKSWSIVAQGMFTLREINQMEREMCNYLDWELTVDNPILADFT # TMVKEDFSSSQGPYPTYPLKVVSKRAAKAASTSTKSTPIPEHNSTTSPIPIGHPSSPRKPPQSLVPPRKGSPTIDMSPDTPASSYSDTTSPATSSSPQ # TPIGDEDFSAKIRDNDYPLGFSITEKHMGAALKSKTFAFAVPAVW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g549 ### # start gene g550 3 AUGUSTUS gene 1970633 1971309 0.39 + . g550 3 AUGUSTUS transcript 1970633 1971309 0.39 + . g550.t1 3 AUGUSTUS start_codon 1970633 1970635 . + 0 transcript_id "g550.t1"; gene_id "g550"; 3 AUGUSTUS CDS 1970633 1970655 0.43 + 0 transcript_id "g550.t1"; gene_id "g550"; 3 AUGUSTUS CDS 1970724 1971309 0.6 + 1 transcript_id "g550.t1"; gene_id "g550"; 3 AUGUSTUS stop_codon 1971307 1971309 . + 0 transcript_id "g550.t1"; gene_id "g550"; # protein sequence = [MYGTTDSTTQRTLWFNAAKKDEDRRTLNNNDARSELRQSANNFAERFTGASFPLDRMMAESTVSNLDSFVQRNRPLPE # PKAISQEIRDRSSTFVATIFSAATPEEAKSHVQYLRKVLHASRPATHEISAYRCMMLKPGKTGLAGPDDFELKTGYEDDGEQWAGIKVLKVMESLAVL # DAVVICSRWYLYKLCLLSAVVVNLSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g550 ### # start gene g551 3 AUGUSTUS gene 1971419 1971649 0.65 + . g551 3 AUGUSTUS transcript 1971419 1971649 0.65 + . g551.t1 3 AUGUSTUS start_codon 1971419 1971421 . + 0 transcript_id "g551.t1"; gene_id "g551"; 3 AUGUSTUS CDS 1971419 1971649 0.65 + 0 transcript_id "g551.t1"; gene_id "g551"; 3 AUGUSTUS stop_codon 1971647 1971649 . + 0 transcript_id "g551.t1"; gene_id "g551"; # protein sequence = [MLSTLDDILKQLRDELALLSGPLTSSNDDSSPHLRLKPPDYTLWTESDLPKAKRLVIAREKAIASVKNMIAKRRSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g551 ### # start gene g552 3 AUGUSTUS gene 1972903 1973568 0.99 + . g552 3 AUGUSTUS transcript 1972903 1973568 0.99 + . g552.t1 3 AUGUSTUS start_codon 1972903 1972905 . + 0 transcript_id "g552.t1"; gene_id "g552"; 3 AUGUSTUS CDS 1972903 1973568 0.99 + 0 transcript_id "g552.t1"; gene_id "g552"; 3 AUGUSTUS stop_codon 1973566 1973568 . + 0 transcript_id "g552.t1"; gene_id "g552"; # protein sequence = [MALPSAVLHISNHILSQLSKAVTRPLFVALQGPQGSGKSFLANLVRSHLSAPPHALNVVVLSIDDLYLTHEELVTLAQ # RNPDNPLWRGRGQPGTHDVELGSKVLRSLKEGKNGIELPRFDKSLFDGEGDRLHLDGTGTIVDSPVDVFIMEGWFMGFYPVSLQELQTKWDGIWAQER # QLLGLNDAVVGTKDDIADVNEALKGYMEIWEFFDTIVKVGTYFLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g552 ### # start gene g553 3 AUGUSTUS gene 1974305 1975180 0.99 + . g553 3 AUGUSTUS transcript 1974305 1975180 0.99 + . g553.t1 3 AUGUSTUS start_codon 1974305 1974307 . + 0 transcript_id "g553.t1"; gene_id "g553"; 3 AUGUSTUS CDS 1974305 1975180 0.99 + 0 transcript_id "g553.t1"; gene_id "g553"; 3 AUGUSTUS stop_codon 1975178 1975180 . + 0 transcript_id "g553.t1"; gene_id "g553"; # protein sequence = [MQSARSHIPKAPVYNPYDKFPQTDFDAWIGGITGTLRKVLRHEEEPEPQPQEEKWYYRIGDEEGPQINGYGGKETDGE # SSGEEQLDDSFAAMRARRVKGKARDPREGPGLAAGTINEPIELGSEDEGSDEGVELDVGSDDEELDEEEKYYDSEGEDDPEYERDSARASHRSTRSPT # PSRRRRTVVEDPAEEEEDKDEEGQRSSQGGPEEIEDEQEEEEVSGEISTEDSVNTHARPYDLEDEDGDCFGSPLRPLTFENEHAHRRNSPEDDRQEIH # DVDEEEQPVSENTGTLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g553 ### # start gene g554 3 AUGUSTUS gene 1975211 1976700 0.16 + . g554 3 AUGUSTUS transcript 1975211 1976700 0.16 + . g554.t1 3 AUGUSTUS start_codon 1975211 1975213 . + 0 transcript_id "g554.t1"; gene_id "g554"; 3 AUGUSTUS CDS 1975211 1975721 0.96 + 0 transcript_id "g554.t1"; gene_id "g554"; 3 AUGUSTUS CDS 1975786 1976042 0.48 + 2 transcript_id "g554.t1"; gene_id "g554"; 3 AUGUSTUS CDS 1976140 1976700 0.31 + 0 transcript_id "g554.t1"; gene_id "g554"; 3 AUGUSTUS stop_codon 1976698 1976700 . + 0 transcript_id "g554.t1"; gene_id "g554"; # protein sequence = [MVAFPLDAEQDELYTSQPLSLPDIWEGPQTYAEDYYSGGDVMHDSVFPLSADALNEHDVNEKASDSGFFLTPGLLTPN # GFNVSSPAASDEEQVAVPSSTEKTKSPQLLQDIHDENGKAYNERSNSPLPGSSPLPMSPEFDPEDQYVNNQPSPVYILSDEEEQEQNQFDMRERSSPP # PEYEIDDEVDATPDNDYQDVFADTDADVLAADTVIPLGTSDLDIIDEVDVEAENATIYENELSIEEDKLPALEGKLLACYNSFALKEPLDDVTNPLEM # EAGEALVGLQKTISPLPKPISIPSIETTSRTDLETDSQNINEADVEMVSQSVEIEADVSHSSPLLIGTDVGIAVTVQDIESEETPELMYPENGDVYSV # VSVISEEQDELDEDGEYDLDVESIPGTDVVINLYEVEEILTEGRLTIVSFACSFSLPHIIKVLFSGAGNQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g554 ### # start gene g555 3 AUGUSTUS gene 1977071 1979992 0.39 + . g555 3 AUGUSTUS transcript 1977071 1979992 0.39 + . g555.t1 3 AUGUSTUS start_codon 1977071 1977073 . + 0 transcript_id "g555.t1"; gene_id "g555"; 3 AUGUSTUS CDS 1977071 1978331 0.39 + 0 transcript_id "g555.t1"; gene_id "g555"; 3 AUGUSTUS CDS 1978428 1979992 0.39 + 2 transcript_id "g555.t1"; gene_id "g555"; 3 AUGUSTUS stop_codon 1979990 1979992 . + 0 transcript_id "g555.t1"; gene_id "g555"; # protein sequence = [MLDVSASGPGTPQPSLPLLSPAESSHALGDNTSVNDIIDARKHDLGVSTTPDIVQVLDHEKSSVQSIAATISETPALG # SQTELSTISSDADDISTTHALAPGTIEEKSFGPPVQLPDTFIAELLTRKGIPVLHADPYPASLSTPTDEAEDGSVTDDEVDEIDQDSIISTEVSSSNS # SLEEDKSLTISSELPVQTANEELDETGEDMDMDLQYPPSDEEKTAPASSSGIAHTVADELDFDAEGDIDPDFVESHDVATSGMHIQDDSQVTTEQILA # EHTAEPFISSSIPTASQVADIDSHHGIPIYPSVELEENQSEDLPPEIRADIDDAAARISEPVELVTADINDEVVRSDVVESQSELPSAAAPVLTDSTE # FASAHVFSSEKPKEKMEEEAIIAQAVNDGSKESMVSAAEEPIGKSERYHDVDPNRSLSHDTKSPDTGTTRRTKRKRKTPITLRNGSSAALAKDNNIPI # ISKGKGKKTVVPQDISDTTSTSGASTAAQFLTGSRASSIVSTSTGDGSGRHNPSPTPHRVKDSSPSSTRFAAPPLPPPPPPLPQLMFHNHSKNKAAPI # RRPALSVQTELPRAVSRAPSLSQPLAVSSSQAHSPDVGTPDSRSVTPAPSQSPHILRREPSSNSPVTRSHCRYHKISLPEEEDGGTHIFFLVPGCSLV # DRKLIKEEEIVDHGDATYDDSIRKVADIETLGINEYVIGVIRMLVGPDKEHEVYFMPKPGEERARKVIHRKSRLRSSISSSASLHSPRTSISNINGNL # LSPSSSSVAPVSAAGSSSTNRSSKQWRRQHDREKEADSSLWSEAYSTETDGEESDGEYKGPSKKPKLVHPTDVAETSSQNSHKSLSQGSTQLRESASA # GPGPRNKTKRKRPLDPSAAEYKPHEDEGNESFDEALVKPKKNALKRARTSEPNPSTTSKEPERKRKKKTLKMVPYGFHH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g555 ### # start gene g556 3 AUGUSTUS gene 1980072 1980296 0.87 - . g556 3 AUGUSTUS transcript 1980072 1980296 0.87 - . g556.t1 3 AUGUSTUS stop_codon 1980072 1980074 . - 0 transcript_id "g556.t1"; gene_id "g556"; 3 AUGUSTUS CDS 1980072 1980296 0.87 - 0 transcript_id "g556.t1"; gene_id "g556"; 3 AUGUSTUS start_codon 1980294 1980296 . - 0 transcript_id "g556.t1"; gene_id "g556"; # protein sequence = [MDVSAASADKPKTKRKQKDIFASDDDDDNDGEQKRRAELMQKKKATAVSKRRSDKDKDSDEDQEKPKRKAARRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g556 ### # start gene g557 3 AUGUSTUS gene 1985399 1987438 0.36 - . g557 3 AUGUSTUS transcript 1985399 1987438 0.36 - . g557.t1 3 AUGUSTUS stop_codon 1985399 1985401 . - 0 transcript_id "g557.t1"; gene_id "g557"; 3 AUGUSTUS CDS 1985399 1986542 0.78 - 1 transcript_id "g557.t1"; gene_id "g557"; 3 AUGUSTUS CDS 1986596 1987097 0.79 - 2 transcript_id "g557.t1"; gene_id "g557"; 3 AUGUSTUS CDS 1987150 1987438 0.53 - 0 transcript_id "g557.t1"; gene_id "g557"; 3 AUGUSTUS start_codon 1987436 1987438 . - 0 transcript_id "g557.t1"; gene_id "g557"; # protein sequence = [MNSIRAKSVLGKRSQRQDHSSTCEQLQTPEPTPDFKRVRTSSTTLDGDGNKENIPPFALNALNVESSSPTITSRAARA # LRRSATESMQSTPARSKPQIQRSASISSTPATPATAISTLHISTPPPTPPTFLPLEVRARALLRATCNDIDELPGREEERQSIANFVQSFLEDDEQGV # QSLYISGSPGSGKTALVTSVLNSFAEELTDVKVVTINCMALEDVDALWHRMLDELDKPKKLKAAARSRKHLKGKEAAEAVVTAMKTKCIVLLDELDHI # APTTQTFTSLLTLPEASSGLLRIIGIANTHTLSTTTISTDCVQTLHFAPYTSTQLLRILQSRLAPLNDSEKSSAVMKKFLPIPTLMLLTKKVASLTGD # VRCLLEVLREAIDLASAVPASKEVNVLEVSTSSVTPAHVLAALKVRVPTPTSAPSASPKSSPFVSNSEIVSKISSLGLQARLVLLSILLASKRLEAGL # ALSGSTLPSTSAKRSCSNDIPGRDIGIDTQQLHGYYSNMLSRGDSDLCAPASRNEFIDLTAMLEGIGLVSVATVTCSSPTKMAKRAFGRSSSFISVKS # KNAAMGDVRLGSGVWVDEVVRGLGISDKDSVDVKEEEARAIWNRECARLAKEVKVWQAKSAKTQQPVAGFSDAFED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g557 ### # start gene g558 3 AUGUSTUS gene 1989825 1990337 0.89 - . g558 3 AUGUSTUS transcript 1989825 1990337 0.89 - . g558.t1 3 AUGUSTUS stop_codon 1989825 1989827 . - 0 transcript_id "g558.t1"; gene_id "g558"; 3 AUGUSTUS CDS 1989825 1990337 0.89 - 0 transcript_id "g558.t1"; gene_id "g558"; 3 AUGUSTUS start_codon 1990335 1990337 . - 0 transcript_id "g558.t1"; gene_id "g558"; # protein sequence = [MDQSQLDTFLKQKPRSNVDSLHSSSSIPLLSLPQMDTTLTTRLETTPQYTDVPAPYSDQESGAAQGNDQNGPGDGSES # GHSVFLPSPYSHHGHDGNGDNVPELTQPRFVTPPPRPESQFYAPIPVQAGDFSMKALEASASGSRSSTPVSLSMIHGKKDTSSPPLHPANAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g558 ### # start gene g559 3 AUGUSTUS gene 1990444 1990851 0.64 + . g559 3 AUGUSTUS transcript 1990444 1990851 0.64 + . g559.t1 3 AUGUSTUS start_codon 1990444 1990446 . + 0 transcript_id "g559.t1"; gene_id "g559"; 3 AUGUSTUS CDS 1990444 1990851 0.64 + 0 transcript_id "g559.t1"; gene_id "g559"; 3 AUGUSTUS stop_codon 1990849 1990851 . + 0 transcript_id "g559.t1"; gene_id "g559"; # protein sequence = [MTPPTIAPISVPWPSELGVEDDEALELADVDETVLVIEFDWVNDAEVDDDEEDEAEGDEDEEREEEDEDGETELEPVV # VLLVELGLELDIEVLETEVLSEVVVSARPLNITSSTPTHKQKTDTHNTTESINIMGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g559 ### # start gene g560 3 AUGUSTUS gene 1996599 1998341 0.18 + . g560 3 AUGUSTUS transcript 1996599 1998341 0.18 + . g560.t1 3 AUGUSTUS start_codon 1996599 1996601 . + 0 transcript_id "g560.t1"; gene_id "g560"; 3 AUGUSTUS CDS 1996599 1996877 0.39 + 0 transcript_id "g560.t1"; gene_id "g560"; 3 AUGUSTUS CDS 1997321 1997540 0.41 + 0 transcript_id "g560.t1"; gene_id "g560"; 3 AUGUSTUS CDS 1997662 1998341 0.31 + 2 transcript_id "g560.t1"; gene_id "g560"; 3 AUGUSTUS stop_codon 1998339 1998341 . + 0 transcript_id "g560.t1"; gene_id "g560"; # protein sequence = [MSETPVQRLVPGAPPPPPLTKSQLKKKRKSKTKANEQAGESLVAITDASTVALVEKAPEIADIQEGIVAPELVAQPSE # AQSTTEDVTLKLSPIASNAEKAIKLVVFLRMLALLASGELDLSEFGFNQEEINAVNGAGVILLGSDAATKDVIVREFLSSNGHFDGVSYAVEVNEHEP # SHHSAEVEEYTEPEVAGLVSAPMTTTGSFHFMQASELETPSFEENVEWVDTADLVDGSEQVEETEEVNGHLKETPAPEVGEKLNAHATLTEKENVQVP # ASSEPMDWAAEDDNELPDIDNLHATFGKSGSVTPTVQPEPQESPDIIEPTTNDQISSAVEGEDGFTQARGGRGRGRGSRGGDRGSRGGFRGNDRGGYR # GGERGGFRGGHRGGDRGKEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g560 ### # start gene g561 3 AUGUSTUS gene 1999067 1999519 0.35 + . g561 3 AUGUSTUS transcript 1999067 1999519 0.35 + . g561.t1 3 AUGUSTUS start_codon 1999067 1999069 . + 0 transcript_id "g561.t1"; gene_id "g561"; 3 AUGUSTUS CDS 1999067 1999519 0.35 + 0 transcript_id "g561.t1"; gene_id "g561"; 3 AUGUSTUS stop_codon 1999517 1999519 . + 0 transcript_id "g561.t1"; gene_id "g561"; # protein sequence = [MEYIVSSRRCYRRANSRKEYGHSRGAYDIYILIEYDTDVHSIQFLDVALRSKVICDRYNVPLIVNDRVDIALAVQAAG # VHVGQSDMPVSIARKLLPRGTVIGVSCNNIQELDKAVSDGVDYVGIGAVWSTTTKTLNKPVVGGSSGLRLQC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g561 ### # start gene g562 3 AUGUSTUS gene 2007579 2011817 0.58 + . g562 3 AUGUSTUS transcript 2007579 2011817 0.58 + . g562.t1 3 AUGUSTUS start_codon 2007579 2007581 . + 0 transcript_id "g562.t1"; gene_id "g562"; 3 AUGUSTUS CDS 2007579 2009675 0.78 + 0 transcript_id "g562.t1"; gene_id "g562"; 3 AUGUSTUS CDS 2009820 2009940 0.66 + 0 transcript_id "g562.t1"; gene_id "g562"; 3 AUGUSTUS CDS 2009992 2011817 0.85 + 2 transcript_id "g562.t1"; gene_id "g562"; 3 AUGUSTUS stop_codon 2011815 2011817 . + 0 transcript_id "g562.t1"; gene_id "g562"; # protein sequence = [MFPIPKNNRPSGWPDTFSSSPSTSTSLSSSFSSGSAASDMLPQDSSQSDIVSSDHLANHTTPLPAPIPRHAAGHDLAL # AATRPRSSSLAVVMGQNFSKPSASHKGLSISTAAANTGIKLKRAFAGRRKKSEDSTKLFAVTDNKEWDSPASSPSTSSQVTPPASKFPRSTKLTQIAT # QVIGGAKRAAKSPHASPIPPTPPPKPSSMQVAKLVPTSTPISPLKKVDNRGSIIPMSPGISSAVTFMRLGEEEREAAQVNANEAAAQVKANEAAAAQV # KTNEAAKEVPKELSNKTDTEKDIWRKSDSTMSHHTIRPGAGAGPRSSRPVSMAESLQSNHTIVPVNKRLSALITDAEFGPPEEEDDSSFVSASEEITP # IPLSANTSSTNIKGRRSMSLNLGKATKFAISPPSATSTGALDQLKPRSPRESHPRMTPSLSNETPTLTRAAASGIIAPSSSGVQSTGNNIRGRLAAWT # ATNNASSETYHHHHSHTSRPVPPSAYHRNTPSPQPHQRSTAISITGSLAPAANLARRAAEKLGRWGFSSNSSGYSSSSSSTGYSSDHALGRTTSNNSS # GQMSSGRGKQRRTPDAPSGAWSVSSSGTSDSDALLVPAGPSLGTQIRSPLRKTAGGAAVAGGIVFGRPLTVVVKETSVGRSPNYDSSSGFDRSKMTME # TLGTITKKQSKALETRRLPALVVRCAQHLLLWGIFFVYEPHVSLGADYNLQECSPGELDPHAVASIFKAFLRELPEPILTHSLLPYFEAALAHEQATN # EQQLREQPVSPRAMSGQRGPPLPSGPKNGLQGLRKPPSLSTLAMPNLSGLRPPSRSLLNVLKSLVRQLPIENRDLILTVTDLIKATAKESQHTRMPLN # NLLLVFCPSLNMNPPLLKVLCEAEDIWEQEDPSPVLDIKREDAILDISPSSDIAEAGHTARPDTSDTTAAQEIVEGSLSSASASSSPPTSSRVIHGHE # RLSLERSPTSEERIRSKKPHGPRRAAAVPQVVPVDGTSPVVHNELPYPSGSTDVSFESMSLRDDGSSYISNSDTRSEFASSPFERGVPSPPLSSSVES # LRTPSSSSAGPSLTHLPLEKPRLGKLLSPSEVEIAGDDFVHPRRFLDNHLSGHIKFPTAPDDSPVTPVSPRMSAPSLSLGSPSPTNSAPSSPRARRIK # KPSLQLLFSKRSASSLKSLADGKPVISSPIPTPLAPSLSSDSSVSTPSSAVTAQSVAFFSPPVLDTNIAASPLRFGLGFDPRLSPDLQVRTAAQTNEE # QHVEDVVITPVGETPIANRYCTPASSTLSLPLSSDATMPSHLRPYPTARSKLTSKTLTSSASSNHLGLLGDQEDQEDWTQSVLLAADAGGKWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g562 ### # start gene g563 3 AUGUSTUS gene 2012526 2014346 0.44 + . g563 3 AUGUSTUS transcript 2012526 2014346 0.44 + . g563.t1 3 AUGUSTUS start_codon 2012526 2012528 . + 0 transcript_id "g563.t1"; gene_id "g563"; 3 AUGUSTUS CDS 2012526 2012798 0.45 + 0 transcript_id "g563.t1"; gene_id "g563"; 3 AUGUSTUS CDS 2012935 2013357 0.99 + 0 transcript_id "g563.t1"; gene_id "g563"; 3 AUGUSTUS CDS 2013414 2014346 0.99 + 0 transcript_id "g563.t1"; gene_id "g563"; 3 AUGUSTUS stop_codon 2014344 2014346 . + 0 transcript_id "g563.t1"; gene_id "g563"; # protein sequence = [MASDAVKKVQQKLFRGGNISNDDGLPRSEPALTINIPAVPSTPKPPAAAPPKSTKVSDPSPDDDELDARQQQDDRSYR # ERLASRIGADYKGATVREDYSANGDAWSHFPHEHARSRAYRWGEDGIAGISDNHQRLCFSLSLWNGKDPILKERLFGVTGHQGNHGEDVKELYYYLDS # TPSHSYMKFLYKYPQRRYPYEGLVTENQNRSRDVAEYEILDSDAFDEDRYWDVFVEYAKDEDEPDNVYIRITAYNRGPDPATLHIIPQLWFPNTWSWP # LEKPPMPSLTAHNRSGINYITAKHPDQPKTHLYCLPSPPPVGPDGNFDVDPETEAVEPELLFTENNTNFSRLYGGQNETPYVKDAFHDHIIPSHRPPP # PEGDEDFFSHKIRSRARVYSTAGSEVDDDEVEEGPCTPFPSGPDFVNPNKTGTKSAAHYIFKDVPGQGGCSVVRLKLTPLSVKKDLSIEDEGIFDDAV # EARRQEADEFYNSLVFGPISDDFKQIMRQALGGMLWTKQYYKFIQKEWLEGDPAQPPPPPERKFIRNRVRSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g563 ### # start gene g564 3 AUGUSTUS gene 2019056 2020399 0.6 - . g564 3 AUGUSTUS transcript 2019056 2020399 0.6 - . g564.t1 3 AUGUSTUS stop_codon 2019056 2019058 . - 0 transcript_id "g564.t1"; gene_id "g564"; 3 AUGUSTUS CDS 2019056 2020399 0.6 - 0 transcript_id "g564.t1"; gene_id "g564"; 3 AUGUSTUS start_codon 2020397 2020399 . - 0 transcript_id "g564.t1"; gene_id "g564"; # protein sequence = [MSIMFSFVALLNVCLASGVPTQYPLAVWWKGDDDLEYFTLRCRREDQMKQWESTINRLIREAAQRRASDRGGFSRLQQ # NSTNPRLNPPASVPPYPLPPNGVTSRSRSGSVYDREQGQGPSGPTNGYGSGPQGYPPHDGFDVEADEDEYEDYPPASAQYAPSGRGTPIGQRRTTTAS # ERDSYVDGHLSAMNGSARPITPRLNSNVSAMSAQSDASFGNIVNGPRLSRPSLRSQFSSTKLRTGYDSSGDYRSGIPPTPASAVYNPPPLNRSRSASQ # PSAYIPKSEPPPPLPSAQWNSRPSTSVSSSKRGSGSSQSTGDSSDYSPNSSSPITPYGSSESSLAGVNNIRPSRSQVFENGVGHSPFGHPVKVKVHFH # EDIFVIQVPRMTEFDDLVEKVGRKIRLCGPRRDDGPLRVKYKDEDGDMVSLGSTEDVQMAFEQYRPGGQVTLFVT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g564 ### # start gene g565 3 AUGUSTUS gene 2021760 2022299 0.28 - . g565 3 AUGUSTUS transcript 2021760 2022299 0.28 - . g565.t1 3 AUGUSTUS stop_codon 2021760 2021762 . - 0 transcript_id "g565.t1"; gene_id "g565"; 3 AUGUSTUS CDS 2021760 2022299 0.28 - 0 transcript_id "g565.t1"; gene_id "g565"; 3 AUGUSTUS start_codon 2022297 2022299 . - 0 transcript_id "g565.t1"; gene_id "g565"; # protein sequence = [MASVAGRKKSIVSSAGLPIDLPVANNTLLNQAAITSLYQECSRLRSRLMRIRGFDYYFKLASSSDSRQSTDPVTQLWD # LFSLGIPLCYLFDLLPEDEGFKKLNKSEFNEKFEQNPDRAKKHSILMFAMQLTSEAVTQHIPDCEPFTVTELWLRSSNDGLVKVCTLDLTSFLATDTV # LRW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g565 ### # start gene g566 3 AUGUSTUS gene 2025595 2025945 0.52 - . g566 3 AUGUSTUS transcript 2025595 2025945 0.52 - . g566.t1 3 AUGUSTUS stop_codon 2025595 2025597 . - 0 transcript_id "g566.t1"; gene_id "g566"; 3 AUGUSTUS CDS 2025595 2025945 0.52 - 0 transcript_id "g566.t1"; gene_id "g566"; 3 AUGUSTUS start_codon 2025943 2025945 . - 0 transcript_id "g566.t1"; gene_id "g566"; # protein sequence = [MNADRSQTPPAQRETAGGEELTTRAGPGPGTIAAAQRRLQAEASSSLPRSRSPTPPRALFRSTTGKGVAFTDEDVTFL # MRYMEYRKSEGSLDMVAFWKDVATKVSLADVFHDSHSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g566 ### # start gene g567 3 AUGUSTUS gene 2026188 2027668 0.48 - . g567 3 AUGUSTUS transcript 2026188 2027668 0.48 - . g567.t1 3 AUGUSTUS stop_codon 2026188 2026190 . - 0 transcript_id "g567.t1"; gene_id "g567"; 3 AUGUSTUS CDS 2026188 2026568 0.9 - 0 transcript_id "g567.t1"; gene_id "g567"; 3 AUGUSTUS CDS 2026625 2027668 0.48 - 0 transcript_id "g567.t1"; gene_id "g567"; 3 AUGUSTUS start_codon 2027666 2027668 . - 0 transcript_id "g567.t1"; gene_id "g567"; # protein sequence = [MAPARDSIGLHRGIIEPSSSLPPSSNDDLSELFLDPMLGTPLAMYVEKDVQERDVIIGLITVGRVACFRGAANKDLAS # RSTAEASLMGTAECHTYWVRLIVCFVTYSDDKQQSILSNPLVKTFIASMLQKRERSYSTFAGSMNVSKHASFKHFKLIGLDAKLLERKRMCRKNSIFG # HSTHISSRALLTPSDILSQPPATVTNPDSPRRRDRQTVQIEEARQIAPPPPPPAPIPSQILHPSLHVDPLVHAQNHFPYSIYTASPAQSLHSQRPLQT # PPPQTWQATGIAPHQTHAATPSQLLDRPPYRENAWGEYNQHPHAETVNPAAYDYRYRDPSPWASTAYYDTPAVPYDQTYDQNDYAQDPRSDPPEPTTE # EIEYPEKTRGRKRIRASVRTSSNLNFRAEYVRIQAIPATPASALVVNRNPPARSPTPPTRTVKSTYGGNLFTADDVFYLKKYIDYCQDQGLVLRYGLN # TPLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g567 ### # start gene g568 3 AUGUSTUS gene 2033273 2035090 0.26 + . g568 3 AUGUSTUS transcript 2033273 2035090 0.26 + . g568.t1 3 AUGUSTUS start_codon 2033273 2033275 . + 0 transcript_id "g568.t1"; gene_id "g568"; 3 AUGUSTUS CDS 2033273 2033416 0.57 + 0 transcript_id "g568.t1"; gene_id "g568"; 3 AUGUSTUS CDS 2033484 2033623 0.4 + 0 transcript_id "g568.t1"; gene_id "g568"; 3 AUGUSTUS CDS 2034307 2035090 0.47 + 1 transcript_id "g568.t1"; gene_id "g568"; 3 AUGUSTUS stop_codon 2035088 2035090 . + 0 transcript_id "g568.t1"; gene_id "g568"; # protein sequence = [MRLGIDPKVLSECFKTSSGGSWVNSTVNPVPGVCPDAVTSKGYEGGFKLMKKDISLAIQAAKTVDAKLVLADAGLGAY # AAATDDPNCRDRDSRVVEVYDSSSTTNSTPTKSFFGSSLRGRSGSKTNKPSGNEPGSPSRTKRTIKTSDITYIFSEDNTSLRDFSPEFGLRNLENCNE # DRFSRPGSPPLMIDKALVDQFPLPPVVHAYTSPDVRVPVTSPDFEYGLRVCSDGLLPPPHPRVQQYMDEQKALNGSLRRQPLVRSSSVTSYSRPTATA # YSALFEDNGSSTPSLPPSPSDRSSVTHHHTYRRLLHSQSLSSRSPPPSVKTLLHQRSHSDMNFDRPGSRIGLRAQTPVGTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g568 ### # start gene g569 3 AUGUSTUS gene 2042691 2043032 1 - . g569 3 AUGUSTUS transcript 2042691 2043032 1 - . g569.t1 3 AUGUSTUS stop_codon 2042691 2042693 . - 0 transcript_id "g569.t1"; gene_id "g569"; 3 AUGUSTUS CDS 2042691 2043032 1 - 0 transcript_id "g569.t1"; gene_id "g569"; 3 AUGUSTUS start_codon 2043030 2043032 . - 0 transcript_id "g569.t1"; gene_id "g569"; # protein sequence = [MPYGNHLQVASTPLASSSTLHTDVEDKRTTHPPFTPLASSDTLIHQDEPHQSQTSDPEKCQDIEALKSGIKADVSATS # DISYTPPDGGFKAWSTVLGASLVAFTTFGYAYYSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g569 ### # start gene g570 3 AUGUSTUS gene 2045474 2046273 0.76 + . g570 3 AUGUSTUS transcript 2045474 2046273 0.76 + . g570.t1 3 AUGUSTUS start_codon 2045474 2045476 . + 0 transcript_id "g570.t1"; gene_id "g570"; 3 AUGUSTUS CDS 2045474 2045833 0.76 + 0 transcript_id "g570.t1"; gene_id "g570"; 3 AUGUSTUS CDS 2045878 2046273 0.94 + 0 transcript_id "g570.t1"; gene_id "g570"; 3 AUGUSTUS stop_codon 2046271 2046273 . + 0 transcript_id "g570.t1"; gene_id "g570"; # protein sequence = [MVHSRSVLTAVIAVGVASSVLAIPVPPASTNTGGPNNGVTPTPSNLLVSGQNVMPSYASNSPSPNVNFVLGQSSSNDS # QAQGSPIPAGNVKRALERESRYLDITVQDNVDSEEPNEVSPNGLTTSTVRREILERGPDFNIETAMEELASTKYDWSKFLENTQQGQMIKKMDNDSQN # NWKTYFLSVKTSRERPTNSRASGAPQSTAGPGSQSHNYENLGDKDVKTGAGFTPLMRRARSRARASPYNHVEDLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g570 ### # start gene g571 3 AUGUSTUS gene 2052634 2053703 0.95 + . g571 3 AUGUSTUS transcript 2052634 2053703 0.95 + . g571.t1 3 AUGUSTUS start_codon 2052634 2052636 . + 0 transcript_id "g571.t1"; gene_id "g571"; 3 AUGUSTUS CDS 2052634 2052831 0.95 + 0 transcript_id "g571.t1"; gene_id "g571"; 3 AUGUSTUS CDS 2052924 2053703 1 + 0 transcript_id "g571.t1"; gene_id "g571"; 3 AUGUSTUS stop_codon 2053701 2053703 . + 0 transcript_id "g571.t1"; gene_id "g571"; # protein sequence = [MPNVDSSSSTDDSSPQPQTPLSSSQTGSSIADPANADPSPDNIAGGKKRKQNRRINTAERRATHNADLAAILPNLSQI # RRPSKSAIVNSSIAYFHASRRHRLLASRELRLLKFETDALRRELNDWRDRASIRRVQEPTRSDGFSIVLSGELEILPIDGIDNEDGDDGDDDLYTPVV # SPDDNFEHPFDSPPSTRPPASGPEHDSYNMNAVYPIQRPMGGRGPVPVIASPNGMAVENPAATFDAMGSGVAEPYPAFGEMGQGIQNKWTVQNQAYYG # PPPEREHVHSNRKTSLGDQPAQYFEQRWNNNNGMHNIEMNGNNSGGSFGMM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g571 ### # start gene g572 3 AUGUSTUS gene 2054525 2055967 0.46 - . g572 3 AUGUSTUS transcript 2054525 2055967 0.46 - . g572.t1 3 AUGUSTUS stop_codon 2054525 2054527 . - 0 transcript_id "g572.t1"; gene_id "g572"; 3 AUGUSTUS CDS 2054525 2055967 0.46 - 0 transcript_id "g572.t1"; gene_id "g572"; 3 AUGUSTUS start_codon 2055965 2055967 . - 0 transcript_id "g572.t1"; gene_id "g572"; # protein sequence = [MRDSNADSASQDASAPGEPDDLFAFRPPPTPAGSSYVLQSPIAFRAPRSSTEISIPAHFASSTSQFGLFSTPGPASSI # VQPSPPNSFVPSAAYSQDQPYNPARVILPPAQHHDNEYLLPDNREYVSAASNEFSMEPMNPPASSFAPASSFLVPSQQFPYSDPAVGNYVEQHFDANI # PIHASTPTSMLPIINIGPCSPNDRSNYHENNLDAASDDDIDLHSELTNAFTDPGSAYISSRPLYFDAPTDDPSSDPPDPAYEIDYATLNFQWKPFDRK # ITGSLEYKHPIRPITHYILEQEPSVTEDLGSLPPSSDQISGDDSNFSNSVLHSGKTGSDRELPLATSSDPPMVDDHSLDTTHNATARVKERTISIESQ # PAADLPSPTPFRFTPPSQTPSFSQTIVPTNESSPRRLASSRITKNTLLADGRQPPAAASPVFSDPFFSPPNFGDEAKTKVEDLHVLKVGRPFSVKPPI # YSIRVPLIFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g572 ### # start gene g573 3 AUGUSTUS gene 2063850 2064728 0.93 + . g573 3 AUGUSTUS transcript 2063850 2064728 0.93 + . g573.t1 3 AUGUSTUS start_codon 2063850 2063852 . + 0 transcript_id "g573.t1"; gene_id "g573"; 3 AUGUSTUS CDS 2063850 2064728 0.93 + 0 transcript_id "g573.t1"; gene_id "g573"; 3 AUGUSTUS stop_codon 2064726 2064728 . + 0 transcript_id "g573.t1"; gene_id "g573"; # protein sequence = [MDTRSGEAFTDWGNLFSAPLNPSVFAALDANGVLGPPPQRQHLPNIDVMVQPTGSNQWQESPMSYPRPSMQRSDSSSS # VQSKNSSFALPPSLWMSPAAAPAGTPIPGPSKHDLGPTPAHSPNTDKSTTAFSDLFSDDLFTASQTTSPRLSGSPELTGSLDTSATSSVADDAAQFAK # EDPLATQVWKMYARTKAGLPHKQRMENITWRMMAMALKRGDLVDPNDEKALDLYPSSGRLSEEFEASTSTSSIKVEEKDPSITGERGRRKDKGKDRVR # VVGFDGTNQDEEPALNDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g573 ### # start gene g574 3 AUGUSTUS gene 2064790 2066886 0.19 + . g574 3 AUGUSTUS transcript 2064790 2066886 0.19 + . g574.t1 3 AUGUSTUS start_codon 2064790 2064792 . + 0 transcript_id "g574.t1"; gene_id "g574"; 3 AUGUSTUS CDS 2064790 2066886 0.19 + 0 transcript_id "g574.t1"; gene_id "g574"; 3 AUGUSTUS stop_codon 2066884 2066886 . + 0 transcript_id "g574.t1"; gene_id "g574"; # protein sequence = [MDWRAISRSRSRISMDWRPTSRSRSRPPESTSSASTFSGLNGLGFDMVHMNSNLNFSPMSSSMPNSSMIHALAKPMSG # LSATRTRSPPGGMNIGMGSIYEDSNAFDTSSDTRYSFANHQFAGVQSPSFAPSSLPSHVMHHPHPHQSSHHPHITSQSSHPTNDSTNPHMGLGLNTSG # VNFSLGAAGSFSAGGIRSDSPPPPFGFPRHVRKTSFDHTVSKDSIYPLSPAQGGRHQVNGRPLSPKGPNNALLVPRSGLNMAEVGLGMKRRADAPHAE # SLLRGDLTEMPFNMGSAAGFTLSQSLPAHSHIHTAQHSSRYGPHLPSQHSQHHTGRHHQMGSGDGAEHSSAGGVSGPGSPFPSSTSFNFSFPTYDDNS # TFEAASSTNNFEGFSDAAGVGSQFKSARSSISGPTHSPYMTNSSNDLTGHHSHPNHGRGGHSHHNSTGSGGAGSNLSAAAASASVVMAEGYARLSAVN # GIDDLTGGGMGLGGIGIDGSGGSAVDYTLMGSLGPLYSGLEDSSTGAGNSSGPFTHVDPTQILAGSGGVYAHASPSSDGWGPTSTALPNASGGPGSSS # SPEASNASTPPSGEGGSGLLTGSSSKAGRKYLSLKDEKTRMTGLGDSLRSGSSTPDLETNSASKDGKGTKSNGEDGDNPTLCTNCRTTNTPLWRRDPE # GQPLCEYPPPSFPEKYLSFRFSSQVMHAVCSM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g574 ### # start gene g575 3 AUGUSTUS gene 2068749 2071081 0.4 + . g575 3 AUGUSTUS transcript 2068749 2071081 0.4 + . g575.t1 3 AUGUSTUS start_codon 2068749 2068751 . + 0 transcript_id "g575.t1"; gene_id "g575"; 3 AUGUSTUS CDS 2068749 2069670 0.4 + 0 transcript_id "g575.t1"; gene_id "g575"; 3 AUGUSTUS CDS 2070201 2071081 0.98 + 2 transcript_id "g575.t1"; gene_id "g575"; 3 AUGUSTUS stop_codon 2071079 2071081 . + 0 transcript_id "g575.t1"; gene_id "g575"; # protein sequence = [MGSRPIPSTSPIADVFSSSALRPSSPSISKPLPPIMTTGTREIEDERSMVFVDMMPSDNTTVKGKRRSLSVSRIDTSS # VMAGAILGGPPRTPDRSPLRTPVTENDGLSGGRIEDTTLNGIITHFKGELSQLDPITVSNLDLRDPSTPARRAALLNPNTNGYSQGGQDSDSKHASMM # PTVTLQPPFRTEETAQELDVRSVPPSPSAHRVSTVLSNLDPATNPRNLSLQTSLRSSLGSAGGGTTSARNMHRQSLSPLRSRSGPAESLTYSNLPSPH # LTGASSARGLRVIHRSTASSSEPSLIPTVVAADALTDDFFVLRRLCAKLYLKAETQQVDRILEEFSRRYWECNPNTLYGSSSASSMLPDVYFRLTTIR # VDLVHAVAYSLLLLNTDLHVADLTSRMSRSQFVRNTLAAIQMQLQPSSSTSPKASSPDVYDESGSLRNFPLPGSDQSSNSSSVAVSEGSELDTITRSK # RSDSITSWNSISRDTILSSPALSLATSQATTPIVENDCTPNISDLQSSTISMASSNIVYGRAWEAGMENLLKVLWFHAINRIITDLFVGNVQRHQESA # NTPAFECQQDINVFLTKSRRANVKEPQPTRTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g575 ### # start gene g576 3 AUGUSTUS gene 2071776 2072336 0.86 + . g576 3 AUGUSTUS transcript 2071776 2072336 0.86 + . g576.t1 3 AUGUSTUS start_codon 2071776 2071778 . + 0 transcript_id "g576.t1"; gene_id "g576"; 3 AUGUSTUS CDS 2071776 2072336 0.86 + 0 transcript_id "g576.t1"; gene_id "g576"; 3 AUGUSTUS stop_codon 2072334 2072336 . + 0 transcript_id "g576.t1"; gene_id "g576"; # protein sequence = [MVLTLSNGGVYFFQAGTEELVNEWVSTCNYWAARTSKEPLSGGVSNMEYGWNRVPDPAHGRSHSDSESVRDSDVTSVR # SNKSARSRFNWREGSATVRGQSPWNDRIHINDWKPPMPPTVASLHDEETQMDALKKYVKSLKRDLQKHNELREPMSALVSEDFFFPVEFNNVVPAVST # SYEQCSQGDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g576 ### # start gene g577 3 AUGUSTUS gene 2073930 2074274 0.62 + . g577 3 AUGUSTUS transcript 2073930 2074274 0.62 + . g577.t1 3 AUGUSTUS start_codon 2073930 2073932 . + 0 transcript_id "g577.t1"; gene_id "g577"; 3 AUGUSTUS CDS 2073930 2074274 0.62 + 0 transcript_id "g577.t1"; gene_id "g577"; 3 AUGUSTUS stop_codon 2074272 2074274 . + 0 transcript_id "g577.t1"; gene_id "g577"; # protein sequence = [MPTSTPTGIVPLTCDKVIYGCRGILCKLIHWLVKIDGYNKIYTQVSQGMQHSKDREPPCSQLSSTKPLTPTSGVMYNF # SALCGAILEGLTPASSFAPPSNEAQSVDEERAAWPM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g577 ### # start gene g578 3 AUGUSTUS gene 2075739 2080178 0.95 + . g578 3 AUGUSTUS transcript 2075739 2080178 0.95 + . g578.t1 3 AUGUSTUS start_codon 2075739 2075741 . + 0 transcript_id "g578.t1"; gene_id "g578"; 3 AUGUSTUS CDS 2075739 2080178 0.95 + 0 transcript_id "g578.t1"; gene_id "g578"; 3 AUGUSTUS stop_codon 2080176 2080178 . + 0 transcript_id "g578.t1"; gene_id "g578"; # protein sequence = [MSTNIKFKVPILKEDLSNWVIYKQRVQTEVVSHRLGRHMTGTIRPPRRVTEISGDFYLTGSATPLTDDEYEKCMEARD # EYEAKEAQLCKILYETIPISLFLRIREEVTAHDTWKQLCSVIEDRPPISADTLHHRMMSLRTPEEGDIRETLTQLQMWYDELAGMGHRVPDDSFMTYI # RQCCGIPYRDLFKSLAITSELTGIPLTSQFLIKKARQAADERDVEKEDDAVNSALSAAKAASLVPKGPNYQKRQGRKDNTKSKEDRSHLFCDNCEKVG # HTKPNCWAPGGGSEGKGPHQRNRQGKKQKGATAATAQSSKQDDENEEETYAFVMDAKHKDDFGMPDLQATSDFRERSDALAAANVTHNGEVIDTGATR # HFSPIQSNFKNLVQIAPSPVTAADGRSFVVTARGDYMTSLPMGPGKKPTPIVLSNTYYSPSLAFTLISVSCMDKAGFSLTIEDGNCTIFSPRPNRKAI # GFIPVNHGLYRVSTGSNPRSVLVAAAASTQRLTMYQFHCIMGHPGEDTLRRMLKTEMATGINVDLGTTVGFCEPCVQAKAVRKPFPKHSDNADAKAYG # DKVVTDVWGPAEVQSLKGARYSANFEDVYSREERVDFLKLKSDFFQSYKEYEAWVKAHRGVKLIKILGSDPGGELTSNAMNKHLKSQGTRRHLTVHDS # PQSNGLSEITNRNHLEGARAMLIRAGLPRFLWTEAVNHKVYLKNRTSHSSLPGKITPHERATKLKPNLSNLREFGALVWVKVKVPKLTARAEKVHFVG # IDEEAKGFRVYWPGKRRVSAERNIYMNPDEIVLSNPLEIEGETETTEVEIELEIPYNPSSLPQPKDENALKDSPELPENDPSKSVSTQDLPDHTPLSR # SLSPLTPLPSPSPSAPSSPTPVEVSLEPENTRPRRVRQPTGFYNETRMRKAAGIAADATALAAEDVNKKTEEFNPDGWTDFALAAPEDPQTIRKALKG # PEASEWARAYTDELASLEYFHTWDLVERPNGVNVAKNKVVLKTKRNHNDLVVLHKARLVVGGYSQIHGIDFYETFAPCVKFETLRLLLSVGASKDSKI # EQADVKNAYLQADLHEELYMELPPLYEEFRTLPVHQKGKDIVTKLRRPLYGSKQGGHEWYKKLRQEAINEGFTVSESDPCVFYKYKGDRYQIFAAATD # DFTMVTDNDESMVELKASLDRRFDMKFMGPISWLLGFEVTRDIDKKTITLSQKAYIERIIKRFGQETSRPVVTPMEPGIDLSPDSPAVSDTLLSPSEQ # ATYREAVGSLMYPAKVSRPDIAYATSTVACYMHEPHTTHWTAVIRVYRYLNGTTDFALVLGGKDSLSLFLFSDADWGSQMNRRSISGYVSYVGVGPIS # WSSKKQPIVTLSSTESEYVALTHAAKELIWLRQLFSELIQPLSEPTTLCCDNQSAIRLSKDSTFHARTKHIDIHFHFIRQVVEREQASIRYVPTDDMI # ADIFTKSLARIKFVRFRSLLNVLDPSSIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g578 ### # start gene g579 3 AUGUSTUS gene 2085329 2086100 0.11 + . g579 3 AUGUSTUS transcript 2085329 2086100 0.11 + . g579.t1 3 AUGUSTUS start_codon 2085329 2085331 . + 0 transcript_id "g579.t1"; gene_id "g579"; 3 AUGUSTUS CDS 2085329 2085331 0.11 + 0 transcript_id "g579.t1"; gene_id "g579"; 3 AUGUSTUS CDS 2085432 2086100 0.61 + 0 transcript_id "g579.t1"; gene_id "g579"; 3 AUGUSTUS stop_codon 2086098 2086100 . + 0 transcript_id "g579.t1"; gene_id "g579"; # protein sequence = [MSRPFSPYRHAPTQEDLLAAATRGRAIVIPEEEEPTKASSVAHSRASKTASAAPSATPSHRTRQSVATNGKASNKLPS # IAPSKQPSMAPSKPSSIAPSKQPSVAPSHQGRSSRNRDVDATPTPSRPHTPDMDELNQEEARIVEQALASAVRTPRTSYYTPSVLDAEVQQSSFHDNE # LCILLHQLKAPQTHDLVRKVVLKAVKQRMKKLSMNYDNEVRVNLDLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g579 ### # start gene g580 3 AUGUSTUS gene 2086300 2087346 0.97 + . g580 3 AUGUSTUS transcript 2086300 2087346 0.97 + . g580.t1 3 AUGUSTUS start_codon 2086300 2086302 . + 0 transcript_id "g580.t1"; gene_id "g580"; 3 AUGUSTUS CDS 2086300 2087346 0.97 + 0 transcript_id "g580.t1"; gene_id "g580"; 3 AUGUSTUS stop_codon 2087344 2087346 . + 0 transcript_id "g580.t1"; gene_id "g580"; # protein sequence = [MQQRIESLGPKIENLRPPPPPQSYVEEGNFYDDDQYTHTPVTQTVNIHTQATGTMAESMYQPETEMTMEDAPPGSHFD # NAAEFEDDGEMTEPTHRGFPAPTADQIRTPPNYALSDGRDDSPGQQYLEEELYKLQQRPSATGEEQTTWDLRRSDVPDEYDDEESPAVAPTIPGSEAG # DLNRRSTSPSLPPIPRDDTGQRSLVPQPQWNGNYNDHQQDLPPWQKIHQRLLSWAIVWPLSELDEALNSTTRGHQVNEVAMSIWSTQTYKRYVRTRMT # DTPSGVVDRLFVPPNMADAISNAVYNGRHGDACGMLRDLWGPFGLQGMPRLLVVLAKHRSDENHWVVHRYVFDH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g580 ### # start gene g581 3 AUGUSTUS gene 2094748 2096124 0.62 - . g581 3 AUGUSTUS transcript 2094748 2096124 0.62 - . g581.t1 3 AUGUSTUS stop_codon 2094748 2094750 . - 0 transcript_id "g581.t1"; gene_id "g581"; 3 AUGUSTUS CDS 2094748 2096124 0.62 - 0 transcript_id "g581.t1"; gene_id "g581"; 3 AUGUSTUS start_codon 2096122 2096124 . - 0 transcript_id "g581.t1"; gene_id "g581"; # protein sequence = [MPTSIRSLPPELLYAVFELTMSAENDPLESHDDEITVSPPWPDIFDLKKGPWVLAQVCSRWRFIALSIPQLWSNFYVR # LPRCEDSAVDVLQAWLGRSGNRPLQFQITATLGFCGHHCGSALLTTLASTSARWQTVELVDVSIKFLDTLAMQREIQLCSLPLLKELSLRSRNWDIES # DDSPEFEDPSTAYEVFFRAPNLDTLINLDTLSLSVFKLPWNQLTTYIGSDASHAIDHLEIMLLCPNLIECDVAFDRTHTWPTIPSLPLKQLKKWTIRV # RNSAHDLSLLLSQTTIEVPNLQELALLAGPFVLTPILDLFRPVLISSACSLQYLELSGNTIDHSLMRFLESVSTITRLRVWSSLTILPLLQNQEALVP # MLHTLDIGLTERADIYAFDLTILAVVVRSRRRSDHVESICRMNIVVNMWELDIMGHHVFPPIMEVLQEEGLDIRVCKRTEKLPRIK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g581 ### # start gene g582 3 AUGUSTUS gene 2106745 2107557 0.65 + . g582 3 AUGUSTUS transcript 2106745 2107557 0.65 + . g582.t1 3 AUGUSTUS start_codon 2106745 2106747 . + 0 transcript_id "g582.t1"; gene_id "g582"; 3 AUGUSTUS CDS 2106745 2107557 0.65 + 0 transcript_id "g582.t1"; gene_id "g582"; 3 AUGUSTUS stop_codon 2107555 2107557 . + 0 transcript_id "g582.t1"; gene_id "g582"; # protein sequence = [MLEAELLQGPLELTRRTKMLVWDDEIEISGDDSGLDEAVRDLNEPTSSPKLSINSVPIIPRRRRSQSSSGEFPPPMRR # IITESGINRPVPFSSKFQRVHPGTTGVTVLEHLERLDAVEASLQRLVSDDNVDEVDVGESQNVHIQNEPTTSNLPPTSPFSPPGSPLATVPEIASLES # SITEEDLVALSKSTSHLEGSSTISGRHTRWASQALGSGVDWLQENETPVTRTVISEVNLLCCSSSISVLTASLRDWKWLLRSHCARVGDTNRQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g582 ### # start gene g583 3 AUGUSTUS gene 2114169 2115307 0.13 + . g583 3 AUGUSTUS transcript 2114169 2115307 0.13 + . g583.t1 3 AUGUSTUS start_codon 2114169 2114171 . + 0 transcript_id "g583.t1"; gene_id "g583"; 3 AUGUSTUS CDS 2114169 2114288 0.13 + 0 transcript_id "g583.t1"; gene_id "g583"; 3 AUGUSTUS CDS 2114486 2115307 0.54 + 0 transcript_id "g583.t1"; gene_id "g583"; 3 AUGUSTUS stop_codon 2115305 2115307 . + 0 transcript_id "g583.t1"; gene_id "g583"; # protein sequence = [MKHSMPEYTLAKNQILGGTKKKMELKWNLTPSRAYGCLLSTPAAPVLRRENKKRKEPEDYTSATPAPLAGPSIKRGKH # DKKDKPPAERKSKNTAVYVTGLPVDTTMDELVQCFSRYGVLEEDDEGDPKVKMYAKDDGSFSGEALVVYFKEDSVVLALNILDESELRLGDPSTRMSV # AKADFAHKTSQTNGAGGEPRKTVDKKKVSRRLGKMQKYCRYSFVFFYYEFSSFTRKLEEWVDEDGFGPAIEPEDNANVANKNGRVVVLKHMFTLDNLQ # KDASLLLDLKEDVREECSSLGEVTNVVLYDVSTTKYNIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g583 ### # start gene g584 3 AUGUSTUS gene 2116010 2116321 0.71 - . g584 3 AUGUSTUS transcript 2116010 2116321 0.71 - . g584.t1 3 AUGUSTUS stop_codon 2116010 2116012 . - 0 transcript_id "g584.t1"; gene_id "g584"; 3 AUGUSTUS CDS 2116010 2116321 0.71 - 0 transcript_id "g584.t1"; gene_id "g584"; 3 AUGUSTUS start_codon 2116319 2116321 . - 0 transcript_id "g584.t1"; gene_id "g584"; # protein sequence = [MSFTIDTKDPILGDAVVVNPEISSGLPLQGVNRFPPPGSRPEKYSTPATKGATICVLSSSSAFLNNHILSFRYRSKPL # LETRRPTCLPPAFRDNTDRLVFVVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g584 ### # start gene g585 3 AUGUSTUS gene 2119247 2120158 0.99 - . g585 3 AUGUSTUS transcript 2119247 2120158 0.99 - . g585.t1 3 AUGUSTUS stop_codon 2119247 2119249 . - 0 transcript_id "g585.t1"; gene_id "g585"; 3 AUGUSTUS CDS 2119247 2120158 0.99 - 0 transcript_id "g585.t1"; gene_id "g585"; 3 AUGUSTUS start_codon 2120156 2120158 . - 0 transcript_id "g585.t1"; gene_id "g585"; # protein sequence = [MGLLDYLSPSKSSLNAQERSQREESPVNVQITPATPLTSSADVPFPLSPVTSPNEIAYDEKPMKQPLRRFSFRPFAVQ # LHLEHNDTLSSIQEREKKEQATAALSKRVVKPISSSSDKRAKQSALLVRGLIVGPTASSPKLSSAVAKPQMGKLKSQLMQAKSANKIIAHLRTLSADS # AEPKPTGPIHAVCLAHPDGEEHDLHFSKLGTTTPPSVSSFAVMNSAPLEALSSLFNEMHVIDLVKSPDFGLGQPGDGNGILAGALPTAETVINGIEQI # TPQLMALGYATGRAVMPDHTGQSLFAYTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g585 ### # start gene g586 3 AUGUSTUS gene 2124281 2124700 0.86 + . g586 3 AUGUSTUS transcript 2124281 2124700 0.86 + . g586.t1 3 AUGUSTUS start_codon 2124281 2124283 . + 0 transcript_id "g586.t1"; gene_id "g586"; 3 AUGUSTUS CDS 2124281 2124700 0.86 + 0 transcript_id "g586.t1"; gene_id "g586"; 3 AUGUSTUS stop_codon 2124698 2124700 . + 0 transcript_id "g586.t1"; gene_id "g586"; # protein sequence = [MLRWFLGLHSPTHSFSFSPDKNDRNVEIDQVEDELSDEEVGSLPNLMSTATSSTKSLDATRTPPFDLSSIPPAPLATP # RKADSTGSQANVASLPPPVTPSLEQTLMKVENLPGYVPPPLPAGLSTSTLQGRLDGKKKIK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g586 ### # start gene g587 3 AUGUSTUS gene 2128919 2129686 0.56 + . g587 3 AUGUSTUS transcript 2128919 2129686 0.56 + . g587.t1 3 AUGUSTUS start_codon 2128919 2128921 . + 0 transcript_id "g587.t1"; gene_id "g587"; 3 AUGUSTUS CDS 2128919 2129686 0.56 + 0 transcript_id "g587.t1"; gene_id "g587"; 3 AUGUSTUS stop_codon 2129684 2129686 . + 0 transcript_id "g587.t1"; gene_id "g587"; # protein sequence = [MLMASSGWEPEEKETSSSNPPLRNSSSRTGASDVQSSPEPSKSAVSYSLPQNNRRVVERYSLDNEAQQEPTVQQKQHS # FQEVSVSLMPAAPRHPSLPAAGSRAGPSNTNGSVSPVIMPLSASPTYSPPISSRQRAYPQQPTYIQNVSPNPVNPVYLPNNPPAEEVCIECAMRDQDM # ADVDVTSPGIWDRESDIHYEELKRKELEEEASGIIDTEGPPRPKAIGGQLTESNLKLWLSVVRSNLFTSIRIISHYNTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g587 ### # start gene g588 3 AUGUSTUS gene 2130487 2131863 0.66 + . g588 3 AUGUSTUS transcript 2130487 2131863 0.66 + . g588.t1 3 AUGUSTUS start_codon 2130487 2130489 . + 0 transcript_id "g588.t1"; gene_id "g588"; 3 AUGUSTUS CDS 2130487 2131863 0.66 + 0 transcript_id "g588.t1"; gene_id "g588"; 3 AUGUSTUS stop_codon 2131861 2131863 . + 0 transcript_id "g588.t1"; gene_id "g588"; # protein sequence = [MVQSPVDVAPGMHRQTWPSTELAPIISRQSEEQPKKKKGFAKIWRIVTRSKKNRSSSARESQSLDRTEDEADYPLAPP # PPLSYLVNRGNPGDRMSPRHASTPSLPLASSPKLALSSTTGISPPTAPSTSLPSPASSRQSGADQDTGEGKKTTIVNGDEIEPPNAGYFISSNVHSPI # SEPDLRRISQTAVPIIDVPMDKHFSQTVSSRLTISTLSREKSLPPLPNDAIIRPYVNGSARDNSRPRTVYTFDSRPPGTGAPHDFIPPQAPFRTEARR # QSFGGLTSRPNLSSFLSRSTNSKAVANPQQGLAPTYDEFGASRGSLRLPPADTNARNSVAHTGPTPTKRRSRFGLSSLLGKKNTSPDRSKEAYEPQYQ # PYTVPNQQGQPQQQQQFPALHTSGSDVHDEVMTGYATSNSRHSGSGGGGPRMSITSRKALDELVSQDAEFVAYRYPSNDQRLDLLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g588 ### # start gene g589 3 AUGUSTUS gene 2132547 2132891 1 + . g589 3 AUGUSTUS transcript 2132547 2132891 1 + . g589.t1 3 AUGUSTUS start_codon 2132547 2132549 . + 0 transcript_id "g589.t1"; gene_id "g589"; 3 AUGUSTUS CDS 2132547 2132891 1 + 0 transcript_id "g589.t1"; gene_id "g589"; 3 AUGUSTUS stop_codon 2132889 2132891 . + 0 transcript_id "g589.t1"; gene_id "g589"; # protein sequence = [MPPSYEPLPSNDSEQDITQPQTSAPQKAGKQPITRSNLLFIIFGFLVTAFVFYKAGQWSVSLLPSTSVEQSSSIPTGD # VKENESVPDDNLKNGSSSSSSASTIDETMPGKYSVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g589 ### # start gene g590 3 AUGUSTUS gene 2133901 2134356 0.47 + . g590 3 AUGUSTUS transcript 2133901 2134356 0.47 + . g590.t1 3 AUGUSTUS start_codon 2133901 2133903 . + 0 transcript_id "g590.t1"; gene_id "g590"; 3 AUGUSTUS CDS 2133901 2134356 0.47 + 0 transcript_id "g590.t1"; gene_id "g590"; 3 AUGUSTUS stop_codon 2134354 2134356 . + 0 transcript_id "g590.t1"; gene_id "g590"; # protein sequence = [MPLYGRSFLQTQGPGTPFNGVGQGSWEAGVYDYRALPLPGSHLMQDDKAKASWGYDYQKQEMISFDSEDVGRWKGAWI # KKMGLGGSMFWELSGDKGGPERKEMEGGHGKDPQPGQSLVKVVKEAMGGIEMGQHNWLNYESSRFDNLRNGMQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g590 ### # start gene g591 3 AUGUSTUS gene 2136067 2136621 0.67 - . g591 3 AUGUSTUS transcript 2136067 2136621 0.67 - . g591.t1 3 AUGUSTUS stop_codon 2136067 2136069 . - 0 transcript_id "g591.t1"; gene_id "g591"; 3 AUGUSTUS CDS 2136067 2136621 0.67 - 0 transcript_id "g591.t1"; gene_id "g591"; 3 AUGUSTUS start_codon 2136619 2136621 . - 0 transcript_id "g591.t1"; gene_id "g591"; # protein sequence = [MIKPDIGKLPKNLVDRIPLVVYIPTPPDASPTEGPIQMLTNIYSYSPKSPVKGTEIPAKKCFRFIKFHQFSSKFNKTT # NDGPTGILKQANLTESGFLEDSWDTGGYPHVVLDDNRAACAICLLDFEEPKRLHIMGEEQSKGGQGKAGVISEKKYENDELKSADVNEGAQLLRLLRC # GHVFHVRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g591 ### # start gene g592 3 AUGUSTUS gene 2138947 2139668 0.41 - . g592 3 AUGUSTUS transcript 2138947 2139668 0.41 - . g592.t1 3 AUGUSTUS stop_codon 2138947 2138949 . - 0 transcript_id "g592.t1"; gene_id "g592"; 3 AUGUSTUS CDS 2138947 2139204 0.81 - 0 transcript_id "g592.t1"; gene_id "g592"; 3 AUGUSTUS CDS 2139276 2139293 0.46 - 0 transcript_id "g592.t1"; gene_id "g592"; 3 AUGUSTUS CDS 2139399 2139668 0.78 - 0 transcript_id "g592.t1"; gene_id "g592"; 3 AUGUSTUS start_codon 2139666 2139668 . - 0 transcript_id "g592.t1"; gene_id "g592"; # protein sequence = [MSLENRVQKALVLESPKTPFVLKTVPIPKPGPGEVLVKIIVSGLNPVDWFIQSRDLFAPNTPYPAIIGLDMAGDVEEV # GEGVKEISKGDRQYALAPIPENLSYGQAACVPLTFSTAVYGLLPAHPVGMGLNSTFDDTVSYPKEIALVIGGSTSVGQYGMFLPSIMTFLDIHLNGII # QPFKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g592 ### # start gene g593 3 AUGUSTUS gene 2141591 2141851 0.1 + . g593 3 AUGUSTUS transcript 2141591 2141851 0.1 + . g593.t1 3 AUGUSTUS start_codon 2141591 2141593 . + 0 transcript_id "g593.t1"; gene_id "g593"; 3 AUGUSTUS CDS 2141591 2141851 0.1 + 0 transcript_id "g593.t1"; gene_id "g593"; 3 AUGUSTUS stop_codon 2141849 2141851 . + 0 transcript_id "g593.t1"; gene_id "g593"; # protein sequence = [MDDLSRWSSDGKLLEAFGAGTAVIITSIGKIGFKGEDIILPEHEGGLGPIANAFRTRILDIQEGKEVWKNWGVVVDGS # TAPTKTEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g593 ### # start gene g594 3 AUGUSTUS gene 2142419 2143895 0.39 + . g594 3 AUGUSTUS transcript 2142419 2143895 0.39 + . g594.t1 3 AUGUSTUS start_codon 2142419 2142421 . + 0 transcript_id "g594.t1"; gene_id "g594"; 3 AUGUSTUS CDS 2142419 2142606 0.48 + 0 transcript_id "g594.t1"; gene_id "g594"; 3 AUGUSTUS CDS 2142923 2143895 0.47 + 1 transcript_id "g594.t1"; gene_id "g594"; 3 AUGUSTUS stop_codon 2143893 2143895 . + 0 transcript_id "g594.t1"; gene_id "g594"; # protein sequence = [MTQDLNALIDQSYLTVPSFTLECGAELHDVPVAYKAWGTLNEERDNVMIICHAFTGSADVPDWLHKLVLDHLGVSSVA # VVIGGSMGGMAVLEWPLCTPPGYVKHIIPIATSARHSAWCISWGEAQRQSIYSDPGYQDGYYISQPASGLAAARMSALLTYRSRDSFESRFGRKAQIQ # KEARKPLTPPGSPKIRAEDDARVAHNDGYRNSHTNSQSTTPAPKTTTPIFSAQSYLRYQGDKFTSRFDANCYIHITRKLDTHDLARDRFIEGEDQDDD # SAALARVLSTLPPRALVISISTDGLFTPSEQKEIAAHIPGAELVTVQSPDGHDGFLLEFEQINTHIMRFLMREFPRFYERELGGDEADEAVEGFEIKK # TSLFGEAEADITHW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g594 ### # start gene g595 3 AUGUSTUS gene 2147668 2148423 0.35 - . g595 3 AUGUSTUS transcript 2147668 2148423 0.35 - . g595.t1 3 AUGUSTUS stop_codon 2147668 2147670 . - 0 transcript_id "g595.t1"; gene_id "g595"; 3 AUGUSTUS CDS 2147668 2148423 0.35 - 0 transcript_id "g595.t1"; gene_id "g595"; 3 AUGUSTUS start_codon 2148421 2148423 . - 0 transcript_id "g595.t1"; gene_id "g595"; # protein sequence = [MAVPDLLNRTFHEVDASLSQMCEESDGKIHSGCTAVTAFLRIEDADGHQSFLDLAQSQSPYPESPVATKVQESDEPPS # PHGSSGESVSGDEVTKPKKKSLSDPIKKALRSLGGGSISGAISPARKTQSPTPSSPKESKEKKPVRIPPESSRRVLYCANAGDARGVLCRAGKAVRLT # YDHKGSDKQEAKRITDAGGFVMGGRVNGVLAVTRSLGDSSMKDFVVGAPYTTETELIEEDEFLILACDGVCSLRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g595 ### # start gene g596 3 AUGUSTUS gene 2151289 2151780 0.65 + . g596 3 AUGUSTUS transcript 2151289 2151780 0.65 + . g596.t1 3 AUGUSTUS start_codon 2151289 2151291 . + 0 transcript_id "g596.t1"; gene_id "g596"; 3 AUGUSTUS CDS 2151289 2151780 0.65 + 0 transcript_id "g596.t1"; gene_id "g596"; 3 AUGUSTUS stop_codon 2151778 2151780 . + 0 transcript_id "g596.t1"; gene_id "g596"; # protein sequence = [MSTQSAAPKPSLQGVRIKARKGAVKAHAKHEPTGNNFYFDIHTSADSYSTVFRDQLYKHLETVPDGDFESFTTKLIQA # GSTLEFLKYADPLFEIILVGGLLQPGGSYIDDGAPVSPFAIFNAKDPANVEEIKKYIEVLNKLIRRYVVLASVFDHTLILFLGSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g596 ### # start gene g597 3 AUGUSTUS gene 2152068 2152499 0.31 + . g597 3 AUGUSTUS transcript 2152068 2152499 0.31 + . g597.t1 3 AUGUSTUS start_codon 2152068 2152070 . + 0 transcript_id "g597.t1"; gene_id "g597"; 3 AUGUSTUS CDS 2152068 2152262 0.67 + 0 transcript_id "g597.t1"; gene_id "g597"; 3 AUGUSTUS CDS 2152341 2152499 0.31 + 0 transcript_id "g597.t1"; gene_id "g597"; 3 AUGUSTUS stop_codon 2152497 2152499 . + 0 transcript_id "g597.t1"; gene_id "g597"; # protein sequence = [MDHLSGSLKKGGIRDLLAFFPANKQEPKQLEEHFRKADLPQIAEWYAKKQYAMIKDAIVKEVQSLIVAAVKAQQGSTP # IPDPELVACLWQGLISSVDWSARPDQIEGLALREVGVRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g597 ### # start gene g598 3 AUGUSTUS gene 2153764 2154072 0.53 - . g598 3 AUGUSTUS transcript 2153764 2154072 0.53 - . g598.t1 3 AUGUSTUS stop_codon 2153764 2153766 . - 0 transcript_id "g598.t1"; gene_id "g598"; 3 AUGUSTUS CDS 2153764 2154072 0.53 - 0 transcript_id "g598.t1"; gene_id "g598"; 3 AUGUSTUS start_codon 2154070 2154072 . - 0 transcript_id "g598.t1"; gene_id "g598"; # protein sequence = [MLASTGQTMDENSLLRKILAGELHYAKLWLVCVALRGVSWDKMPFEQRELAFQAKDAASSCLDIFLSSPEYRYAMSEM # DGVYLTNIVPYLVLPSDMQFTIAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g598 ### # start gene g599 3 AUGUSTUS gene 2157479 2157932 0.47 - . g599 3 AUGUSTUS transcript 2157479 2157932 0.47 - . g599.t1 3 AUGUSTUS stop_codon 2157479 2157481 . - 0 transcript_id "g599.t1"; gene_id "g599"; 3 AUGUSTUS CDS 2157479 2157766 0.7 - 0 transcript_id "g599.t1"; gene_id "g599"; 3 AUGUSTUS CDS 2157855 2157932 0.47 - 0 transcript_id "g599.t1"; gene_id "g599"; 3 AUGUSTUS start_codon 2157930 2157932 . - 0 transcript_id "g599.t1"; gene_id "g599"; # protein sequence = [MKISQHTQLLEIQQSIEREKSTRIESYMKKELAKLDEELTAYGACDPVKLEETRRAITLGKEAAMRWTGNLDVPFLIS # LTHEFFGAENYSALLPHFLHHSMASIEDIRKYLEIDEEYEDIY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g599 ### # start gene g600 3 AUGUSTUS gene 2166585 2167481 0.47 + . g600 3 AUGUSTUS transcript 2166585 2167481 0.47 + . g600.t1 3 AUGUSTUS start_codon 2166585 2166587 . + 0 transcript_id "g600.t1"; gene_id "g600"; 3 AUGUSTUS CDS 2166585 2167481 0.47 + 0 transcript_id "g600.t1"; gene_id "g600"; 3 AUGUSTUS stop_codon 2167479 2167481 . + 0 transcript_id "g600.t1"; gene_id "g600"; # protein sequence = [MASPFAGPSSPRKLTGSTPGILDSTQRDRLLTFSRSTLSFASFNPRTATSSQLTPDARKLSLNEELYNPKRVVIETSP # TGESFWRFVPKARIDEGVVDEGDWPRVIDICGCVNLNCSLPTPSYLIAFSMLYECSQDQWDIYKLDPLYECRVRAPPASSTIIRVSPKSPESPQSNGK # RTSSKAGIPPLNPRKKLHTGSGNSSLDLGYDDDEVEEVEDMIVDQTMPPPPRARSASLRRKREEISQIRQQRRENISRRAEKLSSREDEFNFNFSTED # SPGRSQSVPVDNGGKRKGKLLCVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g600 ### # start gene g601 3 AUGUSTUS gene 2167738 2168591 0.36 + . g601 3 AUGUSTUS transcript 2167738 2168591 0.36 + . g601.t1 3 AUGUSTUS start_codon 2167738 2167740 . + 0 transcript_id "g601.t1"; gene_id "g601"; 3 AUGUSTUS CDS 2167738 2167786 0.36 + 0 transcript_id "g601.t1"; gene_id "g601"; 3 AUGUSTUS CDS 2167837 2168591 1 + 2 transcript_id "g601.t1"; gene_id "g601"; 3 AUGUSTUS stop_codon 2168589 2168591 . + 0 transcript_id "g601.t1"; gene_id "g601"; # protein sequence = [MQEVYAEVPDLKSPSNDIPAQNIGDGEYDDDSGTEDENWNGGPSTDTSFDDDAARVAAIAESRRKLAELEADRPLWEE # EARKRALRQRVEEESQRLKAEERKWADMKRAEVEARQAEMHRKAQETAERTEEQQDAKLREEAIKRQRERRQREQRWAYGHWTPIRALERYRVLSEAF # DTTKFNVYDPLTFHVIPWPILNPPAKMSVEDVDWNAVELFFESVRPHMRSQDFKSFVEKSQRRFHPDRWRSRGLLRTVADEAERSCLEVGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g601 ### # start gene g602 3 AUGUSTUS gene 2170769 2173384 0.24 + . g602 3 AUGUSTUS transcript 2170769 2173384 0.24 + . g602.t1 3 AUGUSTUS start_codon 2170769 2170771 . + 0 transcript_id "g602.t1"; gene_id "g602"; 3 AUGUSTUS CDS 2170769 2171336 0.24 + 0 transcript_id "g602.t1"; gene_id "g602"; 3 AUGUSTUS CDS 2172051 2173384 0.97 + 2 transcript_id "g602.t1"; gene_id "g602"; 3 AUGUSTUS stop_codon 2173382 2173384 . + 0 transcript_id "g602.t1"; gene_id "g602"; # protein sequence = [MIKPDIGKLPKSFVDRIPLVMYIPPPPDASPMEGPIQMPPSIYSYPPKSPVKKTEISAKTRFRFIKFRNFSSKSDKMS # IDGTTDSSKQEKSTKAGSWEDNWDTEGYPFVVLDDNRAACAICLLDFEEPTRLHPMGEEQSKVVESEPNGGPAEVEVISEEERESNELRLADVGEGAQ # PLRLLKCGHVFHVPISLNGTWKFKLVDNPLNAPDDFQLPSFDSTAWANIVVPGMWQLQGFGRPQYTNTVFPFPVSVEPDGTPSIPYEGNHVGNYIRNF # SVPSEWEGSSVRLRFEGVDSAFHVFCNGKEVGYSQGSRNPSEFDVTSLLQINNENTIALRVYQFCDGSYIEDQDQWWLSGIFREVWLISFPVNHIADI # QLQTHLDENYCDATLAVEVNTFGSSIPLTIKLLNLSKSLVATKEESATAPSTSFAFSVSNPLKWTAETPHLYHLVVSTPQQTVAVRVGFRNIEIEHGV # FMVNGRPIKFRGTNRHEHHPEFGRSVPHDFLRADLLLMKKHNINAIRTSHYPNHPRLYHLADELGFWVIDEADLEAHGFADIEEAALGPDKDALKGKE # RQNYFYDLAAKWTTDNPAWKEAYVDRARQLVSRDKNHPCVILWSLGNEAFYGKNFQAMVSCSRTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g602 ### # start gene g603 3 AUGUSTUS gene 2173512 2175092 0.85 + . g603 3 AUGUSTUS transcript 2173512 2175092 0.85 + . g603.t1 3 AUGUSTUS start_codon 2173512 2173514 . + 0 transcript_id "g603.t1"; gene_id "g603"; 3 AUGUSTUS CDS 2173512 2175092 0.85 + 0 transcript_id "g603.t1"; gene_id "g603"; 3 AUGUSTUS stop_codon 2175090 2175092 . + 0 transcript_id "g603.t1"; gene_id "g603"; # protein sequence = [MYSSVATIITYAEDPASTKPLVLCEYIHAMGNGPGAIKEYIDAFYKYPLLMGGFVWEWANHGLLTTNKEGKRYYAYGG # DFCDEPNDGNFVMDGVLFSDHTPTPGLAEYKKAIEPVQVIGGSEKQIEIINRYDFLTLDHLRCEWNIVGDGYVCPGGEVTIPLGIKPGQTATLIIDNA # VKSNSLPAEGFLTVRFSLKTATSWAPAGHEVANGQILLKPHVPRSSSSYFSAMYKTVSSSLTYPFPVTEKDKMLSIKGKDSQWTFEMTSGHLVSWVKG # GTNILCSPPVMDFYRALTDNDRPQDGMQWIAKRLHQTKDHLKSISWKTTSKGDTEVSVVSRIAPPVFEWSVDTTTTYTFSSAGVQIKIHGIPQGINLP # DTFARIGLTFHMPPEFGTVRWFGRGPGESYRDKKLSQKFGTWEATVDQLFTNYEFPQEGGNRTDVRWVSFSSGERQLKATFPFEEGGNFCASHYTTEA # LDSSKHPFELEEKRLDNVVSRLDFAHHGLGTGSCGPKTMDKYALRAEEFSFEVWLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g603 ### # start gene g604 3 AUGUSTUS gene 2187772 2188316 0.48 - . g604 3 AUGUSTUS transcript 2187772 2188316 0.48 - . g604.t1 3 AUGUSTUS stop_codon 2187772 2187774 . - 0 transcript_id "g604.t1"; gene_id "g604"; 3 AUGUSTUS CDS 2187772 2188037 0.61 - 2 transcript_id "g604.t1"; gene_id "g604"; 3 AUGUSTUS CDS 2188088 2188316 0.48 - 0 transcript_id "g604.t1"; gene_id "g604"; 3 AUGUSTUS start_codon 2188314 2188316 . - 0 transcript_id "g604.t1"; gene_id "g604"; # protein sequence = [MFSSNKTRDRITSEDVENGEASRPLLGDHNVVFSVDDDSDEESLAGPSKTEHSVRFQEDVQVIGPPLRSTTASREAEY # ELDSDEIDDEPEITSTPRGHMSPNMPLIVGLLDSSRRSFDSPLPLNGANGRVGDLDLEAIAAKRTAGGGLFDSIANMANSILGAGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g604 ### # start gene g605 3 AUGUSTUS gene 2192891 2193906 0.86 + . g605 3 AUGUSTUS transcript 2192891 2193906 0.86 + . g605.t1 3 AUGUSTUS start_codon 2192891 2192893 . + 0 transcript_id "g605.t1"; gene_id "g605"; 3 AUGUSTUS CDS 2192891 2192947 0.88 + 0 transcript_id "g605.t1"; gene_id "g605"; 3 AUGUSTUS CDS 2193010 2193302 0.87 + 0 transcript_id "g605.t1"; gene_id "g605"; 3 AUGUSTUS CDS 2193354 2193906 0.98 + 1 transcript_id "g605.t1"; gene_id "g605"; 3 AUGUSTUS stop_codon 2193904 2193906 . + 0 transcript_id "g605.t1"; gene_id "g605"; # protein sequence = [MNLSWIASLEKFSHPWHFLTLTDLNDFITPSQACIKPVEQILSKTEGKQPGSASVCDSLNPFYPYRFNTLQPQNEIRI # DHNGSYYEVNGATPIGGSTTPGKKLEQAQISLNDCLACSGCITSAESVLITLQSHNEVLSFLSSNATADVPSRKVPVISIAPQSLASLAASVSSPSSA # PITPRQMLHRLRAFCKEVLGFDHVFDTTFARHVALREHVKEFIERQEEYRLKDQAVKSEGGTALPMLASACPGWICYAEKAHPEMLPFIARTQSPQQV # MGTLVKHWMGEKWGKQSVVCLFCDIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g605 ### # start gene g606 3 AUGUSTUS gene 2193956 2194969 0.97 + . g606 3 AUGUSTUS transcript 2193956 2194969 0.97 + . g606.t1 3 AUGUSTUS start_codon 2193956 2193958 . + 0 transcript_id "g606.t1"; gene_id "g606"; 3 AUGUSTUS CDS 2193956 2194969 0.97 + 0 transcript_id "g606.t1"; gene_id "g606"; 3 AUGUSTUS stop_codon 2194967 2194969 . + 0 transcript_id "g606.t1"; gene_id "g606"; # protein sequence = [MPCYDKKLEASRADFYNEAYSTRDVDCVITTGEMQLLAQEKGWDLSSPVPEEDTLQPSLTTSSKLLSDVSLPELMVHS # GSSSGGYLQSIIEHIQSTSPTPLSLSVKQIRNADYEEFVLRREAEPAAEGKIVFKGAKCYGFRNLQNVVRKVGKETGVRVAMGAAGKLKGQAAVMKRG # RRGQEMISEKGYDYIEVMACPGGCVNGGGQAKPPTNFGAVEDAEGYSRKWEESGVLLEDNSGPLAAKWGNKEWTKRVENVYWHDLPTPPASPTSENHH # MTNSGEKEDAGYDSEIRNEIVMMADRLLIDVTDELYRSGSQHNLFRTNYRAVESEVVGLAVKW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g606 ### # start gene g607 3 AUGUSTUS gene 2199552 2199796 0.53 + . g607 3 AUGUSTUS transcript 2199552 2199796 0.53 + . g607.t1 3 AUGUSTUS start_codon 2199552 2199554 . + 0 transcript_id "g607.t1"; gene_id "g607"; 3 AUGUSTUS CDS 2199552 2199564 0.53 + 0 transcript_id "g607.t1"; gene_id "g607"; 3 AUGUSTUS CDS 2199651 2199796 0.53 + 2 transcript_id "g607.t1"; gene_id "g607"; 3 AUGUSTUS stop_codon 2199794 2199796 . + 0 transcript_id "g607.t1"; gene_id "g607"; # protein sequence = [MGTAYNEPLSNGSAMITTYGSTEQELNECRVDSGKTVLWFSNDNSTVPKNNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g607 ### # start gene g608 3 AUGUSTUS gene 2202577 2202897 0.88 + . g608 3 AUGUSTUS transcript 2202577 2202897 0.88 + . g608.t1 3 AUGUSTUS start_codon 2202577 2202579 . + 0 transcript_id "g608.t1"; gene_id "g608"; 3 AUGUSTUS CDS 2202577 2202897 0.88 + 0 transcript_id "g608.t1"; gene_id "g608"; 3 AUGUSTUS stop_codon 2202895 2202897 . + 0 transcript_id "g608.t1"; gene_id "g608"; # protein sequence = [MFIENIARYFPTPDEADSVFALFDRDGNGDASMEEIEIACMDFHREQLSIEHSMQDLDSAVGRLDNIFMSLYVVVAVL # IIAVVLVDSFHSNPNELLINANVIGRSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g608 ### # start gene g609 3 AUGUSTUS gene 2203650 2204124 0.99 + . g609 3 AUGUSTUS transcript 2203650 2204124 0.99 + . g609.t1 3 AUGUSTUS start_codon 2203650 2203652 . + 0 transcript_id "g609.t1"; gene_id "g609"; 3 AUGUSTUS CDS 2203650 2203824 0.99 + 0 transcript_id "g609.t1"; gene_id "g609"; 3 AUGUSTUS CDS 2203922 2204124 1 + 2 transcript_id "g609.t1"; gene_id "g609"; 3 AUGUSTUS stop_codon 2204122 2204124 . + 0 transcript_id "g609.t1"; gene_id "g609"; # protein sequence = [MSAKRRNKWICALKQALADVGIFGPAGNPDATTKPKQYTEVPWEEVKHAEQNKTSRPMRNVTGDDSDNVFDDDADEQV # MRSSWRSPTADSDYASLSTPRMPHAAPMPSQSQLAYAPEAIELSERR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g609 ### # start gene g610 3 AUGUSTUS gene 2204308 2205275 0.48 - . g610 3 AUGUSTUS transcript 2204308 2205275 0.48 - . g610.t1 3 AUGUSTUS stop_codon 2204308 2204310 . - 0 transcript_id "g610.t1"; gene_id "g610"; 3 AUGUSTUS CDS 2204308 2204667 0.9 - 0 transcript_id "g610.t1"; gene_id "g610"; 3 AUGUSTUS CDS 2204722 2204865 0.61 - 0 transcript_id "g610.t1"; gene_id "g610"; 3 AUGUSTUS CDS 2204951 2205108 0.85 - 2 transcript_id "g610.t1"; gene_id "g610"; 3 AUGUSTUS CDS 2205194 2205275 0.73 - 0 transcript_id "g610.t1"; gene_id "g610"; 3 AUGUSTUS start_codon 2205273 2205275 . - 0 transcript_id "g610.t1"; gene_id "g610"; # protein sequence = [MEITSDQLEIQPHPNEGTEEAGEERVRHDPDADPILICKIRKGQELKLRCIAKKVRGHYQSLASQTELFCAGNRKGTR # KMAEWPLGENAREEEPPREDEPFDFNAKPNKFYFDVETDGSLGAQEVVMKGIAELQKKLASLVLALRRVRNGENEMDMPSGGDQTFVDQPAGGSGGER # GWGSGAGSGWGNPSSSASGAGGGASWGGGASPSRGGGNAAWGSSPGNANAWSSPSNAGWGSPSAQANGWNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g610 ### # start gene g611 3 AUGUSTUS gene 2214446 2215595 0.99 - . g611 3 AUGUSTUS transcript 2214446 2215595 0.99 - . g611.t1 3 AUGUSTUS stop_codon 2214446 2214448 . - 0 transcript_id "g611.t1"; gene_id "g611"; 3 AUGUSTUS CDS 2214446 2215400 1 - 1 transcript_id "g611.t1"; gene_id "g611"; 3 AUGUSTUS CDS 2215459 2215595 0.99 - 0 transcript_id "g611.t1"; gene_id "g611"; 3 AUGUSTUS start_codon 2215593 2215595 . - 0 transcript_id "g611.t1"; gene_id "g611"; # protein sequence = [MIFGINDCTTLSHISVQIQTVTRVVKAWDDRNVNVHELTEDIVSCMFHPDFPNHSSKIQGEMMHYMQTWVQQLGSKQH # ATLSRLSKNAVRNHENTRLAGAGGTPAAQGTYGYNQGIQAQHNLQGYASQIPGVAQAQSLLGKLDSGNRRDVSGTSLGGSSYPGAPVPPHQYNSAPPP # LLSGESASYYGAEYPPPLSGSRIHHATPPGPPGGSASHYGADRPSMPGSGAHYAPPPGPPGGSASGYAPSYSSPSSFPDSPSPFPDVPPSFPGDTPHF # PGADGHGGHHGHPHHYAPPPGPPPGAFGPPGGPPGVSFPQSSPYGTPGGGPSFPGADPYPQQGASFPNAAPHFPPPSEGYNPYGGNQGW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g611 ### # start gene g612 3 AUGUSTUS gene 2220195 2220671 0.56 - . g612 3 AUGUSTUS transcript 2220195 2220671 0.56 - . g612.t1 3 AUGUSTUS stop_codon 2220195 2220197 . - 0 transcript_id "g612.t1"; gene_id "g612"; 3 AUGUSTUS CDS 2220195 2220671 0.56 - 0 transcript_id "g612.t1"; gene_id "g612"; 3 AUGUSTUS start_codon 2220669 2220671 . - 0 transcript_id "g612.t1"; gene_id "g612"; # protein sequence = [MIFFELQFNEQELELLISGTPDIDVDEWRAATEYNGYTSSDPNIVWWWRALKSFNRDERAKVLSFATGTSRVPLNGFV # DLQGVQGVQKFSIHRAYGESDRLPQAHTCRFFSVFQKLARLNLHLLGFNQIDLPQYSSYEMLRQQVLFAISEGGEGFGFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g612 ### # start gene g613 3 AUGUSTUS gene 2220935 2222284 0.91 - . g613 3 AUGUSTUS transcript 2220935 2222284 0.91 - . g613.t1 3 AUGUSTUS stop_codon 2220935 2220937 . - 0 transcript_id "g613.t1"; gene_id "g613"; 3 AUGUSTUS CDS 2220935 2222284 0.91 - 0 transcript_id "g613.t1"; gene_id "g613"; 3 AUGUSTUS start_codon 2222282 2222284 . - 0 transcript_id "g613.t1"; gene_id "g613"; # protein sequence = [MTLQAVEQQILLSNPPQIPHAVLRLIVNILTVGECSSRTFQQSLNLIQHLSYIPDTRDVIAQELKSKAQEFGHTLFSE # LDELASALRNSSETQLSSVASKFSAASSIQAKLLRVLKTIDYMYSPRPSSVGIGANHESEDTEKVQAIYESFRFAPLWKSLGDCLAIIEEKADTEHVT # TVLLPLIESLMVVCKYVGTNSSANRALRATSSPRSPTTPKESMEDLFVTFTDTHRKVLNVMVRNNPSLMSGSFSLLVHNPRVLDFDNKRNYFTQQLHR # KPHAREHHGTIQLNIRRARVFEDSFQQIMRKTGDQIKYGKLNIRFYEEEGVDAGGLTREWFQILARQMFDPNNALFQPCAADKLTYQPNKNSWVNPEH # LTFFKFVGRVIGKAIYDGRLLDAYFARSLYRQLLGKPVDYKDVEWVDPEYYNSLCWILENDPTLLELTFSVEADEVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g613 ### # start gene g614 3 AUGUSTUS gene 2222352 2224244 0.43 - . g614 3 AUGUSTUS transcript 2222352 2224244 0.43 - . g614.t1 3 AUGUSTUS stop_codon 2222352 2222354 . - 0 transcript_id "g614.t1"; gene_id "g614"; 3 AUGUSTUS CDS 2222352 2224244 0.43 - 0 transcript_id "g614.t1"; gene_id "g614"; 3 AUGUSTUS start_codon 2224242 2224244 . - 0 transcript_id "g614.t1"; gene_id "g614"; # protein sequence = [MERNTRTPPTSSQARTLDPLLTLQRWAEEVKVLHGDLVADRASKLVNHLVNTMLPNAIEVAQKATEEEAARERDAEAK # AQQEKEEEERKEAEDKAQTQISVESSDQPIQSQSSKIEGPSDVHDTSPEDHPMEDATSSVGVSVAAVPEMADTEMVDGTAVTGLQPLEPGESNDDNVT # SLPSENEASASGQVNTTNRVTVMIHDNEVDITDTGIDPTFLEALPDEMREEVLNQHVRDQRAARIERPADSQISVEFLDALPPEIRAEIIQQEAMERA # RHSAEVAQSASGVPRVPAEIDPASFIASLDPTLRQAVLMEQDEGFIQTLPPHVIAEAGHYRTAQSRRLHVSSRGVRETSGAPAIVRKFAPQHDAIQLL # DKAGVAALIRLLFFPQVLKKTLIFKVLVNLCENAKTRTELFNLLLSILQDGTGDLAAVDKSFAQMSVRNSKTPKAIGKQKSTSDLITTLVLPGGHTEA # VPDLIAQRCLEALTYIVTANSSSSLFFLTEHELPAGLRRASSKKGKGKEKQIPQTHYPIVLLLGLLDRQSLLRTPSIMESVVGLLATVTRPIKEAKLQ # AQLQPSTSKSVTNDAESSNNQTTNGTGDNSVPAVETTPAPPSSLPHDGIASEFFKPFLPLHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g614 ### # start gene g615 3 AUGUSTUS gene 2224953 2228401 0.32 - . g615 3 AUGUSTUS transcript 2224953 2228401 0.32 - . g615.t1 3 AUGUSTUS stop_codon 2224953 2224955 . - 0 transcript_id "g615.t1"; gene_id "g615"; 3 AUGUSTUS CDS 2224953 2225024 0.86 - 0 transcript_id "g615.t1"; gene_id "g615"; 3 AUGUSTUS CDS 2225072 2225386 0.84 - 0 transcript_id "g615.t1"; gene_id "g615"; 3 AUGUSTUS CDS 2225447 2225619 0.53 - 2 transcript_id "g615.t1"; gene_id "g615"; 3 AUGUSTUS CDS 2225719 2228401 0.42 - 0 transcript_id "g615.t1"; gene_id "g615"; 3 AUGUSTUS start_codon 2228399 2228401 . - 0 transcript_id "g615.t1"; gene_id "g615"; # protein sequence = [MLGLVTVLLIDGMISSIYFGSADLCFLERTTNHTIYTVQLLAFYRVGGVDAVLNVSRSFISSIRSIVPIREEDRSPAQ # TQELLHAFSGLKIVLHLLHPLVSSKPLFESGQTNIVVTKDKKDTDDDYFEPHNFLVRLRLAVLPLLKDIWESSWLIKAPLGVCRSVVQTVLEVLNSSD # ESKASIETGPSSSTFFRSNVLDESRIRQLTDMGFPRAAAEHALRRTHNNVPAATEILLSNPFLPFAAEPEPEPATTASGSAEVVTDESSVNEDGAGSG # PTTMPAEPVDDSPSPEPTIGKTVEEWRKDLEAAREPLRAGISRKALSLVDEHISLLFDIHAAFVRPGDAHQPEAIRNIVDDIKGFSPYAYDVQEQPLA # NRCRLLALVLSETPYSLDPELRSSLMDSLLALLLSNPVSMDPEHPIIPRWLAAHLLVTEALLTLSEEPRDIGTPKEGEPIPSEPLSTGPALTDARAMV # FDFCLKLLAMPDLPSDELLSSLRLLVLLTRDHEYALQFVKKDGLGMLFSRLHTSPVTGSSSYIAIILRHIIEDHKTVQGIMHQSIRRYLTNPRNRVPD # VSSYLKNCSAMALRDPNTFIEVTQKLCHLGSPYATSYTLSLNKNSDVPPKNEELKNTVDMQVDPSTADSSESVDEVMYFLAAELMKAAKALNSDTPST # TSSAPSSVVEPHTAPDAAHVPGLKDSADSSTDKAQHLYMCFLMQCMTELLFSYDSCKVALLSYSVKKRTNTPAKENPHSRFRTSTMHFLLSELVPFDG # LNPPNSPETRSKMSVSTWAMSLLVALCVDTSSGQEGRDISNDLVAVRKFVLESISRAIKDASPAESTELQYGRLFALSDLCHRLLTVRFSPSTRKHED # GPTQISKVMLEKNFVATLTNTLSDIDLNYPNVLAIKMSRAPGKARESSSPKAGSISPLSSDEEDEEEENQDAREETPDLYRNSALGMYGGEMEDMTYH # GEDEDMDDEEDMGEHDEEMDFDEETGSEDTSNTDEEEEADEDLDDAEEEGWEDEEDDEEDLVPDEVDEGHEDEEGIVNPHEPVDEEEIEEAEEMMWQD # IQDDVDAEELREEDEDEDSGGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g615 ### # start gene g616 3 AUGUSTUS gene 2229470 2230232 0.13 - . g616 3 AUGUSTUS transcript 2229470 2230232 0.13 - . g616.t1 3 AUGUSTUS stop_codon 2229470 2229472 . - 0 transcript_id "g616.t1"; gene_id "g616"; 3 AUGUSTUS CDS 2229470 2229934 0.14 - 0 transcript_id "g616.t1"; gene_id "g616"; 3 AUGUSTUS CDS 2230089 2230232 0.69 - 0 transcript_id "g616.t1"; gene_id "g616"; 3 AUGUSTUS start_codon 2230230 2230232 . - 0 transcript_id "g616.t1"; gene_id "g616"; # protein sequence = [MATFVHNEPGSLTVIQEAGLPETFYKSIELGLEPAIEVRLFLIFMSAFILLEKENAVLIGTAVDELIRHHPFLKAPVF # QALKSTMTKIEELGHAYVPPDDIRNWYQLTVARPSPSSTSEDVDKMEGVESSEGKESSPPPPPAYTAALLEPHSEEAMRLHENNIISFIDILGRVSIN # RVSHGTSTDSSQSVLGRSFSTHPTLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g616 ### # start gene g617 3 AUGUSTUS gene 2231734 2232191 0.3 - . g617 3 AUGUSTUS transcript 2231734 2232191 0.3 - . g617.t1 3 AUGUSTUS stop_codon 2231734 2231736 . - 0 transcript_id "g617.t1"; gene_id "g617"; 3 AUGUSTUS CDS 2231734 2232093 0.95 - 0 transcript_id "g617.t1"; gene_id "g617"; 3 AUGUSTUS CDS 2232162 2232191 0.3 - 0 transcript_id "g617.t1"; gene_id "g617"; 3 AUGUSTUS start_codon 2232189 2232191 . - 0 transcript_id "g617.t1"; gene_id "g617"; # protein sequence = [MKILHKSKRTPPQVADLITRLINTPDDALAQTLEEIDAWKWQRSDLNAWIKVLNKFDTVLEDVIREYDIDKLQVREFS # TESKKMVSEILKFERLLLENSTNRKMFNSYDVRNPFVTMEYLSQASQKNSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g617 ### # start gene g618 3 AUGUSTUS gene 2239671 2240213 1 - . g618 3 AUGUSTUS transcript 2239671 2240213 1 - . g618.t1 3 AUGUSTUS stop_codon 2239671 2239673 . - 0 transcript_id "g618.t1"; gene_id "g618"; 3 AUGUSTUS CDS 2239671 2240213 1 - 0 transcript_id "g618.t1"; gene_id "g618"; 3 AUGUSTUS start_codon 2240211 2240213 . - 0 transcript_id "g618.t1"; gene_id "g618"; # protein sequence = [MSTDHPDSNSSSVVDPPASLDSLFSPKQATFGEAEARARESIAESELSDISLDDEKMEDLDVSDSTVDQTDSTTPAEL # FLPTKPFELDLNETHSGSTSSHKKSASLATLHSGRHISLLVNHDEQAPGSRVSLDGQHKLQEEFARLQKEKDSENLKGPPTPGFSAGIDWGELPPPGS # TVYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g618 ### # start gene g619 3 AUGUSTUS gene 2244607 2245398 1 + . g619 3 AUGUSTUS transcript 2244607 2245398 1 + . g619.t1 3 AUGUSTUS start_codon 2244607 2244609 . + 0 transcript_id "g619.t1"; gene_id "g619"; 3 AUGUSTUS CDS 2244607 2245398 1 + 0 transcript_id "g619.t1"; gene_id "g619"; 3 AUGUSTUS stop_codon 2245396 2245398 . + 0 transcript_id "g619.t1"; gene_id "g619"; # protein sequence = [MSSLQVSQHNSDYDLTTNKLPQQNEPTTLLFHAELDNTPPSKNEESDPTSYSTFLRSRPDAFEINAISLITRLQTKYP # NLPCHIVHLSSSKALPLIRDAKAAGLKLSVETCFHYLCLSAENIPRGQTIAKCCPPIREASNRELLWDALKDGTIDFVVSDHSPCTTELKKIDEGDVM # GAWGGISTLGLGLSLLWTEGSQRGISLAQIIDWTSVKTAKHAGLSERKGKLQTGYDADLVIWDPDAEFAVSLDKLHFSLSLPSSNLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g619 ### # start gene g620 3 AUGUSTUS gene 2248069 2249081 0.95 + . g620 3 AUGUSTUS transcript 2248069 2249081 0.95 + . g620.t1 3 AUGUSTUS start_codon 2248069 2248071 . + 0 transcript_id "g620.t1"; gene_id "g620"; 3 AUGUSTUS CDS 2248069 2248096 0.95 + 0 transcript_id "g620.t1"; gene_id "g620"; 3 AUGUSTUS CDS 2248177 2249081 0.96 + 2 transcript_id "g620.t1"; gene_id "g620"; 3 AUGUSTUS stop_codon 2249079 2249081 . + 0 transcript_id "g620.t1"; gene_id "g620"; # protein sequence = [MFIQAAETDVRPTDPEAPHTLPKTEADDVASTLPDPPGAQSVTPRTHDADAMEFEGMEDEDIELQMALQASLGHDIPP # SPADPPQLLRTSVPLPLVDSYPPSTSGSGTRTPLQQDSLLSPISPDVPHDPASVEASIAQSRRIYERMLAEQNLAHREIAAEGGGNSRVRRMREEEEE # EEMLRRAIAESEAMAKEEGHELGSIGDDEGGSHVDLDQSHLAPPSTAGRRVYDDEDAELQAALRASLEGWNPPPETTTVSAPTVSHTSPLQSSDSSMT # DDDESIASEDTAPAESSEAPVSVEEMRRRRLARFGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g620 ### # start gene g621 3 AUGUSTUS gene 2249786 2252290 0.94 + . g621 3 AUGUSTUS transcript 2249786 2252290 0.94 + . g621.t1 3 AUGUSTUS start_codon 2249786 2249788 . + 0 transcript_id "g621.t1"; gene_id "g621"; 3 AUGUSTUS CDS 2249786 2250046 0.96 + 0 transcript_id "g621.t1"; gene_id "g621"; 3 AUGUSTUS CDS 2250722 2252290 0.94 + 0 transcript_id "g621.t1"; gene_id "g621"; 3 AUGUSTUS stop_codon 2252288 2252290 . + 0 transcript_id "g621.t1"; gene_id "g621"; # protein sequence = [MHGQPYPSGSDNAKDQTFNLKLICDENASDPKFVSYDGSLAEVEWTNPAACGSEVGDGSDNDSGNDGDSEGDEEEESV # GSGIGWFFLCRLQVSRVREGTNCEGYETQEEAVKAFDEALTNGFVKISGSFDHPYQSPRIHPPLDCPPYSCGPASVAVPNSPPPTPGRARARSISTPA # PAPVHVPIFAPSTPSPSTFLPPSVFENASFGDIPGYAQNVTIRSPKREKAPINTPTPPKQNKEIQTVGRTKGACAQCGCDCTTDPRQKQQQNGASSSR # STSDPSQSAKGKQSTRRDELSIISSESESDDVFTRSSSSDEKKAPITPRRAHTRIPASVHSTHRSSIRAKPVLRTLSAPPNSSSFASPPSSPSRIHQK # LKPQPPAAAASSPQPAAATSRYHRNPNTQFPTSTTTTNSSFQLPNAVIDISDVESYPSSDSSVSGSKTDEEEDSSGPEDVTPLQTRQRLLSPLTSPNF # KNAVLTDGVGGGVHRHPDVKGKKTTVSNSSPSAQRKRSPYTPNCTADVFTTGTSLGAAAEHLVSPRQGHTSSSSPRVSPVSRFGGSELEQGSSNDGVS # SALGLLHQSPAPTNISAMYNVILDPRSPILRNRVMALGEPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g621 ### # start gene g622 3 AUGUSTUS gene 2252908 2253453 0.99 + . g622 3 AUGUSTUS transcript 2252908 2253453 0.99 + . g622.t1 3 AUGUSTUS start_codon 2252908 2252910 . + 0 transcript_id "g622.t1"; gene_id "g622"; 3 AUGUSTUS CDS 2252908 2253453 0.99 + 0 transcript_id "g622.t1"; gene_id "g622"; 3 AUGUSTUS stop_codon 2253451 2253453 . + 0 transcript_id "g622.t1"; gene_id "g622"; # protein sequence = [MDYSSDFSLETNGSRLLSESPMLPSSSSLSSSSSQADLSLSELSISERRPESPSSSSSSRPFSLLARPVSPSTPVQTR # RSNPKEVGDENSNEHEDMEDDEDFGEITQKQITVDDEQAATSDSEEREQVIRTKAKLLREDKLQNDIFVLRKLNAAFSSFNEALEGVGDANEARLCYY # RRSLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g622 ### # start gene g623 3 AUGUSTUS gene 2256855 2258102 0.67 + . g623 3 AUGUSTUS transcript 2256855 2258102 0.67 + . g623.t1 3 AUGUSTUS start_codon 2256855 2256857 . + 0 transcript_id "g623.t1"; gene_id "g623"; 3 AUGUSTUS CDS 2256855 2256970 1 + 0 transcript_id "g623.t1"; gene_id "g623"; 3 AUGUSTUS CDS 2257025 2257296 0.67 + 1 transcript_id "g623.t1"; gene_id "g623"; 3 AUGUSTUS CDS 2257393 2258102 0.84 + 2 transcript_id "g623.t1"; gene_id "g623"; 3 AUGUSTUS stop_codon 2258100 2258102 . + 0 transcript_id "g623.t1"; gene_id "g623"; # protein sequence = [MSSPGSGNHCSFVLLAEFDIIEGAQLKYQFPQPLGIDESVLAMSMLPDGAETQLDDWTIFFLNQTDFNTIEPVLALES # DSDSFLEDQAGDHAGQERRKKKKELLCVLNLVRTKHDKTLNRGAKVLALAISLDDYLSNPSQDVLARLFDAVNAIDFTVAPVLSRDEKLVMRMSERKD # IFAERHKHLYTNFTSSFTQHKNSNSDSSVNNQSLPIRPPVKEDPDLNIPGDVSFGSAVWVGDESAFDISGTTSDSDGATDGASTVIGSTRQRSSTDAS # SSSSSSHLHLPRIPISRAGSSFGSHDSTVSGTKVGGTSSYMGAGNTIQDTHFFNTTVEYNDHKLPIKMPLSTFPEEVGDVRCSFDGASSEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g623 ### # start gene g624 3 AUGUSTUS gene 2260223 2260558 0.99 + . g624 3 AUGUSTUS transcript 2260223 2260558 0.99 + . g624.t1 3 AUGUSTUS start_codon 2260223 2260225 . + 0 transcript_id "g624.t1"; gene_id "g624"; 3 AUGUSTUS CDS 2260223 2260558 0.99 + 0 transcript_id "g624.t1"; gene_id "g624"; 3 AUGUSTUS stop_codon 2260556 2260558 . + 0 transcript_id "g624.t1"; gene_id "g624"; # protein sequence = [MPPTKRKHSDSSDERSLSDLDIDGIDNDLEDDDVDISSALTRKRSKNNSQQNQSDGEEDFSIFLQDAMAKHNVKSGTE # LLKKTKGKAKLVKGEVGGGSFQSMGTSRIKQRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g624 ### # start gene g625 3 AUGUSTUS gene 2261099 2263254 0.45 + . g625 3 AUGUSTUS transcript 2261099 2263254 0.45 + . g625.t1 3 AUGUSTUS start_codon 2261099 2261101 . + 0 transcript_id "g625.t1"; gene_id "g625"; 3 AUGUSTUS CDS 2261099 2262453 0.45 + 0 transcript_id "g625.t1"; gene_id "g625"; 3 AUGUSTUS CDS 2262597 2263254 0.92 + 1 transcript_id "g625.t1"; gene_id "g625"; 3 AUGUSTUS stop_codon 2263252 2263254 . + 0 transcript_id "g625.t1"; gene_id "g625"; # protein sequence = [MNLDLKSVQYVVFDEADRLFEMGFETSLTEIIHRLPSSRQTLLFSATLPTSLVEFAKAGLENPKLVRLDAESKISPDL # KMAFFSVKQAEKDACLVSLLRDVIKVPLIDSSQREEEERHDDKGKGKAKKRETMPHQTLIFVATKHHVEYLLNLLTTAGYAVSHIYGSLDQAARTYQM # DQFRRGLTSILVVTDVAARGIDIPVLENVVNYDFPHGARVFVHRVGRTARAGRQGWAWSFVTHTELPYLIDLQLFLGRPLKCEVTEEGDQVYTESMVL # GPMERSRIDEDMEYLKSLDDANHSLPSLRDVMKRAQSMYERSKGKASPSSYKRAKEMIKDPKWILAGSDTGINPVLLRGSNEFERRAQVQAKQTLLRA # VNSFRPAETVFEIGTKGKASTANAALMKERRKALTKSVQRAQAATSSALAEDEVLDAVASTSKNLEMANEDDIAVSVHAPIWSKFKPSSPSYSLTDGA # SFLEQARGATFDLAGDEGVADRKKRQLNWDKKKKKFVKGGGVGSDNVKMVKTESGTKLPATYRSGRFDEWKAKTHSSLPRVGEVEGEGVRSRQMSGPG # GHRFKHQKITESKPLDKRNKDYERKSRQLKKRGDAEAGNSGGVSSSQVKGGRTKVGGRYGGKSVGRVKSELKSAEDIRKSRKVQEKRKAKNNRPPSHR # KGRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g625 ### # start gene g626 3 AUGUSTUS gene 2271589 2272600 0.65 + . g626 3 AUGUSTUS transcript 2271589 2272600 0.65 + . g626.t1 3 AUGUSTUS start_codon 2271589 2271591 . + 0 transcript_id "g626.t1"; gene_id "g626"; 3 AUGUSTUS CDS 2271589 2271740 0.65 + 0 transcript_id "g626.t1"; gene_id "g626"; 3 AUGUSTUS CDS 2271796 2272600 0.84 + 1 transcript_id "g626.t1"; gene_id "g626"; 3 AUGUSTUS stop_codon 2272598 2272600 . + 0 transcript_id "g626.t1"; gene_id "g626"; # protein sequence = [MSTDSGPLSDEDSTMGDGVDLNGHANGIGNGSHLPMSDDEDMSLVKTACLLRNLKRKKSNYAESSDEDDIPLASSPAK # QPTSAAIPMPGAVAATTVPSSKASKSKRLGTKKEESDDDGYLKKPQKKKPRKKVKKEESSDDDIPIVAPKSSARKRKVKPESEAESSDEDKPIIKKTS # ARKTPAKKAKKEEDVEQPASKVNGKAKAREINDGEDEGKGKGKGKKKKKEEEQEEEVYRWWEADPNGDGSVKWQTLEHNGVIFPPPYESLPSHVKMKY # NGGPDGLTLICTQSCLTSHRHRKGCSSSSGIRRGCRLLWCFDRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g626 ### # start gene g627 3 AUGUSTUS gene 2274039 2274461 0.5 + . g627 3 AUGUSTUS transcript 2274039 2274461 0.5 + . g627.t1 3 AUGUSTUS start_codon 2274039 2274041 . + 0 transcript_id "g627.t1"; gene_id "g627"; 3 AUGUSTUS CDS 2274039 2274461 0.5 + 0 transcript_id "g627.t1"; gene_id "g627"; 3 AUGUSTUS stop_codon 2274459 2274461 . + 0 transcript_id "g627.t1"; gene_id "g627"; # protein sequence = [MKLRHGLFGMDSKYKKIDKYKEDESDIDDDWIVEYEEQMKSKEIEKAEKKFAKENEKLTEDDLKPQLDSVLEARIRHI # EEEFKRLAKERGKTTVAVKGNKTPEKLMEGIDKLTERIKSFKLQMVDRDEGKEVALGTRCGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g627 ### # start gene g628 3 AUGUSTUS gene 2275021 2275862 0.64 + . g628 3 AUGUSTUS transcript 2275021 2275862 0.64 + . g628.t1 3 AUGUSTUS start_codon 2275021 2275023 . + 0 transcript_id "g628.t1"; gene_id "g628"; 3 AUGUSTUS CDS 2275021 2275112 0.65 + 0 transcript_id "g628.t1"; gene_id "g628"; 3 AUGUSTUS CDS 2275166 2275862 0.93 + 1 transcript_id "g628.t1"; gene_id "g628"; 3 AUGUSTUS stop_codon 2275860 2275862 . + 0 transcript_id "g628.t1"; gene_id "g628"; # protein sequence = [MFAALSVESSGEESEEEISESEVKSSATTSSAATEPPAPPVKMSKTAMKKAAKAARLEKLNSLAAEKPNGEITANAVS # SSDSAEAGSFTGNLGDLEPEPPVDLVDEATVVSNHALEPPVTIPLEAAPPSKDPMELSYSMPTPEPGPSSELEASPIAPIEAPSSKQDAPPSDPENVK # KRQNIFTRTLWTFIMIGIFIGASPRSMSWFHIVTHFQASYLWAMHTWSCLSCYVKHLYIAKSLLYSSWRNLINGTKSKARTLGARR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g628 ### # start gene g629 3 AUGUSTUS gene 2277116 2278633 0.94 - . g629 3 AUGUSTUS transcript 2277116 2278633 0.94 - . g629.t1 3 AUGUSTUS stop_codon 2277116 2277118 . - 0 transcript_id "g629.t1"; gene_id "g629"; 3 AUGUSTUS CDS 2277116 2278633 0.94 - 0 transcript_id "g629.t1"; gene_id "g629"; 3 AUGUSTUS start_codon 2278631 2278633 . - 0 transcript_id "g629.t1"; gene_id "g629"; # protein sequence = [MSLPRPPLPARRGSGAPPPPPPPRPSYVVKPVSQDEEENAKPLGIAARIASLQLKQGSPSTGKSTLPQLITPEELSEK # ELEELTLPPAPSRKSFLPAVPQSKRPTWDEIESRGSEFVRAVSRKPPPIPSSEQPLPAKGTSTPPFSGRRLPPKPVRLPTPPPEPEIIYEEPEQKESS # CIKCYDFSLVDEHASLFPRHSVTSLDHLAYDLTSPWESETEKFRAIFTWLHHNIAYDADAFFCGNVQASTPESTLHSGLAVCDGYAGLFAFLAERSGL # QAMKVTGHGKGFGYTPTESGGPVPQYQGNHAWNCALMDEEWRLIDSCWGAGAVDSSGFCKGFNPVWFTSTNAEFGKRHYPEDPAYQLISDEEGGPISW # EDYILEPEGPLLFNDFHTHKFSPQYMQPSTKYIQGESWVSFHLFKLCEHLSTTEADNFVHFISLPDGSRTPLVLNDSGGWSATVYVPAGGDVSLFYVK # EIGGKDARGLTMKDYSAAVGRKAMQFGGLCRWTLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g629 ### # start gene g630 3 AUGUSTUS gene 2281062 2281619 0.62 + . g630 3 AUGUSTUS transcript 2281062 2281619 0.62 + . g630.t1 3 AUGUSTUS start_codon 2281062 2281064 . + 0 transcript_id "g630.t1"; gene_id "g630"; 3 AUGUSTUS CDS 2281062 2281619 0.62 + 0 transcript_id "g630.t1"; gene_id "g630"; 3 AUGUSTUS stop_codon 2281617 2281619 . + 0 transcript_id "g630.t1"; gene_id "g630"; # protein sequence = [MPRGTPSIKVRNVERLGAKVILHGIDFDEAKAECARLADVHGLVFVPPYDDPLVIAGQGTIGMEILKQLPDSDNLEGI # FAAVGGGGLVAGISAYVKRIGNPRTKVFGVETVDGDAMDKSLAQGERITLPEVGPFSDGTAVRIVGSEGFRICKELLDGVVKTDNDAICAAIKDIFEG # QSLLALHIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g630 ### # start gene g631 3 AUGUSTUS gene 2283127 2284157 0.33 + . g631 3 AUGUSTUS transcript 2283127 2284157 0.33 + . g631.t1 3 AUGUSTUS start_codon 2283127 2283129 . + 0 transcript_id "g631.t1"; gene_id "g631"; 3 AUGUSTUS CDS 2283127 2283680 0.51 + 0 transcript_id "g631.t1"; gene_id "g631"; 3 AUGUSTUS CDS 2283827 2284157 0.66 + 1 transcript_id "g631.t1"; gene_id "g631"; 3 AUGUSTUS stop_codon 2284155 2284157 . + 0 transcript_id "g631.t1"; gene_id "g631"; # protein sequence = [MGPPLSPRETRRSGRRSGPSLSNSHSPESDISPRLKEPAQRPPLISTASGSNGRHKRPKQEDTDDLTEDRKNGTAHSV # STSSNSSTQGSTKSKRKPKEKLPPPEETSDTTKPPLLPPEMAASEGQEEEEEGGITRCVCGNTGVFFLFYLCVQHGHLCDFVKGEDDPDAGEFMVQCE # TCKVWQHGLKLSRRPRHSSANSHHTAGANTRLSRSRSPHPPTKSQPSKRRNTMNSAFDENLKQILETTAIEAGADPATIHVNDQPTALESEELPETNN # RNKKRKRTENEMLVITPNLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g631 ### # start gene g632 3 AUGUSTUS gene 2284402 2285175 0.55 + . g632 3 AUGUSTUS transcript 2284402 2285175 0.55 + . g632.t1 3 AUGUSTUS start_codon 2284402 2284404 . + 0 transcript_id "g632.t1"; gene_id "g632"; 3 AUGUSTUS CDS 2284402 2285175 0.55 + 0 transcript_id "g632.t1"; gene_id "g632"; 3 AUGUSTUS stop_codon 2285173 2285175 . + 0 transcript_id "g632.t1"; gene_id "g632"; # protein sequence = [MFTEDTHVRPEGVVVQPAANKRSTNSHRKGAKGNARPSQSQSNTGTGHASGSHDSRRTQGNNSNTNTQTSLDSRAYRN # SHAYVVSQQPLYTSWNLPDYLSHLEEMLPTDVPKPLEVVAGATGRESIERTTERGVKVKWPSKRTSVADMNKRVRALVEWVGREQASASDRARRHEAL # EIALKKNAANAFRGNGASGAGSFDRSVLTVSSLDRNAEGSSNRPGIPGTSSMKDMEALMEELIGFQEKFGPGARRERRIAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g632 ### # start gene g633 3 AUGUSTUS gene 2285453 2285827 0.99 + . g633 3 AUGUSTUS transcript 2285453 2285827 0.99 + . g633.t1 3 AUGUSTUS start_codon 2285453 2285455 . + 0 transcript_id "g633.t1"; gene_id "g633"; 3 AUGUSTUS CDS 2285453 2285827 0.99 + 0 transcript_id "g633.t1"; gene_id "g633"; 3 AUGUSTUS stop_codon 2285825 2285827 . + 0 transcript_id "g633.t1"; gene_id "g633"; # protein sequence = [MSSEFQYPNGAGSLPREDSLNLSGSEDDNDHGGDYSTRMEELFADDVQDSNGHLEDESDDDGGFLYTGNDADLSTSYR # DQLRNVLEDDSDAEVHEVEKSLMAEDPTEEVPSEDEEHDPLVCISN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g633 ### # start gene g634 3 AUGUSTUS gene 2286889 2290334 0.51 + . g634 3 AUGUSTUS transcript 2286889 2290334 0.51 + . g634.t1 3 AUGUSTUS start_codon 2286889 2286891 . + 0 transcript_id "g634.t1"; gene_id "g634"; 3 AUGUSTUS CDS 2286889 2287364 0.51 + 0 transcript_id "g634.t1"; gene_id "g634"; 3 AUGUSTUS CDS 2287727 2290334 0.99 + 1 transcript_id "g634.t1"; gene_id "g634"; 3 AUGUSTUS stop_codon 2290332 2290334 . + 0 transcript_id "g634.t1"; gene_id "g634"; # protein sequence = [MPLPLGTTSHPTDTYQAVALLTPHKLVVVGLKPTPKTWFKFARDDTKSQTRVRSRGTLCWFPSILPNTNKDGGLPPVT # EEPTTPLLACSWGRVMHILRVFESRSRQLVRNPKTGKSIEHEVGSITYLNAGKWTADEDILAIQWLNVNVGSFASCCPSLNAIDLTRSYYTGEAPGNT # NGLPDDPRLRKEVIGKKICELMTASANYAFSEDRMTDGTHDGPDGRGVDRTSLFEGLVSTCARACIALDDFDFLFEDLFQLYDDHSISQIFLTQLETF # ILNNEIHFVPPRITQRLVAMHDNNSRPDLVERIIWHIDAECLDSNQAVQICQAHHLYDALIYVYTRALRDYVAPVVELLGLIRKVNQYRRHIAEYTES # SMSDMEPVILNAYKIYPYLANILSGLTYPSEQPLGEEEALQAKRDVYTFLFFGRSSVWPEGGGGKLVLTADEEGGLEPTYPYVQQLLRYDAESFLHSL # DIAFEDAYLNEKSPAVDRLVVVRILMDIVATGSLTQTDKTFVHIFIARNIPKYPQFLQEAIPFSTLHKILVSLAEDPDPDTREDRQLAAEYLLSAYNP # HNVPHMTELFRKAGFFRILRGWHRQDKQWGPLLLTFLQDPTLPSFEMFQDLDEVLHSSTRSSSNTLPQELVVIIQDALPSLIRKSPSDTALLIDKHIP # SLHDQAIDSLAESSDEDRFMYLHCLLGPPEEEEYAHAHHPSRNLSLPLRQLYITLQCRFHPENVIPIMQYLPPDILDWDHAITTCETNKVFDAAIWAL # NRQGKPLEALAKADAFDQSLSLELINIFQAAPDQVSIADVGSTLRSLESIGRTGISMCIEQSQDPSAMDIPLEDIWFKLLHSQINCVQTITGSSSPEA # LAADIHTSFTSAIVQSEWKALSTLRSLVQETFSALVSVTTTRAVSFPRLFNRLVNAATHSQVTTGTQYTEFRSILTGMLESYRSDGDMLIITKHLLDR # DLFETLEDATRERVRGWTPSRITDCSICRKPLLKRSKGQPDTGGVSLDQRIVVSRTGSIYHNRCSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g634 ### # start gene g635 3 AUGUSTUS gene 2292076 2292498 0.36 - . g635 3 AUGUSTUS transcript 2292076 2292498 0.36 - . g635.t1 3 AUGUSTUS stop_codon 2292076 2292078 . - 0 transcript_id "g635.t1"; gene_id "g635"; 3 AUGUSTUS CDS 2292076 2292498 0.36 - 0 transcript_id "g635.t1"; gene_id "g635"; 3 AUGUSTUS start_codon 2292496 2292498 . - 0 transcript_id "g635.t1"; gene_id "g635"; # protein sequence = [MGSGFSNSSSSMPPRTPFTPFTAFSTQQSAFPSLGKTKSPYSHLLDDSDDPLAKLYTQILRFVERDFSSIMDIAEKVS # VKSRSSTDPFQIDTAENGRKRDGLGFDIMANVIWNELGKAIMDDLGGFVFASGRPDEFRKVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g635 ### # start gene g636 3 AUGUSTUS gene 2293373 2293885 0.57 - . g636 3 AUGUSTUS transcript 2293373 2293885 0.57 - . g636.t1 3 AUGUSTUS stop_codon 2293373 2293375 . - 0 transcript_id "g636.t1"; gene_id "g636"; 3 AUGUSTUS CDS 2293373 2293885 0.57 - 0 transcript_id "g636.t1"; gene_id "g636"; 3 AUGUSTUS start_codon 2293883 2293885 . - 0 transcript_id "g636.t1"; gene_id "g636"; # protein sequence = [MALISSRGAKPVAPGSTRPCTMSVLSPAASSSSSADPFQLERLAEELATRELSHPAQSYPQDGSSHDLPIYTPLSHEN # PFLSAEKFDVEAFLLSRSHTSLQDLRAELRDYLATLKEELVKLINDDYEAFISLSTDLKGEGERLTGLKQPLGALKSEISVSCSINYSGIMI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g636 ### # start gene g637 3 AUGUSTUS gene 2298354 2298911 0.58 + . g637 3 AUGUSTUS transcript 2298354 2298911 0.58 + . g637.t1 3 AUGUSTUS start_codon 2298354 2298356 . + 0 transcript_id "g637.t1"; gene_id "g637"; 3 AUGUSTUS CDS 2298354 2298380 0.58 + 0 transcript_id "g637.t1"; gene_id "g637"; 3 AUGUSTUS CDS 2298519 2298911 1 + 0 transcript_id "g637.t1"; gene_id "g637"; 3 AUGUSTUS stop_codon 2298909 2298911 . + 0 transcript_id "g637.t1"; gene_id "g637"; # protein sequence = [MSRAPAPAQEVEDAEFKRKREEAEANAEAKTAKNRAKRQKKKGKAKNAGSESTHGATSSQKEGADGNDIPFKKRRLVN # GRELVFRKQGEDGEDSDENEDEQSVPNHPATEASDPPLGMSASDTRPPPVAPSKIVIHEDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g637 ### # start gene g638 3 AUGUSTUS gene 2301435 2301758 0.58 + . g638 3 AUGUSTUS transcript 2301435 2301758 0.58 + . g638.t1 3 AUGUSTUS start_codon 2301435 2301437 . + 0 transcript_id "g638.t1"; gene_id "g638"; 3 AUGUSTUS CDS 2301435 2301758 0.58 + 0 transcript_id "g638.t1"; gene_id "g638"; 3 AUGUSTUS stop_codon 2301756 2301758 . + 0 transcript_id "g638.t1"; gene_id "g638"; # protein sequence = [MLLTLLSSRSEIEEPSSLMIRSEDETAAASTNAFLKSRLNFIKDKNGQEICVVKVGDEEIGVMMGWEQGIMQETVKNL # CEDHPSSDNFKVLNIGFGLGIVCVFFPRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g638 ### # start gene g639 3 AUGUSTUS gene 2307017 2308860 0.12 - . g639 3 AUGUSTUS transcript 2307017 2308860 0.12 - . g639.t1 3 AUGUSTUS stop_codon 2307017 2307019 . - 0 transcript_id "g639.t1"; gene_id "g639"; 3 AUGUSTUS CDS 2307017 2308756 0.21 - 0 transcript_id "g639.t1"; gene_id "g639"; 3 AUGUSTUS CDS 2308834 2308860 0.12 - 0 transcript_id "g639.t1"; gene_id "g639"; 3 AUGUSTUS start_codon 2308858 2308860 . - 0 transcript_id "g639.t1"; gene_id "g639"; # protein sequence = [MSTTDQAAKRADILDRIRLQRQQGKILGSPLTSLSSSSSYPAPPAQSRDATISSRYFPQTPGSPNDTVLVPSSSPLNS # PVNRNPNQPYTQPRWPDVAFRNGAALAGSWNLSQLAPSYDPLSVSSGFTSQNNSQRGSNVRPFSPGESESGLPRKRPNLSDAPSNLAIARSPDSPGIQ # RPGQRRRTLLDAGSTSSEESTPESSSRTRLVRGRPADSAEPPLSSPPADIFLDPKFVRFNMTMPGVPSHRVRAAWLHAKQDVRLATQLASDDSWVPKP # STPLQSSPSHSLKASTGIHGKVDGLEEAHKAKLAAMKEKSKKSSIYANRPNASKVAPPATPSVKNPPIDLIAESPAMSQPVRRKRNKNMIVDSDSDVE # MDDSEEERSHKRSRQESHHELRVLTFFNTQGAEALQELTGMLFSIHSLSRNSECVIGCTQVQAQAIIDLREFESVDDLNTKLGQGKKKAGPAGLSPRL # IDEAVEIFKGYTAVDEILEGCEEIGAKLQSSIATWTTIPFKGKGKQVDTLPESVEDGALNLRTMPSFKEHRPKGYISEQPASLSDSVKLKDYQLLGLN # WLHLLYRSNFSCILADEMGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g639 ### # start gene g640 3 AUGUSTUS gene 2317654 2319074 0.59 + . g640 3 AUGUSTUS transcript 2317654 2319074 0.59 + . g640.t1 3 AUGUSTUS start_codon 2317654 2317656 . + 0 transcript_id "g640.t1"; gene_id "g640"; 3 AUGUSTUS CDS 2317654 2317931 0.77 + 0 transcript_id "g640.t1"; gene_id "g640"; 3 AUGUSTUS CDS 2317991 2318213 0.69 + 1 transcript_id "g640.t1"; gene_id "g640"; 3 AUGUSTUS CDS 2318388 2319074 0.72 + 0 transcript_id "g640.t1"; gene_id "g640"; 3 AUGUSTUS stop_codon 2319072 2319074 . + 0 transcript_id "g640.t1"; gene_id "g640"; # protein sequence = [MSTISTFFPSSSSVPISNDSTQAKSLPYPAVSRSQTPVSSPLAGPSIWRPPAHWNLDTNGRPANPPSNSIKKPPRNKV # RTPEERDAIAETSARFSSRIVADHEAVLNPDVESPFVDTIDVVNRLLPYHIFFQPKEDLVPLLRDRKGKTKAAEIEDLAGNFIDSRQIALVVLTQSVL # DSDRAEVAALNAELRAARSEYDRLERQKRATSNPPPPTPASRTSLYTAPTQSAVANGQSAYYRPYPYTYTSTFGTSSPAQAAAATPTFSVASNATSIP # QVNTSTVPPPATYPTTSAIPVQLPIAFMPALNRLGIIPVPTGSVSAGQPQPPAVLRGSSSNGTVLNLEINVAMLQPSQMSGLAVILNSLMSRSNSSSI # PSAPALSSGSSTGVFPPPADKVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g640 ### # start gene g641 3 AUGUSTUS gene 2325653 2326195 1 + . g641 3 AUGUSTUS transcript 2325653 2326195 1 + . g641.t1 3 AUGUSTUS start_codon 2325653 2325655 . + 0 transcript_id "g641.t1"; gene_id "g641"; 3 AUGUSTUS CDS 2325653 2326195 1 + 0 transcript_id "g641.t1"; gene_id "g641"; 3 AUGUSTUS stop_codon 2326193 2326195 . + 0 transcript_id "g641.t1"; gene_id "g641"; # protein sequence = [MDQAASVISVPSSALYISFFPELSASAVPLPTGAIFIIANSLVVSDKAVTAKHNYNLRVVETLAAARILARHLELKVG # KTEKVTLREVVGRLAGEVEEVGAMPVEWLLETLKRMEREIECLKPKKSSGEGQFGVTMEEMIEMSGMTAEEFKEVYLSWVEGKSAEYFTATILSSPFP # STQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g641 ### # start gene g642 3 AUGUSTUS gene 2329297 2329632 0.44 + . g642 3 AUGUSTUS transcript 2329297 2329632 0.44 + . g642.t1 3 AUGUSTUS start_codon 2329297 2329299 . + 0 transcript_id "g642.t1"; gene_id "g642"; 3 AUGUSTUS CDS 2329297 2329384 0.44 + 0 transcript_id "g642.t1"; gene_id "g642"; 3 AUGUSTUS CDS 2329469 2329632 0.61 + 2 transcript_id "g642.t1"; gene_id "g642"; 3 AUGUSTUS stop_codon 2329630 2329632 . + 0 transcript_id "g642.t1"; gene_id "g642"; # protein sequence = [MAGLGVPVKLLHESLGHIITVEVKTGQLYPEDNMNIFMRDATVTGRDGRVSQLDQVYIRGSMIRFFIVPDMLKNAPMC # VFPFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g642 ### # start gene g643 3 AUGUSTUS gene 2330936 2332721 0.99 - . g643 3 AUGUSTUS transcript 2330936 2332721 0.99 - . g643.t1 3 AUGUSTUS stop_codon 2330936 2330938 . - 0 transcript_id "g643.t1"; gene_id "g643"; 3 AUGUSTUS CDS 2330936 2331570 1 - 2 transcript_id "g643.t1"; gene_id "g643"; 3 AUGUSTUS CDS 2331629 2332721 0.99 - 0 transcript_id "g643.t1"; gene_id "g643"; 3 AUGUSTUS start_codon 2332719 2332721 . - 0 transcript_id "g643.t1"; gene_id "g643"; # protein sequence = [MFYSGDRSGLVCKTDVEDCADVSEGECILLCQDTHESPIAEGINKIVALDDNLLWTASGSSTIRRWRVPQRRGVRAPF # NSEVKRLSQPESPTSTLSSARRGHGENSSLSRSMHSEYDQLKAEKGTLYGIPFESLVKLTSPNNPFGFYTTSKDRDAEIATLYSAASVMSVPKTNPRS # PVQSTFAQSNQHKQSQPHRSETVVELPSARALFEDREIAADAVPLYTEPDDVIRGDHGLVRSIILNDRIHALTVDTSGTVEVWDIARCVCKGKFSKED # VAAASVRAASSTSSGDGGGDRTNERERSPREALEIVRERIEHEVVVLPWSTADTKSGVLTIHVTERCFDAEVYADEAGFVHDRYVNDESKLNIGKWVL # KNLFLGFIREEQRLQRKLERSSSRDRNHDTSHDPSKLRSSRTSASVISSSKMLQAVAPTVSGFTRSSPLLTPMIPLNIPKENALPLPAIPQLPTIHSN # DATPMPRRHRSGTLDSLHQSSAHGDYFSVPTRRPSITASTPDELPAWNGASKIDAGLQTPTTPSSGLMGRLKNFGKNKKISADTANTISVANDPAAAE # TMLEVRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g643 ### # start gene g644 3 AUGUSTUS gene 2335775 2336308 0.66 - . g644 3 AUGUSTUS transcript 2335775 2336308 0.66 - . g644.t1 3 AUGUSTUS stop_codon 2335775 2335777 . - 0 transcript_id "g644.t1"; gene_id "g644"; 3 AUGUSTUS CDS 2335775 2336308 0.66 - 0 transcript_id "g644.t1"; gene_id "g644"; 3 AUGUSTUS start_codon 2336306 2336308 . - 0 transcript_id "g644.t1"; gene_id "g644"; # protein sequence = [MISPTVLQSERRQAATKKKHNPFAALLKEKREDDRSGRSDLEFIKAAENILPKSQMLLEMDEEDGYDSFETPSQKTAA # WLGREVDDMKVDLDDGNRRRLFGEQSEGIKDILDGEQKNLQADERRKIEVGVRFWRDNTSSAGDDVDMDVEPTLDFGEDTKSPVLRKLYNALKSRGRF # S] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g644 ### # start gene g645 3 AUGUSTUS gene 2336417 2337286 0.99 - . g645 3 AUGUSTUS transcript 2336417 2337286 0.99 - . g645.t1 3 AUGUSTUS stop_codon 2336417 2336419 . - 0 transcript_id "g645.t1"; gene_id "g645"; 3 AUGUSTUS CDS 2336417 2337286 0.99 - 0 transcript_id "g645.t1"; gene_id "g645"; 3 AUGUSTUS start_codon 2337284 2337286 . - 0 transcript_id "g645.t1"; gene_id "g645"; # protein sequence = [MAKATKNASASGSKPITDYFSRKPATRSKSDNISDGQSNTPKKQQPKPTTSSPPTEPSTSALSPENRLQMRSSTPEAN # SRVESGCVPPQSQPIAIPPTPFSSKKISTKKNGSRTKNFISSSESSSIDEVPGSVSGEEEMECVTRVRRDVEASKQSVAKWRNESPLLSDLPERMNVD # EVPTSNFNTDQSPSSAERSTPPPSQQQLTPPPTTVLDHQILPPIPAAIETARKTEELIAAIKAKAIAAAKSSPIEQEIRPFKETLSDSDTDEELRPLE # INVKGKGKAKEVLVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g645 ### # start gene g646 3 AUGUSTUS gene 2338141 2339090 0.53 - . g646 3 AUGUSTUS transcript 2338141 2339090 0.53 - . g646.t1 3 AUGUSTUS stop_codon 2338141 2338143 . - 0 transcript_id "g646.t1"; gene_id "g646"; 3 AUGUSTUS CDS 2338141 2338956 0.78 - 0 transcript_id "g646.t1"; gene_id "g646"; 3 AUGUSTUS CDS 2339085 2339090 0.54 - 0 transcript_id "g646.t1"; gene_id "g646"; 3 AUGUSTUS start_codon 2339088 2339090 . - 0 transcript_id "g646.t1"; gene_id "g646"; # protein sequence = [MPLESPYISDKPPAFQRSPKVPNFDKETQLTLEYDGLPPLRSIKGAEVVVFANVSNVFVRSSGTVREIYSATAIAGGV # VVSRNGRLICTGNQSTCLTEAVLASDSKPFFVDLKGGSIEPALTSYGAPLGLEHINQEPSTNDGFAIEPLSQRVPKILGGSIVRAVDGLLFDTRDALY # AYRAGVTTGITAPSHYGFFFGLGTAFSTGASHKLENGAVVQEVTALHTAIGFDDTPSVSTQIATLRKLLMTPPEGPAGVWFRKVSEVCAAYSDFDII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g646 ### # start gene g647 3 AUGUSTUS gene 2343720 2344094 0.91 + . g647 3 AUGUSTUS transcript 2343720 2344094 0.91 + . g647.t1 3 AUGUSTUS start_codon 2343720 2343722 . + 0 transcript_id "g647.t1"; gene_id "g647"; 3 AUGUSTUS CDS 2343720 2344094 0.91 + 0 transcript_id "g647.t1"; gene_id "g647"; 3 AUGUSTUS stop_codon 2344092 2344094 . + 0 transcript_id "g647.t1"; gene_id "g647"; # protein sequence = [MKSATLASGSLQMPRLRNRSSRKVSGSKPDLEAGDPDDDASVHSGENGALWAVGDVSDDEGEDEDIDHHQHPLHAHRT # VSAARSNTRLATHGEEGRGLIEDNLDDDIESPHERSRDSQDNGRSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g647 ### # start gene g648 3 AUGUSTUS gene 2344242 2344683 0.96 - . g648 3 AUGUSTUS transcript 2344242 2344683 0.96 - . g648.t1 3 AUGUSTUS stop_codon 2344242 2344244 . - 0 transcript_id "g648.t1"; gene_id "g648"; 3 AUGUSTUS CDS 2344242 2344514 1 - 0 transcript_id "g648.t1"; gene_id "g648"; 3 AUGUSTUS CDS 2344573 2344683 0.96 - 0 transcript_id "g648.t1"; gene_id "g648"; 3 AUGUSTUS start_codon 2344681 2344683 . - 0 transcript_id "g648.t1"; gene_id "g648"; # protein sequence = [MIKERVDKDYASMLRTSLTSISKVNKTDVETLRSSFGSIANIARTSPDQLSNLPGFGQVKVKNIKNAFEKPFRNHATN # TLAFMASSPSREPMGNEPHDGVEQGNTVAEPSYKPPREPSPVWDIELDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g648 ### # start gene g649 3 AUGUSTUS gene 2348108 2348902 0.42 - . g649 3 AUGUSTUS transcript 2348108 2348902 0.42 - . g649.t1 3 AUGUSTUS stop_codon 2348108 2348110 . - 0 transcript_id "g649.t1"; gene_id "g649"; 3 AUGUSTUS CDS 2348108 2348442 0.46 - 2 transcript_id "g649.t1"; gene_id "g649"; 3 AUGUSTUS CDS 2348645 2348673 0.87 - 1 transcript_id "g649.t1"; gene_id "g649"; 3 AUGUSTUS CDS 2348814 2348902 0.81 - 0 transcript_id "g649.t1"; gene_id "g649"; 3 AUGUSTUS start_codon 2348900 2348902 . - 0 transcript_id "g649.t1"; gene_id "g649"; # protein sequence = [MITVDLGPHSTPMTLPQLFVHTYSNIFGVYPDNGGDPRPRHSESIMADNHEAMDVDVDERAPQRSASVPFQPPRDLTV # GYVYSSEMTSHFNPRGHQEAPERITRIWQAIVDGKYNTKMQWLPIRPVTKAEALLVHSQTTWDLIEAYQCKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g649 ### # start gene g650 3 AUGUSTUS gene 2351163 2351591 0.5 - . g650 3 AUGUSTUS transcript 2351163 2351591 0.5 - . g650.t1 3 AUGUSTUS stop_codon 2351163 2351165 . - 0 transcript_id "g650.t1"; gene_id "g650"; 3 AUGUSTUS CDS 2351163 2351591 0.5 - 0 transcript_id "g650.t1"; gene_id "g650"; 3 AUGUSTUS start_codon 2351589 2351591 . - 0 transcript_id "g650.t1"; gene_id "g650"; # protein sequence = [MMPSFDRGRYSALSEDQGDDISLMPKNLVYNTTPSTAEFNPYEDTEHPRYPSYQAGPSSYAAHDEAPAIEEGYGGGSW # THEQISQDEKSLLRQQEQDDDALPSPSRNFNEQNRDVKTAAGPPTPHEIDPLPQYALTESPELR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g650 ### # start gene g651 3 AUGUSTUS gene 2357742 2361875 0.1 + . g651 3 AUGUSTUS transcript 2357742 2361875 0.1 + . g651.t1 3 AUGUSTUS start_codon 2357742 2357744 . + 0 transcript_id "g651.t1"; gene_id "g651"; 3 AUGUSTUS CDS 2357742 2357979 0.6 + 0 transcript_id "g651.t1"; gene_id "g651"; 3 AUGUSTUS CDS 2358034 2358395 0.18 + 2 transcript_id "g651.t1"; gene_id "g651"; 3 AUGUSTUS CDS 2359046 2359240 0.38 + 0 transcript_id "g651.t1"; gene_id "g651"; 3 AUGUSTUS CDS 2359293 2361875 0.99 + 0 transcript_id "g651.t1"; gene_id "g651"; 3 AUGUSTUS stop_codon 2361873 2361875 . + 0 transcript_id "g651.t1"; gene_id "g651"; # protein sequence = [MLMRLLLTGIDIVANRLFGPVPRTITYVCLWEIHVGGIKASLSAYQATVFQAAVRALGINFTDPLNAPADQYQTGIYP # DITFVKVSLETVEILWKAGCATAHVSVHKGLKFDYNDLGGQFHKKLTSIRLPHLSVKALLDYNASNTWLEAAEIVTDVFLDIYSSPAGWHEMSAAQAD # FVWEQDRPTGRVDQLITMLKTTRSENQFAYAKKHLNAERSNWTPFAFEPPDNSKNTITVKFSQHDGIDLKLTPLIVNVLEALQSDLESTHFSAEYLTD # RWLSSYIGDFPDPSKPKVSSRTILDIHSESVALHVLHRLDVIENGPVHKNDYSGRFAYLVFTASNIQISGNMSVENRSIAARFARTDMDLTSVHSDGR # AAAKQPALSFSVLEFQTTLFKDNHEFSCAKLTAELSHSLPSLLISVANAVEGDLPRLVRLRKRASESSSNVIRSTIYHILHSSSNELVIDPLSTIQPS # FLVQVGLPQMLRVDPAFRFLFHLRDCLWRLREVNPTWDMDRIEAQKVTIDDVTPLLRDRLLALDPDAYHTSRLESLQPLLPFIKPATNRRKDETHFSF # SYVSIKLNSVELKVADSENRTPCQISLSDMFSGLRLRHHQLLDEEDEFRRLAASQTSLRSKSPDLVQRASVSIVLGDIQTTVYPYLINFVQEIIRAQK # LNAGASSAKKLKRARFKPFNVVYIHAVLTIKRFRLRASAEKLTFEFGISELRHSSTVLIHHHSKKQSMNHSLLFTEMFIKARATSEPHEHDDLASLTI # ADSLLSSVMRNETLDQSIKLAFNLKALRFSVPRSALRLYHFVEQWRADFLSGIESTVQALILEVNKPSTNNARLPQSHSTFPKSSTLQIDGQVSCAGI # YLRVMHDTWLSWEVNDISLFLNSLARARQRSHEFGLQLSSQLFAVSTESSEPSYKTRVKFEFPPTLLSGHIDQSSIRITSFIHFLELKVKPSYWDTLL # AVQQKFGQDFNNLLVVIQQTRSKRFPAPPASLSKPETTTQTDFSVFVQMEGFRIGFEGRSSVLYLECPGIRSKFEGVPEKAWSVVVTDLALSLAPRLS # MTPHSFGLNRHQRSAFVIIDFKIQSESQGSGSEALEVVVTKIHAVMQPSSIGEMGDFIDELQVNLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g651 ### # start gene g652 3 AUGUSTUS gene 2361920 2362303 0.78 + . g652 3 AUGUSTUS transcript 2361920 2362303 0.78 + . g652.t1 3 AUGUSTUS start_codon 2361920 2361922 . + 0 transcript_id "g652.t1"; gene_id "g652"; 3 AUGUSTUS CDS 2361920 2362303 0.78 + 0 transcript_id "g652.t1"; gene_id "g652"; 3 AUGUSTUS stop_codon 2362301 2362303 . + 0 transcript_id "g652.t1"; gene_id "g652"; # protein sequence = [MIDRREQRTQELAAFKQKTQRLIKTFEIKNQEPALSDRISWLDNYIIQFSLSNIGVAFPLAHDHDMDLPPLGSHDSTA # VRAFLFSIKSVKFGTQRGETGEAGMESLSFQFVPRYMFSKLLSVNEANG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g652 ### # start gene g653 3 AUGUSTUS gene 2362384 2363868 0.4 + . g653 3 AUGUSTUS transcript 2362384 2363868 0.4 + . g653.t1 3 AUGUSTUS start_codon 2362384 2362386 . + 0 transcript_id "g653.t1"; gene_id "g653"; 3 AUGUSTUS CDS 2362384 2363868 0.4 + 0 transcript_id "g653.t1"; gene_id "g653"; 3 AUGUSTUS stop_codon 2363866 2363868 . + 0 transcript_id "g653.t1"; gene_id "g653"; # protein sequence = [MTAQLRSSKSATFNQIYMTATVSGFVLNMDSTIPDYVFSLFDVYRHGKERVQRLSASIPRGGSSIPNAAVSNRQISHS # AASPDIFASLTFQSGKVCMFSTDASKSSRIRAYSGTWDRPEEPIGDVEAEVFNLPVVSVWAEYRAAPPSRQGSNAEIEPSILIFKSTVHSSHNTLRPM # LLPFVTEVVTHVEARLRTSTRIDLPSLAVEPAVQTEVTPVPNATSTLRMSFSLRIDQSRLELTCLPDVNVVAAVNWDSGGFMVNVLPGSRDVTFTGVV # GGLTIGLKHGFLSEDCLKLDARNLAFSVALGKPCFQDRPMLTSISLVVDTEFLGAVRFSRLQDILCFKAVWLDRIPVFNTHNDNDDLSKIKPNHAPPT # TLNNKPEFDIAILVRIRRIKLEVDLGQSISTVTLHLENSNLRTKLTQSFHELSIRVGHLAITAKGNVAGYANVPNCVFQTIQWVGKPPVEDGTRDRML # ELRMMSGPLIVMLESDYQKLLHYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g653 ### # start gene g654 3 AUGUSTUS gene 2363909 2365234 0.55 + . g654 3 AUGUSTUS transcript 2363909 2365234 0.55 + . g654.t1 3 AUGUSTUS start_codon 2363909 2363911 . + 0 transcript_id "g654.t1"; gene_id "g654"; 3 AUGUSTUS CDS 2363909 2365234 0.55 + 0 transcript_id "g654.t1"; gene_id "g654"; 3 AUGUSTUS stop_codon 2365232 2365234 . + 0 transcript_id "g654.t1"; gene_id "g654"; # protein sequence = [MAFRAEPLEVDILDDWSIPKSSQTDRPLRLSFTVKSKEVVAIATVGTIPKLLAYANKFKANLEAQREGASRESNTFRI # SRAPKPDNPLSAVAEAMITSARTRFKEADAILSYTIRQHMSLRLDLLRLVVFPRTMGDAEVAQFVGQDVRGRLNRLIESASTSSKRDIRLSFSFMRIS # RFTQLGHAIMPPITEISDGRQWLEDLLKDANNADIVGLPSMIMHMASTESQEGLHKTLAYNFDSQFVRLKGVQHSEDIYITLNVGLYSWLTVLRKTLS # REMEQVQTAADWRMFAANPVQTRRNIPEPLNLANPPRSATVPSPTNVFSPLSPKSASAVTTNFGSSLDVASLSKSQSEAFAPSPTDGEGEAKAFVYRP # GHRRIERLTMRQLGEATPDVMHPFFMKKAGFSLEDSLPQYVHEYATVPLEEIMEVLLRLYSRQLLAATI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g654 ### # start gene g655 3 AUGUSTUS gene 2368329 2369251 0.67 - . g655 3 AUGUSTUS transcript 2368329 2369251 0.67 - . g655.t1 3 AUGUSTUS stop_codon 2368329 2368331 . - 0 transcript_id "g655.t1"; gene_id "g655"; 3 AUGUSTUS CDS 2368329 2368857 0.86 - 1 transcript_id "g655.t1"; gene_id "g655"; 3 AUGUSTUS CDS 2369004 2369251 0.72 - 0 transcript_id "g655.t1"; gene_id "g655"; 3 AUGUSTUS start_codon 2369249 2369251 . - 0 transcript_id "g655.t1"; gene_id "g655"; # protein sequence = [MLRGFSNVAFLITMCNVCTAVLIVHLWDLKAKEISERSIRISTTEDVKPQYALAIQSAKDDIEIFLNALEWAKPHYSS # VAQIFSEGSRTLWSWDSPEVPSNAPSLPTLSKPDWNNLPPGNYSPLRTNSYSIPTASFERTSNPLIRRDSDPYLGQRAFWPTYSNPSSSTQIPSNQHT # ISNYPAPNRESLPFIKAIKRSPFALSQPAHPRYSSTSSSRHDYSPYDSYQANDELNISQQLPTSDARSLPTSPEYDKRSFTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g655 ### # start gene g656 3 AUGUSTUS gene 2370652 2371351 0.69 - . g656 3 AUGUSTUS transcript 2370652 2371351 0.69 - . g656.t1 3 AUGUSTUS stop_codon 2370652 2370654 . - 0 transcript_id "g656.t1"; gene_id "g656"; 3 AUGUSTUS CDS 2370652 2371272 0.99 - 0 transcript_id "g656.t1"; gene_id "g656"; 3 AUGUSTUS CDS 2371331 2371351 0.69 - 0 transcript_id "g656.t1"; gene_id "g656"; 3 AUGUSTUS start_codon 2371349 2371351 . - 0 transcript_id "g656.t1"; gene_id "g656"; # protein sequence = [MEILLQRLRPGQDFSAELGPPVLRDSWKDPKPSSEISHSKSRLRVSSPPKLAPHLDSNISIPLSSHLKIHTNPSTSSK # MLPYRRTRQGSATNSADSSSSQYDSSDADELVDNFEKGMQRLTLHSGHSQLQSAGPYDRFHGQSSYIKLVDATRKLKQAHIMAQKEEFSHSSGSNTST # TSPSPEISNALRRLEFWRAPKASGWTSVKILSLIDSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g656 ### # start gene g657 3 AUGUSTUS gene 2378824 2379675 0.81 - . g657 3 AUGUSTUS transcript 2378824 2379675 0.81 - . g657.t1 3 AUGUSTUS stop_codon 2378824 2378826 . - 0 transcript_id "g657.t1"; gene_id "g657"; 3 AUGUSTUS CDS 2378824 2379675 0.81 - 0 transcript_id "g657.t1"; gene_id "g657"; 3 AUGUSTUS start_codon 2379673 2379675 . - 0 transcript_id "g657.t1"; gene_id "g657"; # protein sequence = [MSAPTILEKIYTQRQKDVEVAKATPGTKPEDIQTYLDMGLAPTQISLVPRLKSNPSIDTAEPSLSLMAEIKRASPSKG # EIAMSTNPAKQGLIYALAGASVISVLTEPTWFKGSLLDMRLVRQAVDKLPNRPAILRKEFIFDEYQIAEARLHGADTVLLIVAMLTQELLASLYAYSV # SLGMEPLVEVNNAAEMARALGLGAKVIGVNNRNLHNFDVDMGTTSRLVDMVREKNVLLCALSGISGPQDVKVYKDQGVNAVLVGEALMRAADTTAFIR # DLLNWPHNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g657 ### # start gene g658 3 AUGUSTUS gene 2381982 2382422 0.72 - . g658 3 AUGUSTUS transcript 2381982 2382422 0.72 - . g658.t1 3 AUGUSTUS stop_codon 2381982 2381984 . - 0 transcript_id "g658.t1"; gene_id "g658"; 3 AUGUSTUS CDS 2381982 2382422 0.72 - 0 transcript_id "g658.t1"; gene_id "g658"; 3 AUGUSTUS start_codon 2382420 2382422 . - 0 transcript_id "g658.t1"; gene_id "g658"; # protein sequence = [MDQLNVQGRSNDDYVATYDPTTSKVTRLQLENFNSDQPISVHGMDVVQSTSSGSELFVFVINHRAPPAGQDPRKVGAD # SVIEVFKTTVAGDRLVHINTVRDPRVIVSPNDVVGEADGKGFFFTNDRGSKISNSYVRRQCSLALFTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g658 ### # start gene g659 3 AUGUSTUS gene 2383465 2383878 0.39 - . g659 3 AUGUSTUS transcript 2383465 2383878 0.39 - . g659.t1 3 AUGUSTUS stop_codon 2383465 2383467 . - 0 transcript_id "g659.t1"; gene_id "g659"; 3 AUGUSTUS CDS 2383465 2383878 0.39 - 0 transcript_id "g659.t1"; gene_id "g659"; 3 AUGUSTUS start_codon 2383876 2383878 . - 0 transcript_id "g659.t1"; gene_id "g659"; # protein sequence = [MSLVSLTGNDSISPTGSTAKLDLYVNMIMNLSSQIHYIYFLQALQARTLLTSFSSVGYCHSDHGCKIAVDNLYTANGI # AKATNGTVYVASTSGLELKMFEKQDDDSLVFLEGVHCGVYIDERSVLTDSSKRLSRYPD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g659 ### # start gene g660 3 AUGUSTUS gene 2387880 2388113 0.47 + . g660 3 AUGUSTUS transcript 2387880 2388113 0.47 + . g660.t1 3 AUGUSTUS start_codon 2387880 2387882 . + 0 transcript_id "g660.t1"; gene_id "g660"; 3 AUGUSTUS CDS 2387880 2388113 0.47 + 0 transcript_id "g660.t1"; gene_id "g660"; 3 AUGUSTUS stop_codon 2388111 2388113 . + 0 transcript_id "g660.t1"; gene_id "g660"; # protein sequence = [MSRRRQHSTHENGEAETKKDSAEHRDHDHDHDHNHEHSHSHSQSFFSGHSHAGEYNYGAEKIMAAWEGSGEFVLHSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g660 ### # start gene g661 3 AUGUSTUS gene 2388280 2389317 0.66 + . g661 3 AUGUSTUS transcript 2388280 2389317 0.66 + . g661.t1 3 AUGUSTUS start_codon 2388280 2388282 . + 0 transcript_id "g661.t1"; gene_id "g661"; 3 AUGUSTUS CDS 2388280 2389317 0.66 + 0 transcript_id "g661.t1"; gene_id "g661"; 3 AUGUSTUS stop_codon 2389315 2389317 . + 0 transcript_id "g661.t1"; gene_id "g661"; # protein sequence = [MHSASLLADAGHSLSGLCSSLFIFTTTHSTLDLLGDFVTLFCWKLSRKPPSEWYPYGFAKFETLGTTTVSLLLIGGAL # GIGFHSYHILLTALSETAATLPAGPIQSILTNVTSAVPDVPHVLSHHSHVEAVDPNAAWFAAISVLVKEWLYRVTKAVADEENSPVLLANAIHHRSDA # YSSFVALFAILGSWIFPKLPLDPIGGTSHPQFKFFVLVIFFLFTSGLLVSFVILQQGIGLLVGAWGDLTDAGVSAKTRQSLKSTLKPLVASSSSADSA # SLSISKPTILAVSQLRARRAGSLIFVDLTAEVPRNLTVDDLVLLEEKILQTLKESRKEVKEVHVKFRPVED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g661 ### # start gene g662 3 AUGUSTUS gene 2390305 2395284 0.42 - . g662 3 AUGUSTUS transcript 2390305 2395284 0.42 - . g662.t1 3 AUGUSTUS stop_codon 2390305 2390307 . - 0 transcript_id "g662.t1"; gene_id "g662"; 3 AUGUSTUS CDS 2390305 2393796 0.92 - 0 transcript_id "g662.t1"; gene_id "g662"; 3 AUGUSTUS CDS 2393887 2395284 0.42 - 0 transcript_id "g662.t1"; gene_id "g662"; 3 AUGUSTUS start_codon 2395282 2395284 . - 0 transcript_id "g662.t1"; gene_id "g662"; # protein sequence = [MLAVAKLKRAASLPRLKDGRRPPMHNEAVSEGEKGPVGEEQQPDTDTPPPQQKEQQHEEQSEARAGTESENEVGPETL # VEGAPVPTPATRTKRRSRSRSRSRGSRDMKGKARAPTPSPLITGDSSQDEAFTASPTITLPVVPQLISPVPSQFQRSLLLRSPTPTSQDPSQFQYPGT # SPPTPLPSLEALQKGLFRSNSAGRMLAMHKLTNGTESYEPSLSPSPALSPGKFKRTNTVSGGERNAARKLLMDTLGSRSRVAKDTDGSGNDEIQAPSP # SPNPKRRRRRSRRGSSGANTGISDSEFASTSPNTPIVPPTPLPPTPLDLFRARSVTPNQLPSPRALSPALSKAESPQPPLIFNESRRRSVVVEEEDEE # ISALSRRLPSSPTRKLPSPPTPFISRMPNTPELNDYPTTSGVGVPVYLNHRDDIFPTSPFSRPLKEKLLKMTTKRRSSITQTHPRIYTHSTPSSIRRP # IYDNDDDDEDDGDYPDEDEAPYDERPPSTHSRSSNEEVYEDISPRVSSDSQNVLIESDSIPDVTPLYAPHSPSSVAALSPASMPRESDGSLSPQYHNR # PSPRLQGELSPMSAEFGDLDDRPIVNDNSSKRSGDSTSTSAWEKVKSTFTRSNSVTGRRSRSNSIVTRERRDHTDSSISRESGASINSPRGDPNGGFA # SQQSQAPVLSPSTSALSLAPQSISRVSPVPPPTSDTYARYQNAKLFPFPGIHKLEEERNRVKGLTPSASTPDINAQFHAYEDLTSPSYPGPAGSSTQF # DQSKDRTLMQQTSESNIAKYLLSPPLSSDASSSSTFPEYFDITPASSTPTNTNSIKLPMTLPAVKQWMSKNKKIFSSPSQVSSASLPTSPNGEYRNGQ # QGFKKPSLSDLLRIRKDTELVSDWEDLNSTSTETGTLADRPPPVSSERSLSGEQVPAATPPRASPVGTSEHDVEKTPKAQRTITSPTSNVERPKLSSS # AQSSALPSPPDPLSSTTPDPSSSLSDYPAPSTSTSSSSLSSNYSVAAPPGAQGSIVLERLEENLARGPRSPMWASVLESPPRKLILSSPVLQVVNANT # VKDRFLFLFSDILVIAKPVAEGENEGMDLPTPERKFTVKSVVSLQNLRFSADRADPVNRNSTFGLPNRNPLLRSFVHQFSKDPDHAISTFFAKSGLSD # DPVFLGQLLFRTTELDRATLGRYLSQRTSKVVLKSYVDSFGFVSSQVNMALRAFLMSLHVPSHPVNHHSALEYLLDAFASRWYEANARFVDYDKDLAI # RLVRAIIQLNDLLHGGISDTAGLGGFPRQNISSNDFVNAFRRYDPRSLVADSLLENIYKSIWEERLSQAKAPGDNADILITIKRPLPTRITYKVQSDP # IIIRIPQTDPQLSIHLFGQGLTFEPSVLTFSRSSEASFRVTGNSLGSKTVIICRSGPNALKYSGLPLGHNVNIERAFMRNTFQVAFLNHCGAKRRYMF # SVDDPLIRHQWTVSLKKHVGETTTSSVTSMSSSSSPSSRFYRAAELVAFKILQEALIGKNALRGTNSSEFDDSVLQSPSPSGVRGLRLGPSHVRSKSR # SQVYLHTKAGKNELDISNANGDLNRGFFDGHESPLPNNAQPVTPVWTGRDLEIHCLQNSSITLVLSYLQVGAPEHVSGSFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g662 ### # start gene g663 3 AUGUSTUS gene 2398208 2400604 0.39 + . g663 3 AUGUSTUS transcript 2398208 2400604 0.39 + . g663.t1 3 AUGUSTUS start_codon 2398208 2398210 . + 0 transcript_id "g663.t1"; gene_id "g663"; 3 AUGUSTUS CDS 2398208 2399068 0.39 + 0 transcript_id "g663.t1"; gene_id "g663"; 3 AUGUSTUS CDS 2399213 2400604 1 + 0 transcript_id "g663.t1"; gene_id "g663"; 3 AUGUSTUS stop_codon 2400602 2400604 . + 0 transcript_id "g663.t1"; gene_id "g663"; # protein sequence = [MALIKDSSERESRPPSGQSNKTGSRRPSPARGVTPPLNATETLASLRGNEASAQQKDAEVGSRTKSKTPPGPQPTYQQ # HYYPYPPPPPPPHMYSVSPYESSWGRMMPPPLPPASGDRGRDPRGSESPVAGGSPGYPQSGMPGYPHPHHHHHHHQGHHPHPHDPYPPLPHHYAHSAY # PYGNPNGPHMPVYPVQTSYTYNPAGVTAYGSHPPPYSGPGGHGTVGSNYSHNGAEPMNMPPSSESDSNIHSIGPGAPPSVPGNGFAAITATLTPTPIP # ESEIIYTEDAATKLCNKCGLFERTHSRPRPEQFPHKRTSLGGEGEGGNQSPSSPSYSLTPVPSQSPLHSQDTSSRPVLPHRESIGPTKRNKKAKLGHD # KPESDSKAQSIAPVPTSSSGGPPGPVSALHVPSQANGLVLPTSDTPSNSHHLPVGLANLTHPHPPQHQPYYGNQPNSSPHPSSYPTHPSHSSHTMYAG # GAFGVPLQYNGYPSSNGFALPPIGGPALNGYEYTQPHNHSHQQQQQHSGPPPPQRASAPVSGLQGLLNGVDGRGRDSRESSAPAPFRKSSDVPIDPSL # SQSNDGMKENDQDNSPSRRNIAKELDVSPSEKSGDLQVKSKSTTSKSPTKSSTGTRVPRKSGKPHDESLDSHTPRPNGVGKATTQRDASPESASDYHS # SLSDGNYPGNADEEEASGSGDDYTSEGDDDDGSGDYKISGSRGTKGRRGRPVRSVAKRQTRMGSGAVGGKRKRSLRGSSPAGDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g663 ### # start gene g664 3 AUGUSTUS gene 2402257 2403058 0.91 + . g664 3 AUGUSTUS transcript 2402257 2403058 0.91 + . g664.t1 3 AUGUSTUS start_codon 2402257 2402259 . + 0 transcript_id "g664.t1"; gene_id "g664"; 3 AUGUSTUS CDS 2402257 2402842 0.91 + 0 transcript_id "g664.t1"; gene_id "g664"; 3 AUGUSTUS CDS 2402904 2403058 0.99 + 2 transcript_id "g664.t1"; gene_id "g664"; 3 AUGUSTUS stop_codon 2403056 2403058 . + 0 transcript_id "g664.t1"; gene_id "g664"; # protein sequence = [MFSLRRAPFRRCLHTQATHSLHQAKPYRLGFTLAASITVASYTTWRWTRDQRIALDSVTVSESTCPLDFTSFTHSWTL # PPDIKTPVLDGSSSETDHISASPLQNPEGSTESSSKSEAETEASDSASQGAYNPETGEINWDCPCLGGMAYGPCGPEFREAFSCFIYSEEEPKGINCV # EKFQAMQTCFRAHPEVYADEIMDDDEDGKANQGATEGVTVDASSPEAASSSGTSQVEKSDSSVSARSTST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g664 ### # start gene g665 3 AUGUSTUS gene 2403746 2406233 0.03 - . g665 3 AUGUSTUS transcript 2403746 2406233 0.03 - . g665.t1 3 AUGUSTUS stop_codon 2403746 2403748 . - 0 transcript_id "g665.t1"; gene_id "g665"; 3 AUGUSTUS CDS 2403746 2404840 0.44 - 0 transcript_id "g665.t1"; gene_id "g665"; 3 AUGUSTUS CDS 2404896 2405030 0.38 - 0 transcript_id "g665.t1"; gene_id "g665"; 3 AUGUSTUS CDS 2405084 2405511 0.59 - 2 transcript_id "g665.t1"; gene_id "g665"; 3 AUGUSTUS CDS 2405563 2405734 0.47 - 0 transcript_id "g665.t1"; gene_id "g665"; 3 AUGUSTUS CDS 2405791 2406091 0.56 - 1 transcript_id "g665.t1"; gene_id "g665"; 3 AUGUSTUS CDS 2406169 2406233 0.19 - 0 transcript_id "g665.t1"; gene_id "g665"; 3 AUGUSTUS start_codon 2406231 2406233 . - 0 transcript_id "g665.t1"; gene_id "g665"; # protein sequence = [MDERDAVPDLDDGEDNDDGEDLDYGTNELLDRYDATGLDDDEDVEELSAAARRLVEKKMDRRDRAARGGKGARAAQRS # RAPAFLDDDDDMDDDDDELLRMKRRTRRQYDERRDMDDMDGLEDEIPLEQLSDIKAKSIVEWIANPRVRRSIVKHFRQFLMTYVDEQGASVYGQRIRN # LGENNSESLEVSYSHLAYSKPILAYFLTNAPTAMLAIFDEVALTAILVYYPAYERIHSEVHVRICDLPFASSLRDLRRSNLNNLVRVSGVVTRRSSVF # PQLKYVKFDCKKCGAVLGPFYQDATKEVKVSYCANCESKGPFPVNSEQTVYRNYQRMTLQESPGSVPAGRLPRHREVIVLWDLVDSAKPGEEVEITGV # YRNNFDASLNAKNGFPVFSTIIEANHVNKKEDLFAAFRLTEEDEKEMRALSRDERIRKRIIKSIAPSIYGHEDIKTAIALSLFGGVSKNINDKHHIRG # DINVLLLGDPGTAKSQILKYVEKTAHRSVFTTGQGASAVGLTASVRKDPVTREWTLEGGALVLADKGTCLIDEFDKMNDADRTSIHEAMEQQSISISK # AGIVTTLQARCAIIAAANPVRGRYNPTIPFQQNVELTEPILSRFDVLCVVKDTVDPVMDELLARFVVGSHLRSHPSFDKQADEMDVGTTVDEDVRFLL # IPHESRYSFLESLFLRTSSASTLCMRAKRSSRSYTSSIRTKSRDCSLTSDINPKLLVHIQLLCVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g665 ### # start gene g666 3 AUGUSTUS gene 2408118 2408675 1 + . g666 3 AUGUSTUS transcript 2408118 2408675 1 + . g666.t1 3 AUGUSTUS start_codon 2408118 2408120 . + 0 transcript_id "g666.t1"; gene_id "g666"; 3 AUGUSTUS CDS 2408118 2408675 1 + 0 transcript_id "g666.t1"; gene_id "g666"; 3 AUGUSTUS stop_codon 2408673 2408675 . + 0 transcript_id "g666.t1"; gene_id "g666"; # protein sequence = [MYVGSAGGNLALALTRYLVEHPNSGLPATPGALILLSAWADLSPQVASPNSSWLDNAKSDYIGLVDEEGLVRSIRSFL # GPHGLGAADANPMISPASRNPAMNVHFKGFPRTFIAAGGAEVFYDMLCSLKEKMVSDLGEGDGVRPEDGKVHWHCPPDATHDWIALPYHEPERSDTLK # EIASWIAAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g666 ### # start gene g667 3 AUGUSTUS gene 2409140 2410207 1 + . g667 3 AUGUSTUS transcript 2409140 2410207 1 + . g667.t1 3 AUGUSTUS start_codon 2409140 2409142 . + 0 transcript_id "g667.t1"; gene_id "g667"; 3 AUGUSTUS CDS 2409140 2410207 1 + 0 transcript_id "g667.t1"; gene_id "g667"; 3 AUGUSTUS stop_codon 2410205 2410207 . + 0 transcript_id "g667.t1"; gene_id "g667"; # protein sequence = [MSKAASGYPARQLGALGEGVYSVWVTPIPKLVVGDLAVWSRTASVSSIHVQGYWYCKSVNTTIPKRALPGEKVLYSLH # GGAYTYDTAHPSGLNAKVIRHLLNLDCSINCAFAIDYRLSSESSNPFPAALVDALAGYYHLVHTIGFNPSNIIIEGSAGGGNLALALTRYLIDYYGHS # EAADLPDVPGSLILLSPWTDIGLAPVKARLEPATINNTRSWLVSDYMFGPQCPMTSYSQHVFLGPHGTDVAAINEYISPSSRHPLLDLDFEDFPRTFI # SAGAAENLLPQIRLLKDRMVRDLGHDDKGSEKRGKVTYHEAPDASHHCLALPFAIQKDAQRELLAAISEWLVGSRRYVDLM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g667 ### # start gene g668 3 AUGUSTUS gene 2413718 2416000 0.1 - . g668 3 AUGUSTUS transcript 2413718 2416000 0.1 - . g668.t1 3 AUGUSTUS stop_codon 2413718 2413720 . - 0 transcript_id "g668.t1"; gene_id "g668"; 3 AUGUSTUS CDS 2413718 2414800 0.99 - 0 transcript_id "g668.t1"; gene_id "g668"; 3 AUGUSTUS CDS 2414943 2415104 0.48 - 0 transcript_id "g668.t1"; gene_id "g668"; 3 AUGUSTUS CDS 2415163 2415392 0.17 - 2 transcript_id "g668.t1"; gene_id "g668"; 3 AUGUSTUS CDS 2415499 2416000 0.72 - 0 transcript_id "g668.t1"; gene_id "g668"; 3 AUGUSTUS start_codon 2415998 2416000 . - 0 transcript_id "g668.t1"; gene_id "g668"; # protein sequence = [MSFDNDHLLLDSEYSKKHEAPPQPSDKKQSEKPNVVPFREKPLTNRPHVKINAQNTPNRRHRIDNEPHKLLTPPLTPS # SSIRTTTSVDSSLGHGDNFAVVLSTEVAGRDDDLCPSRFLRVSSLYKPCPFTFARLWTIPNSTLSREKTVELTPLHTGRQLLARCTSESSQTNRRKSF # LENPIKGLLLRSGFVFLAFHDLRDAIAAKTYFETRQSDVFDSCVDQATDEIGRKRLTGTFLTMDQVTIELGESTFLESMDASFQLTVEPDVPLEDVSI # NLTKRTYNEDVETKKSVRIATREIECKTFRVEFFDIRETTSAYEALDGMAMFGMRIKVSGRENLESIENTKSTADHEDSDVIQAEKTTIVPFPISRAS # DDCIQPFGPPGQLSQTRQLFSLSLPVDGLSNDDTPLTAFSDPSENRGSPPVFYTSETHVVNGTQVGINGKTPDERNTLNPQHQLVQSYYGFAYPALDR # AANQTPLIPYFASTPTPPPLAFHSGYLSPPPPPRFLGPGPINTFSGGIPLERDPYAMQHINMAWPIEMNGIPAYPSGFPLNANAPPPQDPYWLQGATP # TGFSGSTASYFSPGVPCLPGRPPNDESSAPPSSSAQEGSPCSNDSPSPSHNVKTSLTSTSKKETSEHNQLNLVKIETGVDTRTTIMIKVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g668 ### # start gene g669 3 AUGUSTUS gene 2419915 2420331 0.45 + . g669 3 AUGUSTUS transcript 2419915 2420331 0.45 + . g669.t1 3 AUGUSTUS start_codon 2419915 2419917 . + 0 transcript_id "g669.t1"; gene_id "g669"; 3 AUGUSTUS CDS 2419915 2420331 0.45 + 0 transcript_id "g669.t1"; gene_id "g669"; 3 AUGUSTUS stop_codon 2420329 2420331 . + 0 transcript_id "g669.t1"; gene_id "g669"; # protein sequence = [MYAVTRSTTQEHSEDPLPIAYFQQQPPIPRKEARRHPMNVLVDALPLSNINLPEIMQPSKPALNESYSVAQFYMLDDA # VTGVLALGSFSAANFSAFQHSLLDGLVKLKSLGATQLLVDVVSPLLVYDSLLSHLVTFHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g669 ### # start gene g670 3 AUGUSTUS gene 2421773 2422978 0.48 - . g670 3 AUGUSTUS transcript 2421773 2422978 0.48 - . g670.t1 3 AUGUSTUS stop_codon 2421773 2421775 . - 0 transcript_id "g670.t1"; gene_id "g670"; 3 AUGUSTUS CDS 2421773 2422534 0.98 - 0 transcript_id "g670.t1"; gene_id "g670"; 3 AUGUSTUS CDS 2422626 2422664 0.74 - 0 transcript_id "g670.t1"; gene_id "g670"; 3 AUGUSTUS CDS 2422717 2422743 0.59 - 0 transcript_id "g670.t1"; gene_id "g670"; 3 AUGUSTUS CDS 2422799 2422978 0.99 - 0 transcript_id "g670.t1"; gene_id "g670"; 3 AUGUSTUS start_codon 2422976 2422978 . - 0 transcript_id "g670.t1"; gene_id "g670"; # protein sequence = [MQRDAEFEVESVDKSGGFIGSLYLNKTENAAVVLVKEGLASVHSYSADSLSWSKQLYDAESEAKSAKRNLWQDYDESA # EKAAFKYSTQKVLFDSSSLDVSALLKRNVLGIASLEKLMRDFSLHHQGAVAVPAGFTPKSGDLVSAKFSDGAWYRAKIRRASPIKKEAEVTFIDYGNQ # DSVAFKDIRPLAPQFRSLPGQVSFKQSDSGLVLCSTLGQAREARLSFIKLVDPESEYYAEAIDRFRQLCEGRKLVANIDAQEGPLLHLRLIDPQNPQS # ATDPYECLNAELLRDGVATIDRKCNYLSAYPQLLRKLKDSVLEAKKDRAGMFEFGDVEEDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g670 ### # start gene g671 3 AUGUSTUS gene 2427003 2429130 0.38 - . g671 3 AUGUSTUS transcript 2427003 2429130 0.38 - . g671.t1 3 AUGUSTUS stop_codon 2427003 2427005 . - 0 transcript_id "g671.t1"; gene_id "g671"; 3 AUGUSTUS CDS 2427003 2427835 0.95 - 2 transcript_id "g671.t1"; gene_id "g671"; 3 AUGUSTUS CDS 2427962 2428521 0.39 - 1 transcript_id "g671.t1"; gene_id "g671"; 3 AUGUSTUS CDS 2428577 2429130 0.99 - 0 transcript_id "g671.t1"; gene_id "g671"; 3 AUGUSTUS start_codon 2429128 2429130 . - 0 transcript_id "g671.t1"; gene_id "g671"; # protein sequence = [MNVYTLLELPKSSRGFSSISQSNGPRSGAQLRKVARTDTDLDSASASRSSTGVTSGSRRIQISGEDFRPNVLPDPFYS # IRHNISVILTPFKQPSLIESYEAVSLRARYIVCVDGKGEGLYNLLKKELEVCMKDKVLESLMKNGEWISFMGRMCDWFHGAVGLLQSLLSPLDQAYVP # TVKGTRSINALAYDIFNDRIFGHAGVSKQLRENLSTWIAADRQNSSGERASRSSVAHLLRHFIAHDVYFGSSQYEQYLLTSTEEYYVALVATLNHDMY # DDPSAFFEIAYDLIEAEVERAEEVFPPQSRQSIKETTIRALFILPKVAGADNFNDNWLDRLKWLATPETVKAYVTSNRVPTMGKMYHLLSTLSSVSGI # SDIVKVTSTGSAAPDLEEKMVPNLLKFREQAEGIIDVAFISKETNKRDGDFSQALSDGFISGFKTRRVKPAEMLAKYLDGMMRKGQAKFFESLSKSNS # ADGDAIAGATQNAQDTLFHSHLLQVLGLYRFSEDKDVFRTFYHRQLTKRLLLGRSASSDAEVAMLRMLKEQYDSEFDMGETMFKDLALSTELMNEFRN # HRLVNGMSDDNLDVRVLQRSAWPFDVSKKQILIPDGVRLPNFKFADELNHVFHRWNNNYQILLHSTTRSTATERWIGIMH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g671 ### # start gene g672 3 AUGUSTUS gene 2429725 2430378 0.93 - . g672 3 AUGUSTUS transcript 2429725 2430378 0.93 - . g672.t1 3 AUGUSTUS stop_codon 2429725 2429727 . - 0 transcript_id "g672.t1"; gene_id "g672"; 3 AUGUSTUS CDS 2429725 2430378 0.93 - 0 transcript_id "g672.t1"; gene_id "g672"; 3 AUGUSTUS start_codon 2430376 2430378 . - 0 transcript_id "g672.t1"; gene_id "g672"; # protein sequence = [MIVHHLGIIHRDIKPANLVWSFDQSTVKIIDYGISHRNEENLKRPASASCYREKTISKPNPTLFTTEELTKQRGTGYF # MAPEVAWTPPDNTLSSPSIDTLSSTMHADVFQIPVKRPAITKAIDVWSLGVTLYCLLFGKFPFQIPSDGNDNYYHTKYMLFREICTQDWTVPDTMGSD # SLPTGGRAATNHDEVIALLDSMLRKDPNSRIAIDCVKVSGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g672 ### # start gene g673 3 AUGUSTUS gene 2431834 2432184 0.83 - . g673 3 AUGUSTUS transcript 2431834 2432184 0.83 - . g673.t1 3 AUGUSTUS stop_codon 2431834 2431836 . - 0 transcript_id "g673.t1"; gene_id "g673"; 3 AUGUSTUS CDS 2431834 2432184 0.83 - 0 transcript_id "g673.t1"; gene_id "g673"; 3 AUGUSTUS start_codon 2432182 2432184 . - 0 transcript_id "g673.t1"; gene_id "g673"; # protein sequence = [MKPEERAPSPEQAIVLSASNSLQENLGPSEEAEAEFAKELAKMVTDTSADSRKLDRKTAMALWDSSVLPPNLRKKRPE # DGDEDEEIDANTMHFTVVTKRGNKQQVKHFASRAAPDC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g673 ### # start gene g674 3 AUGUSTUS gene 2435977 2437593 0.21 + . g674 3 AUGUSTUS transcript 2435977 2437593 0.21 + . g674.t1 3 AUGUSTUS start_codon 2435977 2435979 . + 0 transcript_id "g674.t1"; gene_id "g674"; 3 AUGUSTUS CDS 2435977 2436726 0.43 + 0 transcript_id "g674.t1"; gene_id "g674"; 3 AUGUSTUS CDS 2436810 2436941 0.63 + 0 transcript_id "g674.t1"; gene_id "g674"; 3 AUGUSTUS CDS 2436994 2437593 0.43 + 0 transcript_id "g674.t1"; gene_id "g674"; 3 AUGUSTUS stop_codon 2437591 2437593 . + 0 transcript_id "g674.t1"; gene_id "g674"; # protein sequence = [MDEYDFDDDFDDQTLAALDQIEKSLLSKKHVSPPSNPPAKRVKTETGWRSATTAANNSFDLDELPEISLCQNTYTFQQ # TDGSKSPSLTPQPQYHQETDKRMTNRALVASGSRNISRNNSMQSNRHTVPPKPPAPPIQSTLLTRPSVHRNKPPSPPSSTRRRNSARLLEHITNALAT # SLPEPPQPSLPQQHVPPTLVVPLPATVSHPALKINEQIVAFQKQLEEMRLENEKIRALLKEAEEARISKFGEVATAEDHAAQISKLKAAKEDADAKQM # STQRELKEEMERLKTQFIFKQHELESNSKRPPMSVHARRNIREMPSSTQTPVWGTRATGVSNRILPPESTPVRAPSSIPRLPQFRSPEKTRQSAMLPG # FENSFLESTPKRQSEKGKAAIKSEIHQPLFADELRARDVHLNIPARTVLDDDLGMDIDVPPKFSQISVPKDGPTSSPIRQDDDDVEMDEEDDDDTDEE # FVDGIHFHWKAEVFPMLFGYTCG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g674 ### # start gene g675 3 AUGUSTUS gene 2444799 2445905 0.27 + . g675 3 AUGUSTUS transcript 2444799 2445905 0.27 + . g675.t1 3 AUGUSTUS start_codon 2444799 2444801 . + 0 transcript_id "g675.t1"; gene_id "g675"; 3 AUGUSTUS CDS 2444799 2444829 0.32 + 0 transcript_id "g675.t1"; gene_id "g675"; 3 AUGUSTUS CDS 2445085 2445905 0.4 + 2 transcript_id "g675.t1"; gene_id "g675"; 3 AUGUSTUS stop_codon 2445903 2445905 . + 0 transcript_id "g675.t1"; gene_id "g675"; # protein sequence = [MFRDKETLPGYIFQFQSNSRVIIFGPSFRSSDPKTPEKRQFHKSKGYHRPEHHKHRDGHHQQRRPSISSILDEVGSFS # EQDDRLSFETHRADEAISRAEYAETRLKDAFERLTEAEEARSQSEIHSIKVEEDLHRYREQVTRVQQELRDARIQIESLQQEKSASEREVEKIRVANL # ELQSKFRSYQAKEQGREEGLKSGMLKQFHENRQYIWEAGFSDGFEEGREAGFKEGNRKGRKEGVREGREQGRREERRNALEAFDRFIREEREGEDDRE # VSRALSIRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g675 ### # start gene g676 3 AUGUSTUS gene 2448337 2451068 0.58 + . g676 3 AUGUSTUS transcript 2448337 2451068 0.58 + . g676.t1 3 AUGUSTUS start_codon 2448337 2448339 . + 0 transcript_id "g676.t1"; gene_id "g676"; 3 AUGUSTUS CDS 2448337 2448626 0.95 + 0 transcript_id "g676.t1"; gene_id "g676"; 3 AUGUSTUS CDS 2448726 2449264 0.62 + 1 transcript_id "g676.t1"; gene_id "g676"; 3 AUGUSTUS CDS 2450230 2451068 0.91 + 2 transcript_id "g676.t1"; gene_id "g676"; 3 AUGUSTUS stop_codon 2451066 2451068 . + 0 transcript_id "g676.t1"; gene_id "g676"; # protein sequence = [MSVPPSPPGGRRKGPKSLPKLPLSAFTPPNSGTSEKFPLAPSPSTVHPETVIDANVVALNDDSSLSRWKIEAGPHLGS # RIGGIVVLMSSGDEDSLSNLDNSDRPTSLPTSHPVSLTTVFTGVTTNSVENLKWALQQGRPVDIDIHADLTDDVFESFEDLLSKSMADVSPIPPIILC # TFKLNFISNQFRPSHLSFLIANLLPPPNDLELPIVKLMNHPVYRKFQAQIAALSLFPQVSIKYLPPSWDVETPPTPSVMVASPIDDNKQKKEWKRRIK # MYSFGGISTSATLNTYQAKPTNPGNAKFLPGQTVFPASTTKKVKASGTKTKKTKKKDYATQTGRFRLTDWTSSPNNASASESPPAPTSSSTQPPPPAM # SNVYSLMNNNHNGNGYGSNSYSSSTQASQISTMYSVPPPPIINNTTPYFSNTQHVSTTFTPTSAPPASVTGRFSATKLSTDTQIGSSKGKLLEKAKAT # PSTVTAKVKQKDKPAANSSNRSIDSADNLSRSTTYYRRDYESQVDLDAMSTSGAGPSSPEIPSHLVPKGKSGTSSTQMSCQLYSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g676 ### # start gene g677 3 AUGUSTUS gene 2451126 2454040 0.07 + . g677 3 AUGUSTUS transcript 2451126 2454040 0.07 + . g677.t1 3 AUGUSTUS start_codon 2451126 2451128 . + 0 transcript_id "g677.t1"; gene_id "g677"; 3 AUGUSTUS CDS 2451126 2451257 0.66 + 0 transcript_id "g677.t1"; gene_id "g677"; 3 AUGUSTUS CDS 2451613 2452055 0.37 + 0 transcript_id "g677.t1"; gene_id "g677"; 3 AUGUSTUS CDS 2452912 2454040 0.24 + 1 transcript_id "g677.t1"; gene_id "g677"; 3 AUGUSTUS stop_codon 2454038 2454040 . + 0 transcript_id "g677.t1"; gene_id "g677"; # protein sequence = [MVTVLITDVRSGKEDHQLTEVIVPLKDTDPENPEYGFWANAQEVLPSPPRIPRDLRPSPDPDELSSYSHSHDSRDNKR # DRKRYRSPSDGGDRLNGDYGSRSRSGSVSHQNKKRRKVDEEEVIEDSDADLFTTPLTGIGQEWNFDYESPTSDDDENLDAKIVERIDPALQMHPTPGL # WESVFKVKARLPRVPASATLSKTSHSSKAGSSFEAHAMTPVAGSSGPQGAHDYTEGASPIDINNVLAHSRRSSELSVYNDDEGTMFSGPGHSVNPSSV # TRMSNIDPARRSWSRSRRKSHDSGVSGRLSIERRQSQGSQHSQLSRQSSQEEDIEADSQRHTVRGRRRRSPSPPTRPSVLGNWASLFGKSQATQDGRR # LSISSRRSSASLSRQSSRSDAGSEYAVETDDEERWGYSSGEEDSDEELSGRDDASISRSMDYDSEPPSPTMNQGLPLLSSDPIFGGESRIEMEFSFTE # MEPPPPGPPSRQQIHIEEDDSTIRLVGYEIILWRQWLWRASCILTFGILGLLGNWFPRLWLGFVTHEKAFINIKQGFVVVEVRFLHSSLILILSLTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g677 ### # start gene g678 3 AUGUSTUS gene 2456348 2457312 0.18 + . g678 3 AUGUSTUS transcript 2456348 2457312 0.18 + . g678.t1 3 AUGUSTUS start_codon 2456348 2456350 . + 0 transcript_id "g678.t1"; gene_id "g678"; 3 AUGUSTUS CDS 2456348 2456403 0.39 + 0 transcript_id "g678.t1"; gene_id "g678"; 3 AUGUSTUS CDS 2456460 2456674 0.84 + 1 transcript_id "g678.t1"; gene_id "g678"; 3 AUGUSTUS CDS 2456732 2456895 0.76 + 2 transcript_id "g678.t1"; gene_id "g678"; 3 AUGUSTUS CDS 2457043 2457312 0.44 + 0 transcript_id "g678.t1"; gene_id "g678"; 3 AUGUSTUS stop_codon 2457310 2457312 . + 0 transcript_id "g678.t1"; gene_id "g678"; # protein sequence = [MAGKSIEGLSWLKAQRMKREQAESKLKFLGLTIFENKIKPGTTPAIQALRIAHLPCRMITGDNPLTAVSVARECGLVN # PAAYVFSPSFIRGDATGPDAKLEWTCMDDLSWKLDNYSLKPSSPPLHHTAEADDIGYHDYSLVISGDNEVIERLQGLGYTVLMCGDGANDCAALKAAD # VGVSLSEAEASVAAPFTANTPDIGCVLELIKEGRSALVTSFSCFKYMYVLSSLLDSHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g678 ### # start gene g679 3 AUGUSTUS gene 2466833 2467303 0.51 + . g679 3 AUGUSTUS transcript 2466833 2467303 0.51 + . g679.t1 3 AUGUSTUS start_codon 2466833 2466835 . + 0 transcript_id "g679.t1"; gene_id "g679"; 3 AUGUSTUS CDS 2466833 2467303 0.51 + 0 transcript_id "g679.t1"; gene_id "g679"; 3 AUGUSTUS stop_codon 2467301 2467303 . + 0 transcript_id "g679.t1"; gene_id "g679"; # protein sequence = [MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQ # IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLGESSLAVWKVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g679 ### # start gene g680 3 AUGUSTUS gene 2468749 2469804 0.66 + . g680 3 AUGUSTUS transcript 2468749 2469804 0.66 + . g680.t1 3 AUGUSTUS start_codon 2468749 2468751 . + 0 transcript_id "g680.t1"; gene_id "g680"; 3 AUGUSTUS CDS 2468749 2469804 0.66 + 0 transcript_id "g680.t1"; gene_id "g680"; 3 AUGUSTUS stop_codon 2469802 2469804 . + 0 transcript_id "g680.t1"; gene_id "g680"; # protein sequence = [MSWSVICCSYFDCLGHAVGRKNRHCLCETCEKKGRGGYAPDHTDDDIPSDSAFSDSDSDGTSSESDATSSGQEDGAVK # RQVNLNERRTRRGVYAVVTKEEDHSDESDDEDGSVRPLAGASDIPSPGEMEMAESTSDLTSIPSSRAVSNCNQAGPSCLSSSTSALTPISRSTSSLSS # LSSSEGTSSTHKSSSYQSIIATRRQKAQAEAAALVNASATLPEDSLSSVSSLRHLTQASLSVTPSKGKAKQKEQIRASSTPMRPDNLQATESGKMKDE # DPRILRPRPSASVTTSEAAKEINSKTEIPRGPDGKPLPICATCRNILPVISVDHQIVWGLGLEKDSKKKKAKQDCPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g680 ### # start gene g681 3 AUGUSTUS gene 2469863 2471170 0.21 + . g681 3 AUGUSTUS transcript 2469863 2471170 0.21 + . g681.t1 3 AUGUSTUS start_codon 2469863 2469865 . + 0 transcript_id "g681.t1"; gene_id "g681"; 3 AUGUSTUS CDS 2469863 2471170 0.21 + 0 transcript_id "g681.t1"; gene_id "g681"; 3 AUGUSTUS stop_codon 2471168 2471170 . + 0 transcript_id "g681.t1"; gene_id "g681"; # protein sequence = [MRHYAIYGELWPRRVPLPGCTSTFNTTPREETTPIEFARKVTHKVLPVLDRKIAAVASSKRKRSSEGPVAEEENEHFA # KKLKTSVDRTVPKKRIPIPLPEGQKRKRGRPRLMSVPVTVPALPPIVKMEDTEEPLHPNGFKSQGRRMNGRFERKLSSSSPQKGYDLDKSPKNALAGR # AQRALEREKAKEIVERELLVKRGLSDGEIERITKKGKWDGSNPHDKEPPLKKVFPKRSTSFRSGNLFSRPNPMSFAARAWANPLVSDDASSEDEKGPD # TPEDSLSPPAIVEVELEDWDRGPSLIVTAPAVPPAYKPSPFSFARRRWSSLSASPIEEPKKSTSELRPNADARPPLNMERILGHNSSSITTSSYEKWN # PNHGTYSSEEEVRSHFPITGYKTSILINNSRIPQISLLHGSLRFTGARVTHDPCFSSIHIRQM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g681 ### # start gene g682 3 AUGUSTUS gene 2477279 2477845 0.85 - . g682 3 AUGUSTUS transcript 2477279 2477845 0.85 - . g682.t1 3 AUGUSTUS stop_codon 2477279 2477281 . - 0 transcript_id "g682.t1"; gene_id "g682"; 3 AUGUSTUS CDS 2477279 2477845 0.85 - 0 transcript_id "g682.t1"; gene_id "g682"; 3 AUGUSTUS start_codon 2477843 2477845 . - 0 transcript_id "g682.t1"; gene_id "g682"; # protein sequence = [MSAKRRADAIARFSVPLESIPTVQVPQEISTSAVASRSRRVSRNASYNVDPTEDDDDEDFVMPSADNNYSDDDEVTAA # ATWKSKGKGKAKRTQGDSENEDHFSFGDTQNQNNPPVMLISLKAGALGLNLTGELPTAFRGRFPTGLSWNQLRIMFICKDLFCSHLYSMTYLCHRMDP # YVPVSLYQDSNH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g682 ### # start gene g683 3 AUGUSTUS gene 2477950 2478731 0.28 - . g683 3 AUGUSTUS transcript 2477950 2478731 0.28 - . g683.t1 3 AUGUSTUS stop_codon 2477950 2477952 . - 0 transcript_id "g683.t1"; gene_id "g683"; 3 AUGUSTUS CDS 2477950 2478264 0.63 - 0 transcript_id "g683.t1"; gene_id "g683"; 3 AUGUSTUS CDS 2478427 2478672 0.62 - 0 transcript_id "g683.t1"; gene_id "g683"; 3 AUGUSTUS CDS 2478729 2478731 0.37 - 0 transcript_id "g683.t1"; gene_id "g683"; 3 AUGUSTUS start_codon 2478729 2478731 . - 0 transcript_id "g683.t1"; gene_id "g683"; # protein sequence = [MSNALSMLTRMRQLALHPALLPRDYLEQLKQIDVGKSNNIDLTPESKQRLQARLSQAIEECEECPICFSVPVEAEIKI # TSCAHDRRALSLEDLHDPLPPMDMTQPSFRSQGDEIEEGIRNAPSAKIEQLVQLLKLTPNGEKSIVFSQFTVGRSIYPLIIFTHLHCRAFLTKYVNAF # QCSLPHNVDHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g683 ### # start gene g684 3 AUGUSTUS gene 2479437 2479850 1 - . g684 3 AUGUSTUS transcript 2479437 2479850 1 - . g684.t1 3 AUGUSTUS stop_codon 2479437 2479439 . - 0 transcript_id "g684.t1"; gene_id "g684"; 3 AUGUSTUS CDS 2479437 2479850 1 - 0 transcript_id "g684.t1"; gene_id "g684"; 3 AUGUSTUS start_codon 2479848 2479850 . - 0 transcript_id "g684.t1"; gene_id "g684"; # protein sequence = [MISLIIATKPDVPKNFSNATLVVVPLSVLSNWEKQIQDHCVGGTLTYCSYYGAQRAQLGAQALASHDVVFTTYQTVAG # EHDHPRTQPANKKKKAEKALFGVRWKVDSLLNVSVIGLRSIYSVSSLMKVTQFGTQRPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g684 ### # start gene g685 3 AUGUSTUS gene 2480944 2481874 0.24 - . g685 3 AUGUSTUS transcript 2480944 2481874 0.24 - . g685.t1 3 AUGUSTUS stop_codon 2480944 2480946 . - 0 transcript_id "g685.t1"; gene_id "g685"; 3 AUGUSTUS CDS 2480944 2481015 0.82 - 0 transcript_id "g685.t1"; gene_id "g685"; 3 AUGUSTUS CDS 2481134 2481518 0.8 - 1 transcript_id "g685.t1"; gene_id "g685"; 3 AUGUSTUS CDS 2481867 2481874 0.29 - 0 transcript_id "g685.t1"; gene_id "g685"; 3 AUGUSTUS start_codon 2481872 2481874 . - 0 transcript_id "g685.t1"; gene_id "g685"; # protein sequence = [MPXRADQQKIRTALATRRVAVTDIPVSTRPIIPPPPALASTQKLTVANPKKRKESSSNVTTTTSSSQRAEIDAGEDEP # MEEEVLDELIVSLNTQVVGIQYYKGVKPFNSKSLNFSNPILGLVGPGEEVILVIISRNAIRVDNIGIVPIVRAERR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g685 ### # start gene g686 3 AUGUSTUS gene 2482574 2482789 0.66 + . g686 3 AUGUSTUS transcript 2482574 2482789 0.66 + . g686.t1 3 AUGUSTUS start_codon 2482574 2482576 . + 0 transcript_id "g686.t1"; gene_id "g686"; 3 AUGUSTUS CDS 2482574 2482789 0.66 + 0 transcript_id "g686.t1"; gene_id "g686"; 3 AUGUSTUS stop_codon 2482787 2482789 . + 0 transcript_id "g686.t1"; gene_id "g686"; # protein sequence = [MARSLKSGSGAFDIDDYLAKLVSFMGGHKLDNQNPDDPDADDALLDAPLDWDKIGRTTLAKSKRVPVVGFM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g686 ### # start gene g687 3 AUGUSTUS gene 2485885 2486307 0.72 + . g687 3 AUGUSTUS transcript 2485885 2486307 0.72 + . g687.t1 3 AUGUSTUS start_codon 2485885 2485887 . + 0 transcript_id "g687.t1"; gene_id "g687"; 3 AUGUSTUS CDS 2485885 2486307 0.72 + 0 transcript_id "g687.t1"; gene_id "g687"; 3 AUGUSTUS stop_codon 2486305 2486307 . + 0 transcript_id "g687.t1"; gene_id "g687"; # protein sequence = [MSFPQAEVHYSPSDAFEGTVIGFFRQPATDLGHAILDSISLVRSVVLKCYDAPAPVAMLDDSTINLAKDQLTESVQRA # RAELEKFCDDLDKERRISSDESSDLPPRAFNLCLFMISLLQVDMIFFDATLSSECLSDGGRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g687 ### # start gene g688 3 AUGUSTUS gene 2490354 2491211 0.76 - . g688 3 AUGUSTUS transcript 2490354 2491211 0.76 - . g688.t1 3 AUGUSTUS stop_codon 2490354 2490356 . - 0 transcript_id "g688.t1"; gene_id "g688"; 3 AUGUSTUS CDS 2490354 2491211 0.76 - 0 transcript_id "g688.t1"; gene_id "g688"; 3 AUGUSTUS start_codon 2491209 2491211 . - 0 transcript_id "g688.t1"; gene_id "g688"; # protein sequence = [MVKPAHSPVVSFESESPTRFEPLRPTPVSRTSGGPGKLGRVADRWAEQAIIGVRPVASRSPSTESEIPKISGMVGRRA # LPGLAATPTILPSKLPGGPPSPIKPFSIPRTESSEKSPVSPSLASKYPSEPTRPTTPSRHSRIPSTGNRATVMDVAQAFTEPQKQTEPEKASPEVIEA # PASLPPLNPNFRQNINPPALSERRRSSYQEKYSAIVLPPLREEVTPTPTPVSTVARGSSPAAEHTIPSSIDQVLQGTLNQIEQTAAANSDVVHISKFA # TRTYDVNLTIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g688 ### # start gene g689 3 AUGUSTUS gene 2491420 2493454 0.5 - . g689 3 AUGUSTUS transcript 2491420 2493454 0.5 - . g689.t1 3 AUGUSTUS stop_codon 2491420 2491422 . - 0 transcript_id "g689.t1"; gene_id "g689"; 3 AUGUSTUS CDS 2491420 2493119 0.77 - 2 transcript_id "g689.t1"; gene_id "g689"; 3 AUGUSTUS CDS 2493212 2493331 0.83 - 2 transcript_id "g689.t1"; gene_id "g689"; 3 AUGUSTUS CDS 2493397 2493454 0.64 - 0 transcript_id "g689.t1"; gene_id "g689"; 3 AUGUSTUS start_codon 2493452 2493454 . - 0 transcript_id "g689.t1"; gene_id "g689"; # protein sequence = [MDSPSTPSRSRYSDLPKLDTIDWARKVRALQQQVDADEEAEYKRLQEEIAASRIARKRRTSSRESLSEVSQKSSTSDL # KSIADRQQSQVEAFHKLNGTSSSSSPSNSDIKGSIATARAWMTSNSSNATASKPSGPISLAAFMGGRASGPILNKHAPQQDAHDPTQFEDRGRITAPH # PVFGRGGVAMPGLTASSRFPLRDEIGSLPSVVSPKYGSDRAPTASLATLERTVTPANNGIPESSPSTTAPLVIRPRSASPTKIFDERPVPLQKTGGRD # RTISIPSVSSYLSESGVLSRSSLSEKNGPRERTLSSSPSESPPVSAKFPVVKTSQERPVSTTNTGPRDRTISTPTGNSRVTFTVSDSTTSDNLPSLRR # PISTSFTPPKPPIQATSLSKSPPHKSPVSIPSLAKPIRPDPKPSPQTSHMPVSPNTSPAFLKPPVQKEPTPSISRLQGRGFVQNMVKASHTFETPSSS # TQTTPDRPVSASRKATVLERWHHNGSPSPVPASSPPVTSPKPLAMRKSFTLEPNSSLKATATGPSVTPKPVKTLPLTTKVDSEPIRPRRDSPPMLNSQ # GTGLGSATTLVVFKPPADEEEVGSFGAVSELGVKHSAAQQKLPVVAGKPLTHVRSFW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g689 ### # start gene g690 3 AUGUSTUS gene 2493655 2496072 0.57 + . g690 3 AUGUSTUS transcript 2493655 2496072 0.57 + . g690.t1 3 AUGUSTUS start_codon 2493655 2493657 . + 0 transcript_id "g690.t1"; gene_id "g690"; 3 AUGUSTUS CDS 2493655 2494238 0.57 + 0 transcript_id "g690.t1"; gene_id "g690"; 3 AUGUSTUS CDS 2494296 2496072 0.73 + 1 transcript_id "g690.t1"; gene_id "g690"; 3 AUGUSTUS stop_codon 2496070 2496072 . + 0 transcript_id "g690.t1"; gene_id "g690"; # protein sequence = [MTSIKTESIHEFNYPRSTSPTKESLRPNAHPYAIKTTSTALLSRSNSSSRTHDSSHHHYVPRTPPATSLGHRKHEGAH # YRHRYSSSLSSDNIPRPLPVPPSPTKEAVNDSSGKHPRTFYNPVVFSAPLTLEDLPPNPKLWTPSQLCAYLSTALRVKSGESLQLPAPVARDIASFVR # ESKITGRIFLRLDEKDLEAYGVNKLWKNALLKTSQNLRQNVLKGQIWGFVEELEGTSNGINFPSVGDAHSGSIDEDEDEDSTPHRRRRSASQPQTTRS # RFIAGSTVKSSFNHPFPNGLPVYSSASSSSSSDDLFSPTGINPSVSFTTRSTSPNGHSHYMHDNRSRHGRVKGMVDSFERSSSFDEGDPTSAKLLQEI # KGNRELDLEKLRKIRRERSGSTSSISNGSSGSSHSPTSSSDDGSEPGAFVGSPVEEYNVSTITSSRPLPNPPRNEIDDVLFVSGLEEPSIEELLAQEG # RLEDAISSHTSLATLNSTFKNQTPSFAKGTFSISKGKGRAKKRGGVYAWEEEVEDLGAAAPGKTTAKRVFSQIPIPATMMSSASSAKDIFEELENVNG # NIREDQLRSVDTSSPAPVKSGQGSGTHTPSRPLPEIPLHPSLVALPEPGDISFSPVSPKETDEETRLRASIAEITGLLQAFEVRLADVERKVDVLDVE # LKELEVANLVRNKQQAEDGVQIKNETEQMTREDKVEEVNEPIFLSEWPIMRKVINRVFRFSPAGQLPSIGSRVFHSQYWRSPSHINPQTLSQLPPYVL # LVGLGVCAVVLRVVARRLTGKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g690 ### # start gene g691 3 AUGUSTUS gene 2498171 2499008 0.25 + . g691 3 AUGUSTUS transcript 2498171 2499008 0.25 + . g691.t1 3 AUGUSTUS start_codon 2498171 2498173 . + 0 transcript_id "g691.t1"; gene_id "g691"; 3 AUGUSTUS CDS 2498171 2498341 0.7 + 0 transcript_id "g691.t1"; gene_id "g691"; 3 AUGUSTUS CDS 2498451 2498479 0.33 + 0 transcript_id "g691.t1"; gene_id "g691"; 3 AUGUSTUS CDS 2498596 2498621 0.48 + 1 transcript_id "g691.t1"; gene_id "g691"; 3 AUGUSTUS CDS 2498716 2499008 0.97 + 2 transcript_id "g691.t1"; gene_id "g691"; 3 AUGUSTUS stop_codon 2499006 2499008 . + 0 transcript_id "g691.t1"; gene_id "g691"; # protein sequence = [MRTIETPTPRKVFPDMREIALNALLDPDEVEESLALSTIPEGVDPSTINHVLEVVSDAALVQLEQVTVTAAVHKGFEI # KVAVSVEEKPRADSSVPQPAVTFVTMAERVSFVQGATPQTLVSQESTESTMDVFDEEVRMGINEDGLKQAEEELRAICANAEVHSDERPLQKLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g691 ### # start gene g692 3 AUGUSTUS gene 2499573 2500931 0.74 + . g692 3 AUGUSTUS transcript 2499573 2500931 0.74 + . g692.t1 3 AUGUSTUS start_codon 2499573 2499575 . + 0 transcript_id "g692.t1"; gene_id "g692"; 3 AUGUSTUS CDS 2499573 2500931 0.74 + 0 transcript_id "g692.t1"; gene_id "g692"; 3 AUGUSTUS stop_codon 2500929 2500931 . + 0 transcript_id "g692.t1"; gene_id "g692"; # protein sequence = [MKPGDLRNVFSDCSDMYVHVSQRIRVHHDFDYPQRHGAHPSRTSFSSYDTHYFTKFNEHDGLERVLRLEKDSGIRVIP # VSASPVSAEEYQSVNYRGSGTPRPKEHPLNNLQNIPIVDANRVRHYSHIPDAVLTPSTNLVHAPDHGRPEIDAPKFNNHDDTNPPIWMNALNSSSLLS # PIVINKQHSYPHSSEKPKTATVSPLTYIHSAKALDSLTLPCIPLTTHIRLCLCGELFSYNLSNLQSDPREIIELLKSTGSERGNWMTVGACYRRQGNP # HAAIAVIQSMVEGEEYGCPRHSGFPLIYLPPIVMARYGVSENELKPAFLMLAGCESDLSKLTRNEGRITLEHQQKSQRWLQKVYGAMKSHSDNIGVDA # PSNNPKLPARPPSPSGSDEHLRREIQSLRDRLRHQAGLLSDVRSAKRKLEGSYKSERDTRRRIEREIKGMKAERDKTCRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g692 ### # start gene g693 3 AUGUSTUS gene 2503681 2505258 0.74 - . g693 3 AUGUSTUS transcript 2503681 2505258 0.74 - . g693.t1 3 AUGUSTUS stop_codon 2503681 2503683 . - 0 transcript_id "g693.t1"; gene_id "g693"; 3 AUGUSTUS CDS 2503681 2505258 0.74 - 0 transcript_id "g693.t1"; gene_id "g693"; 3 AUGUSTUS start_codon 2505256 2505258 . - 0 transcript_id "g693.t1"; gene_id "g693"; # protein sequence = [MPSPLPPALPPSPPASRSTSPVAGPSVQSAKRKSEVGLDTDRPKRSKTESTATTHRVSHLPPTHYLPRSELAEDGEVA # EEPNSVSHPIQSRATPIHPSPDAPVTSFVPIRRPKRGHQHNVQLIPTLHEKYHQAGRKLKYSGDARFWSTYPPSHKEYRPIPNAPPPNSLYHIHGGMV # AKLELMEALVMFVYSSWCKEYGRGGIYTDSWLTMEGFIKWCKAKWKPEEGSSDGEKAFYGLMYVLSSGSSMFVLMISSRHMFHAFIHARIVTQSQRKL # RSDLERVTEATCQAVNAAISDAPSHSSSSLGAKSQSTPPMLPSPASIGAANSANSTPTNRDGTPISSEIRSASISSSSAISAPSQSSSSPSGPSIPLP # FLPPQYRTGIPPSHITAAANTVSASFNLNQLATVNEVSYSLSVSIAEMQTAQVHLNFSIIARHFPRTFARMVHSTLKSTEEHEVDFEDDDGELFWPGQ # SITGDGLGWLCYMGEAMVQEFGKQFDYKGLKGVVPKPDQYDPRIRPPSFGMAGQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g693 ### # start gene g694 3 AUGUSTUS gene 2512888 2514600 0.92 - . g694 3 AUGUSTUS transcript 2512888 2514600 0.92 - . g694.t1 3 AUGUSTUS stop_codon 2512888 2512890 . - 0 transcript_id "g694.t1"; gene_id "g694"; 3 AUGUSTUS CDS 2512888 2514600 0.92 - 0 transcript_id "g694.t1"; gene_id "g694"; 3 AUGUSTUS start_codon 2514598 2514600 . - 0 transcript_id "g694.t1"; gene_id "g694"; # protein sequence = [MSKHRLSPAPLPPSKKIHLSSEISESSSTSPTSFESLSDELVLCVFARLSFADLCACQATSGNWYRLATDNELWRNLY # LRNFGRPRLRGARGFVGRTDGREVKSLPGRAKVEDHKDWKWMFRISSNWKNGMSFSPSTMNHFSLCAGRCAMDDVRPFVQGLGMESLKQSHMLLAGSL # TITATSRSSSCPLIYVQDVAGEEHTLACPTTHIAHVTALALDQSAPLSGHIRLISFLSSGDFRVFSVDHNHPASSSTELSYTPLRRSSRVCPIIQAVY # HHPLLITLSEAFTLSIYDLSSGGAVLTQTLSSFTSFPPTSLVLSTTSAATYKLVLAYAIPVYPAHWSVGATELIIAGPSTNSELLRSSSFLAPTHTPM # TIISTRTARALDVPQGWVDEKKLRVMREQWSRKVYRVADTQTDGKFVVLAPEDTHSESHGSMPSSPSSTPSLSSSSPPYASSLYSPTSLQLYRLSLPS # STSVSSSGPKLSFVRTLHGQMGPIAALALSDGRCVSFGVNGSIWVWDLESTTGTEVAAPMSAKSSDGAPALTSAKRSVTFDERRIVTAVNDHVVERRF # DI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g694 ### # start gene g695 3 AUGUSTUS gene 2523657 2524516 0.29 - . g695 3 AUGUSTUS transcript 2523657 2524516 0.29 - . g695.t1 3 AUGUSTUS stop_codon 2523657 2523659 . - 0 transcript_id "g695.t1"; gene_id "g695"; 3 AUGUSTUS CDS 2523657 2523835 0.8 - 2 transcript_id "g695.t1"; gene_id "g695"; 3 AUGUSTUS CDS 2523888 2524063 0.66 - 1 transcript_id "g695.t1"; gene_id "g695"; 3 AUGUSTUS CDS 2524119 2524516 0.39 - 0 transcript_id "g695.t1"; gene_id "g695"; 3 AUGUSTUS start_codon 2524514 2524516 . - 0 transcript_id "g695.t1"; gene_id "g695"; # protein sequence = [MTGAKSALEVKDDMTFLDLTVRQIEHLNTTSRVDVPLILMTSFNTHDDTLRIIKKYANQQLRITTFNQSRYPRILKES # LLPCPKRADDDKKNWYPPGHGDLYNALLHSGVLDQLLAEGKEYLFVSNSDNLGAVVDEKILQHMIESQAEFLMEVTDKTKADVKGGTLIDYDGSMRLL # EIAQVPSEHVEDFKSVRKFKIFNTNNLWVNLKALKHIMEHEGMELDIIINPKMTDDGQGVIQVGVYACNPCVGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g695 ### # start gene g696 3 AUGUSTUS gene 2530482 2531205 0.63 + . g696 3 AUGUSTUS transcript 2530482 2531205 0.63 + . g696.t1 3 AUGUSTUS start_codon 2530482 2530484 . + 0 transcript_id "g696.t1"; gene_id "g696"; 3 AUGUSTUS CDS 2530482 2530484 0.8 + 0 transcript_id "g696.t1"; gene_id "g696"; 3 AUGUSTUS CDS 2530534 2531205 0.77 + 0 transcript_id "g696.t1"; gene_id "g696"; 3 AUGUSTUS stop_codon 2531203 2531205 . + 0 transcript_id "g696.t1"; gene_id "g696"; # protein sequence = [MSPSHASSSSSQNHNAVSPPAPSNNIASSSPEVSVNDEIRASRKVTFLDPDTQNLPPKKRRRATLANASDSAAPYDSQ # PDIVVSPTRDISDSAENLPEPAIPPKKIKKKAERTISKSSEVETSSRPRATSITRNHDDTEAVNKPKLKKKSRKEPETEHGSTSSTFKASDETANSAP # AAIAKSSKKSKKQKAETSVNAFSQQLAQTITDGHRKFKHSFSFHVILK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g696 ### # start gene g697 3 AUGUSTUS gene 2531490 2533607 0.43 + . g697 3 AUGUSTUS transcript 2531490 2533607 0.43 + . g697.t1 3 AUGUSTUS start_codon 2531490 2531492 . + 0 transcript_id "g697.t1"; gene_id "g697"; 3 AUGUSTUS CDS 2531490 2531568 0.45 + 0 transcript_id "g697.t1"; gene_id "g697"; 3 AUGUSTUS CDS 2531887 2533607 0.93 + 2 transcript_id "g697.t1"; gene_id "g697"; 3 AUGUSTUS stop_codon 2533605 2533607 . + 0 transcript_id "g697.t1"; gene_id "g697"; # protein sequence = [MNAEFWLGRAKTAEPMSETTEHERPDARRVGYDSSSLHVRTSVPQLFLSSYSTFFKTNSSTPREDDAPSSNLKKFVIP # TKSSLASEPESSDDDDDDGSGVISKPISIPQPPSTSNSLDHIDSELYLKELLRGPNKRRLTLDSILPFATTPNRKRKAVVLEEDSIVTPKSVRRSLQK # KVSAWPSSDSDNAYYESASDDVASVSNGLSGVDQPPTLEDSKKDSIGPDDTIEPESHFAPDGFDDTPASGQVDPVQTPAHKTFTETFSDMPHSVTPTN # KQAPVVPRVPSSSHGFSDEHDPIEPIVPSPRSQSPIENALATKNSMPTHRTRPTTTYSKPEIVLVRRSTRKSQSQPISKHEADVRQSVVRLTKAKSTA # QIQTPRSPAPPPSPTLPSPRRLRSATQPARVIPTGESLNYQTPASAQEKQSQTLANMWTTLHAEPSSTVDAESSHGDDELHSSPGHEPATGPENPLFT # ASESQVDFPYSQFQDINLDTDNGADEPLIGVDRLDEDSEEEEEVQETITPRVTRRSSTAYRGLSEIAGQNKFFAGFQPSSVPTSTPINFKEDMYGPLS # QAYDDDASDSGSESGTEKSHIPRARRAGNKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g697 ### # start gene g698 3 AUGUSTUS gene 2534973 2535773 0.7 + . g698 3 AUGUSTUS transcript 2534973 2535773 0.7 + . g698.t1 3 AUGUSTUS start_codon 2534973 2534975 . + 0 transcript_id "g698.t1"; gene_id "g698"; 3 AUGUSTUS CDS 2534973 2535773 0.7 + 0 transcript_id "g698.t1"; gene_id "g698"; 3 AUGUSTUS stop_codon 2535771 2535773 . + 0 transcript_id "g698.t1"; gene_id "g698"; # protein sequence = [MTDPSYRGQILVFTTPLIGNYGVPSNTAPFDAHDVGVVLESQGIQCAAVVVSDVAERFSHYTAAESLASWCQRHDIPG # ITGVDTRAITRLLRDQGTTLGRITVGSDTSLPAPKADEFWDPSLENLVDQISTKEPYEINPSGSLKIALLDFGAKANILRSLIRRGAAVTVLPWNYDF # NAVRDQYDGLFLSNGPGDPTHCMEAALKLRPTLEEWSKPVFGICMGHQIIGMAAGLDAYRMTFGNRGHNQPVLALASSGSIKAGRVYVTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g698 ### # start gene g699 3 AUGUSTUS gene 2536263 2537385 0.24 + . g699 3 AUGUSTUS transcript 2536263 2537385 0.24 + . g699.t1 3 AUGUSTUS start_codon 2536263 2536265 . + 0 transcript_id "g699.t1"; gene_id "g699"; 3 AUGUSTUS CDS 2536263 2536281 0.24 + 0 transcript_id "g699.t1"; gene_id "g699"; 3 AUGUSTUS CDS 2536400 2537385 0.58 + 2 transcript_id "g699.t1"; gene_id "g699"; 3 AUGUSTUS stop_codon 2537383 2537385 . + 0 transcript_id "g699.t1"; gene_id "g699"; # protein sequence = [MAIKYTCNWPAGPFLGWVQEAGALTLVRIRSLKLNNQKHQSQNALEVARKDLTEVVSQAQKELHKFTGDASNEAQPSS # SLSGPQSEELHPRSSSETLKPDAAVSSESASASSSTTSVQNLFSRLQTSLPPNVVSTVQANLPESLKHLSENTDFAQFRTTLTSEFQRLQGVTLTQAE # EYVHKSEILLRDAMKEAGEVLRDAVKVLPPDENTSNNTGLIWDGSDMWMLPSESGDIPTSGKGKGKANSQNAVATRAEALLKRLRSDPNILKHDPEVD # GGVYLQWIASDIDSADGGIDGTHWRAKIDETLQSEDGKTLQATFDILGVSCNEGSMQLSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g699 ### # start gene g700 3 AUGUSTUS gene 2537551 2537850 0.96 + . g700 3 AUGUSTUS transcript 2537551 2537850 0.96 + . g700.t1 3 AUGUSTUS start_codon 2537551 2537553 . + 0 transcript_id "g700.t1"; gene_id "g700"; 3 AUGUSTUS CDS 2537551 2537850 0.96 + 0 transcript_id "g700.t1"; gene_id "g700"; 3 AUGUSTUS stop_codon 2537848 2537850 . + 0 transcript_id "g700.t1"; gene_id "g700"; # protein sequence = [MENEEDFSWEDDEADDSSASIATAAKNTEAPKVQPLDPDPVAKKSPDPSSQVNTPANTSPRVSSEESYDVVSGNVSAS # GEGRKGNEAAEESSDGDSDWE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g700 ### # start gene g701 3 AUGUSTUS gene 2541908 2542273 0.56 - . g701 3 AUGUSTUS transcript 2541908 2542273 0.56 - . g701.t1 3 AUGUSTUS stop_codon 2541908 2541910 . - 0 transcript_id "g701.t1"; gene_id "g701"; 3 AUGUSTUS CDS 2541908 2542273 0.56 - 0 transcript_id "g701.t1"; gene_id "g701"; 3 AUGUSTUS start_codon 2542271 2542273 . - 0 transcript_id "g701.t1"; gene_id "g701"; # protein sequence = [MRGTPADDPSGPVMLAIKKIRELFPTIYIACDVCLCEYTDHGHCGLLKTDGSIDNSPSVDRIAQVAVNYAKAGAHCVA # PSDMMDGRIKGIKRGLIDAKLGNKCTLMSYSAKFASCMYGPFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g701 ### # start gene g702 3 AUGUSTUS gene 2544146 2545225 0.63 + . g702 3 AUGUSTUS transcript 2544146 2545225 0.63 + . g702.t1 3 AUGUSTUS start_codon 2544146 2544148 . + 0 transcript_id "g702.t1"; gene_id "g702"; 3 AUGUSTUS CDS 2544146 2545225 0.63 + 0 transcript_id "g702.t1"; gene_id "g702"; 3 AUGUSTUS stop_codon 2545223 2545225 . + 0 transcript_id "g702.t1"; gene_id "g702"; # protein sequence = [MLASTQISPFPSRTYNPSLSPSSGNQPDATRRASLFDTASAKSPLRQRPLFPPVAVEGRSHSDFALKSPYKTPVVPAW # SPFASNSHLGVDDDEASVLLGSPSATTSPLFAASMARSLFTPVKQAPRVVDGLSPTPTVGSPSALRPQPSTGTGLKRKSVSTRQSTPLRQHSLTPLDI # ASTGLKGSMDGRRFDRLAPLPAPKFPIRTPQTKKETDPQLRQETATMTRLRISDLNEFQDEFEGGNDSGCDLGCDLNLEDDKARGDELFLGGEVMPMR # GRGKVEAALRLAGKGKFNEEVAEAVSPGGHIIKRRARARPLSDELLSSTVSQASVSSNYLHILYHGPLTNFDRQRGPRLTMVSTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g702 ### # start gene g703 3 AUGUSTUS gene 2545300 2547259 0.37 + . g703 3 AUGUSTUS transcript 2545300 2547259 0.37 + . g703.t1 3 AUGUSTUS start_codon 2545300 2545302 . + 0 transcript_id "g703.t1"; gene_id "g703"; 3 AUGUSTUS CDS 2545300 2546473 0.62 + 0 transcript_id "g703.t1"; gene_id "g703"; 3 AUGUSTUS CDS 2546530 2546902 0.37 + 2 transcript_id "g703.t1"; gene_id "g703"; 3 AUGUSTUS CDS 2546962 2547259 0.49 + 1 transcript_id "g703.t1"; gene_id "g703"; 3 AUGUSTUS stop_codon 2547257 2547259 . + 0 transcript_id "g703.t1"; gene_id "g703"; # protein sequence = [MPRRRASGLHPSKPPVYRRAQLNRVDSATLFFGGPAVTAAPSLASPSTSSRRVTTSISSDAADSPFTTATRPKILNRH # SYSGSGPVTPSWRQMHPRSNDVSPTTSPPLSYTAGETESYDTDDDDSMMVDLPANSSFVLNITEDTPSPKRIGRTSEQISKKYTRDSGIALSDDDEDM # EFVESSTSSERLSTMPRASTSVSSLYSDIEDGLVTPGVGPRSSSAWPDFVIVNGPDDGGCDASEQDVDAFILRTLAAAAKSTYEAKKAPGTPVKKSKV # SYLARQRPWQSAMTHKVGFGAHAEEKMKKVPRKSMPASFPLVGRKHNRSVDPDTDSESDCDDSPSNRKEKYIGLGIGIPSLSKNGVSRNRWLMRRSSS # GAFSSSSESAGTPTRNRPLGDCLRPSGSPHLSKQTSPTHRSKLSPARSASSSSNGSVTSPSILRQLPIAGDQKYRAPRFSTRTRRLSQPSHQQRPGRF # EQQFVEIAEVGSGEFGKVLKVRTKDGNSDACFAVKKSKRFEGVKHRLRLREEVDTLQHLSHVTGGCGHPNILAFIDAWEEDEQLFIWTELCEGGNFAH # FLWEYGRVFPRLDQARVWKIIVELSNVSVTPTIRSLAHDGFPDHRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g703 ### # start gene g704 3 AUGUSTUS gene 2549919 2551171 0.34 + . g704 3 AUGUSTUS transcript 2549919 2551171 0.34 + . g704.t1 3 AUGUSTUS start_codon 2549919 2549921 . + 0 transcript_id "g704.t1"; gene_id "g704"; 3 AUGUSTUS CDS 2549919 2550412 0.43 + 0 transcript_id "g704.t1"; gene_id "g704"; 3 AUGUSTUS CDS 2550934 2551171 0.93 + 1 transcript_id "g704.t1"; gene_id "g704"; 3 AUGUSTUS stop_codon 2551169 2551171 . + 0 transcript_id "g704.t1"; gene_id "g704"; # protein sequence = [MPTHQGGMHVRHSSVDSRCYRLSPHGVTVSPSPSPMSAYHSSTIRSSLPDSRLVAFSTRPIYSPLPGPLPSPDYSFGV # ASSMPSLASPDSERNSPDHSHGLLFQREDLDAEDDASYDGYSRFGSITSIGTSDSSNSAYYSDVGNCVDPLSGVELGDASHQQHRRGYPPIALPSASI # EFAGNEYQFVAHQSSQDGANFGGSTSVAESYPVGVDAMGHEHFPNHGHNGSRDPDYNNFEDGSTSFM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g704 ### # start gene g705 3 AUGUSTUS gene 2552650 2554203 0.17 - . g705 3 AUGUSTUS transcript 2552650 2554203 0.17 - . g705.t1 3 AUGUSTUS stop_codon 2552650 2552652 . - 0 transcript_id "g705.t1"; gene_id "g705"; 3 AUGUSTUS CDS 2552650 2554203 0.17 - 0 transcript_id "g705.t1"; gene_id "g705"; 3 AUGUSTUS start_codon 2554201 2554203 . - 0 transcript_id "g705.t1"; gene_id "g705"; # protein sequence = [MSEEYSSNSGSLTSGSVSSSLTGSINMSSGSSMMFGGSSIISGNIGDAEATPVHRDRLELPLETETASLYPSFDRSRR # VKAQDETSTSRTTRTRSPITEPLTNDPEWRQALLQLLARTEEAPSASRLPIFPYVSTSRPLQRHVCLHLIGWGFILRDDSLMAEVRRWERESEGDEGY # ARAAAWLVFSGRYGGGAGVSNEGAVHGEGAIECLLRSEGAHFMFALSLLFSSTNSNPLPLRLDESHHMMSGVIAALVPFASATLTTPNSSSKLALPST # LLEHYARLVNKLQDSYLRALLTHLTAISSSVTPSGEHWLEILHDEEDLLPFYERLALAFCFLDDTALTTYLRRCREHALGKNGGDVDALIVTGLGTSE # GREVVGLWLDRIGDVQSAALLGWTGLSSSLGRERIPKLASDLKTKGQTSIQDSQVTRWVETYRDFLDSVKLFHCRVEFDIERGEMLQIAKDQKITNLA # PRQILIRCNYCNKTVTPNAEINLSESNNLGTGQDSIPRGKVITMQHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g705 ### # start gene g706 3 AUGUSTUS gene 2554805 2556309 0.29 - . g706 3 AUGUSTUS transcript 2554805 2556309 0.29 - . g706.t1 3 AUGUSTUS stop_codon 2554805 2554807 . - 0 transcript_id "g706.t1"; gene_id "g706"; 3 AUGUSTUS CDS 2554805 2555244 0.55 - 2 transcript_id "g706.t1"; gene_id "g706"; 3 AUGUSTUS CDS 2555397 2556309 0.44 - 0 transcript_id "g706.t1"; gene_id "g706"; 3 AUGUSTUS start_codon 2556307 2556309 . - 0 transcript_id "g706.t1"; gene_id "g706"; # protein sequence = [MNPFDNSNVVTIPHSKEPIGKFSTYPPIPRTDHPVRTDQRIVQAHAQTELISSLAWLPQNTHPYLLLAGLSPRWLRLF # DIRNPAGSGAGASYVSSIATKVTGIATDPFDTTRFATWGDGVVTVWDIRKLHISRIHSDSTNATPSPTPLLTFSEKDAGFDGVSSTLAPGASKPSVAS # SSTSSKTRGVSATDFPNLPVVQHSTYMTAEFSPSRRGVLVTLAKDANYVRLWDVLEVDNSPISREVDNVDENIIKLQDKVPAGRKSWANLPWGSSGTS # TESKNPSPIHEEEHREQSQHPMLILYNTRKGEITVQSVHDAPQALAWSSRGDMLYGPLQSVDKDDVIGFGVVHSYHEEQEETVKDEYIHDSQTSPSVT # KPSTNQKPFRASEPNELHERGRPRNPITFREVPPSPALFGRGDAEGFPALSRPISENPVSANLAATKPTDGRKEEERK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g706 ### # start gene g707 3 AUGUSTUS gene 2558581 2559507 0.99 + . g707 3 AUGUSTUS transcript 2558581 2559507 0.99 + . g707.t1 3 AUGUSTUS start_codon 2558581 2558583 . + 0 transcript_id "g707.t1"; gene_id "g707"; 3 AUGUSTUS CDS 2558581 2559507 0.99 + 0 transcript_id "g707.t1"; gene_id "g707"; 3 AUGUSTUS stop_codon 2559505 2559507 . + 0 transcript_id "g707.t1"; gene_id "g707"; # protein sequence = [MSQRIRDLENALSTLQSSISTSPYPEITNSLQEIRKPETFDALGTLTLDKRGDARYLGRSAGLEVNVVSSRIWHPYNK # SHGQSLLEDGPELPEIEHEEDEDDHNLAVSEEIAQLPKYFPFASDCSWDVGLSLQLILSYLPPKERAWTLAENFIEHSPLQINVVPREELFDELLTPI # YQYASAMDFAGQKCPLSPTRVGVLFICFAHGSMADIGIPMYCAESEDYLRLSRISLSLHPIISSPDLASVQALTLIGMFHDTGGRSYNIEAAWSFLTI # ASKLSQSVSLNQQLTDIPDAKSESFTARVTCVLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g707 ### # start gene g708 3 AUGUSTUS gene 2560595 2561546 0.48 + . g708 3 AUGUSTUS transcript 2560595 2561546 0.48 + . g708.t1 3 AUGUSTUS start_codon 2560595 2560597 . + 0 transcript_id "g708.t1"; gene_id "g708"; 3 AUGUSTUS CDS 2560595 2560633 0.48 + 0 transcript_id "g708.t1"; gene_id "g708"; 3 AUGUSTUS CDS 2560701 2561546 0.51 + 0 transcript_id "g708.t1"; gene_id "g708"; 3 AUGUSTUS stop_codon 2561544 2561546 . + 0 transcript_id "g708.t1"; gene_id "g708"; # protein sequence = [MGANHSDKAKRGLMHEKATNVYESQANSMSDEMNVAQEDMDALHTLEMFAGYTKLLMKDMASNPRMFSDKAVSRSLNP # DSNNGSFVGSGPQRNDLSQEQYEANFLPRSSSFRTVMPSATTYHDTDPDASPSIEHSHSAVSFLRTNEPVDQVLNHQHPYSAHTGHEHNFVSSSSIAP # TVYSYENDRHAAHSFGMSSQVAYGMNSYSQYVDHGEHWTDTRSQYDSSVYPLFKREDKFDNQSSSYPDSHFWPPMSERNDTSQHPGRLPLATTVGAMN # FQWAELVQDEGLTVLQRVQM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g708 ### # start gene g709 3 AUGUSTUS gene 2561639 2561959 0.83 - . g709 3 AUGUSTUS transcript 2561639 2561959 0.83 - . g709.t1 3 AUGUSTUS stop_codon 2561639 2561641 . - 0 transcript_id "g709.t1"; gene_id "g709"; 3 AUGUSTUS CDS 2561639 2561959 0.83 - 0 transcript_id "g709.t1"; gene_id "g709"; 3 AUGUSTUS start_codon 2561957 2561959 . - 0 transcript_id "g709.t1"; gene_id "g709"; # protein sequence = [MTQIQEQLTLVRSSLVPSLEKFLQTLPTQSNTTIPFDSTSNPPTSPASIHKEHARLSEMLLQSLLTLDAITVDGEWVQ # ARQERKTAVREVQGYLDQLDAAWNSRVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g709 ### # start gene g710 3 AUGUSTUS gene 2563629 2564335 0.31 + . g710 3 AUGUSTUS transcript 2563629 2564335 0.31 + . g710.t1 3 AUGUSTUS start_codon 2563629 2563631 . + 0 transcript_id "g710.t1"; gene_id "g710"; 3 AUGUSTUS CDS 2563629 2563738 0.32 + 0 transcript_id "g710.t1"; gene_id "g710"; 3 AUGUSTUS CDS 2564074 2564335 0.8 + 1 transcript_id "g710.t1"; gene_id "g710"; 3 AUGUSTUS stop_codon 2564333 2564335 . + 0 transcript_id "g710.t1"; gene_id "g710"; # protein sequence = [MCLSIIAVRSNYVILEYLVNWRRVLPKLTSGAKHTWLCLVKVPDGRATYAELLEHDFIQRDEAKANAENGDAVDMAGW # LSKALQFREAKIAHVQALAAAALAPSAPPGHPVLSAPATTRIRLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g710 ### # start gene g711 3 AUGUSTUS gene 2566805 2569217 0.63 + . g711 3 AUGUSTUS transcript 2566805 2569217 0.63 + . g711.t1 3 AUGUSTUS start_codon 2566805 2566807 . + 0 transcript_id "g711.t1"; gene_id "g711"; 3 AUGUSTUS CDS 2566805 2568659 0.64 + 0 transcript_id "g711.t1"; gene_id "g711"; 3 AUGUSTUS CDS 2568805 2569217 0.97 + 2 transcript_id "g711.t1"; gene_id "g711"; 3 AUGUSTUS stop_codon 2569215 2569217 . + 0 transcript_id "g711.t1"; gene_id "g711"; # protein sequence = [MGAKFTPSMSSKNTVLIAAQLVNLFPLSDDISCTTRADGTKTERARAWGIPIVNHLWLEDCFINWKNMTVGNDRYIHF # PQGSDFASRLGERGLEPSIEDLAELDRLEEEDADQEAQEQGEPVSVAVSASRTQDSARDAREAADIVMGADNDPYLGQENEGHAMVVDVEPEPAKHTP # RTPVSSKSKPRPRPQAIHRKDDDDNDLNSSPSKMPKQSPPKSSSRRSRIVETDEPQMDSDYHVSSEKENRHVSNRDEEEQEMEKRPVASKKKVKVQDP # TNFSSRWRTTNTAGSSDCEGDFDADLPPVTKANVKNNIKAAMKRARYASGDESDNGGNDISEKEDSPESEDDDVVTPSKKKRVQPSRPNAVRPKARGR # ETEDSDVPRRVSMKANAVPKAKPKTVPSPKQLSVVMPRLAKSTASAGPPSPSKTLAKSSSVHVASAERRARPSTSLPNTFDSPASGRPSRRAAERASQ # QLRDTIMPDVVRFESEMKKHRRHSSSSVSAFPRDRDEPDQEEEKPAANGKSKTKPKEDFGVIAGKKRKVSSRDMREVEESDMPADAASPPKKVRKRKP # GSVRVMTTQVNLTDATKKVLWSRLTFRSLCLSVSQAMEKLGAKFVTKPSESLDFQLIFIAAEEPFFLKDRGKWDIDLKKSLEEAKKSKYPLLANRVFY # VTPGVKEDRSLLNNVITAFGGKMVACMPNDRQLLSNGKQISMRHLLTCEDDRELWEPIAKDAYIHNVELLLQGVLNQFMDFDNPKFHIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g711 ### # start gene g712 3 AUGUSTUS gene 2569364 2570491 0.97 + . g712 3 AUGUSTUS transcript 2569364 2570491 0.97 + . g712.t1 3 AUGUSTUS start_codon 2569364 2569366 . + 0 transcript_id "g712.t1"; gene_id "g712"; 3 AUGUSTUS CDS 2569364 2570491 0.97 + 0 transcript_id "g712.t1"; gene_id "g712"; 3 AUGUSTUS stop_codon 2570489 2570491 . + 0 transcript_id "g712.t1"; gene_id "g712"; # protein sequence = [MSEADLGYSEGSFDLPRWQTHVDLSSSAQAAHSAQAAYYASPLPPPPPSASTNRPPRLNALVDQDYSPQPLSRSASLG # GNRNIRRHHLPDELEPAPMSAYPSSTPNSFYPQAPRSPLRTPNTAVMLDPYSPQQSPYQQSHSRNHSREYETSLSPNQHQLRKPSISNPPTPLSYLPD # PMLVDPTPPPPRRRPHGLRRVRGPTDLQPRLDVAPSGHRMGSDGSYLSPLQHLTTNILDTYRICNPQFRYESTHNPRRVLTKPSKPAHNEGYDNDDYD # YILYVNDWLGTEEGHKYVDYPFCSQARPHALSRYLILDILGQGTFGQVVKCQNMKTHEIVAVKVVKNKPAYFNQSMMEVTILELVRRHMVWPSRSSDT # LDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g712 ### # start gene g713 3 AUGUSTUS gene 2571811 2573282 0.59 + . g713 3 AUGUSTUS transcript 2571811 2573282 0.59 + . g713.t1 3 AUGUSTUS start_codon 2571811 2571813 . + 0 transcript_id "g713.t1"; gene_id "g713"; 3 AUGUSTUS CDS 2571811 2571813 0.59 + 0 transcript_id "g713.t1"; gene_id "g713"; 3 AUGUSTUS CDS 2571897 2573282 0.84 + 0 transcript_id "g713.t1"; gene_id "g713"; 3 AUGUSTUS stop_codon 2573280 2573282 . + 0 transcript_id "g713.t1"; gene_id "g713"; # protein sequence = [MVYTAQAQAQAQQQREYRNPYLAPGPAGQNQSQPPSSQVPSHDGYGLPTNPAQLTQPPPPVHHRLMHQTSTGHLNMNS # SSSMPQFPGSGSGGGAGSNSYYTSNSMQSSSQQSPASSTSSRGRANTINQMDAAIPPALARLQHMNQDVIQGRNALTPVLNRDDAMREWERRQSGKGG # PPPPNAYSRELEYLQQQAELAASGAVGGGQWGGSGTGMGGMFPSIGRYHAGHTQAPSKLSHGYSANLPPILVDDSESASASSGNARRDAIMSNVRSAA # RGDGAGAALYGGAGSVISSPPQAYTGGTATPGNRYTLTYNSQPPLQSTGVPLSSSHPPSLQPQHNSPQTPFDSVDRRTDIGSMYVPMQTDVSGAGGYG # PPSGSYSNHGSSAMNARHIGPSAQNVAPSFYGAGVAGALPPMVGTQSMPGSVGSINPLQQQQRPAFGEMSPSSGSLKDSRRASGMDAWPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g713 ### # start gene g714 3 AUGUSTUS gene 2575283 2575633 0.47 - . g714 3 AUGUSTUS transcript 2575283 2575633 0.47 - . g714.t1 3 AUGUSTUS stop_codon 2575283 2575285 . - 0 transcript_id "g714.t1"; gene_id "g714"; 3 AUGUSTUS CDS 2575283 2575633 0.47 - 0 transcript_id "g714.t1"; gene_id "g714"; 3 AUGUSTUS start_codon 2575631 2575633 . - 0 transcript_id "g714.t1"; gene_id "g714"; # protein sequence = [MLDDSDQGVKDPGRFLPSQNGYSQPALSVPPSVLVRLTMIPTKVHYIASDNPSIPAFALQITQIVDSYMLWASPTELF # EGDVERAPLSGNLCRDWACAMPPKAVSWIDMIGICYDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g714 ### # start gene g715 3 AUGUSTUS gene 2576107 2576637 0.52 + . g715 3 AUGUSTUS transcript 2576107 2576637 0.52 + . g715.t1 3 AUGUSTUS start_codon 2576107 2576109 . + 0 transcript_id "g715.t1"; gene_id "g715"; 3 AUGUSTUS CDS 2576107 2576637 0.52 + 0 transcript_id "g715.t1"; gene_id "g715"; 3 AUGUSTUS stop_codon 2576635 2576637 . + 0 transcript_id "g715.t1"; gene_id "g715"; # protein sequence = [MRMDAIQEALAEKKPDSRANGSNQFTTPSSNLRAQAVKTPGQLRRDEEINRALGTPTRQSTQLQRNDANVFQSSQPPP # ANFKLTPLSQESSIHSDEDDPFDNLPLTPPTSQRYKRSRDQESNEESEPDSFRSSPSRNKGKKKANLAHDWVRYIRVRICEGNKHYENIDHPDYFYER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g715 ### # start gene g716 3 AUGUSTUS gene 2581893 2582943 0.8 + . g716 3 AUGUSTUS transcript 2581893 2582943 0.8 + . g716.t1 3 AUGUSTUS start_codon 2581893 2581895 . + 0 transcript_id "g716.t1"; gene_id "g716"; 3 AUGUSTUS CDS 2581893 2582174 0.8 + 0 transcript_id "g716.t1"; gene_id "g716"; 3 AUGUSTUS CDS 2582227 2582943 0.94 + 0 transcript_id "g716.t1"; gene_id "g716"; 3 AUGUSTUS stop_codon 2582941 2582943 . + 0 transcript_id "g716.t1"; gene_id "g716"; # protein sequence = [MAQTSWLSSAIHGERTSRSDLYENSSSSSVAPRPIPPPSDISRWDLAEILNPTSAFRERKLSMDFTSGSAGPQHSVYG # QSEIDHPFSALHTSDPDHSSYDLFSHSAPNSFGARYRNASSSSLGGNYAGLNGDSLYSQQSFNDSVPSFGSSNGNPYDMIHSLPSSYGSGKVSPLTPS # DPVGPLHPPFPVGGKDFTSSNFPDFTPDRRLSSVSSGTYGSDLSDDFAMNNGNLPFPSSALQHFSERLGRFQSGANSGISPISPTAHSPDILRGVAPH # ATHGYRPDNGMNGFDEMQYMGNPHGDYRMSGVDEQLARVGLRGPSIMGTSSDLSTFIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g716 ### # start gene g717 3 AUGUSTUS gene 2583862 2585188 0.3 + . g717 3 AUGUSTUS transcript 2583862 2585188 0.3 + . g717.t1 3 AUGUSTUS start_codon 2583862 2583864 . + 0 transcript_id "g717.t1"; gene_id "g717"; 3 AUGUSTUS CDS 2583862 2584660 0.84 + 0 transcript_id "g717.t1"; gene_id "g717"; 3 AUGUSTUS CDS 2584717 2584840 0.3 + 2 transcript_id "g717.t1"; gene_id "g717"; 3 AUGUSTUS CDS 2584897 2585188 0.69 + 1 transcript_id "g717.t1"; gene_id "g717"; 3 AUGUSTUS stop_codon 2585186 2585188 . + 0 transcript_id "g717.t1"; gene_id "g717"; # protein sequence = [MYIVDVNKPTGGIDVPPPPALQPDYPSPPPNAIPFTNNGSQIPIYYNQTVVLQCLTSGVVSPVLIIRKVDHQTTVVGG # GLQEGAKGVADHFCAPGEVCGDPVSQLHKIAFEVYDGAKGMPEPGTPGITGAFLSCMGEKVNTYRPIDGRQWNSGGSNSGNSPVASPVSSTPVSSNGS # EYFGHNLDSAPESPSSPDFLSNDGGRVKKKRGTSSAGGPSKNPTKGRRRPSSAGSVTSGRRGSTSDSGAASGALWQVDIGETSVWTIVGTDQIRYNFY # VPPVLFDAQHAPQTGSFPIPSKPVTPFPGVVKYLPPDRAAEAPKANCSSSRSMLSKPNPHASKMLTVYGENFSKSDPVSVFFGHEPSPYVEVRCTEVL # GCLPPEQQIAKRRPIILIRPDGVVFPSNTMYP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g717 ### # start gene g718 3 AUGUSTUS gene 2586817 2588775 0.16 - . g718 3 AUGUSTUS transcript 2586817 2588775 0.16 - . g718.t1 3 AUGUSTUS stop_codon 2586817 2586819 . - 0 transcript_id "g718.t1"; gene_id "g718"; 3 AUGUSTUS CDS 2586817 2587128 0.98 - 0 transcript_id "g718.t1"; gene_id "g718"; 3 AUGUSTUS CDS 2587238 2587363 0.8 - 0 transcript_id "g718.t1"; gene_id "g718"; 3 AUGUSTUS CDS 2587647 2588235 0.56 - 1 transcript_id "g718.t1"; gene_id "g718"; 3 AUGUSTUS CDS 2588771 2588775 0.21 - 0 transcript_id "g718.t1"; gene_id "g718"; 3 AUGUSTUS start_codon 2588773 2588775 . - 0 transcript_id "g718.t1"; gene_id "g718"; # protein sequence = [MYNDVKEEEEVDNKKPEEKLEFFVHWDQFNKRLDDWVSGTRILLHRDLEWPRPKAPPVKKALNGTPKVPPGKAPPGKA # HRPNNLLKAATSNAALGASPAPTPQHSQLFSISRASPSPAPPSLKRKVPHDEEEEPTEEAYDFDADADGDMEIDGDGDLETFDLSLTDTGPDSQEPPP # FSAFSKEQEIEKLRTSGSLTQSSIVKVFFRSVSFNSMTHRSPTQFALFSKTLYYDVTPFMYYVMESAENYNVACILTLPHHQRHGYGKLLIEFSYELS # KKEGKLGSPEKPLSDLGLLSYRAYWSEVVVELLMEWDGDISIDEVAQKTSITHADVMNTYVMCLSTACS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g718 ### # start gene g719 3 AUGUSTUS gene 2589321 2591901 0.5 - . g719 3 AUGUSTUS transcript 2589321 2591901 0.5 - . g719.t1 3 AUGUSTUS stop_codon 2589321 2589323 . - 0 transcript_id "g719.t1"; gene_id "g719"; 3 AUGUSTUS CDS 2589321 2591277 0.98 - 1 transcript_id "g719.t1"; gene_id "g719"; 3 AUGUSTUS CDS 2591891 2591901 0.5 - 0 transcript_id "g719.t1"; gene_id "g719"; 3 AUGUSTUS start_codon 2591899 2591901 . - 0 transcript_id "g719.t1"; gene_id "g719"; # protein sequence = [MDPLLKAKRGAKRKNRNEQPSNPGKPHNIQTEIEEPQRKRPRVEKPPAQSASKEHPHVQSHPPTQIISSLFSYNPKVQ # TPVNPDPSKVPSAPSNAPLTDASSFSGLGLNPLISAHLSSKMGIQKPTSIQRAALPVTLSVSPDVMARDIFIQSQTGSGKTLSFLLPIIQDLLPLSSL # SYIDRSLGTLAIIIVPTRELAKQISDVLESLLYLRLRATDESADDSNTVRLTRWLVSGLLIGGGTRTHEKARLRKGLPILVATPGRLLDHLQNTSTFN # VSKCRWLVLDEADRLMELGFEESITGILKCLDGHRKLALQAVREGIGKEVGGWDWERRRRTILCSATIREDVQKLANTTLTRPIMIKATEVEIPSGLT # ASKTVHALENFSPPSQLSQKYVITPLKLRLVVLVALLRNMISQRRGQPGSKAIVFLSCTDAVDFLWKMLGGSLMDGEDIERAEQESNVEDNSDDVDEG # QIESKSEQISLKSSLLPDTSVFRLHGSLPTQTRLATLRGFSGSSKRTAPFSVLLCTSVASRGLDLPLVWSVIQYDLPTEGGATEYVHRVGRTARAGKG # GEAWSFVSPSEVAWVQWVEGKMRSDSSESEKQNISLIPVTPESVLKLGFGGKGSEYEERATQVQLSFERWVLRSKEVRLSPHHAIRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g719 ### # start gene g720 3 AUGUSTUS gene 2595215 2596765 0.4 + . g720 3 AUGUSTUS transcript 2595215 2596765 0.4 + . g720.t1 3 AUGUSTUS start_codon 2595215 2595217 . + 0 transcript_id "g720.t1"; gene_id "g720"; 3 AUGUSTUS CDS 2595215 2595424 0.4 + 0 transcript_id "g720.t1"; gene_id "g720"; 3 AUGUSTUS CDS 2595845 2596765 0.8 + 0 transcript_id "g720.t1"; gene_id "g720"; 3 AUGUSTUS stop_codon 2596763 2596765 . + 0 transcript_id "g720.t1"; gene_id "g720"; # protein sequence = [MRVSQKTVPPKSPVKPGKGVKFVPAAGRMPVAHGKTNVEPEPRVKIEDKLDDAQLDRLATGVPVDSETTAGYGGMLMD # HYKMHIRKTYPRMNHFLTYADNYAVGYFEKQGFSKEITLDRSVWAGYIKDYEGGTIMQCTMLDKVDYLDKANILAQQQDAIMSKVRQMSRSHIVHAGL # PQFQESAPVGVTVDPQDVPGLRAPVSLHLDDIRLKYIQVKLDGPRPWLKSQFCLYPCPQQHQLIFYSLARLLPKSPDQHFMDRLLKDLQEHNQAWPFL # KPVTAEDVPDYHDIVLKPMGTSLLALAKIRPFLTAWHVDFSTMEHKLDNNQYQAVEDFVSDARLVFDNCRLYNLEDSVYHKCANTLEKFLNEQLKERI # KRES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g720 ### # start gene g721 3 AUGUSTUS gene 2597625 2598524 1 + . g721 3 AUGUSTUS transcript 2597625 2598524 1 + . g721.t1 3 AUGUSTUS start_codon 2597625 2597627 . + 0 transcript_id "g721.t1"; gene_id "g721"; 3 AUGUSTUS CDS 2597625 2598524 1 + 0 transcript_id "g721.t1"; gene_id "g721"; 3 AUGUSTUS stop_codon 2598522 2598524 . + 0 transcript_id "g721.t1"; gene_id "g721"; # protein sequence = [MSSDLATDTPTLDEYHPQFCSPEADIVLRSLEGTLYRVPSFVLRSASGFWNALLSISPQTPASTSSPLPTSQHNDILE # PMLRLMSGLPIPSWTPDPESVDSDEKCISEIENLLLLAESWDAPGPLSFLRFGITAPMFLEQPLRLYALATHFGWVPEAKVASKHSLGLNLYDDEHEE # VLKRLSAKDLLILLRLHRARRDQMKMFLDDQDVFTLGNSESSRCVACNNEVDNSAWRELKARIFQEMDRCSKGDFVGSWEMEEWKETDRCWKVKCGKC # AALLYHKGQTIRKMKEGLSILPDTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g721 ### # start gene g722 3 AUGUSTUS gene 2602731 2603057 0.54 + . g722 3 AUGUSTUS transcript 2602731 2603057 0.54 + . g722.t1 3 AUGUSTUS start_codon 2602731 2602733 . + 0 transcript_id "g722.t1"; gene_id "g722"; 3 AUGUSTUS CDS 2602731 2603057 0.54 + 0 transcript_id "g722.t1"; gene_id "g722"; 3 AUGUSTUS stop_codon 2603055 2603057 . + 0 transcript_id "g722.t1"; gene_id "g722"; # protein sequence = [MKEKEYVVNHVYVAVISESITAIMADKGGGAYGTKAADTDFRKKWDKEEYTERAKKRDLEEKERMQENEERMKQGENI # PYLYILSLMHICQERGPEKGQNRISQSPQN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g722 ### # start gene g723 3 AUGUSTUS gene 2603108 2603580 0.8 + . g723 3 AUGUSTUS transcript 2603108 2603580 0.8 + . g723.t1 3 AUGUSTUS start_codon 2603108 2603110 . + 0 transcript_id "g723.t1"; gene_id "g723"; 3 AUGUSTUS CDS 2603108 2603225 0.8 + 0 transcript_id "g723.t1"; gene_id "g723"; 3 AUGUSTUS CDS 2603282 2603580 1 + 2 transcript_id "g723.t1"; gene_id "g723"; 3 AUGUSTUS stop_codon 2603578 2603580 . + 0 transcript_id "g723.t1"; gene_id "g723"; # protein sequence = [MVVQNPGGRGSGQPGFHCEACNRTYKDTTGYLDHINSRAHLRALGQSTRLERSTLEQVRARIALLREKTKEATNAKAY # DFDQRLAEVRAKETAIREEKKAQKKAQKEKLLVNALAANNPENDEMAKLMGFGGFGSSKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g723 ### # start gene g724 3 AUGUSTUS gene 2603656 2604336 1 - . g724 3 AUGUSTUS transcript 2603656 2604336 1 - . g724.t1 3 AUGUSTUS stop_codon 2603656 2603658 . - 0 transcript_id "g724.t1"; gene_id "g724"; 3 AUGUSTUS CDS 2603656 2604336 1 - 0 transcript_id "g724.t1"; gene_id "g724"; 3 AUGUSTUS start_codon 2604334 2604336 . - 0 transcript_id "g724.t1"; gene_id "g724"; # protein sequence = [MELLVFHPDEQYLADIRPLQRYIESELNVRDVIFSSDERLSGVRYRAVADWGVLGKKLRKDIGRVKRALPDVSSDRVK # EYISTGKMDVDGITLVEGDLAVQRYLELPSSGIGQYGTHTDNDVVVRLDIQIHADLQGEWLARELINRIQKLRKKAGLQATDDVELYYSLEGSTGAAL # LNAMEQYAEFIRKTVGNVPINDNQRKSGTELIREEQEIVDVKFELILVRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g724 ### # start gene g725 3 AUGUSTUS gene 2606220 2607579 0.49 - . g725 3 AUGUSTUS transcript 2606220 2607579 0.49 - . g725.t1 3 AUGUSTUS stop_codon 2606220 2606222 . - 0 transcript_id "g725.t1"; gene_id "g725"; 3 AUGUSTUS CDS 2606220 2606456 0.99 - 0 transcript_id "g725.t1"; gene_id "g725"; 3 AUGUSTUS CDS 2606516 2606802 0.96 - 2 transcript_id "g725.t1"; gene_id "g725"; 3 AUGUSTUS CDS 2606855 2607225 0.77 - 1 transcript_id "g725.t1"; gene_id "g725"; 3 AUGUSTUS CDS 2607554 2607579 0.62 - 0 transcript_id "g725.t1"; gene_id "g725"; 3 AUGUSTUS start_codon 2607577 2607579 . - 0 transcript_id "g725.t1"; gene_id "g725"; # protein sequence = [MSLAPHDSQFGWDTHGLPVEHEIDKKFGITGKDDVMAMGIDKYNAECRNIVMRYSNEWRNTVERMGRWIDFDNDYKTL # NISFMESVWWAFKELFKKGLVYRGLRVMPYSTGLTTPLSNFEAGLDYRDINDPAVTIAFPLVDDPATSLLAWTTTPWTLPSNLALCVHPDFTYIKIHD # AEKDQNFILHENLLSTLYKDPKKAKYKKLGQFQGSDMKGWRYIPLFEYFTEQFEDKAFRVVVDTYVTASDGTGIVHQAPAFGEDDHRIAIANGVLSPE # EMPPCPIDDKGNFTKEVPDFAGENFKVHNFLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g725 ### # start gene g726 3 AUGUSTUS gene 2611283 2612223 0.33 - . g726 3 AUGUSTUS transcript 2611283 2612223 0.33 - . g726.t1 3 AUGUSTUS stop_codon 2611283 2611285 . - 0 transcript_id "g726.t1"; gene_id "g726"; 3 AUGUSTUS CDS 2611283 2611522 0.46 - 0 transcript_id "g726.t1"; gene_id "g726"; 3 AUGUSTUS CDS 2611574 2611613 0.64 - 1 transcript_id "g726.t1"; gene_id "g726"; 3 AUGUSTUS CDS 2612011 2612053 0.65 - 2 transcript_id "g726.t1"; gene_id "g726"; 3 AUGUSTUS CDS 2612172 2612223 0.69 - 0 transcript_id "g726.t1"; gene_id "g726"; 3 AUGUSTUS start_codon 2612221 2612223 . - 0 transcript_id "g726.t1"; gene_id "g726"; # protein sequence = [MFNESNQAKLLDHSQRQVVSLLLSDAMFVYFLDYDEIKRELDIMKFVEFAGFEDEPEDDQIQIQDHELGVHLPNPNAD # KANAQQGKSLEALLASKNKRLLEELTKFRVCIIILNLSDYFSTIKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g726 ### # start gene g727 3 AUGUSTUS gene 2613323 2614375 1 + . g727 3 AUGUSTUS transcript 2613323 2614375 1 + . g727.t1 3 AUGUSTUS start_codon 2613323 2613325 . + 0 transcript_id "g727.t1"; gene_id "g727"; 3 AUGUSTUS CDS 2613323 2614375 1 + 0 transcript_id "g727.t1"; gene_id "g727"; 3 AUGUSTUS stop_codon 2614373 2614375 . + 0 transcript_id "g727.t1"; gene_id "g727"; # protein sequence = [MNILRSQAFSVLRRPLCRRLATTRPFVPPVQAQLVFHDTLFAPGAKELDDNTVDALEAETNEREFEDDDFDANNFQDK # AHPDSPNFYTGRSSYYDNIVELQNAISRTRGTLQRLHLLPLPEFAWKCLKPMPTVWKTPEEMTTDFETAMTISRYRKVTALLNELNEYLRIATTAGYA # DVADRIGSIISIFESGKKEAFLARGVRKPVQLDQYGRSYTFGKRKTSAARVWMIPVKPLSHESGSDVNVEEAFGLSDKPRRPPVNVTVSTILINNLPI # AEYFPQPVDRERIVRPLKIAGVLGKYNVFTIVRGGGTTGQSGAVAHGIAKGIFAHEPETGAILKRGMFILVQSFLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g727 ### # start gene g728 3 AUGUSTUS gene 2614959 2616064 0.11 - . g728 3 AUGUSTUS transcript 2614959 2616064 0.11 - . g728.t1 3 AUGUSTUS stop_codon 2614959 2614961 . - 0 transcript_id "g728.t1"; gene_id "g728"; 3 AUGUSTUS CDS 2614959 2615162 0.64 - 0 transcript_id "g728.t1"; gene_id "g728"; 3 AUGUSTUS CDS 2615232 2615354 0.46 - 0 transcript_id "g728.t1"; gene_id "g728"; 3 AUGUSTUS CDS 2615418 2615435 0.48 - 0 transcript_id "g728.t1"; gene_id "g728"; 3 AUGUSTUS CDS 2615738 2616064 0.18 - 0 transcript_id "g728.t1"; gene_id "g728"; 3 AUGUSTUS start_codon 2616062 2616064 . - 0 transcript_id "g728.t1"; gene_id "g728"; # protein sequence = [MNVRETETRLASHEEVLAKLNHDHPNVAQYVQSEVEARQKLAEVTAQLTQYQNLYGEFSSVQPDSLANELQHKEDELR # RLRLLNAQHAQVGSLVSVVRLFTEEISGRKCRLNGLLDELSKHKAYCQEAHDNAVKQLSLKSLELHERASEGTKTAHIIDKFQREHHSRQEALRKEME # AMSAAKMALEKERLALQSKAKFDSTRHQHKTEDPDAGLMVRSIGFRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g728 ### # start gene g729 3 AUGUSTUS gene 2618240 2619373 0.97 - . g729 3 AUGUSTUS transcript 2618240 2619373 0.97 - . g729.t1 3 AUGUSTUS stop_codon 2618240 2618242 . - 0 transcript_id "g729.t1"; gene_id "g729"; 3 AUGUSTUS CDS 2618240 2619373 0.97 - 0 transcript_id "g729.t1"; gene_id "g729"; 3 AUGUSTUS start_codon 2619371 2619373 . - 0 transcript_id "g729.t1"; gene_id "g729"; # protein sequence = [MPEEPTDLFDMAHVFAGGRVETVSDQHFGIGSNLILPGRGKNMGDGWETKRSRLPGHKDWAIIKLYVFSTKGFLILDG # RFLNRGAPGFLEQVELDTAHFKGNFPESCEIHALTSASNVVWTMEHSESDNWTLILPRTRLGPHRQHYFQLENVGGTPFTHVKLTIYPDGGLKRVRIL # GRRTDTKTTIKAASVPTELDSVPTSTPIIIKKPMLQSTIPVLPLTPEGFAPFGQVIQAYGDHTAAPKGTKITQANAGTASKFHNLSLLVSSYPHNSGA # TAGLSVYRCQPLKDINAIEGTTELTILERHPFTNQGFIPMGGGQGEGLSDSGHRYLVVVAKNGEDDKPDVRTLRAFMASTAQGIVYNTGIWRKSWSSL # KYLMD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g729 ### # start gene g730 3 AUGUSTUS gene 2620454 2622857 0.44 + . g730 3 AUGUSTUS transcript 2620454 2622857 0.44 + . g730.t1 3 AUGUSTUS start_codon 2620454 2620456 . + 0 transcript_id "g730.t1"; gene_id "g730"; 3 AUGUSTUS CDS 2620454 2620516 0.45 + 0 transcript_id "g730.t1"; gene_id "g730"; 3 AUGUSTUS CDS 2621976 2622857 0.98 + 0 transcript_id "g730.t1"; gene_id "g730"; 3 AUGUSTUS stop_codon 2622855 2622857 . + 0 transcript_id "g730.t1"; gene_id "g730"; # protein sequence = [MDAVRDRTALDIDSDGRQETYSIQCVYDTIEQLKRTNKNPQNTTTNVAETPRPSTPAPQQEQPQPHLSTCQHLLKHPF # TLFSTSPSIADPILQESPTFEVPFDSNFPFGSEAANLEYSILSAILGNPSPPQGDSTPPPTYSGWPSSDPLIASQSPTFSSTFPTSLSSNLAASPTTA # YLTYQYQEPPRTSELSEVQYPPFQQSVNTPNTTTQPLQSRYSLESRAKSPPYSVFIDETSHGLLSPPHSNASPSLTPSVVRSTDSVASASICTPSSKL # QSIHDRVTKPYDYTEGYHFLMKHLPIRCVLSLKTNQTRVF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g730 ### # start gene g731 3 AUGUSTUS gene 2625992 2627722 0.86 - . g731 3 AUGUSTUS transcript 2625992 2627722 0.86 - . g731.t1 3 AUGUSTUS stop_codon 2625992 2625994 . - 0 transcript_id "g731.t1"; gene_id "g731"; 3 AUGUSTUS CDS 2625992 2627454 0.98 - 2 transcript_id "g731.t1"; gene_id "g731"; 3 AUGUSTUS CDS 2627506 2627722 0.86 - 0 transcript_id "g731.t1"; gene_id "g731"; 3 AUGUSTUS start_codon 2627720 2627722 . - 0 transcript_id "g731.t1"; gene_id "g731"; # protein sequence = [MAALRSSLPAADAQSFKQNVVADWAVDFLTQQPMQASSPQPLAAAATQSTVSSMHSSAASSTTQAVNMIRPAQVMPFG # SMWNATMQFIPSANSFQATTVPRSVLPDTRTLVCSILKKNISHVPDLELSWYKEFDAQQSDSVPTEGLSNANAQEEAPQSFREQDELSRTAGLLLETV # KTEKNPKFQNSIFMNLMTQLRDQKVVVRGNEMVENDGTHTVGQDSRVDVKGKGKGKASDSPFIPYAGLVSTLGQTIGNNATMAGVSPYNEQIDIQEDA # NDAYFRQENEDYTRYWNGMDPRKSQRQTVEVDLNWDKLQTDWEKFEASTKGITPVVSYQFQKNNPYLRGDSLRMRHHSMHSDDRLEVCSHSFHGDFLF # MLNQIQTVLALEAAVQQDMSNASAWFELGVKQQEHERETQALQALKRATELDPSYLPGWLALAVSYTNDGRRLEAYEAIREWVLRNDDHRDILQQHLS # QHPSSEEATIQEKFKQLVQCLITMAQQSAFGQIDADIQIALAVLFNSNEVRYSVVRSDSWAGEIDYPSSCRNMERLKTVLERHFLFVLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g731 ### # start gene g732 3 AUGUSTUS gene 2628828 2629277 0.63 - . g732 3 AUGUSTUS transcript 2628828 2629277 0.63 - . g732.t1 3 AUGUSTUS stop_codon 2628828 2628830 . - 0 transcript_id "g732.t1"; gene_id "g732"; 3 AUGUSTUS CDS 2628828 2629277 0.63 - 0 transcript_id "g732.t1"; gene_id "g732"; 3 AUGUSTUS start_codon 2629275 2629277 . - 0 transcript_id "g732.t1"; gene_id "g732"; # protein sequence = [MSTFHQLMTLDQSSTNFTQPPIPTAGPATEPDGPRSFAFVPTLGILVPHPPPPVIQVQRQDTLGQDPANAIVDASGSV # VGNFNTGAGANHYPSSAGVPRLPPILQVEKQQVTTSATQLASASRRRNEANFACPVPGCGSTFTRRFNLRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g732 ### # start gene g733 3 AUGUSTUS gene 2629430 2630136 0.19 - . g733 3 AUGUSTUS transcript 2629430 2630136 0.19 - . g733.t1 3 AUGUSTUS stop_codon 2629430 2629432 . - 0 transcript_id "g733.t1"; gene_id "g733"; 3 AUGUSTUS CDS 2629430 2629918 0.32 - 0 transcript_id "g733.t1"; gene_id "g733"; 3 AUGUSTUS CDS 2629972 2630136 0.2 - 0 transcript_id "g733.t1"; gene_id "g733"; 3 AUGUSTUS start_codon 2630134 2630136 . - 0 transcript_id "g733.t1"; gene_id "g733"; # protein sequence = [MSSVDASHAENIAAMKRERDKLARESEDDWVQLVLFAEWSHGYLQMAALIPEAKVVIEDLGEWIDDVFLRYSGKENGE # DEGPTAELGFTKPASPRRELKSNNNKRQPSPFTCETENDDSGIIFVAKKDKRTSSNDRGMIDIGSERTDSTKVDPTKPAKVDVKTEAEEEKTIGPDAD # DEYEVGNIEGMRTSSSRQGGQIISESELMRRRRLLDSHIFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g733 ### # start gene g734 3 AUGUSTUS gene 2635871 2636215 0.4 - . g734 3 AUGUSTUS transcript 2635871 2636215 0.4 - . g734.t1 3 AUGUSTUS stop_codon 2635871 2635873 . - 0 transcript_id "g734.t1"; gene_id "g734"; 3 AUGUSTUS CDS 2635871 2636215 0.4 - 0 transcript_id "g734.t1"; gene_id "g734"; 3 AUGUSTUS start_codon 2636213 2636215 . - 0 transcript_id "g734.t1"; gene_id "g734"; # protein sequence = [MKILLRSLAHFLAKGALKASPIDTYECLCSVLLYSSANPPSKTPSNDANSFPPFKMVDSTIMHNIVQQLNALDQGLDE # EGLPSLSCLNYSHILSAPSALVGALTKALCCKLGLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g734 ### # start gene g735 3 AUGUSTUS gene 2636819 2638387 0.08 + . g735 3 AUGUSTUS transcript 2636819 2638387 0.08 + . g735.t1 3 AUGUSTUS start_codon 2636819 2636821 . + 0 transcript_id "g735.t1"; gene_id "g735"; 3 AUGUSTUS CDS 2636819 2637007 0.7 + 0 transcript_id "g735.t1"; gene_id "g735"; 3 AUGUSTUS CDS 2637135 2637244 0.52 + 0 transcript_id "g735.t1"; gene_id "g735"; 3 AUGUSTUS CDS 2637316 2637628 0.29 + 1 transcript_id "g735.t1"; gene_id "g735"; 3 AUGUSTUS CDS 2637749 2638387 0.32 + 0 transcript_id "g735.t1"; gene_id "g735"; 3 AUGUSTUS stop_codon 2638385 2638387 . + 0 transcript_id "g735.t1"; gene_id "g735"; # protein sequence = [MASSVLDINYPSDVDDDDNNTMNVDDRYNSHSQDRDASADDDVNMDVVDQPSARPSYNGSRYSGYEDLADEEDEDDEE # EDGTYADEDYTKKKSAPKKKKFCAAPVRQASASDSDSDYGSRSKKKKRARPQSDELRVSSRGGKIPNYFDDVQDFEKFDEEEEPDTGYYAGPVQQYQE # EDEIEAVLSHSRDEGREADPEDVWFDNITYEFLKRFKGLKRVDNYIKAYKLWQSHVNAPNLSQEDKEALLLDKEREKEDLETFKTVERIVAHRESEDQ # DGNPTVDYFCKWTGLNYEHCTWETQKDVNPIAKDQIEAYRTREAEGRFPYKSPVYPKHSRPAFHKITEDPDYIVETGCKLKDFQLTGVNWLAYLWCKG # ENGILADEMGLGKVSTVSTIPFKYLSLIMFVDRSINLFHIIPIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g735 ### # start gene g736 3 AUGUSTUS gene 2640080 2641492 0.27 + . g736 3 AUGUSTUS transcript 2640080 2641492 0.27 + . g736.t1 3 AUGUSTUS start_codon 2640080 2640082 . + 0 transcript_id "g736.t1"; gene_id "g736"; 3 AUGUSTUS CDS 2640080 2640093 0.34 + 0 transcript_id "g736.t1"; gene_id "g736"; 3 AUGUSTUS CDS 2640179 2640605 0.71 + 1 transcript_id "g736.t1"; gene_id "g736"; 3 AUGUSTUS CDS 2640713 2641492 0.99 + 0 transcript_id "g736.t1"; gene_id "g736"; 3 AUGUSTUS stop_codon 2641490 2641492 . + 0 transcript_id "g736.t1"; gene_id "g736"; # protein sequence = [MNSLPFDKDDSQQTQKLDEMDLDAVLAHAEDHETMAAGGDGGTSLGGEGFLAQFAAVSDVKNDMNWEDIIPLEERQKF # DKEEDQRKAEELAAEESRDRKRTHAQVSYEGMDVDHPAAAAAPKKPKVPGPMRKSASQKAMELKERDVRVTESKLQDKNKGMILDVSDEIIQICEDAV # KENEDQKRSKMASGESLTNAQKAKAVLVTCRGVGNINAETVISRHKDLRILFETLMNVDDPYKWQIPVDNIRPTLNWSGRWGPQDDSMLLVGAFIYGF # GNWEAMAKDSKLNLDGKFFLEEGKKGEDAATRPIPNAIHLVRRGDYLLSLLREQHERLRSYENSLRKNSKISISPPPLPIASSSSTSSHINHLKRRAE # SEAVASVDDTSARKRKRRPTPTFTDSESSDEWSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g736 ### # start gene g737 3 AUGUSTUS gene 2643926 2645508 0.59 - . g737 3 AUGUSTUS transcript 2643926 2645508 0.59 - . g737.t1 3 AUGUSTUS stop_codon 2643926 2643928 . - 0 transcript_id "g737.t1"; gene_id "g737"; 3 AUGUSTUS CDS 2643926 2644389 0.59 - 2 transcript_id "g737.t1"; gene_id "g737"; 3 AUGUSTUS CDS 2644485 2644920 0.88 - 0 transcript_id "g737.t1"; gene_id "g737"; 3 AUGUSTUS CDS 2644981 2645508 1 - 0 transcript_id "g737.t1"; gene_id "g737"; 3 AUGUSTUS start_codon 2645506 2645508 . - 0 transcript_id "g737.t1"; gene_id "g737"; # protein sequence = [MSHKKKDCLERPRRKGARFSNKDIKADEVIQEVELGYDAKRDRWNGYDPAEHKKIYAEYAAVEATRQKLREEEIDNQT # TTDLAAVRKMAKAGKTEKKEDADFGSSDEEDADEDKYADAADAVGQKLDAKTRITVRNLRIREDTAKYLINLDPSSAYYDPKTRSMRDAPNKDTAPED # AKFAGENFFRSSGEAPAVQQLQLFAWQAAARGNDVHLNANPTQGELLHQEFKEKRQELKETSKGSILAKYGGEEYLQTAPRELRQGQTEDYVEYSRTG # QVIKGRERAKARSKYPEDGTCVVTIVVNSSSFNLQFLSTIIHLSGAREASNAQNLLSAPSEPIAPSPEISTSKTVTSHEKVEQNYSKKRVGEGEVKLD # KNRLARALQEEKKRARGDEEDDRSGKRVKVGGSHDVTEEELGTFFQRCGPFGTSTNILFRGISDAENNHGGSNGQLCRCTRLVYLVLYVHNIELYYTA # SQRSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g737 ### # start gene g738 3 AUGUSTUS gene 2648724 2651342 1 - . g738 3 AUGUSTUS transcript 2648724 2651342 1 - . g738.t1 3 AUGUSTUS stop_codon 2648724 2648726 . - 0 transcript_id "g738.t1"; gene_id "g738"; 3 AUGUSTUS CDS 2648724 2651342 1 - 0 transcript_id "g738.t1"; gene_id "g738"; 3 AUGUSTUS start_codon 2651340 2651342 . - 0 transcript_id "g738.t1"; gene_id "g738"; # protein sequence = [MSFPATAEAIDSLEEYEDIIAWINDTLTASSSEQDLESLINLDQQITQLIASLDIACEDTSSQLERTIDDVSRGIPRL # TYDLHFIKDNALSLQNSLANVHSSSRAAIPDTTASALEQLKRLDTMKGHMEAAREVLREAESWSTLELEVTSMLTEHNYAKAASRLSEANKSMVVFQN # TPEYDPRRTLLVNLQNQLEASLSSALVAAINEQNLETCRSYFDIFNNIQREVEFRNYYYGSRRAPLTATWSDAELLDAAPEGKIVSGQTFSEFLSKFY # ASMLALLNQECGSIPAIFPDPAHTLSAFISSILSSLQPTFSQRLSSLSSYYSDLALKELIAVYRVTEEFAVGVVKLMEKIQYSTVPPVNTSSSDPATP # THPSHSRKRSMRMSISFRSGMNRTNSGGQKISSLVDGLDWDQELFHPFLEFQVDYSSLERRFLDHALRDIVSNDTRQKASGSDQARIFRERAVDIFSA # AEESLARCSAFTHGYGSVSLLQALDGFLKSFVDMWTADVSFASLGPHSTLQEAGSEDLSGLDYTSQDWQNIQTMLHLLGSARSVYERMNSFEVKLRSN # LANTASTFRLHRGDPTSFPIADTKGAEQILEQSSLNSADLHALLDKIDVDPSHIRDNFSRQQGTASSTLGEPLLTDARSAMFDFAKACQISLQDTILS # PLRQQLASYAISSIWVITTEESRNTTFNDLQVPTFSLSPSEIFQRVTEGLLNLPRLFEVYADDDALSFSLQTLPYADPELLKNLPAASVPDIPTHSRR # HSVTKSVTLDPEVVSTAWLSSLGQSLLAHLTTEVLPRINKLNSGGAAQLASDLGYLSNVIRVINVESEELEQWKEYVELNDDAGKAKVDTKNDEDRVL # NHVARMRGWR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g738 ### # start gene g739 3 AUGUSTUS gene 2651897 2652382 0.99 - . g739 3 AUGUSTUS transcript 2651897 2652382 0.99 - . g739.t1 3 AUGUSTUS stop_codon 2651897 2651899 . - 0 transcript_id "g739.t1"; gene_id "g739"; 3 AUGUSTUS CDS 2651897 2652382 0.99 - 0 transcript_id "g739.t1"; gene_id "g739"; 3 AUGUSTUS start_codon 2652380 2652382 . - 0 transcript_id "g739.t1"; gene_id "g739"; # protein sequence = [MPDAALFTRPPRNADYNTLTAIVLFTKLPFAFFPIDIFLQRVSDTDMDTPTDAIDSQVLITLTTHFKVHWRTSVLSKN # SQHVLMASQTLGDLFEVMPCVSNEYPEEIVEDDKVIGYKETNGMNGSSGCVIVINDLAYGDALNEEDYAEYVGISQLSVCYRH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g739 ### # start gene g740 3 AUGUSTUS gene 2658888 2659520 0.33 + . g740 3 AUGUSTUS transcript 2658888 2659520 0.33 + . g740.t1 3 AUGUSTUS start_codon 2658888 2658890 . + 0 transcript_id "g740.t1"; gene_id "g740"; 3 AUGUSTUS CDS 2658888 2659520 0.33 + 0 transcript_id "g740.t1"; gene_id "g740"; 3 AUGUSTUS stop_codon 2659518 2659520 . + 0 transcript_id "g740.t1"; gene_id "g740"; # protein sequence = [MSNEPSVTYVDRAIQTEPPRHLSRSDGHNALNLHEPLSSQDVDAAYSQLSSLTISKRDHKLSQFAYKKPSELNALKKR # IVSLPETSPPSRIDSEPIRDRVVSMSEQVKVSLVSSADNSLSSDCFESSVETSQSQILSDLGSSSAKRARPRRSLAFPQTPSPPSSPESIMIIGNNMQ # VPSSFLRQKAIKFPKALADDNSERRKSFKNVRKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g740 ### # start gene g741 3 AUGUSTUS gene 2659711 2661369 0.62 + . g741 3 AUGUSTUS transcript 2659711 2661369 0.62 + . g741.t1 3 AUGUSTUS start_codon 2659711 2659713 . + 0 transcript_id "g741.t1"; gene_id "g741"; 3 AUGUSTUS CDS 2659711 2661369 0.62 + 0 transcript_id "g741.t1"; gene_id "g741"; 3 AUGUSTUS stop_codon 2661367 2661369 . + 0 transcript_id "g741.t1"; gene_id "g741"; # protein sequence = [MTRTIWGLGNDAGAREHGVDTKFDTHPDQSLSVQKRDTLNQSKLHTLGICTVSNTPSERAEQSKVLGNPPSDSLYVSP # SSVSGIDALNHLHQFPDNLKRSVKGRDPIQGLGLVWNNTQPSNADIHGVNEQPHLKASAPEFIPRGRLSDHPQPRVTVEPAVRSHYIVPKPQIPAIDL # AYEYRAQRERKTPLLASPSSTSSSWSPYLSTPLPLHTERFADVWNSEDAADELRRFIFERIGQQNLSPGELKQISELARSMNLDRTSAYPSSSYERPF # FATKFPPESPLKLDFHHPGPPPNTPLPPIPSQNPKAMSLAPPSPKSSVLRLGGRPGTQPRSVPFARLLQRKLSVVPEEPGSNVEHPPTSPRNERTAFG # GGAEGQHYKPYFAHTSQNTPRLPDISNHDGAIHRSHSYSSHFGSEPFTAGNLEVGGFIQLGPRTNSTNASAHIRAVKPPFQGVIVSEDIRERPCKIRS # NMVATASSGVIANKENGPAIGRSDSAGSNRSGKTFSSVTGKETVRKKFKSKKQGNSVTTSAETFVSTGDPWLSGSELDAWLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g741 ### # start gene g742 3 AUGUSTUS gene 2662484 2662690 0.33 - . g742 3 AUGUSTUS transcript 2662484 2662690 0.33 - . g742.t1 3 AUGUSTUS stop_codon 2662484 2662486 . - 0 transcript_id "g742.t1"; gene_id "g742"; 3 AUGUSTUS CDS 2662484 2662690 0.33 - 0 transcript_id "g742.t1"; gene_id "g742"; 3 AUGUSTUS start_codon 2662688 2662690 . - 0 transcript_id "g742.t1"; gene_id "g742"; # protein sequence = [MENVLFKISYPAEFHAQTAVEAAHIIHTKLKETGKTAEDIKSVRIRTQEAAVRIIDKQGPLDNFADRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g742 ### # start gene g743 3 AUGUSTUS gene 2667429 2667995 1 + . g743 3 AUGUSTUS transcript 2667429 2667995 1 + . g743.t1 3 AUGUSTUS start_codon 2667429 2667431 . + 0 transcript_id "g743.t1"; gene_id "g743"; 3 AUGUSTUS CDS 2667429 2667995 1 + 0 transcript_id "g743.t1"; gene_id "g743"; 3 AUGUSTUS stop_codon 2667993 2667995 . + 0 transcript_id "g743.t1"; gene_id "g743"; # protein sequence = [MLSELVNDFNVIDHYRPSNKRARNANEPINKLPSSAQQAQQAQVPFSRSQTTTYQSQSQSQPAQPYPTRSTRLDEQVS # ADLQLASQLLYGWRSTGESPPAWTNQQTAESLSTIDKKTVTYLEQIFGRIDNFHNDPGVAYKDADQGIYQDPNQDYYSSQLQPGYQGEALAMSGVNHA # ADFESSTASGFE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g743 ### # start gene g744 3 AUGUSTUS gene 2671708 2672550 0.5 - . g744 3 AUGUSTUS transcript 2671708 2672550 0.5 - . g744.t1 3 AUGUSTUS stop_codon 2671708 2671710 . - 0 transcript_id "g744.t1"; gene_id "g744"; 3 AUGUSTUS CDS 2671708 2672244 0.66 - 0 transcript_id "g744.t1"; gene_id "g744"; 3 AUGUSTUS CDS 2672287 2672550 0.5 - 0 transcript_id "g744.t1"; gene_id "g744"; 3 AUGUSTUS start_codon 2672548 2672550 . - 0 transcript_id "g744.t1"; gene_id "g744"; # protein sequence = [MLRDRVILAVEIPAAQHRALIGRGGQHLNELQDQTGAQIQFPGSRSYAHVGEPENAVDFGDVDPANIVKVTGPRAACE # KAIDGLKVGINSMKAAAPELITSTISVPLKYHHIISQQGQFFRNLRNFGVQVDQSVQAQKQEVPVRPVPSGTTTARIDEEEDPEAPEVEWEVAPNYQN # AEEGDSLWTLKARDQGGLERAAKLVHDAIEHAKGMSFIGFLTLPDRSTFPRIVGSKGANVMRIRNETGADIQVSRENSTIIIVGMCCYFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g744 ### # start gene g745 3 AUGUSTUS gene 2672645 2674144 0.15 - . g745 3 AUGUSTUS transcript 2672645 2674144 0.15 - . g745.t1 3 AUGUSTUS stop_codon 2672645 2672647 . - 0 transcript_id "g745.t1"; gene_id "g745"; 3 AUGUSTUS CDS 2672645 2673342 0.67 - 2 transcript_id "g745.t1"; gene_id "g745"; 3 AUGUSTUS CDS 2673503 2673542 0.54 - 0 transcript_id "g745.t1"; gene_id "g745"; 3 AUGUSTUS CDS 2673593 2673766 0.66 - 0 transcript_id "g745.t1"; gene_id "g745"; 3 AUGUSTUS CDS 2673858 2674003 0.76 - 2 transcript_id "g745.t1"; gene_id "g745"; 3 AUGUSTUS CDS 2674072 2674144 0.59 - 0 transcript_id "g745.t1"; gene_id "g745"; 3 AUGUSTUS start_codon 2674142 2674144 . - 0 transcript_id "g745.t1"; gene_id "g745"; # protein sequence = [MVKEAADVKSDTLQVEKRWHEAIIDILHRIIGEDKALSIKFGVEAGDSATEDSILIRGTSADVSRAAKEILQISTEFD # IDREYVGRVVGAQGAGINKLRDQLGVRVDVLDDTDEKESGKKKKAVHHKSKVKITGRKENVEEAQKPSTHASAFQLDDLIFIYLGKYVIRLEENYSVK # ITFPRQTAENGEGKTREQLKPDEVLIKGGKKGVAGAKAELLDVSLSLKILIHYLDCLQAVEFEKETNNVLKFTVPTRSVARILGKGGKSINEIKDTTD # AQIDVEKVSDDQTNITVRGTKKAINAAKIAILAIADQVAEELALTVPVESKYHRTLIGVGGQGLKDLVSRCGGGSDPKVLANLIRLSALFLFLHGSDS # HPLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g745 ### # start gene g746 3 AUGUSTUS gene 2674366 2675880 0.3 - . g746 3 AUGUSTUS transcript 2674366 2675880 0.3 - . g746.t1 3 AUGUSTUS stop_codon 2674366 2674368 . - 0 transcript_id "g746.t1"; gene_id "g746"; 3 AUGUSTUS CDS 2674366 2675282 0.53 - 2 transcript_id "g746.t1"; gene_id "g746"; 3 AUGUSTUS CDS 2675436 2675880 0.45 - 0 transcript_id "g746.t1"; gene_id "g746"; 3 AUGUSTUS start_codon 2675878 2675880 . - 0 transcript_id "g746.t1"; gene_id "g746"; # protein sequence = [MEGAPDPFAPTPEEQVEPRSKPLKQELDTNSHQAFPSLASSAPTTKPATQSAWGAANGPRIKPVINKQPVFTDSFTLG # TVELTTKDNKPVTLGETIKQVMAKYKVKVEASGNQRGRQTTFHMKAESQRELDKAKRLLLALLSPIVRVLSATLKQIRDQTGAKIDVPPKDSANGTSN # GHAVGDDEDEEPSVQITVMGPKPLALEAVDLINQIVASKTSRITQRVRDIPPHVLPFILARKSVFEAAAQGSELKLQSGHLEVTASGERDAVHRALDL # IKADIAELSSNLTSLKISLPKRQHRLLVGKGAQGVMAKSKCAVMVNFDDPSDEIAVWGHAADLPSGLAAVMEQANSKYIHEFPLPGPVTLSKQLLEYM # NRIDYPKTLSEKHPGVSIFTPAPATIDRAHSLVIDIVGDKPAVDAVVRQVSELIGKLIGATKDVSIDWLLHRIINGKNAKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g746 ### # start gene g747 3 AUGUSTUS gene 2680619 2680927 0.91 + . g747 3 AUGUSTUS transcript 2680619 2680927 0.91 + . g747.t1 3 AUGUSTUS start_codon 2680619 2680621 . + 0 transcript_id "g747.t1"; gene_id "g747"; 3 AUGUSTUS CDS 2680619 2680927 0.91 + 0 transcript_id "g747.t1"; gene_id "g747"; 3 AUGUSTUS stop_codon 2680925 2680927 . + 0 transcript_id "g747.t1"; gene_id "g747"; # protein sequence = [MPVPLDLRIQNNQAPCNISLDSKFSGNYDVSTKLATASVDLVPDLHDYTGDGPRQMLPEVDTMSVKHGWVGWGSQPAQ # FNPRQQGQVVLVSSLSPVSLSLGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g747 ### # start gene g748 3 AUGUSTUS gene 2682547 2682888 0.7 + . g748 3 AUGUSTUS transcript 2682547 2682888 0.7 + . g748.t1 3 AUGUSTUS start_codon 2682547 2682549 . + 0 transcript_id "g748.t1"; gene_id "g748"; 3 AUGUSTUS CDS 2682547 2682888 0.7 + 0 transcript_id "g748.t1"; gene_id "g748"; 3 AUGUSTUS stop_codon 2682886 2682888 . + 0 transcript_id "g748.t1"; gene_id "g748"; # protein sequence = [MAGPREAVWHAIIRKNFGATHFIVGRDHAGPGKNSEGKDFYGPYDAQDLVTKYHEELEIEMVPFQQMTYLPSTDEYQP # VDEVPKGVQTLDISGTELRRRLRTGASIPDWFSYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g748 ### # start gene g749 3 AUGUSTUS gene 2685257 2685904 1 + . g749 3 AUGUSTUS transcript 2685257 2685904 1 + . g749.t1 3 AUGUSTUS start_codon 2685257 2685259 . + 0 transcript_id "g749.t1"; gene_id "g749"; 3 AUGUSTUS CDS 2685257 2685904 1 + 0 transcript_id "g749.t1"; gene_id "g749"; 3 AUGUSTUS stop_codon 2685902 2685904 . + 0 transcript_id "g749.t1"; gene_id "g749"; # protein sequence = [MNSTRWVTLTEFIKHLGRTGVARVDETEKGWFIAWIDNSPKALAKAVRLLPIQIGIAFHWATQEASMKKERATTSDEQ # RERTLIAEQIERAAAEAGPSRSETPPEDLGLKRDEGAEKVVLSLSAKAADAPNSVSPPAPLKMNAFKSSAFNPLKPATNPLKRPNVFKSTTASSSSST # GTSIEKDAKKRALPMSAAERLIVEEQERKRRRMDKESMN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g749 ### # start gene g750 3 AUGUSTUS gene 2686010 2686774 0.7 - . g750 3 AUGUSTUS transcript 2686010 2686774 0.7 - . g750.t1 3 AUGUSTUS stop_codon 2686010 2686012 . - 0 transcript_id "g750.t1"; gene_id "g750"; 3 AUGUSTUS CDS 2686010 2686774 0.7 - 0 transcript_id "g750.t1"; gene_id "g750"; 3 AUGUSTUS start_codon 2686772 2686774 . - 0 transcript_id "g750.t1"; gene_id "g750"; # protein sequence = [MLCTQFTYSLKLTRLFQIADIIVASLLVEGTPVPRKVARLHLICDILHNSAASVPSAWKFRQEFQSRLGIVFDHLSNI # YHSFPGRITAETFKKQITTVVDIWEDWIVFPPAFTSELRVRLEGMAMENKTETVETVATEEVKGDSAKLPSRFTTSTFKTATEPASGVGVDEDLDGAP # LDTATEGRIDGTSMDDVDGIPIEDVDGTPMEDLDGAPMEDLDGTPMEDVDGTPMEDVDGAPMDNMSPSLDDLDGEPLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g750 ### # start gene g751 3 AUGUSTUS gene 2687221 2687697 0.8 - . g751 3 AUGUSTUS transcript 2687221 2687697 0.8 - . g751.t1 3 AUGUSTUS stop_codon 2687221 2687223 . - 0 transcript_id "g751.t1"; gene_id "g751"; 3 AUGUSTUS CDS 2687221 2687697 0.8 - 0 transcript_id "g751.t1"; gene_id "g751"; 3 AUGUSTUS start_codon 2687695 2687697 . - 0 transcript_id "g751.t1"; gene_id "g751"; # protein sequence = [MWPRGDGTVGPGADMTASRRSKNSGLSGFVSFMTRRDAEEALREFDGLDWGGSVLRVGWSKAVPVAAKPMYGEDNPPS # VLQQLLKTTQCPTNLELDITAAVEVVVGALVEAIDALMNGVVQILRGPEDIHREGIIKFSVLPLKKKQSQMYLFVLSLSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g751 ### # start gene g752 3 AUGUSTUS gene 2690915 2691465 0.56 - . g752 3 AUGUSTUS transcript 2690915 2691465 0.56 - . g752.t1 3 AUGUSTUS stop_codon 2690915 2690917 . - 0 transcript_id "g752.t1"; gene_id "g752"; 3 AUGUSTUS CDS 2690915 2691222 0.56 - 2 transcript_id "g752.t1"; gene_id "g752"; 3 AUGUSTUS CDS 2691288 2691465 0.56 - 0 transcript_id "g752.t1"; gene_id "g752"; 3 AUGUSTUS start_codon 2691463 2691465 . - 0 transcript_id "g752.t1"; gene_id "g752"; # protein sequence = [MSDTTSTPSSPTSSASTLPSSAPSPELNTLSLTEERIPVSEADIAAAAALKAQANKAFTSHDFPNAARLYGEAIEKNP # NESTLWCNRAYARMKLEEFGYAISDASGFTRVLLNRKGLMTRNEFFWLCRVRGEKVKQSNWIRNMPRHTIGKERCSLGWELLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g752 ### # start gene g753 3 AUGUSTUS gene 2692263 2692896 0.19 - . g753 3 AUGUSTUS transcript 2692263 2692896 0.19 - . g753.t1 3 AUGUSTUS stop_codon 2692263 2692265 . - 0 transcript_id "g753.t1"; gene_id "g753"; 3 AUGUSTUS CDS 2692263 2692784 0.56 - 0 transcript_id "g753.t1"; gene_id "g753"; 3 AUGUSTUS CDS 2692879 2692896 0.2 - 0 transcript_id "g753.t1"; gene_id "g753"; 3 AUGUSTUS start_codon 2692894 2692896 . - 0 transcript_id "g753.t1"; gene_id "g753"; # protein sequence = [MQFMLALNSPPVNPSFGKANDNAVQFSSSTSSSSSATTSSPTSSSASAQSSASTNNSSGIWNGASSLLSVVSSCGDIG # ATCTYSLLFVYQSLNVFTVDITSQSGPNGNIYWMNCGVSDSGWNPTYVNINQIIVKDFATALQDSNTPFSACSSYTDKFYEYGQQFGIPPIVIASFAM # QEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g753 ### # start gene g754 3 AUGUSTUS gene 2695197 2696207 0.64 + . g754 3 AUGUSTUS transcript 2695197 2696207 0.64 + . g754.t1 3 AUGUSTUS start_codon 2695197 2695199 . + 0 transcript_id "g754.t1"; gene_id "g754"; 3 AUGUSTUS CDS 2695197 2696207 0.64 + 0 transcript_id "g754.t1"; gene_id "g754"; 3 AUGUSTUS stop_codon 2696205 2696207 . + 0 transcript_id "g754.t1"; gene_id "g754"; # protein sequence = [MKGFVHEVLRRSRTSGSVLQTALCYLEAIRPRISEIAQSGDSFKGETELADRITVASEDELAREAELCIGTDTILINE # SDDSMDTIRITDSYSGSTAVSSGIMEDAESTLKKSKGPFSALVPLPHLPSPLLCPRRAFLASLILASKFTQDKCYSNRAWAKLSGLPPREIGRCERAL # GDALDWRLWVGKSSPQPQATPITSPPSSSNSRPLARSRSESLIPCNPPDSGGFLSGSDKRPISPITSTSGRPRESNNAESSRSIGLRRAVTLPAEAFA # FNDDSNRQFTVSRDRAVAQWIHHDKSNNDQVVDMDMYSPNTTVSVELDVQVSIPTPFFPFLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g754 ### # start gene g755 3 AUGUSTUS gene 2704556 2705470 0.73 - . g755 3 AUGUSTUS transcript 2704556 2705470 0.73 - . g755.t1 3 AUGUSTUS stop_codon 2704556 2704558 . - 0 transcript_id "g755.t1"; gene_id "g755"; 3 AUGUSTUS CDS 2704556 2705470 0.73 - 0 transcript_id "g755.t1"; gene_id "g755"; 3 AUGUSTUS start_codon 2705468 2705470 . - 0 transcript_id "g755.t1"; gene_id "g755"; # protein sequence = [MQTSQLSRPPIHLKGPRERLSRPVSPSPNTMILPETPPLNIKKVNPSHPPNSSVPQPPNSSPRKFPAPALTLSIPTPR # SRPTTPKPRIQIDIPLPSNNHSADEDSYCYYGGGPTTVISSGGSADETTIRPPATTRPSITIAMPSKQDEPIESIRHAIDNMRPTDDEVDSVVQEAVF # SNPWSDDILEEVCRLGEGAGGAVHKVKDKRTGKVMARKTITTREAPMKQLERELSIMSSTKHINIVHFYGAYMSPSSSEVKILMDFCEGGSLETVSKK # IKERNAVVGEKIAGRLAEGVSRVTSTILIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g755 ### # start gene g756 3 AUGUSTUS gene 2711442 2711741 0.75 + . g756 3 AUGUSTUS transcript 2711442 2711741 0.75 + . g756.t1 3 AUGUSTUS start_codon 2711442 2711444 . + 0 transcript_id "g756.t1"; gene_id "g756"; 3 AUGUSTUS CDS 2711442 2711741 0.75 + 0 transcript_id "g756.t1"; gene_id "g756"; 3 AUGUSTUS stop_codon 2711739 2711741 . + 0 transcript_id "g756.t1"; gene_id "g756"; # protein sequence = [MGVLAVCELCCSPSEVDLVSIKPYRSRGLGSQSLQHIIDAAKSHIKTKIDKIYLHVQTSNVEAKKFYDRHGFEAVGIH # KNYYKKLVPRDAWIMELTIGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g756 ### # start gene g757 3 AUGUSTUS gene 2716317 2716457 0.85 + . g757 3 AUGUSTUS transcript 2716317 2716457 0.85 + . g757.t1 3 AUGUSTUS start_codon 2716317 2716319 . + 0 transcript_id "g757.t1"; gene_id "g757"; 3 AUGUSTUS CDS 2716317 2716457 0.85 + 0 transcript_id "g757.t1"; gene_id "g757"; 3 AUGUSTUS stop_codon 2716455 2716457 . + 0 transcript_id "g757.t1"; gene_id "g757"; # protein sequence = [MQASDASFLANLWKSQQGKSKEQDDELIDVDVDSTSDYSEMDDIDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g757 ### # start gene g758 3 AUGUSTUS gene 2720435 2720767 0.79 + . g758 3 AUGUSTUS transcript 2720435 2720767 0.79 + . g758.t1 3 AUGUSTUS start_codon 2720435 2720437 . + 0 transcript_id "g758.t1"; gene_id "g758"; 3 AUGUSTUS CDS 2720435 2720767 0.79 + 0 transcript_id "g758.t1"; gene_id "g758"; 3 AUGUSTUS stop_codon 2720765 2720767 . + 0 transcript_id "g758.t1"; gene_id "g758"; # protein sequence = [MGVGPLSSQYSSVNPIATHDPSRGAGSRSYSNYDYLTHPRVSTTLDNRNRSEEAEYALTSLAQSYPDVQPPSRDMPKG # SVAPPAKYECTYCGKGFNRPSSLKVESLVSDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g758 ### # start gene g759 3 AUGUSTUS gene 2726231 2727103 0.79 + . g759 3 AUGUSTUS transcript 2726231 2727103 0.79 + . g759.t1 3 AUGUSTUS start_codon 2726231 2726233 . + 0 transcript_id "g759.t1"; gene_id "g759"; 3 AUGUSTUS CDS 2726231 2727103 0.79 + 0 transcript_id "g759.t1"; gene_id "g759"; 3 AUGUSTUS stop_codon 2727101 2727103 . + 0 transcript_id "g759.t1"; gene_id "g759"; # protein sequence = [MHSICQHSVASTYPNQYTQPRSMPTRYDYNHALYNQWPGNNRKCIRGFERYAYRSLTSHELAESSAHMNYAYYDTTDN # RYASNYYSAYPSSRTSPAPEHSDSRKLPPLTTTSGLGRDDRWSSNTASYSVGPAENPSYSGIRSPTASYPPSFAAYPTPNSTNNYGNPVPMTDAHTQS # HIHAASHASMMLPESHRPVTPSYAPSGLQIPPSYTPPPVSPTTGTANEPLIKKKRKRADASQLRVLNDTYARTAFPSTEERQALAKLLDMSARSVQIW # RVAFATHVILFLIVTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g759 ### # start gene g760 3 AUGUSTUS gene 2728891 2729172 0.49 - . g760 3 AUGUSTUS transcript 2728891 2729172 0.49 - . g760.t1 3 AUGUSTUS stop_codon 2728891 2728893 . - 0 transcript_id "g760.t1"; gene_id "g760"; 3 AUGUSTUS CDS 2728891 2729172 0.49 - 0 transcript_id "g760.t1"; gene_id "g760"; 3 AUGUSTUS start_codon 2729170 2729172 . - 0 transcript_id "g760.t1"; gene_id "g760"; # protein sequence = [MGRQKLKKSFQYEIKWRGLDHRFNTWVARDDLITKGFTKLVQQFDDLESSREGAGSRDTAAHLVRKHLEDIGLDGDIA # QYNEISGLSGGEFCD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g760 ### # start gene g761 3 AUGUSTUS gene 2730931 2731713 0.93 - . g761 3 AUGUSTUS transcript 2730931 2731713 0.93 - . g761.t1 3 AUGUSTUS stop_codon 2730931 2730933 . - 0 transcript_id "g761.t1"; gene_id "g761"; 3 AUGUSTUS CDS 2730931 2731392 0.98 - 0 transcript_id "g761.t1"; gene_id "g761"; 3 AUGUSTUS CDS 2731447 2731713 0.93 - 0 transcript_id "g761.t1"; gene_id "g761"; 3 AUGUSTUS start_codon 2731711 2731713 . - 0 transcript_id "g761.t1"; gene_id "g761"; # protein sequence = [MANPDSVPACIKALSSTTFVAEVTAPALAVLVPLLIRALNDRSMETQRRTVVVIDNLVKLVRDPKVAAQYLSPLVEGV # EKIAKGAAFPEVRAFGETALETLLKSGASAKVPPSESRDLEQQTKDACSALLLLLPEDIRDPSSPPNGPYTPKYSLLTRSLDFQASLVADLVNARQFS # DINAWSRCIGLFIKGWTDPEHSTRFSEAVREHFLAIDKVLHFLKPVLQGVTEGFLPGKVYCSYQWQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g761 ### # start gene g762 3 AUGUSTUS gene 2735736 2737185 0.23 + . g762 3 AUGUSTUS transcript 2735736 2737185 0.23 + . g762.t1 3 AUGUSTUS start_codon 2735736 2735738 . + 0 transcript_id "g762.t1"; gene_id "g762"; 3 AUGUSTUS CDS 2735736 2736422 0.23 + 0 transcript_id "g762.t1"; gene_id "g762"; 3 AUGUSTUS CDS 2736472 2737185 0.39 + 0 transcript_id "g762.t1"; gene_id "g762"; 3 AUGUSTUS stop_codon 2737183 2737185 . + 0 transcript_id "g762.t1"; gene_id "g762"; # protein sequence = [MEQALAKIRIHTSSSLPHQKTPASLLSALESTFKEQKTEPSSTAYFAALLTTLDGTLQKKELSLNDGDVLPAELYLLA # LVAPFVSTPVIRTNLSTILAFTAPLFPSLLNHAPALRSQLSLYQVVLVSLDRSQLETHGIRQAFASILQLTVDPRPKVRKKATEVVKEVLSKPLPPLL # IHPYAERVAEWSQSALAEMNKNIPPKSKGDSEGESAIHLLAFLKPTISKFPPSSYSTLTGLLLNLPRLGNPFLSQSAYAILSDLFSQSHEDDALAFDE # EVLPQVLKTVMAFPPAKTDTTLAPSWILLLGNAMASYNVVHSDACYAQVGLVWKTLWPFLESSSASVRKATVQSLDQLARCIVTDASSSKMDDIVAQV # MKALTSVSHARAIPDLLSLTSALLTSSYGKGKRTLDDVMGQRLLALVVQIGKLRTEKAFEYKEAADDTLSTAMRMLGPKVLLNVLPLNLEPEDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g762 ### # start gene g763 3 AUGUSTUS gene 2737338 2738425 0.2 + . g763 3 AUGUSTUS transcript 2737338 2738425 0.2 + . g763.t1 3 AUGUSTUS start_codon 2737338 2737340 . + 0 transcript_id "g763.t1"; gene_id "g763"; 3 AUGUSTUS CDS 2737338 2737775 0.2 + 0 transcript_id "g763.t1"; gene_id "g763"; 3 AUGUSTUS CDS 2737829 2738425 0.82 + 0 transcript_id "g763.t1"; gene_id "g763"; 3 AUGUSTUS stop_codon 2738423 2738425 . + 0 transcript_id "g763.t1"; gene_id "g763"; # protein sequence = [MFDLQQKAENEGRQSESKVWNVLISQIWAGFPAYCHATPNIEGTMDASFSQLVSQLLYGQPELRSAVLRGLRLIVESN # VALSNSVPDTLNPSGLTDEQAAHNVTFLRTQAESWLAVLFNVFGTVGRDARGPVGDVITAWASITSEQEIHKAYIKVVDLFKGHIGKTSSASGNEENI # SATALDLLLLLLPYLSSADLTVLFQNCLSSEFLCAKDNALQKRAYKILTRLTESGKVIIDSEAVLKELDALSEGLTSAAKKDRFNLFAVLIPLIPSSA # MHLIPSMIPEAVLGTKETSDKARNAAFELIIAMGQKMSQGGVVKRDMLEEMDEDSAVEGQLLHPCRSMSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g763 ### # start gene g764 3 AUGUSTUS gene 2739030 2739305 0.55 + . g764 3 AUGUSTUS transcript 2739030 2739305 0.55 + . g764.t1 3 AUGUSTUS start_codon 2739030 2739032 . + 0 transcript_id "g764.t1"; gene_id "g764"; 3 AUGUSTUS CDS 2739030 2739305 0.55 + 0 transcript_id "g764.t1"; gene_id "g764"; 3 AUGUSTUS stop_codon 2739303 2739305 . + 0 transcript_id "g764.t1"; gene_id "g764"; # protein sequence = [MKVPETKATAGDAFEDILYGSESEVDASDDDEGAGRKPSQLRTKSKKQSQGMRLRLDDDEPMDLLQGVASRITSEYMS # MVMPLRQPPSSLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g764 ### # start gene g765 3 AUGUSTUS gene 2739380 2739730 0.55 + . g765 3 AUGUSTUS transcript 2739380 2739730 0.55 + . g765.t1 3 AUGUSTUS start_codon 2739380 2739382 . + 0 transcript_id "g765.t1"; gene_id "g765"; 3 AUGUSTUS CDS 2739380 2739730 0.55 + 0 transcript_id "g765.t1"; gene_id "g765"; 3 AUGUSTUS stop_codon 2739728 2739730 . + 0 transcript_id "g765.t1"; gene_id "g765"; # protein sequence = [MVIDQSDDEDAVPHQASNDVSGTAYRESITSVDGFTRGPNGRVKFNKDTKKRRRDNEDLDMMDVDESDRNHNQQKRKT # APKLGHEFKAKVGFYLFIVEFVMISVYRELVEMLKKAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g765 ### # start gene g766 3 AUGUSTUS gene 2741649 2742718 1 + . g766 3 AUGUSTUS transcript 2741649 2742718 1 + . g766.t1 3 AUGUSTUS start_codon 2741649 2741651 . + 0 transcript_id "g766.t1"; gene_id "g766"; 3 AUGUSTUS CDS 2741649 2741742 1 + 0 transcript_id "g766.t1"; gene_id "g766"; 3 AUGUSTUS CDS 2741820 2742718 1 + 2 transcript_id "g766.t1"; gene_id "g766"; 3 AUGUSTUS stop_codon 2742716 2742718 . + 0 transcript_id "g766.t1"; gene_id "g766"; # protein sequence = [MIWARTWKILELLGLGSAFSKIAHSPPDGSIGLTNLRKAHDSIWCKCPVSAYMVFTLEYPTGDHFTDGCIRFYRVDFL # DAFVEALPPNVAHFGMRLASYSQNASASEISLQFSNGTTATCDLLAGCDGIKSSIRAQLYRECSERSGDSTLLKFIDPVWTGTIAYRGLIPVEHLPPC # HRSIADPMMVCMQTVVDSVQIDSTFILVLRQEQSLSFPLKLQLSFIERGLQHVVSYSISRGKVVNVVTFASDPKREGEPHNEDVWVTNCLQQELLECY # SNWEPEVEQLLNVSFWVNPSDRTFPENPYSKLRIQLNGLYTTLGHCHFSWTERSHY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g766 ### # start gene g767 3 AUGUSTUS gene 2743383 2744685 0.46 - . g767 3 AUGUSTUS transcript 2743383 2744685 0.46 - . g767.t1 3 AUGUSTUS stop_codon 2743383 2743385 . - 0 transcript_id "g767.t1"; gene_id "g767"; 3 AUGUSTUS CDS 2743383 2744139 1 - 1 transcript_id "g767.t1"; gene_id "g767"; 3 AUGUSTUS CDS 2744193 2744369 0.6 - 1 transcript_id "g767.t1"; gene_id "g767"; 3 AUGUSTUS CDS 2744618 2744685 0.5 - 0 transcript_id "g767.t1"; gene_id "g767"; 3 AUGUSTUS start_codon 2744683 2744685 . - 0 transcript_id "g767.t1"; gene_id "g767"; # protein sequence = [MSGFKVICSLCKGLPVECCDRPQNYASGPSPHALVFLEHRQGDIDSGSLSALTAASQLGGKVAGLVVGSSEFVPAVVD # KVKKLKGLTSLLHCTSDLYAEQLPETLSPLLEKLLSDSEYTHVVSTPSSLAKSLLPRVAAKLDVPSVSEITSLEHDSSSNSTTFTRPIYAGNAISTVR # LPSSVPIKFFTVRATNFDPAPFEESQEIEVKAIDPVDVPNCPTKHISTQLAKSDRPDLSVAGRVVSGGRPLKNAETFAATLNPLADVLGAALGASRAA # VDAGYVDNSLQVGQTGKVVAPELYMAIGISGAIQHLAGMKDSKMIVAVNKVRESCYSSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g767 ### # start gene g768 3 AUGUSTUS gene 2744751 2746023 0.26 + . g768 3 AUGUSTUS transcript 2744751 2746023 0.26 + . g768.t1 3 AUGUSTUS start_codon 2744751 2744753 . + 0 transcript_id "g768.t1"; gene_id "g768"; 3 AUGUSTUS CDS 2744751 2744995 0.27 + 0 transcript_id "g768.t1"; gene_id "g768"; 3 AUGUSTUS CDS 2745085 2745432 0.4 + 1 transcript_id "g768.t1"; gene_id "g768"; 3 AUGUSTUS CDS 2745483 2746023 0.99 + 1 transcript_id "g768.t1"; gene_id "g768"; 3 AUGUSTUS stop_codon 2746021 2746023 . + 0 transcript_id "g768.t1"; gene_id "g768"; # protein sequence = [MIVAFIYQQLHQLPGTSSSAATGHDLALARQFFEANRASPAIFASAIPELSNPQMKDAWIAEQQQHMRIFESNKSHSQ # WTADAQLPHGSHMVAAPQMASYMPQVAMYGNYVPHNNLFAMGGPPLMQNYTPPIVDSAEGKGKSREADFDAAFAQAAAFLPSQEAGTSGIVEVNDGVT # DIEEGLKSTTLQDHTIEPDFRRVWDHLQNSDAPPPAEDLAKWETEFQQLMDAQRDELNYGNAMQEAWENGLGNFTDSTTLGDPPLKFDNDGLPILQAY # VFETNNKYLDPSNSTSSPLSDAKALLEQNGSLSEASLLLEAAIQKGDLGDGGYEAWILLGETKNMDEHEEAGMRALTEGVKRAEAAGASGAGMMVRCL # NYFRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g768 ### # start gene g769 3 AUGUSTUS gene 2747537 2747959 1 - . g769 3 AUGUSTUS transcript 2747537 2747959 1 - . g769.t1 3 AUGUSTUS stop_codon 2747537 2747539 . - 0 transcript_id "g769.t1"; gene_id "g769"; 3 AUGUSTUS CDS 2747537 2747959 1 - 0 transcript_id "g769.t1"; gene_id "g769"; 3 AUGUSTUS start_codon 2747957 2747959 . - 0 transcript_id "g769.t1"; gene_id "g769"; # protein sequence = [MIEEAHDDSDASFEPPKTTARKRKSTSGVSTSKKAKFATSSSSASSGVLNKQYSELASSVLANGANFYTKSENQDAAS # DAAVTLAGYTKQLEVALGEALKSSGGIPAAEPKTGVELTAAAGKIRKAAVSGIKKQMSVSTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g769 ### # start gene g770 3 AUGUSTUS gene 2751885 2752760 0.78 + . g770 3 AUGUSTUS transcript 2751885 2752760 0.78 + . g770.t1 3 AUGUSTUS start_codon 2751885 2751887 . + 0 transcript_id "g770.t1"; gene_id "g770"; 3 AUGUSTUS CDS 2751885 2752760 0.78 + 0 transcript_id "g770.t1"; gene_id "g770"; 3 AUGUSTUS stop_codon 2752758 2752760 . + 0 transcript_id "g770.t1"; gene_id "g770"; # protein sequence = [MRTLSMGTAWASEGSYPWEQGRYVGGIETVKVNLALRIYSNAWHVYAGLAILNPNAREQINQYAQSATELYKMMLEAG # GALSNGKSDQSSEYDSERESKLRQRIEWAQGVVFGDPSKTRNRKPILLSEDILDKFSLGRSNTVSSVIPDPCAMETESSPRKANSHLSLLAMVDCWAH # LDINPFHHLDLAATPLFRLFLGVAEHLFLNPALMDMTIQSAIYDTWHRANDLEFVVAARGWSQCVKFMSFEVYRKRFDETRIFFEPRFDEAGLLGGEM # IKAVMASDMDAKSTKSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g770 ### # start gene g771 3 AUGUSTUS gene 2760976 2761335 0.52 - . g771 3 AUGUSTUS transcript 2760976 2761335 0.52 - . g771.t1 3 AUGUSTUS stop_codon 2760976 2760978 . - 0 transcript_id "g771.t1"; gene_id "g771"; 3 AUGUSTUS CDS 2760976 2761335 0.52 - 0 transcript_id "g771.t1"; gene_id "g771"; 3 AUGUSTUS start_codon 2761333 2761335 . - 0 transcript_id "g771.t1"; gene_id "g771"; # protein sequence = [MDSSSISSGRSASSSSPLNPSINANANPSSPHLANSPSISRSTSEHVLTSSPTQESDLHPGGGGGMDPAMLAAHIEKV # RLLIMGMETRISKREDHLQEMVKRAESEGRRWEEVVGGVRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g771 ### # start gene g772 3 AUGUSTUS gene 2762755 2763827 0.21 - . g772 3 AUGUSTUS transcript 2762755 2763827 0.21 - . g772.t1 3 AUGUSTUS stop_codon 2762755 2762757 . - 0 transcript_id "g772.t1"; gene_id "g772"; 3 AUGUSTUS CDS 2762755 2763189 0.78 - 0 transcript_id "g772.t1"; gene_id "g772"; 3 AUGUSTUS CDS 2763486 2763827 0.22 - 0 transcript_id "g772.t1"; gene_id "g772"; 3 AUGUSTUS start_codon 2763825 2763827 . - 0 transcript_id "g772.t1"; gene_id "g772"; # protein sequence = [MDDLFESDWKASREAHALDFGSFALLAGELAEEMKRRGIPGDDEQMTAEIIKESLDCGASATNVTIGASVPRDASQWF # TTQAPDAEDYIRDVVYGGTEGFAYVRSLAEFVTPPELRTHTIDMGSLIRAPDEIYQSEKEWFGNLASGEQVKKEDSMEVDTQASPNTSTTIGTMEQLD # RVFSYVGNAITALDRQRRAQNSVVEATQMKVDDTEEDPVLRNIRLNLLALAKRAPLDTIALLPRDLIPEQIRHVIPALASAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g772 ### # start gene g773 3 AUGUSTUS gene 2769335 2769916 0.82 - . g773 3 AUGUSTUS transcript 2769335 2769916 0.82 - . g773.t1 3 AUGUSTUS stop_codon 2769335 2769337 . - 0 transcript_id "g773.t1"; gene_id "g773"; 3 AUGUSTUS CDS 2769335 2769916 0.82 - 0 transcript_id "g773.t1"; gene_id "g773"; 3 AUGUSTUS start_codon 2769914 2769916 . - 0 transcript_id "g773.t1"; gene_id "g773"; # protein sequence = [MYNVGSSSSFIVEDSSPLISYSPAGAWSDSPANDTLLSVSSRNVVASAYLKQHLVLFWLFIPHRLHSRRDSYYNVHWY # NIVHDLCLRKPINSSFYLGIGITIFGGHRQNYGTYQISVDGQTVVASESSAGQDVFQQVLGTVSGLSNEKHTAVVTSSSVSSIDIDYVNVQTQIGETG # CVFYFIVMSTLNLIFIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g773 ### # start gene g774 3 AUGUSTUS gene 2771682 2772367 0.82 + . g774 3 AUGUSTUS transcript 2771682 2772367 0.82 + . g774.t1 3 AUGUSTUS start_codon 2771682 2771684 . + 0 transcript_id "g774.t1"; gene_id "g774"; 3 AUGUSTUS CDS 2771682 2771702 0.85 + 0 transcript_id "g774.t1"; gene_id "g774"; 3 AUGUSTUS CDS 2771861 2772367 0.92 + 0 transcript_id "g774.t1"; gene_id "g774"; 3 AUGUSTUS stop_codon 2772365 2772367 . + 0 transcript_id "g774.t1"; gene_id "g774"; # protein sequence = [MGRRTITNYKGTCGKDLDALWGLSEVLNATPQWHAYGLILGRGDDDDEDNDGPLKLSGKIKKPLAITYGGESDDSMPS # LQEVSDSDDSDDWSENESEDDDDDDDDGSDDESGYDTDQEDTVRDLLREAMDAVTAVNWQEPPVANDELDPFNAEDSKRNSFLKLLGSLRGERESNY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g774 ### # start gene g775 3 AUGUSTUS gene 2772537 2773160 0.98 + . g775 3 AUGUSTUS transcript 2772537 2773160 0.98 + . g775.t1 3 AUGUSTUS start_codon 2772537 2772539 . + 0 transcript_id "g775.t1"; gene_id "g775"; 3 AUGUSTUS CDS 2772537 2773160 0.98 + 0 transcript_id "g775.t1"; gene_id "g775"; 3 AUGUSTUS stop_codon 2773158 2773160 . + 0 transcript_id "g775.t1"; gene_id "g775"; # protein sequence = [MISVDRPKAGVTLEEVSDEDDISHAKKKKKKKPKKKKKKPTAAADGEAPVEDNAATAPPPIPSATVSPAPNAQSKAPA # KPKAATAASQSTTSFYPSETIAQSARSYLQSEQLDVLKTKTKSRSAQASLFSSTKGLFDKFGVGQEKKKDTSADKKERRNWFANLGKRTRTYMHQILN # TADDETQGKAGMKWDIFVKVSHTFSQHRDDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g775 ### # start gene g776 3 AUGUSTUS gene 2773718 2775012 0.75 - . g776 3 AUGUSTUS transcript 2773718 2775012 0.75 - . g776.t1 3 AUGUSTUS stop_codon 2773718 2773720 . - 0 transcript_id "g776.t1"; gene_id "g776"; 3 AUGUSTUS CDS 2773718 2774673 0.95 - 2 transcript_id "g776.t1"; gene_id "g776"; 3 AUGUSTUS CDS 2774763 2775012 0.75 - 0 transcript_id "g776.t1"; gene_id "g776"; 3 AUGUSTUS start_codon 2775010 2775012 . - 0 transcript_id "g776.t1"; gene_id "g776"; # protein sequence = [MSHSTTTTATYTLVKYSRSYPNSAQDANSEWQHYTKPTLKLILDVKKSLTTGELESVFLRIVWSMENSYAQDQSEVSF # VSKFSHRQQGGLPLKAVYRDSVVGIRYINASNGVSVSKYLGQLRRQADSAKTFRRFQITFSSANDASQFIDSISSVCPCKANSTAGPPNIPQMMSAPS # MVPPVLHHPIAKPPILNNSAYAQTVPVSAAFPLSHMHNNNIPLNQTDVFFPVTPSQRLSTYPTMHFPYPGAPYASVSGMPMPSSQMLMDHPNQIQSSS # PPLLPPPSSQPPFQFGGSQTHSQSAPFTPTPTQSEHPHYSQSTSVNQQAFTQTLGNEIIKPVKSKFKAESSEKEVQTTDPFVFALREATSLYDMPRHS # LEKLVGDVVREDGFVHLVSTLNRFFTTTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g776 ### # start gene g777 3 AUGUSTUS gene 2777729 2779270 0.42 - . g777 3 AUGUSTUS transcript 2777729 2779270 0.42 - . g777.t1 3 AUGUSTUS stop_codon 2777729 2777731 . - 0 transcript_id "g777.t1"; gene_id "g777"; 3 AUGUSTUS CDS 2777729 2778247 0.99 - 0 transcript_id "g777.t1"; gene_id "g777"; 3 AUGUSTUS CDS 2778694 2778987 0.5 - 0 transcript_id "g777.t1"; gene_id "g777"; 3 AUGUSTUS CDS 2779040 2779270 0.78 - 0 transcript_id "g777.t1"; gene_id "g777"; 3 AUGUSTUS start_codon 2779268 2779270 . - 0 transcript_id "g777.t1"; gene_id "g777"; # protein sequence = [MSTPTASNAAAGSGSSKQASEAAAAAAAIAAKIAAQFASGGAGSMGGSLNDAAFTFDIDINDARNRYMLCKSSTQQDI # QEDTGASISTKGTWHPNRSKATERDPPLYLHIMAPTKEVLDKAIKKVEELLAIDMGSLVEDKKDKMGGRRKWPEEKMPVGLESIRNFNLRAKVVGPSA # QQQYAAYAASYQGGGGYPGGAAGSYGGGYVPPPPGDAPPPPPGDSQPPPPPPSGGGGDPSAVTAASAGGTPQEQYAAYWFVFSFRLYSPTNSTPHHFR # YRAAYGYDVNSPEFKTWVAEQAKQTEQYYAQQQAQTQGVYPGYDPSVGAGGAAAPPPPPPPDSQAPPPPPPPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g777 ### # start gene g778 3 AUGUSTUS gene 2779837 2780648 0.35 + . g778 3 AUGUSTUS transcript 2779837 2780648 0.35 + . g778.t1 3 AUGUSTUS start_codon 2779837 2779839 . + 0 transcript_id "g778.t1"; gene_id "g778"; 3 AUGUSTUS CDS 2779837 2779868 0.64 + 0 transcript_id "g778.t1"; gene_id "g778"; 3 AUGUSTUS CDS 2779964 2780648 0.43 + 1 transcript_id "g778.t1"; gene_id "g778"; 3 AUGUSTUS stop_codon 2780646 2780648 . + 0 transcript_id "g778.t1"; gene_id "g778"; # protein sequence = [MGGYTLMRCRIVRIFQAEGAQLLSELPLSNVIELSFSPRGTYLSTWERPIKLDDNQQHKNLRVFSVSTGEELVAFTQK # SQEGWDLQYTITESHAIRLVAQEIQVFRPTEWGKGVVDKLKVEGATKACLSPGLNPSVAVFVAEKKVSNTKPILILINLLTMCSFRALQPASKSTVSS # PSPHPQPAKKPSSKPIDPQLNGTSLAPRSYSSPKPMSTTPTSRTTGKLACTCSVPQGTLTVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g778 ### # start gene g779 3 AUGUSTUS gene 2781056 2781967 0.6 + . g779 3 AUGUSTUS transcript 2781056 2781967 0.6 + . g779.t1 3 AUGUSTUS start_codon 2781056 2781058 . + 0 transcript_id "g779.t1"; gene_id "g779"; 3 AUGUSTUS CDS 2781056 2781967 0.6 + 0 transcript_id "g779.t1"; gene_id "g779"; 3 AUGUSTUS stop_codon 2781965 2781967 . + 0 transcript_id "g779.t1"; gene_id "g779"; # protein sequence = [MYQASWRPTPVDNVPPFPSQGGPLQSSLVPPPPSPSVSLYQLSLKNSGAGGSTTSLDGTPTKPAGAYRPPGARGNATP # AIFKREDEGGFSRTPSGQNTPVRGYSKSPAPPGSAGMNGPGGPGGQGRGGRYVPGAPPPTNQNQNPSRPGALPRGDSGGQGQGQGQGPGKGDGQARKR # NKGGKNKGGEGEGGGREGSVGRGQQGKNGANGQQRASGNGIQQNANTNGNSKKPTSIDLNGVNGKITTSTSTNAANGDGNVAKAALASAALTPLDTAL # STPVTPGLDSALDPIAKKVRNLNKKVRFQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g779 ### # start gene g780 3 AUGUSTUS gene 2783522 2784588 0.37 + . g780 3 AUGUSTUS transcript 2783522 2784588 0.37 + . g780.t1 3 AUGUSTUS start_codon 2783522 2783524 . + 0 transcript_id "g780.t1"; gene_id "g780"; 3 AUGUSTUS CDS 2783522 2783572 0.56 + 0 transcript_id "g780.t1"; gene_id "g780"; 3 AUGUSTUS CDS 2783629 2784120 0.58 + 0 transcript_id "g780.t1"; gene_id "g780"; 3 AUGUSTUS CDS 2784238 2784588 0.6 + 0 transcript_id "g780.t1"; gene_id "g780"; 3 AUGUSTUS stop_codon 2784586 2784588 . + 0 transcript_id "g780.t1"; gene_id "g780"; # protein sequence = [MDIGSLLIFDANHIPFGCSVWPSLFTQGQVWPQQGEIDVIEQVNLATDNRYSLHVGVDNCNQPTSVASNQTGTISTAV # GDISNCTVTPTTGQNTVGCVTTETKSNSFGSGFASQGGGVYAMLWDTNGIALWYFARGSVPSDIGVSSSPDPTTWGEASAWYPASGCNPSTAFGPQII # TLVRLRLIVRPWFPILPTTTTHTGKSTISKCSQSMYSICLLRLFSLMLNLIQSSGQSNSSSTSSTSASGTNSGAGASSTGTGTGSSSSGSSNSAIAFA # VKGIWEYLLVPASVSFLGMLSMI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g780 ### # start gene g781 3 AUGUSTUS gene 2788360 2788827 0.98 - . g781 3 AUGUSTUS transcript 2788360 2788827 0.98 - . g781.t1 3 AUGUSTUS stop_codon 2788360 2788362 . - 0 transcript_id "g781.t1"; gene_id "g781"; 3 AUGUSTUS CDS 2788360 2788827 0.98 - 0 transcript_id "g781.t1"; gene_id "g781"; 3 AUGUSTUS start_codon 2788825 2788827 . - 0 transcript_id "g781.t1"; gene_id "g781"; # protein sequence = [MLTSHIKNSFASPVTLELLRTRRLTTQLSGAFDSISGSLDEATLEIKEKLSDISKLRQEYEQDLNRIPSEVLGVYNAS # VSDSKQDNLVTKALATSERLVQAQMSRFTLLKMFSHIDEINIVVNRIVDETWCKELEQHVNILRLSTNIVAHHILPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g781 ### # start gene g782 3 AUGUSTUS gene 2790138 2791961 0.39 + . g782 3 AUGUSTUS transcript 2790138 2791961 0.39 + . g782.t1 3 AUGUSTUS start_codon 2790138 2790140 . + 0 transcript_id "g782.t1"; gene_id "g782"; 3 AUGUSTUS CDS 2790138 2790188 0.51 + 0 transcript_id "g782.t1"; gene_id "g782"; 3 AUGUSTUS CDS 2790313 2790631 0.83 + 0 transcript_id "g782.t1"; gene_id "g782"; 3 AUGUSTUS CDS 2790706 2791961 0.98 + 2 transcript_id "g782.t1"; gene_id "g782"; 3 AUGUSTUS stop_codon 2791959 2791961 . + 0 transcript_id "g782.t1"; gene_id "g782"; # protein sequence = [MLQLDDLIEQHAYEESVPIPPPTVSSRKPETPFRDQKVVHPPKESCYKYVSTLLWVISSSDLAFSLPIMFPSIPESGT # KSRVETQVRVTVDLADPSSSIDPHIYDRVGSWKWLKLPPGTATKRHPDSQDMLFLTVSVSCASPPHNRVLSCSSCQTREAKRVAKKIAARVRPARNSD # VDEEYPDDANNSGPARKSAALLEDTSSIIQFNCAEVLDFSTGSAVLPIRITCYCRHHREKTGFNVNLVMMDSAGRTVGVGSSSPIMITDDHKTTSAPK # HADLQPYDWCQPGGSNTTSGASSPVGIVKKAPSKRKTDVGGKKRVKPYDSSAKPNRSSRETSVVSNAPSPTASEPLSITTAPSPPSYPPLTSADPLSA # TEIPSLQFSTQESDSSPDVLTTPLDIDIPMLPESITNLEDLFTAAGVAPDATMIPPSVTSASLPFLFTPPPTTISMPIIHRLIPNCGPTHGGIEVTVL # GANFHPTLQFNCVFGDMPASSTQRWSDNTLVCILPPRATAGMVSVWFDGFPKVEEQPPSFFTYSDESDRAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g782 ### # start gene g783 3 AUGUSTUS gene 2792044 2793510 0.66 + . g783 3 AUGUSTUS transcript 2792044 2793510 0.66 + . g783.t1 3 AUGUSTUS start_codon 2792044 2792046 . + 0 transcript_id "g783.t1"; gene_id "g783"; 3 AUGUSTUS CDS 2792044 2793510 0.66 + 0 transcript_id "g783.t1"; gene_id "g783"; 3 AUGUSTUS stop_codon 2793508 2793510 . + 0 transcript_id "g783.t1"; gene_id "g783"; # protein sequence = [MTGKIEDAKNVAMRIVGAGEGTDSQNSNEQSASNSMNMQLSTTLSASRDLRSLMLVRAGNSEDFESLIADFLKLIDTP # VDHPSAQVVSASKALSHMTKSGQSLLHLSAFLGYATIVEFLVKHGIDMDLRDRNGYTALHFASMAGSRDCVAKLLKAGADREIVNALGKTAEEVVAKG # MGKTVFEEILEEISDSQEGVASDDEEAEWGDVEEEVEVKPVVNSSRRAKMDRRARRSRAASRKASREELRSHHTSKTPSMTPLATAVPVDGKKEKEAA # AVDNEKQALSFIDMLQRTMAQLPGAPQLPLPHFPLLPGVPAMPWEALHQLNQFQFPMVFPVAVPLLPGWFTAQHRQDQDAADVADDNAGKLAGPLKAA # QEWRALWEKWLAHVPWQATEMPPPPQYTPRAAPTEEDLTSTPSQLVRRASSRASDPEPVAAPRPIASGSRPLPDARRRYDYDAVSVTDQEVKAYAYQP # KPQQKKRKSLEIPVFHHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g783 ### # start gene g784 3 AUGUSTUS gene 2794383 2795732 0.99 + . g784 3 AUGUSTUS transcript 2794383 2795732 0.99 + . g784.t1 3 AUGUSTUS start_codon 2794383 2794385 . + 0 transcript_id "g784.t1"; gene_id "g784"; 3 AUGUSTUS CDS 2794383 2795732 0.99 + 0 transcript_id "g784.t1"; gene_id "g784"; 3 AUGUSTUS stop_codon 2795730 2795732 . + 0 transcript_id "g784.t1"; gene_id "g784"; # protein sequence = [MCAFRSSGFAILNPYIQDSRPNFSAFGGFGAGSTSSFQFTPPASPFSPSPSTTASPFAKPAVSSTATNAARTFSNLIA # SSFEPQPSSSNPTPLASQPTLPDFSVSNGDPTVEYYKSLRGLNTSILTAITKSVERDSFADVSFLLERYKTFRANVQNEYDEKSRKDNRSSLTSLSTA # SVGSFSMPTPPSSFSGFGAKLAESSTVTGGGFTPKLDNGKSLSSPFSFPSANASSNPFSFPPAGSLATSTPKPTESTPKHTESSTTMSLFGSKPPPAS # AFSFGTPPSTSGSTTNLFGAPPSPSVFGMPSNNNPSSSTSGTAPKFGGFGGFGIAGKSSPSAGSIGNPVGFGFGSPSKSGSSSSFSFANPPPSSVKAE # EETVKTEADENGGSQATQSDSNADDTGPKSLFGVNPHDEEGEGEENEETIHSIRSKAFRMKKADEGTSGWADMGTGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g784 ### # start gene g785 3 AUGUSTUS gene 2797147 2798215 0.32 - . g785 3 AUGUSTUS transcript 2797147 2798215 0.32 - . g785.t1 3 AUGUSTUS stop_codon 2797147 2797149 . - 0 transcript_id "g785.t1"; gene_id "g785"; 3 AUGUSTUS CDS 2797147 2797171 0.32 - 1 transcript_id "g785.t1"; gene_id "g785"; 3 AUGUSTUS CDS 2797656 2798215 0.34 - 0 transcript_id "g785.t1"; gene_id "g785"; 3 AUGUSTUS start_codon 2798213 2798215 . - 0 transcript_id "g785.t1"; gene_id "g785"; # protein sequence = [MAAPPTRPHIVLRPSTFFKPSDTVDDDAWDSASDSEEPAQSTFTFPSWSRASTTAPKPVPRPITSDNPSSTSLAFSYT # HLNAPNPSSYPPRNTDTPQPPKNGWTIVRTVPGRRSSTDTRSSNQDDSFDHVPSTDGDADVEGDMILGDLDPEPAAGEPSQTAPENSKSTSVRTDAET # IVNGTSLWALCRYGIRLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g785 ### # start gene g786 3 AUGUSTUS gene 2799179 2799640 0.95 - . g786 3 AUGUSTUS transcript 2799179 2799640 0.95 - . g786.t1 3 AUGUSTUS stop_codon 2799179 2799181 . - 0 transcript_id "g786.t1"; gene_id "g786"; 3 AUGUSTUS CDS 2799179 2799640 0.95 - 0 transcript_id "g786.t1"; gene_id "g786"; 3 AUGUSTUS start_codon 2799638 2799640 . - 0 transcript_id "g786.t1"; gene_id "g786"; # protein sequence = [MEQTSPRKKRKTHSDDIQVGDHTWQDHIPGFDDDEEDDVQVLNDELLSSAETSSSRRSSAPENAIIHASIPISAKASG # KKRFIESQTFCPVCGTELDTNDNRKLNSHVDFCLNREAIQEAEGHSAEAEAKTRSQAQAWSRFLDSKTKPRGKRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g786 ### # start gene g787 3 AUGUSTUS gene 2802172 2803452 0.91 - . g787 3 AUGUSTUS transcript 2802172 2803452 0.91 - . g787.t1 3 AUGUSTUS stop_codon 2802172 2802174 . - 0 transcript_id "g787.t1"; gene_id "g787"; 3 AUGUSTUS CDS 2802172 2803452 0.91 - 0 transcript_id "g787.t1"; gene_id "g787"; 3 AUGUSTUS start_codon 2803450 2803452 . - 0 transcript_id "g787.t1"; gene_id "g787"; # protein sequence = [MDNRVFAVIIGIDQYKSGDIWNLEACVDDAKSMKRWLVNDLGVPKHQIAMLVNEKATKQNIESTLNTHLLNNSRIRKG # DAILIYFAGHGSTLKAPRDWLLEKNLRCNVEVLCTYDHDTKGPDGRVAGISARAMHTFIHDLSKLKGNNVTLMLDACFTSPPPSSRDRSCIRWTATGK # AVAEDLYRGELPCPRLQKRNESFYNRHWTTHTVITACRPGATAFEGKEGGKLTSVFLETVRSVALHDTSFSDLLEEIKRRMGEGQSIYCSGVHPARLF # NSIPFTQDHSYIPVQFHLQKGIRIELGSLHGIEKGGEFSIHGHNYVGSRNPVLASFTVQQVHPTWCVGKTKTSSLLPRHCWARVPRNPSSYRLIKAFR # ALLHSAALHKPLAASRSVSIVSISDIKNSTTKSELIETAEAILASKPLLAPLMK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g787 ### # start gene g788 3 AUGUSTUS gene 2804274 2805170 0.28 + . g788 3 AUGUSTUS transcript 2804274 2805170 0.28 + . g788.t1 3 AUGUSTUS start_codon 2804274 2804276 . + 0 transcript_id "g788.t1"; gene_id "g788"; 3 AUGUSTUS CDS 2804274 2804294 0.28 + 0 transcript_id "g788.t1"; gene_id "g788"; 3 AUGUSTUS CDS 2804382 2805170 0.97 + 0 transcript_id "g788.t1"; gene_id "g788"; 3 AUGUSTUS stop_codon 2805168 2805170 . + 0 transcript_id "g788.t1"; gene_id "g788"; # protein sequence = [MMSNPSVLDASLVDLAPSAYDTIIASLPPRSSSTHLRHATDAEKVGQPSAPSSVREVWRKSKGSPSSAASLSPKTQGK # QPQNSTMSPHDSFVLLQDSVVHHTPSISTPSPSKKGSIKAKNSANPASVSRPPETVVQNSPLSHHLRSTVRLFNLISSRTDIDHPLCTECTQVLLTSL # QRQLDETKKERDGYIAFEKEVRKERERESQGLTKEEAEKKIEKLKLDEQLAVEQLKEAEKERLQLDEELRVLEQEEKLLELDEAKYVLHRIFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g788 ### # start gene g789 3 AUGUSTUS gene 2809193 2809865 0.44 - . g789 3 AUGUSTUS transcript 2809193 2809865 0.44 - . g789.t1 3 AUGUSTUS stop_codon 2809193 2809195 . - 0 transcript_id "g789.t1"; gene_id "g789"; 3 AUGUSTUS CDS 2809193 2809476 0.72 - 2 transcript_id "g789.t1"; gene_id "g789"; 3 AUGUSTUS CDS 2809649 2809677 0.46 - 1 transcript_id "g789.t1"; gene_id "g789"; 3 AUGUSTUS CDS 2809822 2809865 0.69 - 0 transcript_id "g789.t1"; gene_id "g789"; 3 AUGUSTUS start_codon 2809863 2809865 . - 0 transcript_id "g789.t1"; gene_id "g789"; # protein sequence = [MASLRLATSAARRAPSTDVVQVNLFSGGFATVHPNNKLTINAVEAAPLEDFSVEVCTSGPSDIFLSRTNSSLSFLQSI # RVNLQEALKVASGNGSEEDKLEARIEAEVYESLQYALGSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g789 ### # start gene g790 3 AUGUSTUS gene 2811098 2811301 0.6 + . g790 3 AUGUSTUS transcript 2811098 2811301 0.6 + . g790.t1 3 AUGUSTUS start_codon 2811098 2811100 . + 0 transcript_id "g790.t1"; gene_id "g790"; 3 AUGUSTUS CDS 2811098 2811301 0.6 + 0 transcript_id "g790.t1"; gene_id "g790"; 3 AUGUSTUS stop_codon 2811299 2811301 . + 0 transcript_id "g790.t1"; gene_id "g790"; # protein sequence = [MPVVSSTEDTTCDASLENDNARTSESDYEEAMDISPDDERIPSTTAASPGNAAPKFSRRMPGIVFQH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g790 ### # start gene g791 3 AUGUSTUS gene 2814360 2815598 0.98 - . g791 3 AUGUSTUS transcript 2814360 2815598 0.98 - . g791.t1 3 AUGUSTUS stop_codon 2814360 2814362 . - 0 transcript_id "g791.t1"; gene_id "g791"; 3 AUGUSTUS CDS 2814360 2815598 0.98 - 0 transcript_id "g791.t1"; gene_id "g791"; 3 AUGUSTUS start_codon 2815596 2815598 . - 0 transcript_id "g791.t1"; gene_id "g791"; # protein sequence = [MQESKSVYRFEDSEKLHSTRLEYDMTTPIANFSKPLPPPVEERSLPALPSSSECDTDDASLFSCATPLETSHNLFNVQ # PELEVLSCSMPPIIAHSLSVPCTSPQSLRSTSIANLSKRSMVKQRLAQMEQDHSQNSPKFPPASPRRGRTLPSPFSPSKDQHAEFKGATLVMQQTNTS # DSIVDSYSYSDQTVPASTGARLPWSRPAVSPIAEDIKKEVTEAKFLHNAIPLRVDTSAETLYRSRTNVETSENFPMHPQPYHDTADLIAAQEVQNSKQ # TVALNHLRHTLSGVDKKISNTDRTLLSIDQRLEGLQSCIDSVVSKSSSDKSDNAHAQDLADIHESLHGLQALLTSNVVDILKGMEEAESKSRPSPESI # TSQSTVASMEIQAQVRFMIIRDHVKTDSPCLVHRHTYTLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g791 ### # start gene g792 3 AUGUSTUS gene 2818885 2819410 0.18 - . g792 3 AUGUSTUS transcript 2818885 2819410 0.18 - . g792.t1 3 AUGUSTUS stop_codon 2818885 2818887 . - 0 transcript_id "g792.t1"; gene_id "g792"; 3 AUGUSTUS CDS 2818885 2819253 0.82 - 0 transcript_id "g792.t1"; gene_id "g792"; 3 AUGUSTUS CDS 2819360 2819410 0.18 - 0 transcript_id "g792.t1"; gene_id "g792"; 3 AUGUSTUS start_codon 2819408 2819410 . - 0 transcript_id "g792.t1"; gene_id "g792"; # protein sequence = [MLHTTPDDTWDIIMKIHPEQRENRSIINVSSTSGLHGNVGQANYAAAKAAVIGLTKTIAKEWGPFGVRANTVAFGLIH # TRLTAAKEDGATMEIDGKKVALGVPGAKPPTDAARQSGEAYPLIPLKRGGNADEAAASMLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g792 ### # start gene g793 3 AUGUSTUS gene 2821410 2822138 0.89 + . g793 3 AUGUSTUS transcript 2821410 2822138 0.89 + . g793.t1 3 AUGUSTUS start_codon 2821410 2821412 . + 0 transcript_id "g793.t1"; gene_id "g793"; 3 AUGUSTUS CDS 2821410 2822138 0.89 + 0 transcript_id "g793.t1"; gene_id "g793"; 3 AUGUSTUS stop_codon 2822136 2822138 . + 0 transcript_id "g793.t1"; gene_id "g793"; # protein sequence = [MHQGHKDIAVVRLGSSASINVDEVDKRRRSREIDAVPDFLATSPSSPPITPHVPSAIIEEDEDQLFPLPSPRRSPNSS # PANSTSASPMPSPNASSSHLSPAASSNSPTIPEEGILAKSLMRKGRCEKGLLTPEADAGPTLSSISISVSSEDIPSLSLSVSPDATSSPTSPTFVESA # RNMSPNLPPTPTSSRHRFHSQSPEHRRESFTKERRSSFGSTVLRATGDIIKGVSFNSGTMHGGMSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g793 ### # start gene g794 3 AUGUSTUS gene 2824574 2825350 0.95 + . g794 3 AUGUSTUS transcript 2824574 2825350 0.95 + . g794.t1 3 AUGUSTUS start_codon 2824574 2824576 . + 0 transcript_id "g794.t1"; gene_id "g794"; 3 AUGUSTUS CDS 2824574 2825350 0.95 + 0 transcript_id "g794.t1"; gene_id "g794"; 3 AUGUSTUS stop_codon 2825348 2825350 . + 0 transcript_id "g794.t1"; gene_id "g794"; # protein sequence = [MKTSQATITFAEICGLGLDIRFTDSAEPLFIDVEGDNFETLFVISTSQPPGSAAQTRLASTGPRKRLREDTPAESSRF # KKPMKAVVQSTTDRMSIARDTTPASDRLSSSRQMPPPATPPSPGHQHSSHHTLHAPQTSASVAPKLSQELPLFLPGSSQLSILDEVALRESGLGIEHM # SAEEFNDMFEAHGEEVNIEEVPPNPNSTAQTDRIGGGLEEDAMFTPTQTGDTLSNDEPRVSFLGNCAMCLVLNVYPGVLSAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g794 ### # start gene g795 3 AUGUSTUS gene 2825455 2826354 0.58 - . g795 3 AUGUSTUS transcript 2825455 2826354 0.58 - . g795.t1 3 AUGUSTUS stop_codon 2825455 2825457 . - 0 transcript_id "g795.t1"; gene_id "g795"; 3 AUGUSTUS CDS 2825455 2826354 0.58 - 0 transcript_id "g795.t1"; gene_id "g795"; 3 AUGUSTUS start_codon 2826352 2826354 . - 0 transcript_id "g795.t1"; gene_id "g795"; # protein sequence = [MNQIIPIAAPNLERVEFVVRGPDRARRFGEIWQGRPVLNGGCPRLKQATLRGFALHFARPPLSSVTRLHLDYRGHIPL # NYDEFRELLTKAPSLENFSINGIVIESMPRNHTRTVIVLPKLLRLGISSLHGQVYSGILLTVKAPFLQSLILEGAQDSDLDPFLDAPYDLPHLRSFSL # CGSAFAPLKLNKIYVLFPSLEEIVLMDMVFNPSEILRIVSESICDLGLAPLHLIQSTLSTSQEPQTLVLMLNPDQRSDLRELLQQRLIDEEIVDLDNS # KWTFMKFFDWLQHFVTAEILLSVTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g795 ### # start gene g796 3 AUGUSTUS gene 2828447 2829055 0.32 + . g796 3 AUGUSTUS transcript 2828447 2829055 0.32 + . g796.t1 3 AUGUSTUS start_codon 2828447 2828449 . + 0 transcript_id "g796.t1"; gene_id "g796"; 3 AUGUSTUS CDS 2828447 2829055 0.32 + 0 transcript_id "g796.t1"; gene_id "g796"; 3 AUGUSTUS stop_codon 2829053 2829055 . + 0 transcript_id "g796.t1"; gene_id "g796"; # protein sequence = [MFNISVCCRSLLMVIAVEITGIRDLLMNYISFESAICVLHKVSVIGWPTNIPWKYLQKLAAEEVRALHASWSDGKTHW # YCMTASEHRSLVCHLTTEGKLDPKERKKRKPSKSKKHIDGNELLNTASNSSSDNNDNEPSSSISGPSNTRGVGKNAAQKVRMNHPSSKAAGPSAKHTE # PLKETHAKGKGAESDRGNKGGKGKGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g796 ### # start gene g797 3 AUGUSTUS gene 2830337 2831503 0.94 + . g797 3 AUGUSTUS transcript 2830337 2831503 0.94 + . g797.t1 3 AUGUSTUS start_codon 2830337 2830339 . + 0 transcript_id "g797.t1"; gene_id "g797"; 3 AUGUSTUS CDS 2830337 2831503 0.94 + 0 transcript_id "g797.t1"; gene_id "g797"; 3 AUGUSTUS stop_codon 2831501 2831503 . + 0 transcript_id "g797.t1"; gene_id "g797"; # protein sequence = [MSTPIPPAPNTSADDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSASAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g797 ### # start gene g798 3 AUGUSTUS gene 2831554 2835270 0.89 + . g798 3 AUGUSTUS transcript 2831554 2835270 0.89 + . g798.t1 3 AUGUSTUS start_codon 2831554 2831556 . + 0 transcript_id "g798.t1"; gene_id "g798"; 3 AUGUSTUS CDS 2831554 2835270 0.89 + 0 transcript_id "g798.t1"; gene_id "g798"; 3 AUGUSTUS stop_codon 2835268 2835270 . + 0 transcript_id "g798.t1"; gene_id "g798"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIYRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPTSSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLWELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYICLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEISTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDTGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g798 ### # start gene g799 3 AUGUSTUS gene 2838237 2840948 0.62 + . g799 3 AUGUSTUS transcript 2838237 2840948 0.62 + . g799.t1 3 AUGUSTUS start_codon 2838237 2838239 . + 0 transcript_id "g799.t1"; gene_id "g799"; 3 AUGUSTUS CDS 2838237 2839261 0.87 + 0 transcript_id "g799.t1"; gene_id "g799"; 3 AUGUSTUS CDS 2839373 2840948 0.62 + 1 transcript_id "g799.t1"; gene_id "g799"; 3 AUGUSTUS stop_codon 2840946 2840948 . + 0 transcript_id "g799.t1"; gene_id "g799"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLISIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGESTDPLTVRQQEKLPERRVSPAV # SEQSRASSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWEHTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEK # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSSGAVRFEPPPSRVNIPNYQAIQILRNANLA # EAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMRHMHQLLVRSEESEAMLCSQETRHRMLLAESDTLMLSE # ELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQ # NATPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEA # VPPQGAPFGTPFVTGAQMNRPGMAFESAHSQESIAMIQQQARVIETLQEQLHEVKKGFTAGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVV # PQPRSWQATEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPHIFLVNREI # ENDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g799 ### # start gene g800 3 AUGUSTUS gene 2842750 2847048 0.74 + . g800 3 AUGUSTUS transcript 2842750 2847048 0.74 + . g800.t1 3 AUGUSTUS start_codon 2842750 2842752 . + 0 transcript_id "g800.t1"; gene_id "g800"; 3 AUGUSTUS CDS 2842750 2847048 0.74 + 0 transcript_id "g800.t1"; gene_id "g800"; 3 AUGUSTUS stop_codon 2847046 2847048 . + 0 transcript_id "g800.t1"; gene_id "g800"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTPQSPPEAPQQPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFTNESTEEEVEEILEAGRSTMEKVTPNPAKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIVGTHVVERRSDPTIQGKPISLIGAAGMDHLLREGTPAYFLHISPTKEESPTEEMLRASDSSV # TEGVQQPKDPESGDPSSEQGGVVRELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKE # YIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGS # FEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEASHVGHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEK # VKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILS # QLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLG # AKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALRRIARNEEESLVWEDGLIKRGGRIYVPDVGTLR # REVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHPCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPATAGPEKYDAILVV # VCRLTKQAIYVPCHTTNNAEDFANLFITHVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCAYDQD # DWDLLLPIAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLERVQGAEVNEYAANLKELHTYLQERIRTANEVYTKYANQKRQEAPDWKEGDRVWLNME # NVKTRRPMKKLDHKWTGPYSILSQVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFPDKFRRQNSPPPPIFVKGESEHFVESILDSKPIKGKPEEVEYLV # KWEGYDEDFNSWVGWEGMAGSLELMKQWHREHNRKRKPKRDQWELLEKQAEDDRGEAVGSTGGTGNERENKDGWRRRNTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g800 ### # start gene g801 3 AUGUSTUS gene 2847262 2850016 0.5 - . g801 3 AUGUSTUS transcript 2847262 2850016 0.5 - . g801.t1 3 AUGUSTUS stop_codon 2847262 2847264 . - 0 transcript_id "g801.t1"; gene_id "g801"; 3 AUGUSTUS CDS 2847262 2848479 0.9 - 0 transcript_id "g801.t1"; gene_id "g801"; 3 AUGUSTUS CDS 2848613 2850016 0.56 - 0 transcript_id "g801.t1"; gene_id "g801"; 3 AUGUSTUS start_codon 2850014 2850016 . - 0 transcript_id "g801.t1"; gene_id "g801"; # protein sequence = [MTAPHASTSAAASDALGVPPSSPNRRNSDVDEIVSSVEEPSLGQLSLFKSVFGVGVSLARYIVDDPLWSTLAAAGLPC # PTCVRGKKEGSCSLVPHLAQCSNCDDKKPCVLGRLARFRYFSRKCSRDLAFARRFLEVHGDPGQRTRYSLPTEQWRVLYDRVEQSTNSTSALLELNPL # DDQDQHELDRQELREFRQRQPLVPVPSTSAPHTSQLAGSSSLLPPALVTKKRKRPARVDPGFTPKRRRPEPAVDRSSPIAPPVPQVEGESGYRRVVLV # LRPPHVPDSEIPTLPGSGHLVPEGSSHRSVVEQSRSQGYAEIPHRVPQAGSFEQFVPPSEVEDFSRGRIKTPPVQQVSNWFSFFSLLSDMPIQRSREP # MRPYPRSQASSALRVENDRLKAEVEEFRTLLAQSRGQVSTLTSLLRDTSSSLDLRSQELEASRRSLEEVARDHVEYQRVLSQFQAIEAELPEPASEEI # GELRKQVDDASSRSSDAYAELDSANARALRQRDRLEELEEMVCSYRDRAHVAEGLIRQYPEDEGLYEVELPSLSEVQRKLDASEALVRRLATFAHRLY # RADPANLLHYHNRYVGGLLEAITLLLYRGLHHTPERLSSVVDFVLGYLSQARFTHGELHLRSTSSLLYYYSNAADRVEGLYREMLTHSRFPSHDAFLT # AAQHAGYVDARPGSLEPPLHRRFFSFDHPIPIAPSPTSDHLPAVPAMDSIMVSWERLIANYIRDMIDTPGPHYFFPTSADLTVVGGGSSPVEGSVLAE # EDDENAPRAVVEVAGEVGANVATPAEEDDRGLPVGGSETPAMARTPLFLLASRSPSSPLLPPSVPVVPHIIDLTMIDDDGEDLYESREEFEARMQGEV # AVKDERSSPAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g801 ### # start gene g802 3 AUGUSTUS gene 2851302 2852000 0.64 + . g802 3 AUGUSTUS transcript 2851302 2852000 0.64 + . g802.t1 3 AUGUSTUS start_codon 2851302 2851304 . + 0 transcript_id "g802.t1"; gene_id "g802"; 3 AUGUSTUS CDS 2851302 2852000 0.64 + 0 transcript_id "g802.t1"; gene_id "g802"; 3 AUGUSTUS stop_codon 2851998 2852000 . + 0 transcript_id "g802.t1"; gene_id "g802"; # protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFSAENPP # FGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPTLKEAIKRAI # SVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLAHMRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g802 ### # start gene g803 3 AUGUSTUS gene 2852420 2853340 0.85 + . g803 3 AUGUSTUS transcript 2852420 2853340 0.85 + . g803.t1 3 AUGUSTUS start_codon 2852420 2852422 . + 0 transcript_id "g803.t1"; gene_id "g803"; 3 AUGUSTUS CDS 2852420 2853340 0.85 + 0 transcript_id "g803.t1"; gene_id "g803"; 3 AUGUSTUS stop_codon 2853338 2853340 . + 0 transcript_id "g803.t1"; gene_id "g803"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQEQWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLAENEIITATEESPIHRIRANHKTRWAWVKAGILEEQTEEVWCSAGFTYSQQLAEETNRDKPIKTFEERVPEQYRDFKKVSPNLP # LSDYLPISPGITLSIWYPEHQQPCGQRSTQCP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g803 ### # start gene g804 3 AUGUSTUS gene 2853673 2854848 0.24 + . g804 3 AUGUSTUS transcript 2853673 2854848 0.24 + . g804.t1 3 AUGUSTUS start_codon 2853673 2853675 . + 0 transcript_id "g804.t1"; gene_id "g804"; 3 AUGUSTUS CDS 2853673 2854848 0.24 + 0 transcript_id "g804.t1"; gene_id "g804"; 3 AUGUSTUS stop_codon 2854846 2854848 . + 0 transcript_id "g804.t1"; gene_id "g804"; # protein sequence = [MFFSLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLENLRPEKCEFEQQQIEYLGLI # ISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIQNFARIARPLNGLTKKDTSFNWTGTQQEAFDTLREAFISAPILALWAPDRPTRIEV # DASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDWEMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFD # FHMIHCPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIATSILRNPLEDRIQKASEWEAQVLEGLETVKKHGLQRLANGIAASVISGITGP # NCFGLAETCSNPKSPKVHQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g804 ### # start gene g805 3 AUGUSTUS gene 2856182 2857818 0.31 + . g805 3 AUGUSTUS transcript 2856182 2857818 0.31 + . g805.t1 3 AUGUSTUS start_codon 2856182 2856184 . + 0 transcript_id "g805.t1"; gene_id "g805"; 3 AUGUSTUS CDS 2856182 2856257 0.37 + 0 transcript_id "g805.t1"; gene_id "g805"; 3 AUGUSTUS CDS 2856368 2857818 0.47 + 2 transcript_id "g805.t1"; gene_id "g805"; 3 AUGUSTUS stop_codon 2857816 2857818 . + 0 transcript_id "g805.t1"; gene_id "g805"; # protein sequence = [MTTILNISLSLSGTSLPPFCLVAPPFLAPRRGQPPVVTPARGQSITRIESPILQAIARRTGKQPQPRAASESPRDPPP # HFDLDTGDHDDQDPPVDPDNPGVDNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGDPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTV # LAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILNPDLDSLPAWTSSFMALVKDLQD # NFGVYDAQGEAEDALGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLAAYRLEVLRIDNRYWKREETKKREAG # KPFIARNPKKGSSDFKTGSTNQHNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGK # HQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g805 ### # start gene g806 3 AUGUSTUS gene 2860641 2862332 0.97 + . g806 3 AUGUSTUS transcript 2860641 2862332 0.97 + . g806.t1 3 AUGUSTUS start_codon 2860641 2860643 . + 0 transcript_id "g806.t1"; gene_id "g806"; 3 AUGUSTUS CDS 2860641 2862332 0.97 + 0 transcript_id "g806.t1"; gene_id "g806"; 3 AUGUSTUS stop_codon 2862330 2862332 . + 0 transcript_id "g806.t1"; gene_id "g806"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNCGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPDGPGGPGGPGGPGGPGGPRSPNSPDIPNEQRAMLDLLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGVYDAQGEAEDALGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLAAYRLEVLRIDNRYWKREETKKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNTNGKPQNSSNSGQSGGQRPVFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g806 ### # start gene g807 3 AUGUSTUS gene 2862665 2866555 0.97 + . g807 3 AUGUSTUS transcript 2862665 2866555 0.97 + . g807.t1 3 AUGUSTUS start_codon 2862665 2862667 . + 0 transcript_id "g807.t1"; gene_id "g807"; 3 AUGUSTUS CDS 2862665 2866555 0.97 + 0 transcript_id "g807.t1"; gene_id "g807"; 3 AUGUSTUS stop_codon 2866553 2866555 . + 0 transcript_id "g807.t1"; gene_id "g807"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHPDSPQTSVPSAINTVDAKVAV # PLPEPSPSVSPTILETPPGDSLRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSERELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEVA # LRFQNRVNIFYIYKVQKTRLYKRRQGNKKSTKSWPKADVRCPLHYYSTTSLSFSFSDCAAVGAISSSSISSSSPSPSLSTSFSFSSTSLSSSSSSPLS # STILRRFRGRRRSAVLLDGPAVAGPSPIPNIPILVSMEMRRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g807 ### # start gene g808 3 AUGUSTUS gene 2868455 2871082 0.59 + . g808 3 AUGUSTUS transcript 2868455 2871082 0.59 + . g808.t1 3 AUGUSTUS start_codon 2868455 2868457 . + 0 transcript_id "g808.t1"; gene_id "g808"; 3 AUGUSTUS CDS 2868455 2869669 0.59 + 0 transcript_id "g808.t1"; gene_id "g808"; 3 AUGUSTUS CDS 2869757 2871082 0.9 + 0 transcript_id "g808.t1"; gene_id "g808"; 3 AUGUSTUS stop_codon 2871080 2871082 . + 0 transcript_id "g808.t1"; gene_id "g808"; # protein sequence = [MPFSLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTLEEHQEHVKEVLRRLRKHRLYANPDKCEFNMDTVEYL # GYILSPDGLTMSKEKVQTILEWHVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGAPWIWDNNCQEAFENLKIAFTSVPILAHWEPNRPII # VETDASDYAIAAILSIQTVDGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKDLEYFSTTKILTCQQVRWSEYLH # QFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYVQVNPHNFRPIFTNEQLTTSLRATFLEGPMLRASIIMDIEALHQAIILALPKDPSSVVGLELA # KDPSNERWSLGSDRLLRLDDRIYVPNHGDLRLQPKVRDFIRDYVTSCTTCGRNKPRHHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVV # DRSSKQAIFIPTFDTITSEQLAELFVIHVFSKHGVPNHVTSDHGSEFVSAFFRAHGKALSMELHYTSGYHPEADGQTEHVNQTLEQYIRIYCSYQQDD # WSPLLPIAEFAYNNAPNTSTGITPFFANKGYHPNITVWPEVDMKSDLARDFIINLDELHVFLREEILLAQSCYKEQADRKRISHPEFPIGSEVFVLAK # HIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLLDYLRRIHPVFHVSQLEPVTPNPFPNHTQSPPPPIEVDGEEEYNIAEILDSKLDRRYKRCPLRY # YIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPLKPVLRSCTPRNRAKATGCLSAEDEWDSSEVINNTAVTPLVPGERE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g808 ### # start gene g809 3 AUGUSTUS gene 2876546 2880109 0.98 - . g809 3 AUGUSTUS transcript 2876546 2880109 0.98 - . g809.t1 3 AUGUSTUS stop_codon 2876546 2876548 . - 0 transcript_id "g809.t1"; gene_id "g809"; 3 AUGUSTUS CDS 2876546 2880109 0.98 - 0 transcript_id "g809.t1"; gene_id "g809"; 3 AUGUSTUS start_codon 2880107 2880109 . - 0 transcript_id "g809.t1"; gene_id "g809"; # protein sequence = [MANIAVRFPSGKLLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHPDSPQTSVPSAINPVVAKVAV # PLPELSPSVSPTIQETPPGDSPRSRSRCRSRTSRAKPLLSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADIFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVNFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYCRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLHLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFWALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g809 ### # start gene g810 3 AUGUSTUS gene 2880532 2881926 0.23 - . g810 3 AUGUSTUS transcript 2880532 2881926 0.23 - . g810.t1 3 AUGUSTUS stop_codon 2880532 2880534 . - 0 transcript_id "g810.t1"; gene_id "g810"; 3 AUGUSTUS CDS 2880532 2881809 0.64 - 0 transcript_id "g810.t1"; gene_id "g810"; 3 AUGUSTUS CDS 2881924 2881926 0.23 - 0 transcript_id "g810.t1"; gene_id "g810"; 3 AUGUSTUS start_codon 2881924 2881926 . - 0 transcript_id "g810.t1"; gene_id "g810"; # protein sequence = [MTSSQNLGVSTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDGSGGLPRGEPGDPSGPG # GPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQ # RKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYG # RGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQHNNSQPSGSSAPFTPKPKPFSGGKPNNNGK # PQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRIKNNLCLFCGGKHQIADCNK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g810 ### # start gene g811 3 AUGUSTUS gene 2973540 2973923 0.58 - . g811 3 AUGUSTUS transcript 2973540 2973923 0.58 - . g811.t1 3 AUGUSTUS stop_codon 2973540 2973542 . - 0 transcript_id "g811.t1"; gene_id "g811"; 3 AUGUSTUS CDS 2973540 2973923 0.58 - 0 transcript_id "g811.t1"; gene_id "g811"; 3 AUGUSTUS start_codon 2973921 2973923 . - 0 transcript_id "g811.t1"; gene_id "g811"; # protein sequence = [MLAWLEEKYGIKGIRIFAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTG # AEPLLPFDIVESTWLVNPPNRILTRDELIGYVLKLCRNITHSLRKYDVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g811 ### # start gene g812 3 AUGUSTUS gene 2977766 2978982 0.42 - . g812 3 AUGUSTUS transcript 2977766 2978982 0.42 - . g812.t1 3 AUGUSTUS stop_codon 2977766 2977768 . - 0 transcript_id "g812.t1"; gene_id "g812"; 3 AUGUSTUS CDS 2977766 2978210 0.42 - 1 transcript_id "g812.t1"; gene_id "g812"; 3 AUGUSTUS CDS 2978333 2978982 0.42 - 0 transcript_id "g812.t1"; gene_id "g812"; 3 AUGUSTUS start_codon 2978980 2978982 . - 0 transcript_id "g812.t1"; gene_id "g812"; # protein sequence = [MKRLVFDGVHIPKKSGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIEDVDESDDEDTIKLIPSSRPTNQINS # GHRPYDHVQPRTYRPIQIDTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFNAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKT # NNYVSTLSEDGETEILDEPSRVQMIDTCIRIEDLWQDQTDIANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAI # GLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGKVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPTHTRGLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g812 ### # start gene g813 3 AUGUSTUS gene 2979217 2980707 0.64 - . g813 3 AUGUSTUS transcript 2979217 2980707 0.64 - . g813.t1 3 AUGUSTUS stop_codon 2979217 2979219 . - 0 transcript_id "g813.t1"; gene_id "g813"; 3 AUGUSTUS CDS 2979217 2980707 0.64 - 0 transcript_id "g813.t1"; gene_id "g813"; 3 AUGUSTUS start_codon 2980705 2980707 . - 0 transcript_id "g813.t1"; gene_id "g813"; # protein sequence = [MTTSSTSIESTRLIDTLTQTISQASNTIEPVKMTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIP # WFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFD # AEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINKPNSFSR # GHINLPFAADVPKTDRNYLQALKPKVEDKFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKE # NAKGMINLIPPSGPSNQSNRFERNTTPRSLNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDLKRYKSRDNARMPRDDPNIPRYKKIEQMAK # DLGWIVLNPILQTWKMTKMIKSWTSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g813 ### # start gene g814 3 AUGUSTUS gene 2981461 2981820 0.98 + . g814 3 AUGUSTUS transcript 2981461 2981820 0.98 + . g814.t1 3 AUGUSTUS start_codon 2981461 2981463 . + 0 transcript_id "g814.t1"; gene_id "g814"; 3 AUGUSTUS CDS 2981461 2981820 0.98 + 0 transcript_id "g814.t1"; gene_id "g814"; 3 AUGUSTUS stop_codon 2981818 2981820 . + 0 transcript_id "g814.t1"; gene_id "g814"; # protein sequence = [MSTPIPPATPAPPASAEDLMTQLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS # QAKLIKSALGFFTESAGDWATPHLLHFNAEHPPLEEIGRSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g814 ### # start gene g815 3 AUGUSTUS gene 2982686 2985370 0.95 + . g815 3 AUGUSTUS transcript 2982686 2985370 0.95 + . g815.t1 3 AUGUSTUS start_codon 2982686 2982688 . + 0 transcript_id "g815.t1"; gene_id "g815"; 3 AUGUSTUS CDS 2982686 2985370 0.95 + 0 transcript_id "g815.t1"; gene_id "g815"; 3 AUGUSTUS stop_codon 2985368 2985370 . + 0 transcript_id "g815.t1"; gene_id "g815"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFATRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDVILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEISYSHRAAANTESPIPELPN # PEPPTEPTQIEVPLEATLEESKSAVVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLIPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSIDLQEHRRV # VREVLIRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPAPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTRKDISFTWM # DTQQQAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRINTQADALSRMAAHQVLDNEDNRQQTVLKPNHFTKIAASILRNPLEDRIRKASQRE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCETCARK # KNPKTPTSCNSTIRRTLGSMGRGRGGPDNATT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g815 ### # start gene g816 3 AUGUSTUS gene 2987768 2989458 0.25 + . g816 3 AUGUSTUS transcript 2987768 2989458 0.25 + . g816.t1 3 AUGUSTUS start_codon 2987768 2987770 . + 0 transcript_id "g816.t1"; gene_id "g816"; 3 AUGUSTUS CDS 2987768 2988507 0.25 + 0 transcript_id "g816.t1"; gene_id "g816"; 3 AUGUSTUS CDS 2988648 2989458 0.97 + 1 transcript_id "g816.t1"; gene_id "g816"; 3 AUGUSTUS stop_codon 2989456 2989458 . + 0 transcript_id "g816.t1"; gene_id "g816"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGSRVPLRPLVPSSPLSAVPLTALNPRASGSAKEWFVPDILDPDLDSLPAWTSSFK # ALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEIARLPEPATLADYRQEVLRIDNRYWKRE # ETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNYSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNN # LCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g816 ### # start gene g817 3 AUGUSTUS gene 2989791 2993354 0.98 + . g817 3 AUGUSTUS transcript 2989791 2993354 0.98 + . g817.t1 3 AUGUSTUS start_codon 2989791 2989793 . + 0 transcript_id "g817.t1"; gene_id "g817"; 3 AUGUSTUS CDS 2989791 2993354 0.98 + 0 transcript_id "g817.t1"; gene_id "g817"; 3 AUGUSTUS stop_codon 2993352 2993354 . + 0 transcript_id "g817.t1"; gene_id "g817"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINTVVAKVAV # PLPEPSPSVSPTILETPPGDSPRSRSRSRSRTSRAKPLSSKFPFEPIYSYPTVSQFAAQLEIPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELIALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFIVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g817 ### # start gene g818 3 AUGUSTUS gene 2997508 2997978 0.42 - . g818 3 AUGUSTUS transcript 2997508 2997978 0.42 - . g818.t1 3 AUGUSTUS stop_codon 2997508 2997510 . - 0 transcript_id "g818.t1"; gene_id "g818"; 3 AUGUSTUS CDS 2997508 2997978 0.42 - 0 transcript_id "g818.t1"; gene_id "g818"; 3 AUGUSTUS start_codon 2997976 2997978 . - 0 transcript_id "g818.t1"; gene_id "g818"; # protein sequence = [MTPYSNAGPPTMGGQDQHEIGHARPRPRPRMNPVDFTLPDSFGAPFQPNTASGYQPPPDPRPLSSDTFPSPSELAASA # GNGQQGATKQKKKKGTDGKEAKDNGVAKPVNKKGDKRKSNAAVKPTKKTVDDDTPKFWLDVYAVNCDIFTYRFVSRGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g818 ### # start gene g819 3 AUGUSTUS gene 3002196 3003819 0.52 + . g819 3 AUGUSTUS transcript 3002196 3003819 0.52 + . g819.t1 3 AUGUSTUS start_codon 3002196 3002198 . + 0 transcript_id "g819.t1"; gene_id "g819"; 3 AUGUSTUS CDS 3002196 3002200 0.85 + 0 transcript_id "g819.t1"; gene_id "g819"; 3 AUGUSTUS CDS 3002312 3002690 0.92 + 1 transcript_id "g819.t1"; gene_id "g819"; 3 AUGUSTUS CDS 3002760 3003178 0.88 + 0 transcript_id "g819.t1"; gene_id "g819"; 3 AUGUSTUS CDS 3003255 3003819 0.63 + 1 transcript_id "g819.t1"; gene_id "g819"; 3 AUGUSTUS stop_codon 3003817 3003819 . + 0 transcript_id "g819.t1"; gene_id "g819"; # protein sequence = [MPFPQANVPPEPALATVNDLGSAAASKGKAHKVKLAPNVTWSPLPTQLKVNDAEDRIFIREFILRFSGIPGMALTKNQ # LEELEFIAGTHDLSDDENDYVDWVSETCVKSLVISLIGVLAAEEDSSATLVMKKAIQDVRNSGANLTKIWTALSSLRAALGRPEEVSVGKLQAEEPSD # DDDESSEDRIILEYPDPLPAPANHEHNVRSTRFAVADISLVVHSAQMIPVILGLIDAVMECHAIRVELDNGTKEGRKRFRESREVIKLENESKLNLFK # PSEITAQRHTHKSKVQDIENAAKVLSSAFSPRLSPLGSDPEGRVYWALTPGVSDREYALDYIVSRLPNVPKSKRPRNRKQRQQREEEDSEALREWSWF # IAVWGKKPHGNGVNEGGDEPQWWGFWNPQEIRNLAEWLSITNGLKSDPSDGNSTHSCNDLKILVKRLTEYAASLEWRTQGEER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g819 ### # start gene g820 3 AUGUSTUS gene 3006766 3007353 0.5 - . g820 3 AUGUSTUS transcript 3006766 3007353 0.5 - . g820.t1 3 AUGUSTUS stop_codon 3006766 3006768 . - 0 transcript_id "g820.t1"; gene_id "g820"; 3 AUGUSTUS CDS 3006766 3007353 0.5 - 0 transcript_id "g820.t1"; gene_id "g820"; 3 AUGUSTUS start_codon 3007351 3007353 . - 0 transcript_id "g820.t1"; gene_id "g820"; # protein sequence = [MHFASELFDTHPRFIQLKSMLMSLFNGEVVESIYLKGLEHVISVSLAPTPATLNTTTESATPLPKVHIRTYTTRLLAS # GSRIPRVELTPMGPSMDLVLRRHTNPDPELLKQAMRRPKLKKTDVEKGLGKKRKNLDVDEMGDLRGRVHVGKQDLSRLQTRKMKGLKAGAFEDGGDDG # AGDSGSDDDEASNKKRKLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g820 ### # start gene g821 3 AUGUSTUS gene 3007445 3007775 0.2 - . g821 3 AUGUSTUS transcript 3007445 3007775 0.2 - . g821.t1 3 AUGUSTUS stop_codon 3007445 3007447 . - 0 transcript_id "g821.t1"; gene_id "g821"; 3 AUGUSTUS CDS 3007445 3007714 0.63 - 0 transcript_id "g821.t1"; gene_id "g821"; 3 AUGUSTUS CDS 3007773 3007775 0.31 - 0 transcript_id "g821.t1"; gene_id "g821"; 3 AUGUSTUS start_codon 3007773 3007775 . - 0 transcript_id "g821.t1"; gene_id "g821"; # protein sequence = [MMALKRPDAISFSKKNVIHPLDAQNTASGSSSMSSLEFWSSKNDASMFVIGQTSKKRPNDLTFVRMFDGKVLDIVEAG # VENYVSMESVPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g821 ### # start gene g822 3 AUGUSTUS gene 3008338 3009718 0.23 + . g822 3 AUGUSTUS transcript 3008338 3009718 0.23 + . g822.t1 3 AUGUSTUS start_codon 3008338 3008340 . + 0 transcript_id "g822.t1"; gene_id "g822"; 3 AUGUSTUS CDS 3008338 3008382 0.49 + 0 transcript_id "g822.t1"; gene_id "g822"; 3 AUGUSTUS CDS 3008452 3008533 0.29 + 0 transcript_id "g822.t1"; gene_id "g822"; 3 AUGUSTUS CDS 3008622 3009718 0.79 + 2 transcript_id "g822.t1"; gene_id "g822"; 3 AUGUSTUS stop_codon 3009716 3009718 . + 0 transcript_id "g822.t1"; gene_id "g822"; # protein sequence = [MLAQRKSRYFLDGQRLSLIDSFEIEVFISGFATSRRSADVISRFAALPKLESNDNESATTGVLLEPRTLSHSTEDLLK # SVKLPPRPEDISEDYEVQLLERKFQSLNGISEDADSLHSPVYSQSSSRASSVNDLTLHDNTPESSYLGTVVKNTAADELRKLHANLESRLQPFWSSVV # PNRTVRLRLYTSPNHISTPSNSSVSMDNGPVSIQDVVTAPDGSFQARFTVGWTDLANHPGAEHIAFGDPAEEHELLVAAELLPLPSPISSVASSAASS # TTDFSSSSRPSKNNTTRSYQSNSPYDSSVTLPSIPPTTLRIPLTYSPVRVISDIDDTIKYSNVTGGARAVFHNVFVKELKDLVIPGMGEWYEEMWKKG # VRFHYVVHCAQVVLVIKNCTDCPSCSQMDHSSFFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g822 ### # start gene g823 3 AUGUSTUS gene 3024995 3025585 0.99 - . g823 3 AUGUSTUS transcript 3024995 3025585 0.99 - . g823.t1 3 AUGUSTUS stop_codon 3024995 3024997 . - 0 transcript_id "g823.t1"; gene_id "g823"; 3 AUGUSTUS CDS 3024995 3025585 0.99 - 0 transcript_id "g823.t1"; gene_id "g823"; 3 AUGUSTUS start_codon 3025583 3025585 . - 0 transcript_id "g823.t1"; gene_id "g823"; # protein sequence = [MRNIEKQLDKASKLGFGRKRRTSKADRQARVAAAHAARRKQRLPPSPSKADNEEERKQPSHPLSKADSDEDKSKEKGN # FEKLVAETAELERTVDNLREKSRYWKAKTMELREKKKRLEEEINRNEEEVQKKKREAEEEEREMSKKIEDLEMELEREKKLHKIEIAEHEATCVELEE # TYNNLRLQFDPIFERLRPFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g823 ### # start gene g824 3 AUGUSTUS gene 3033978 3035507 0.55 + . g824 3 AUGUSTUS transcript 3033978 3035507 0.55 + . g824.t1 3 AUGUSTUS start_codon 3033978 3033980 . + 0 transcript_id "g824.t1"; gene_id "g824"; 3 AUGUSTUS CDS 3033978 3035507 0.55 + 0 transcript_id "g824.t1"; gene_id "g824"; 3 AUGUSTUS stop_codon 3035505 3035507 . + 0 transcript_id "g824.t1"; gene_id "g824"; # protein sequence = [MLFLNRIFRSPSSSLSPTLYYPLHFLSLFTLALLINSVITFAEAAPVPPGISQQSEQFEAPKKINLLPSGFEKCTPSA # TSGFLFRVGFYESTRKKTTRSGHGVLVLCIGKNNCFGYTTTTTAGGGGTSAAGTQHSNGLVIHTTTQRRTDTSAIRSDRYQLLPNITPNCDKFNTWSK # QNHEKTLVDFLMSIADLQNALTKLDATVTVTIDSQVSYILGVLSYLHSEGMIIAYDKPQIKKFLEQPQSLKPLSVPSTLSWGFRGYKKKTNSNSNMNT # DAKTRRSREGWMFLKDMNLPLHEKTSSLLCFGIDHCFGLRSDDMTVRDINPTSKRDKGHHYLDRRYHFVLGSATLYPSFNLQRFEGHLGTSTTSFFAR # LIGHSQHPAQFADIRSEEIKKETGLEKRDGENMDTFYFRVLLGYMAAKEIIGNYNTKTYDEIMKALELAKAGKTNAAVAEEEPGDDVSSSLPSGGGST # QPAHDSLGTNSQGGGATNLPPRISVLSMLNARVNTLPNH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g824 ### # start gene g825 3 AUGUSTUS gene 3041173 3043471 0.69 - . g825 3 AUGUSTUS transcript 3041173 3043471 0.69 - . g825.t1 3 AUGUSTUS stop_codon 3041173 3041175 . - 0 transcript_id "g825.t1"; gene_id "g825"; 3 AUGUSTUS CDS 3041173 3041221 0.73 - 1 transcript_id "g825.t1"; gene_id "g825"; 3 AUGUSTUS CDS 3041304 3043471 0.7 - 0 transcript_id "g825.t1"; gene_id "g825"; 3 AUGUSTUS start_codon 3043469 3043471 . - 0 transcript_id "g825.t1"; gene_id "g825"; # protein sequence = [MLQETRIQPNSTIRSPTGFTAHALNRRRSADNIENPWGGVATLVRDGLESRVRVDLSSPDILAVQVNGIVLFNTYIIP # ESSRTDWTQWADLHPWDALAQSIHLATTLDIPFVISGDINARTGTSIPYQEHAIRTSSDSVVSTRGRRLLELCSELRLTIMNGCSAIPGTHSSSTSFQ # HRHSMDGTPTTYSSVIDYVLASPLASFFISELAVSTETKWSDHAYLSWDLLVPGPELTRLPPTQHPRPHIMIPIISEIDHLQQQLLHSQKLTHPQRLL # KLYGHSSTSSSSFPLKVFTDGSCLRNNTAAACAGLGIYIGPNHHLNLSARILGPQRNNRAELYAILVTIQRTSAHRQLEIYTDSSYAIQSIVYNAPEN # AQCGWDCPNGDLLNTLSQWISARTATIVFTHVRAHRGIIQNELADQLAKAGACLPLPHEGSELDFISCPIPSPHLPQLLSNIPKVSTSLPDPRSLAPP # PQLVHTPSAVCHRGRTHRRELEDTNLSRLQSAAAAGGAAFWKFYKSLSNSDKPLPRVTLEQLTNCFIPRMNPPDPRTTSFDPQILQQETNRANAIPDP # SPPSAFPSFNSVICENDIATIKSYLKRTTHSDSTGADLITYSIIQDIDNDRLASFFDRAFQLKEFPTSWLVSLIVAIPKPGKDSVDPNNYRAVALESC # ILKFASLLLHLKLSQALEEAHILPASQNGFRAGYRTNNNVFILRTLIEKAKSLGDPLSPANTLTGSVPSTAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g825 ### # start gene g826 3 AUGUSTUS gene 3043811 3045121 1 - . g826 3 AUGUSTUS transcript 3043811 3045121 1 - . g826.t1 3 AUGUSTUS stop_codon 3043811 3043813 . - 0 transcript_id "g826.t1"; gene_id "g826"; 3 AUGUSTUS CDS 3043811 3045121 1 - 0 transcript_id "g826.t1"; gene_id "g826"; 3 AUGUSTUS start_codon 3045119 3045121 . - 0 transcript_id "g826.t1"; gene_id "g826"; # protein sequence = [MANNDSGEYPVDFEDEYFSEVDLGNLENQPSQEADQFGLDNRTAEWMDPTEVATTDPNSLPPTAIVSAPNSLDSRFRD # LGRELRARLYTVSSHQQTSNRSADNFAAAGGVVTTSSPTRLQVPSRRGHKLGSTSKPRKSRNSETALQPITYPQSSLLDQGSSKETKGQQMHRLESNI # VRLETLINRRVEDIQTSTASAASSLREQMLQDIQQETSRGADRLASTQASHHLQLKNLIHQELHLLEDQLKSLISSSIPLEAMNDLLATMENLFSGTP # SFSAPSVTSPPVESSSTLTSPPAQPSVTATSLLYRISDSPLPRPVTKRQQEFSENAGRKQKRPRTDPRFAHSATVVLPPNAPPFPPTVNPHIFNIYRQ # WSSTLSSARGVTLPNVGFIERLGPRHARLCFSPFGLEAFLSTWSAHHAQVVALADISVSRDSTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g826 ### # start gene g827 3 AUGUSTUS gene 3045663 3046850 0.95 - . g827 3 AUGUSTUS transcript 3045663 3046850 0.95 - . g827.t1 3 AUGUSTUS stop_codon 3045663 3045665 . - 0 transcript_id "g827.t1"; gene_id "g827"; 3 AUGUSTUS CDS 3045663 3046850 0.95 - 0 transcript_id "g827.t1"; gene_id "g827"; 3 AUGUSTUS start_codon 3046848 3046850 . - 0 transcript_id "g827.t1"; gene_id "g827"; # protein sequence = [MTTIAAPGTQHTVGTVIHTVPQRRKKGPGISVAYQQLQITPDCDKFNDWSHTPPPPYAHDLGYNEPGTTLVDFLKSIK # NLQSALHDCANPNLDITVVIDSPVSYILAVLDYLYSKGMLIAYDKPSIKDLLDTISLLAKIPGPSRLSWGFLESKSKTNKQRWLKFPNIHSGKTLLCF # GVSHCFGLEGDARRVRDIRPIVGVGGLDGRYFFRMFSARLYPSFNLQKFEECLETSVFLAKLTGRSDDGGIRFAAIPHHEIKKETGLEKELGEDEDSF # YFRVLLGYMMVKGIIERYNSQTYAEMMRALGFARAGKTDAAVAAAVALGGDSGSHQPPPTLPPAVGISPGSTGSSTREGATHAQAGVVAEVHSSHGDN # TAGGSAMKPYPPRISVSSLLQNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g827 ### # start gene g828 3 AUGUSTUS gene 3053812 3055503 1 + . g828 3 AUGUSTUS transcript 3053812 3055503 1 + . g828.t1 3 AUGUSTUS start_codon 3053812 3053814 . + 0 transcript_id "g828.t1"; gene_id "g828"; 3 AUGUSTUS CDS 3053812 3055503 1 + 0 transcript_id "g828.t1"; gene_id "g828"; 3 AUGUSTUS stop_codon 3055501 3055503 . + 0 transcript_id "g828.t1"; gene_id "g828"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSIARIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPDGPGGPGGPGGPGGPGGPRSPNSPDIPNEQRAMLDLLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGVYDAQGEAEDALGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLAAYRLEVLRIDNRYWKREETKKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g828 ### # start gene g829 3 AUGUSTUS gene 3055836 3059399 1 + . g829 3 AUGUSTUS transcript 3055836 3059399 1 + . g829.t1 3 AUGUSTUS start_codon 3055836 3055838 . + 0 transcript_id "g829.t1"; gene_id "g829"; 3 AUGUSTUS CDS 3055836 3059399 1 + 0 transcript_id "g829.t1"; gene_id "g829"; 3 AUGUSTUS stop_codon 3059397 3059399 . + 0 transcript_id "g829.t1"; gene_id "g829"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSATNTVDAKVAV # PLPEPSPSVSPTILETPPGDSPRSRSRSRSRTSRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELIALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g829 ### # start gene g830 3 AUGUSTUS gene 3062273 3062848 1 - . g830 3 AUGUSTUS transcript 3062273 3062848 1 - . g830.t1 3 AUGUSTUS stop_codon 3062273 3062275 . - 0 transcript_id "g830.t1"; gene_id "g830"; 3 AUGUSTUS CDS 3062273 3062848 1 - 0 transcript_id "g830.t1"; gene_id "g830"; 3 AUGUSTUS start_codon 3062846 3062848 . - 0 transcript_id "g830.t1"; gene_id "g830"; # protein sequence = [MSFGSDSGSFLEYALSLPDPVGPDPETSDSSDQSSPSDHNSEQESVQSGTISDPDQSSYDSEFPGPFDYDYLHESSDF # DSDHPGPYDLRYLHSYPSSSASDSVESFHSFASDNSEAPELRPGDDRSGHPYLGPDGRLLDSERERRRVLGLCFYCGGEHMKVDCLKLQARTGQNYDA # DNSESDVPGSDDGSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g830 ### # start gene g831 3 AUGUSTUS gene 3075064 3076029 0.54 + . g831 3 AUGUSTUS transcript 3075064 3076029 0.54 + . g831.t1 3 AUGUSTUS start_codon 3075064 3075066 . + 0 transcript_id "g831.t1"; gene_id "g831"; 3 AUGUSTUS CDS 3075064 3076029 0.54 + 0 transcript_id "g831.t1"; gene_id "g831"; 3 AUGUSTUS stop_codon 3076027 3076029 . + 0 transcript_id "g831.t1"; gene_id "g831"; # protein sequence = [MAFHRLDSYDDSAHNYYPSHDDSDDIADEYEYGPSSSTEGGYSGYASTDYLGSSSASVPRYQPGQHLAPIHTGETLQF # DEHSTLYTQSNPSSTLSYAQNSQSHNNSVSEEYFGYQPEYSAASNHSYASHSYTSAGSAYSSTTGLRSVPPPRSRSPTPAGDDEDYYVVGNDSVHYTG # GLHDPEKADDYNNYNNYSSYDSRYAYDSLPTPTEPITPVETRHFGPAPSGRVTRRHNMKKRVQLTRGNLVLELPVPPNLVLPRMGEPEMMQTRYTAVT # CDPDDFSKQGFSLRQVEMQRTTEMFIVITMYNVRCLVCLFVIGYICY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g831 ### # start gene g832 3 AUGUSTUS gene 3093398 3093919 0.58 - . g832 3 AUGUSTUS transcript 3093398 3093919 0.58 - . g832.t1 3 AUGUSTUS stop_codon 3093398 3093400 . - 0 transcript_id "g832.t1"; gene_id "g832"; 3 AUGUSTUS CDS 3093398 3093724 0.8 - 0 transcript_id "g832.t1"; gene_id "g832"; 3 AUGUSTUS CDS 3093794 3093919 0.59 - 0 transcript_id "g832.t1"; gene_id "g832"; 3 AUGUSTUS start_codon 3093917 3093919 . - 0 transcript_id "g832.t1"; gene_id "g832"; # protein sequence = [MVRWDSPLFTLLWSDESISQSTLNAIWDAIEKGKVNNPNSGTTAKAPTDALAVLEKTTLSIMQQIMSSQNGFGGVVTL # SHTSPVSGSTRLKLTLPSRNVTLPELSRLKRQFVTAQKKAITLGTIERGSVDWSEEGVGERFVVFLGEQFHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g832 ### # start gene g833 3 AUGUSTUS gene 3095700 3099275 0.08 + . g833 3 AUGUSTUS transcript 3095700 3099275 0.08 + . g833.t1 3 AUGUSTUS start_codon 3095700 3095702 . + 0 transcript_id "g833.t1"; gene_id "g833"; 3 AUGUSTUS CDS 3095700 3097964 0.17 + 0 transcript_id "g833.t1"; gene_id "g833"; 3 AUGUSTUS CDS 3098066 3098334 0.15 + 0 transcript_id "g833.t1"; gene_id "g833"; 3 AUGUSTUS CDS 3098453 3099275 0.78 + 1 transcript_id "g833.t1"; gene_id "g833"; 3 AUGUSTUS stop_codon 3099273 3099275 . + 0 transcript_id "g833.t1"; gene_id "g833"; # protein sequence = [MLGKDTSSQTLQSSRSTEFSLNGHPSHPLRAPHANKASEFSRNNQSSVFHPPPRTSSVDSASQRPTPSKNHSMPVALE # EPSLSNHPAVPSLSVPLTTNGGLHVTSTRDKRRSINPGLVIKPPGEPSTASSSLSPIQREPPSPVNDLFGGSPTSVKATSPFRENFPSSRPSSAASNN # SANVHRQRSRPTSAMSSSSVGAATSTNGDESTVTMRPSPSPLRPTTPHVSSSTRPNSANSLQKPERFSGRLSSRPGSAAGRDRPPSRADVPRSVESAT # DEDDDDEEKQEIKSSRFDRAPQRSMTDDSAKYSLIDAYSGVAADSTTYTDKEPHQRTFSVESVPPMPPPKDSKVGPPAPLSTLPKRVSSSSHGPISAM # SDPPSLTPEPHALLSVPSPKSLNTPTGTAGLSVPVMSRNDSSHSNTSASTSGPGEVSDTETTETTAEDKELLDAEIEAEENGEESGNRATATFIAPAL # PPIRFSLNAADFSDLFTSVGGNMNSLKNFDTLATVAENHSSERKLWDITPSTPPPSAASVQPNTMSQTLNVQSVRVVPDLPGPEPTSSSTLMPVHNEF # SSSVYSSAHDPTSVVGTAEESVPNSEDGHSSNSDHHSKKEKGGLLRKVSFGKRNKLDRSASSSRALREREKRVTEAMPVPLNSKAGLTAPPLSRTISE # PQVKNISDETPPSTTIVVSPPADAKEEAKEPISAADLVLQRLQDVLADATDRGAQQMKFDRGFVEAIVNAMATKKADYVEARKQIDSMKTEYDRELKA # RRDAEAEVTRLRVLLSGQAARLTALTGDSRRQELRQQMSKELHENLNGLERDLSKLKVERDVTLAEVEELNAVRCEQSSRSRSLTKRLDNLKSQYQRD # LVPLTQQREALTREVMELKAARDVFLEETTVLNARNEELAQLSAQYSRRVAMAPPNAPSNSNGTETPSKNIGPMIVETPVRIDSRNIQQQQTPQQTHQ # LSAYSSVEEFDARKTKVEETHTPSRGPVKVFKWGSRAKEVSAPIAQSVTEKVKIGHMEHSFQPLSLLRFTRCDHCGEKMWGSQLRCMGCSISVHTRCV # NQVHSACSPQTHNSNGGGNNEDSQLLRECVLSPLSVSFLTVPFRISTINVRSRSDRASPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g833 ### # start gene g834 3 AUGUSTUS gene 3100892 3101542 0.64 + . g834 3 AUGUSTUS transcript 3100892 3101542 0.64 + . g834.t1 3 AUGUSTUS start_codon 3100892 3100894 . + 0 transcript_id "g834.t1"; gene_id "g834"; 3 AUGUSTUS CDS 3100892 3101542 0.64 + 0 transcript_id "g834.t1"; gene_id "g834"; 3 AUGUSTUS stop_codon 3101540 3101542 . + 0 transcript_id "g834.t1"; gene_id "g834"; # protein sequence = [MVDGSDDEPPKLKTKQPRKSALISSSEDETPHNEPAPTTKSPSNRLVKATARTSLSAKVVIDSGDEADPRPVKKRKKL # SVPISDSEDEGGKMLSPPKKKAAIAGGSSSKPKARASLPAKKMKSEDGDYEMVSGDEGKKPIAHKTIIKTKVNTKKGFSSDGDEPGMKTKAKAPVQRT # VKKKLDNDSNRSKGKGKDKAEPQEPKKQKCVIRVLAHITF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g834 ### # start gene g835 3 AUGUSTUS gene 3101744 3102530 0.45 + . g835 3 AUGUSTUS transcript 3101744 3102530 0.45 + . g835.t1 3 AUGUSTUS start_codon 3101744 3101746 . + 0 transcript_id "g835.t1"; gene_id "g835"; 3 AUGUSTUS CDS 3101744 3102048 0.46 + 0 transcript_id "g835.t1"; gene_id "g835"; 3 AUGUSTUS CDS 3102104 3102530 0.95 + 1 transcript_id "g835.t1"; gene_id "g835"; 3 AUGUSTUS stop_codon 3102528 3102530 . + 0 transcript_id "g835.t1"; gene_id "g835"; # protein sequence = [MISRLLMVTRRVVGQPSSKTNYVVLGEDAGPSKLKAIQKHGLKTLDEDQFLDLIATRKGSGKGLDEKTRKKMEKEQDA # IKAVAQEMEKKEKKAMKEAESGTGSSKVVDPSTQLWTTRYAPQSLKDVCGNKSAVEKLELWLKEWYITFVSTVLLIPNLFFRPQSYRASFKKPGKNGM # NMYRAVLISGSPGIGKTTSAHLCAKLAGYTPIELNASDTRSKKLVEVCFPHSFWNDIHLPLERHEHQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g835 ### # start gene g836 3 AUGUSTUS gene 3108219 3109257 0.74 - . g836 3 AUGUSTUS transcript 3108219 3109257 0.74 - . g836.t1 3 AUGUSTUS stop_codon 3108219 3108221 . - 0 transcript_id "g836.t1"; gene_id "g836"; 3 AUGUSTUS CDS 3108219 3108680 0.95 - 0 transcript_id "g836.t1"; gene_id "g836"; 3 AUGUSTUS CDS 3108735 3108887 0.97 - 0 transcript_id "g836.t1"; gene_id "g836"; 3 AUGUSTUS CDS 3108928 3109257 0.81 - 0 transcript_id "g836.t1"; gene_id "g836"; 3 AUGUSTUS start_codon 3109255 3109257 . - 0 transcript_id "g836.t1"; gene_id "g836"; # protein sequence = [MPAITSTPAPAPDVAPVAPAASTPSGESPATPPTYAESPSASTPVPASTTPTESHAAGSSFLSGSALQTSIQSMVDMG # FEREQVMRALRASYNNPERAVEYLMTVRAKSLGIPAHLEAEAVGPAAATSRTPAATAPATPAAAPAPAPAAATPSNQPQNLFQLAQQQQQQGAGAGAG # LSAGAAAGAGAGGGQQLDLAALASSPQMQQLRQHLASNPEAIQPLVQSIAAQNPGLAQLLASNPEALMNLLGGGDLEGEEGDLPPGAQVVNVTEEERA # AIERVRTYSSVSPVLVLITFPIVGSAWIPSATCYRSVFCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g836 ### # start gene g837 3 AUGUSTUS gene 3109845 3112271 0.78 + . g837 3 AUGUSTUS transcript 3109845 3112271 0.78 + . g837.t1 3 AUGUSTUS start_codon 3109845 3109847 . + 0 transcript_id "g837.t1"; gene_id "g837"; 3 AUGUSTUS CDS 3109845 3112271 0.78 + 0 transcript_id "g837.t1"; gene_id "g837"; 3 AUGUSTUS stop_codon 3112269 3112271 . + 0 transcript_id "g837.t1"; gene_id "g837"; # protein sequence = [MQNEHGDDYIRRIAAFIRGNERNLAELGFVRRRNPRRPAETNGPAFYNPLTWFGSESTGPPPKSVVMSIDTHHLFYLL # MRLEALNLPVGTLDVRVDSPSRPLSYINLFPDSDKTETLSLSSFRSTFSAVSALSLGVGWWGRPEPPNVDTELKYIYSSFTKLPALSVTAPTRNLISE # LANEPPNENAIPMDSFKNLQSLECTDIDPRSLLGWDYLAESLISLRIKKSGLEDVSDIFIGAVLDDQARRAGSASRKRMRRIPYGPERHTSFYSAQLP # DTVQEVADEETSSPTNSIPPTTPPELSSRKWASLRFLSLSGNDLTFFPTELTLYLTSITHLDLSSNLLNSVPEGLSALYNLVSLNLCDNMIESVLGIY # TQLGSVTSINLSRNRLESICGLERLHGLEHVDLRHNAIEESSEIGRLAPLPNISNVWIEGNPFTEYEESYRVTCFDFFWKEGKTILLDGSPPGFYEKK # NLTAPPPEQAHTSRPVSAAHSPPTIAIGHTHPHSHPHSQANSPPVEVADGSNHSPTAAPPPALSSTSPQLGPVGAVGVSGKSRKKKVKRIVDLDGDHV # SEDSASIKGSNHKRTTSNGSYAFKHKPQKVNAPQPVDHPSFGQFISLLATPQNLPPTTSSTGETQQPEASASTSTATTRSESSTSPKPSLPPLSRTET # GFASGTLSSRTNRRSRHTRYQTEFALPTAGDSAESSPTLGPIDSNKSAIPPSSPAVPSFRRSRNSQTFFSAKSSARRQRVSASVYEPPTSMDNDSDSF # AGQTNTIVDEAEAFRRRIEALKQDMGDGWLKIFSQTQMKTPSPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g837 ### # start gene g838 3 AUGUSTUS gene 3115130 3115399 0.69 - . g838 3 AUGUSTUS transcript 3115130 3115399 0.69 - . g838.t1 3 AUGUSTUS stop_codon 3115130 3115132 . - 0 transcript_id "g838.t1"; gene_id "g838"; 3 AUGUSTUS CDS 3115130 3115399 0.69 - 0 transcript_id "g838.t1"; gene_id "g838"; 3 AUGUSTUS start_codon 3115397 3115399 . - 0 transcript_id "g838.t1"; gene_id "g838"; # protein sequence = [MAFYATGLAESVGHAYKPPNLAFLARRWFESSSMLNAHVEIDLTLGAHLPLAGELRHSVRLLFDAAVIKLTDEETNTI # VGEWQHQREIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g838 ### # start gene g839 3 AUGUSTUS gene 3117243 3118063 0.24 - . g839 3 AUGUSTUS transcript 3117243 3118063 0.24 - . g839.t1 3 AUGUSTUS stop_codon 3117243 3117245 . - 0 transcript_id "g839.t1"; gene_id "g839"; 3 AUGUSTUS CDS 3117243 3117697 0.61 - 2 transcript_id "g839.t1"; gene_id "g839"; 3 AUGUSTUS CDS 3117772 3117951 0.4 - 2 transcript_id "g839.t1"; gene_id "g839"; 3 AUGUSTUS CDS 3118036 3118063 0.57 - 0 transcript_id "g839.t1"; gene_id "g839"; 3 AUGUSTUS start_codon 3118061 3118063 . - 0 transcript_id "g839.t1"; gene_id "g839"; # protein sequence = [MFGSGPICAPSGTVAPESVSTNLSDPDENLKDRCRVVLLELCTNHLIGTLEVKLELIGQWFCDGLPQAVVSFVFYSLS # SDGRFAVQNLHILPNLPIVTPTKGPQEPQLNLNFVALGPLPNPFKSKPKSPDDDIYVEPTPKSNRVQLDDAFVIGQLCSEGSQLAYNFSSFGDDLKGV # GWSENELVVSPHTTANGVKSQIGAYAGFQLYRWKFHLALFLPTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g839 ### # start gene g840 3 AUGUSTUS gene 3118221 3118979 0.99 - . g840 3 AUGUSTUS transcript 3118221 3118979 0.99 - . g840.t1 3 AUGUSTUS stop_codon 3118221 3118223 . - 0 transcript_id "g840.t1"; gene_id "g840"; 3 AUGUSTUS CDS 3118221 3118979 0.99 - 0 transcript_id "g840.t1"; gene_id "g840"; 3 AUGUSTUS start_codon 3118977 3118979 . - 0 transcript_id "g840.t1"; gene_id "g840"; # protein sequence = [MNLHDFQVPFTFLDLTKLRDAPFPPSTVLASWPLSRDDNEIAAGAIVGLADGSALLLRSSEVQEKRSSHTKSSSPRLG # STAPSRTSATASRSNSPSGSHSSHISPFSVTQRSRVVSGITSEQVEAPKNYVDFDDEPEKLKDLLKGRGPREKASLDSHREKDGKTPASAESNLSTRK # RKEPPKSMLSATASPALSPLSISAPPSPKGPSQTRVSREFELVCHMVPPRIGQRHRVTGIELLHNNDLSAVLQESG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g840 ### # start gene g841 3 AUGUSTUS gene 3122002 3122463 0.96 + . g841 3 AUGUSTUS transcript 3122002 3122463 0.96 + . g841.t1 3 AUGUSTUS start_codon 3122002 3122004 . + 0 transcript_id "g841.t1"; gene_id "g841"; 3 AUGUSTUS CDS 3122002 3122463 0.96 + 0 transcript_id "g841.t1"; gene_id "g841"; 3 AUGUSTUS stop_codon 3122461 3122463 . + 0 transcript_id "g841.t1"; gene_id "g841"; # protein sequence = [MLGADVYPVPAVAYENPANYNHQARDFAKDIPNAIWTDQFDNTANANAHYESTGPEIWEQTKGQVDGFICATGTGGTL # AGVGKFLHEKSQAKTQIWLADPPGSVLTSTSLESRLTSCWTKIDFSTKGYVASGGKLVERSGSSITEGSLCSNVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g841 ### # start gene g842 3 AUGUSTUS gene 3123028 3124227 0.97 + . g842 3 AUGUSTUS transcript 3123028 3124227 0.97 + . g842.t1 3 AUGUSTUS start_codon 3123028 3123030 . + 0 transcript_id "g842.t1"; gene_id "g842"; 3 AUGUSTUS CDS 3123028 3124227 0.97 + 0 transcript_id "g842.t1"; gene_id "g842"; 3 AUGUSTUS stop_codon 3124225 3124227 . + 0 transcript_id "g842.t1"; gene_id "g842"; # protein sequence = [MTASSLSPPDVQSEETQKNSLAGAAVHKPATETSTNQVDSQPVLDQLTATERPESSGEEASTTPLEADNTPSEQPRSS # SPVLSAKFAAKDVSSAPEVKSTEKPVEKAEDGSSSPTTPNGSHRRKAQMSSTSETVAPPESPKTKSARPKPPFLSRLLRVLIPCIPSSPHSQPIEIDE # PKTAPVSTLEKPKPLKEVPEVTSASEPSPSKATPNASTSEPNIPLPLSITPPVAITPTIQDGDVILPPTPTNQLLPQAETEGMTSGAVVPPGSSGTVD # SKRSSHYSTSRTNGAADGEDSDGTSSFTDDDELEDVHNLDDFEDEEDRLISNGGAGIPVGPVCALFIPYKVHAFYVALFRMVFQGRYYLLLPLNMQGE # SVLCLTLMKLSSTVVLRYSSGGYKAYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g842 ### # start gene g843 3 AUGUSTUS gene 3126037 3128235 0.61 - . g843 3 AUGUSTUS transcript 3126037 3128235 0.61 - . g843.t1 3 AUGUSTUS stop_codon 3126037 3126039 . - 0 transcript_id "g843.t1"; gene_id "g843"; 3 AUGUSTUS CDS 3126037 3128235 0.61 - 0 transcript_id "g843.t1"; gene_id "g843"; 3 AUGUSTUS start_codon 3128233 3128235 . - 0 transcript_id "g843.t1"; gene_id "g843"; # protein sequence = [MKTLDRHNELNGESSSFLDYLFVLKQKRKALPGLPFTTRNLPPHGPSRGSPPRLRNREKSSQRNVIVSPRSSSPPPLP # KSVSLPLHAPRTTQSLPERNGPHALAHSHSSPMPSEQINKPAATTPTSFDQSPRVVELLHQISASKSTILDLRGQLNEYHSAASQSHASLQADLVAFR # ERKRQEDTTKNDLKARTKTLEDSKRTAESAKRDSEKRLRSAESARHDAAQRIEHLDKEITQLQNRLADDTAFLTRSQNFNLTSEAEQMITTELEHKKK # EIRVAENVVTALSLRARELEERLAEKKERVRLMLERVEAQKQEQAIPPSSPVEHYDTWSPTSDIPDNHFPVHSHNSSGYTGSLDTDDVSHNYSGEMPV # SRSSKSSLNLVSDFKESSLSTARPVNQVQGYFERPMNVLGRPPLPLNFSPFEEMPQTPAVVISPSTSSSLISSSLISSLDDVDGLSRSFQSESDIFLE # RDWKEKKAHGRQQSLQQPEGNIVCTHTTVSPTGDGFEHDPFEVRVFAPRGHDGFAQLTDNSLKRNNSESFTSVHINADLEPVVADKTHNRRWFSLSAK # TKAKKGLNPDAKVFDFNRSQNKSVPVPVMQGVSPPVYDALNPNGLGSTLVSSTTTDNNFLRAFAPSPAEREALQRALGGSSNGSLERLPSLSDVGSIP # SSPSHIHAKSVDHASPPFEQPQRHVPSWLQSLPRIRKPNFSPWDDEESAPTSTTVVGGPHRFGGKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g843 ### # start gene g844 3 AUGUSTUS gene 3129596 3131530 1 - . g844 3 AUGUSTUS transcript 3129596 3131530 1 - . g844.t1 3 AUGUSTUS stop_codon 3129596 3129598 . - 0 transcript_id "g844.t1"; gene_id "g844"; 3 AUGUSTUS CDS 3129596 3131530 1 - 0 transcript_id "g844.t1"; gene_id "g844"; 3 AUGUSTUS start_codon 3131528 3131530 . - 0 transcript_id "g844.t1"; gene_id "g844"; # protein sequence = [MSKGSQESKFSQQLHTPGTSSYSSYSSSSPLKPSSPQSVLLTDWSSSDCGSPYARHVERKEKDIEKKNGPPSSPTPAQ # RQRLSSARRTALSSSGLSVSDSAHKRSSTPLPPPPAQQPKVHLAPSTAPSSFTPDDNLVEMPSFDLNFTQSVKDERVSPIQVPKPTSVPRLPRIPPAL # PPLGPGHLQSGDTSFVQQVIPESSQFRHAPPTPAQRRRPEPNSYQTPEETRPFSMSNPAGVKSFIPSSSILPHAITKLTSAATAPSNLMNTKFQRKIP # PPPPPPIRDGEGSPKVLAPNSDTSGTQSQSHFGSQSQSQSQEFRNSFWHPQPLGKVPDPGRVSQTESDSQPLDVYTQKPLLTSEVAYEEFDPFNDDHD # SLFSEPDDDDISHHSSSEADSQHSNLAQNDFLQSFEDHRRNSNAKDDPIASTSLKVHCGNSISNDELGVCNDLLGVQTARKPDVSSTVSSIIEAVGSI # DNVPGSSNSPPTDFLNPFYSAIGTSQRSKEIPETLQTVFKPVAHDADAWSLPSFLRHKRTENTRAKELRPVKTFHAEKLKARLFEAPVGDPQPRYQKR # FYADQGETGPSKKKQKIALAISPEKEREQSAPLRKLHGFDPGFDDILPGESFMSWEQLRIISLKIGRARVRQAQTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g844 ### # start gene g845 3 AUGUSTUS gene 3137380 3137709 0.79 + . g845 3 AUGUSTUS transcript 3137380 3137709 0.79 + . g845.t1 3 AUGUSTUS start_codon 3137380 3137382 . + 0 transcript_id "g845.t1"; gene_id "g845"; 3 AUGUSTUS CDS 3137380 3137709 0.79 + 0 transcript_id "g845.t1"; gene_id "g845"; 3 AUGUSTUS stop_codon 3137707 3137709 . + 0 transcript_id "g845.t1"; gene_id "g845"; # protein sequence = [MTTSKTIPFPLYPVPLLQPPVDFLLLTGTARAEAGLEVEADEDLEAKAEDLISLGEEAMTVDAELGEHEAQRFQLGVG # QPKPDILPTDDLLHQPKQVQRPRAENGTPTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g845 ### # start gene g846 3 AUGUSTUS gene 3138618 3139691 0.85 + . g846 3 AUGUSTUS transcript 3138618 3139691 0.85 + . g846.t1 3 AUGUSTUS start_codon 3138618 3138620 . + 0 transcript_id "g846.t1"; gene_id "g846"; 3 AUGUSTUS CDS 3138618 3139691 0.85 + 0 transcript_id "g846.t1"; gene_id "g846"; 3 AUGUSTUS stop_codon 3139689 3139691 . + 0 transcript_id "g846.t1"; gene_id "g846"; # protein sequence = [MTVDSAIERPEPPIPSTSHKTSIRKRLFSHSKRTDPKSNWKRTEKPGQDVANATVQSGHFLSLLVLSASHSPVETSQR # QGPSMLASASTSFPEDTDREQASLNTTLSGNHKVPFYRRSKANKSTVSDLGALSSTTSHSNGFITNQKLKTTRRSIRHGRRPSFLSRVVYKVVPCVGS # EENMTATAIDVDRPRDIVVDEMSEVKMAPVSMSGVKPTHRVSNGADNHGTSAMPSQTLTLPQSSNSKDSTTPPSPTDSEIIIPPPPSTQLLPEDETDG # VTSGAVQPPGSTGEPLIRSITHDSDEDTDGTHFTEDQGEDLQQSLLSEEQAEEERLIRNGGSGIPIGPVSTRSEGLLPIHSLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g846 ### # start gene g847 3 AUGUSTUS gene 3144728 3145651 1 - . g847 3 AUGUSTUS transcript 3144728 3145651 1 - . g847.t1 3 AUGUSTUS stop_codon 3144728 3144730 . - 0 transcript_id "g847.t1"; gene_id "g847"; 3 AUGUSTUS CDS 3144728 3145651 1 - 0 transcript_id "g847.t1"; gene_id "g847"; 3 AUGUSTUS start_codon 3145649 3145651 . - 0 transcript_id "g847.t1"; gene_id "g847"; # protein sequence = [MSASTGEAELRQNSHSENSATSPEHQSSPNSWTLGDRTLNDHSRAKSPHQTASEEPEGHDQSDKDSLQGSTEKSKPKD # KVKANATAEKFKGKEKAIEKEKVTSPQKKPMPNRRSSTRLQTNDNSSLSILSDDDDPSPPSSECLPDDQAAIADALKVQILGKKRSTAVVASALNRNT # LALGGHQLELVEIQRKNEERVRGEIGELRVRVDALEVSGLGAHVDESVISDGSGSPKVPAASLLRDIRTRIKALEGNNHLLKDGVDWKRTLDKEFRTL # KDKVEVYEGFRKLSPSQRMSWRYAHTPQRSLRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g847 ### # start gene g848 3 AUGUSTUS gene 3148904 3149326 0.64 - . g848 3 AUGUSTUS transcript 3148904 3149326 0.64 - . g848.t1 3 AUGUSTUS stop_codon 3148904 3148906 . - 0 transcript_id "g848.t1"; gene_id "g848"; 3 AUGUSTUS CDS 3148904 3149326 0.64 - 0 transcript_id "g848.t1"; gene_id "g848"; 3 AUGUSTUS start_codon 3149324 3149326 . - 0 transcript_id "g848.t1"; gene_id "g848"; # protein sequence = [MAPEILDGIFPAPENDMQDFVQSNYVNEVKPDTDTIMEQVIGPVDVSDVLLTMGMTDVIVNEVDMLYYGDLAIGTPGQ # GLTFDVDTGSADLWVPSPWCGNSKNHYDGSQSSTYVNQDRRFAVSYVSCIRSVNGISLTLHK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g848 ### # start gene g849 3 AUGUSTUS gene 3149824 3150456 0.77 - . g849 3 AUGUSTUS transcript 3149824 3150456 0.77 - . g849.t1 3 AUGUSTUS stop_codon 3149824 3149826 . - 0 transcript_id "g849.t1"; gene_id "g849"; 3 AUGUSTUS CDS 3149824 3150456 0.77 - 0 transcript_id "g849.t1"; gene_id "g849"; 3 AUGUSTUS start_codon 3150454 3150456 . - 0 transcript_id "g849.t1"; gene_id "g849"; # protein sequence = [MSVRARILGRQASAISVDGSVTDLPAVTPGVQTTTNSDAVSVDGPVTMLPPESPGLQPASATVTSDLFTLSTFGIGLP # TPAATNSSTATSSIDGGAIAGGVVAAVVVAVIAVALLLRYRNKRSSRHWRNRIKGGAFGPSHNRSGWQNLDIKSDAVNGDSGFQAGRSNRVLDDHKSP # ITSPVTAKFSTPLMTYPPGASHLPSEKELESMRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g849 ### # start gene g850 3 AUGUSTUS gene 3153822 3154205 0.57 + . g850 3 AUGUSTUS transcript 3153822 3154205 0.57 + . g850.t1 3 AUGUSTUS start_codon 3153822 3153824 . + 0 transcript_id "g850.t1"; gene_id "g850"; 3 AUGUSTUS CDS 3153822 3154205 0.57 + 0 transcript_id "g850.t1"; gene_id "g850"; 3 AUGUSTUS stop_codon 3154203 3154205 . + 0 transcript_id "g850.t1"; gene_id "g850"; # protein sequence = [MNGNTAFILITITNCLSRLQHESVGRMAGLTTEQLLAIRLAPPFFASQGVNLTSILGADLVAAMTFTDWITKNVHVPD # DVFNALKTFLNDSQLVEATATAAGYSFISRFVVALNVDAKMDVPVPVPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g850 ### # start gene g851 3 AUGUSTUS gene 3157886 3158842 0.68 - . g851 3 AUGUSTUS transcript 3157886 3158842 0.68 - . g851.t1 3 AUGUSTUS stop_codon 3157886 3157888 . - 0 transcript_id "g851.t1"; gene_id "g851"; 3 AUGUSTUS CDS 3157886 3158842 0.68 - 0 transcript_id "g851.t1"; gene_id "g851"; 3 AUGUSTUS start_codon 3158840 3158842 . - 0 transcript_id "g851.t1"; gene_id "g851"; # protein sequence = [MVTELKDGPGAKIGRGRDVQNNRDLSDILTEPHFLPRSAVVMRLLEVHHDPISHFLPTKVTPEGSFFCAAPPGLAPEL # AELFMYPLNTIGSKRRGPSPGGKGPNKRQRLDNAAEDEEIEVGRRADSIAPASDILGRGSMGPDALEFGDQSGIIDDFQLDIPQFDPVNVDLDRRSKS # AAPSVRSRMSTPAVEGVVPEEGDENYANSACPISAFDSQTQTQVTGTEKGVQPVDSYSRNTVKAISVIRKELRPTEGDAEEKVLSFRKMADKVGIIYI # VRFFPLTVFLVRHLDVLPLRFSSNCSSLALAIASRSTNPPLSRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g851 ### # start gene g852 3 AUGUSTUS gene 3158983 3159666 0.68 - . g852 3 AUGUSTUS transcript 3158983 3159666 0.68 - . g852.t1 3 AUGUSTUS stop_codon 3158983 3158985 . - 0 transcript_id "g852.t1"; gene_id "g852"; 3 AUGUSTUS CDS 3158983 3159666 0.68 - 0 transcript_id "g852.t1"; gene_id "g852"; 3 AUGUSTUS start_codon 3159664 3159666 . - 0 transcript_id "g852.t1"; gene_id "g852"; # protein sequence = [MAEEQLVANKNAITIQANAFDFDMMPDDDWLDFYYTIPNEFLIFFLPRLLQDFDEDRPAPAHGQHQARIDDITLPPTD # TFEPLDFDNDNFDLGPSDGIGSQDFLDLGVDFGDAPIQSEKGADESMSVDGSVGVGRDAASHRDSIGDQFMDMDGNFDLLSRRSRTRELSEHPFGADM # ALDMPEFGDIDLGDLGIGFDPIPMDIDKTPGQTRSSSRACVPISFLTSTPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g852 ### # start gene g853 3 AUGUSTUS gene 3163021 3163681 0.4 + . g853 3 AUGUSTUS transcript 3163021 3163681 0.4 + . g853.t1 3 AUGUSTUS start_codon 3163021 3163023 . + 0 transcript_id "g853.t1"; gene_id "g853"; 3 AUGUSTUS CDS 3163021 3163035 0.4 + 0 transcript_id "g853.t1"; gene_id "g853"; 3 AUGUSTUS CDS 3163151 3163681 1 + 0 transcript_id "g853.t1"; gene_id "g853"; 3 AUGUSTUS stop_codon 3163679 3163681 . + 0 transcript_id "g853.t1"; gene_id "g853"; # protein sequence = [MLSASPDRQAAASLDTPPVTDLDTSSSLFDSDTDFGSSAFADSDAESVVSQPGIVAAHNNLSDIDELGSQSDDMSPEL # DTDTWSVIGDSDADGELSEAEHSVERQFTSMSMRVGSEDPERTLEAISPRNLRQTGPSDRWPVQRSTSSPSRSRVRTAPRRLVLRNSPPAIKETKTLY # AYLYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g853 ### # start gene g854 3 AUGUSTUS gene 3170505 3171206 0.09 + . g854 3 AUGUSTUS transcript 3170505 3171206 0.09 + . g854.t1 3 AUGUSTUS start_codon 3170505 3170507 . + 0 transcript_id "g854.t1"; gene_id "g854"; 3 AUGUSTUS CDS 3170505 3170580 0.09 + 0 transcript_id "g854.t1"; gene_id "g854"; 3 AUGUSTUS CDS 3170650 3171206 0.32 + 2 transcript_id "g854.t1"; gene_id "g854"; 3 AUGUSTUS stop_codon 3171204 3171206 . + 0 transcript_id "g854.t1"; gene_id "g854"; # protein sequence = [MCSLDVDLAMDALNALHVATTSSTLNLTNSLRRTQELRTQLDRLGTLFDQARQSFLRSFLDLQQAGQDPIVVLEALKA # AEPQCESISVEDWTLLATLFQWSSPFNLNGLKFDNRTPAEWIDLLRSIHSGATSATVTVDGHLVDTSQPPEADVEVSEALDPQGSLPNTVVEKVSGVE # DLASLSEGSPIQTELDLPQIESLTESTLAPEKGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g854 ### # start gene g855 3 AUGUSTUS gene 3172975 3173751 0.55 + . g855 3 AUGUSTUS transcript 3172975 3173751 0.55 + . g855.t1 3 AUGUSTUS start_codon 3172975 3172977 . + 0 transcript_id "g855.t1"; gene_id "g855"; 3 AUGUSTUS CDS 3172975 3173001 0.61 + 0 transcript_id "g855.t1"; gene_id "g855"; 3 AUGUSTUS CDS 3173107 3173242 0.63 + 0 transcript_id "g855.t1"; gene_id "g855"; 3 AUGUSTUS CDS 3173324 3173751 1 + 2 transcript_id "g855.t1"; gene_id "g855"; 3 AUGUSTUS stop_codon 3173749 3173751 . + 0 transcript_id "g855.t1"; gene_id "g855"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSVSDASFVTAQSIPTTGSEDTVVTPTEMAVPVPKTVERA # TTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g855 ### # start gene g856 3 AUGUSTUS gene 3174027 3175252 0.48 - . g856 3 AUGUSTUS transcript 3174027 3175252 0.48 - . g856.t1 3 AUGUSTUS stop_codon 3174027 3174029 . - 0 transcript_id "g856.t1"; gene_id "g856"; 3 AUGUSTUS CDS 3174027 3174395 0.61 - 0 transcript_id "g856.t1"; gene_id "g856"; 3 AUGUSTUS CDS 3174478 3174596 0.5 - 2 transcript_id "g856.t1"; gene_id "g856"; 3 AUGUSTUS CDS 3174651 3175128 0.58 - 0 transcript_id "g856.t1"; gene_id "g856"; 3 AUGUSTUS CDS 3175247 3175252 1 - 0 transcript_id "g856.t1"; gene_id "g856"; 3 AUGUSTUS start_codon 3175250 3175252 . - 0 transcript_id "g856.t1"; gene_id "g856"; # protein sequence = [MITDEAVESTSYFDAYTFIVSEGTCRYNDNVDSSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGC # PEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGLESTWLVNPPNRILT # RDELIGYRAQALSKHNSFIEKVRRRVNWSRLEILELRRVWDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNI # HELIDLTAEQLDLMVEDEDEYWMAPENDYIFDAIPHLRLSDTDSDEELS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g856 ### # start gene g857 3 AUGUSTUS gene 3175295 3176476 0.45 - . g857 3 AUGUSTUS transcript 3175295 3176476 0.45 - . g857.t1 3 AUGUSTUS stop_codon 3175295 3175297 . - 0 transcript_id "g857.t1"; gene_id "g857"; 3 AUGUSTUS CDS 3175295 3175674 0.88 - 2 transcript_id "g857.t1"; gene_id "g857"; 3 AUGUSTUS CDS 3176254 3176476 0.74 - 0 transcript_id "g857.t1"; gene_id "g857"; 3 AUGUSTUS start_codon 3176474 3176476 . - 0 transcript_id "g857.t1"; gene_id "g857"; # protein sequence = [MPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDSQEA # DDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRL # IKKFQVDDQGRLYIEILINPINHN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g857 ### # start gene g858 3 AUGUSTUS gene 3177173 3177801 0.33 - . g858 3 AUGUSTUS transcript 3177173 3177801 0.33 - . g858.t1 3 AUGUSTUS stop_codon 3177173 3177175 . - 0 transcript_id "g858.t1"; gene_id "g858"; 3 AUGUSTUS CDS 3177173 3177613 0.7 - 0 transcript_id "g858.t1"; gene_id "g858"; 3 AUGUSTUS CDS 3177754 3177801 0.33 - 0 transcript_id "g858.t1"; gene_id "g858"; 3 AUGUSTUS start_codon 3177799 3177801 . - 0 transcript_id "g858.t1"; gene_id "g858"; # protein sequence = [MKYSKEELNHFKDLNRQDRSPINLIDETNKQVDSEAIGVEKPIKLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHI # HGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEVGFAWEPSEAGTFKMNSFTCESTCNST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g858 ### # start gene g859 3 AUGUSTUS gene 3198599 3200605 1 - . g859 3 AUGUSTUS transcript 3198599 3200605 1 - . g859.t1 3 AUGUSTUS stop_codon 3198599 3198601 . - 0 transcript_id "g859.t1"; gene_id "g859"; 3 AUGUSTUS CDS 3198599 3200605 1 - 0 transcript_id "g859.t1"; gene_id "g859"; 3 AUGUSTUS start_codon 3200603 3200605 . - 0 transcript_id "g859.t1"; gene_id "g859"; # protein sequence = [MLASRPRPPAQVRRASPSYTACWSPTPTFWDLHALHSSQSQAVSELDTSSTNRNQLYSHTPNHSHSHSHSHSHSHSHS # HSPTHSDLARLSDQNAELIQRLEELEEEAAVKERAGRRTVVRLEKEIQVLRDELDELEKEIQVLRDELDEARREAAGAMQSPTNQTASQTQGGRRRND # NDGDGDGAGDGEHNNSSSSPSSSSPSSSSPSSTLHHSNPNPNPNPIPDSISPILIPILQHLQYLQHLHYKTTQLEDAQLEDANVAICREREQREAGCR # VRDVQVEGEEMREFLWEGVDIDISDGVPNSYNYGRTPTPTPTPIDLESELIHSTQTKYTKYTKDRRNTVIGLPEQEQEPLEVDSMSLIHSRSQSLELD # RLEPLELDELDELDGLDELDRLDGLRPTDIYMRTPKSEIGDFSCLDLGMSELGGIDEGPLSPLPLSRTLTPPSPLTPSRSHISPKSQHNQTHTSPHTP # TSPHTHTPHPHPPPPRHPSLSQTLKSRSAMWSWSWSWSWSWSWRWSRWGPILRLRDVFTSVSTSASPPSSTSPPAPPPSTPSPSPSPSPSPPSSTTPT # PKILPLHSALLEAWAWVHLLVVLGVFVWGVARRGPSGVLECGGRCAGGSGGGENGGGGGSGGGGGGGGGGGGGDGSGGGCGGRRAGGGDEDGETHIGG # RG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g859 ### # start gene g860 3 AUGUSTUS gene 3202252 3203919 0.89 - . g860 3 AUGUSTUS transcript 3202252 3203919 0.89 - . g860.t1 3 AUGUSTUS stop_codon 3202252 3202254 . - 0 transcript_id "g860.t1"; gene_id "g860"; 3 AUGUSTUS CDS 3202252 3203919 0.89 - 0 transcript_id "g860.t1"; gene_id "g860"; 3 AUGUSTUS start_codon 3203917 3203919 . - 0 transcript_id "g860.t1"; gene_id "g860"; # protein sequence = [MISVFGQADDGVAYRFWIRFADGAIIKPGFTPPADLVLAGFITPPLGNAEEFCFFSLAEQRITIQTNTPTQTVTPVTI # PSEYGKLANVFCVNNELFAITVMGYVLRLTSQGELFLEAVNRQWFTQFQGSGEHNEPWWTVLKSFAESHGSTTVSILGLHSVDHGAVPAWFCNGRIVI # TSPHLRGQQLQIAGLTNGGGEAWLCHWKTEESGQLFSQPLIPNDKLATVLSPTTPDVISDQIPEGTRVLEAYPFKTVLMKNNGLQYSTTDGVIFIIMD # RDTITLYGVDKSWQESHLENLEADLGELAKQWRHGEVVVMQGLVPTTMPAWYLVPAGKIVVVTNNSITWGDNPLWLGTDLNGTTGYFYVVSQGAIYSI # GVGEPPRLQQYVSMTVRFNDLLVLIPRPGEFCASIALWNVRYSMLSQRGGTDNTLYFLQQPSWAYYNANVVEWKGPGTVQIQVMFEDAGALLAKKIGE # DLVIFDVAADTRSLTMRKAFQGADTGYGKFNVNFAAAGLGFGITPAVVQGAQLWLQDTAKLDYLPDVTVKTIGYYLQNSGKWRFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g860 ### # start gene g861 3 AUGUSTUS gene 3204126 3208385 0.93 - . g861 3 AUGUSTUS transcript 3204126 3208385 0.93 - . g861.t1 3 AUGUSTUS stop_codon 3204126 3204128 . - 0 transcript_id "g861.t1"; gene_id "g861"; 3 AUGUSTUS CDS 3204126 3208385 0.93 - 0 transcript_id "g861.t1"; gene_id "g861"; 3 AUGUSTUS start_codon 3208383 3208385 . - 0 transcript_id "g861.t1"; gene_id "g861"; # protein sequence = [MFPPSLTLKPGGVPDQGYFQFVRDDFDDKTRRTFEIKYYGAEEGTNTVWAYNLGYNGGALTSRTPSFIDIPKKVPENT # FLFTGSLTGCSVIVTNLDENTYRVFHDSRFDSSLLYDNVEMAIDYSGYVVSDPGLDNQGKLTSAGGAACVFMQYRDGKWNMFVQKQTLASARKQTPEG # LKDTTVVVPRRTEISFAFKTDDPTKPSVVDTGYFPIIVSQPGSYNAEQVRALFDTRRTIIREQLRRVAIEALPDTTIPDVPDGEFEPFEGNKINLRNP # GVSSSQAVRDVVEQTQDTVRKQLEAAEGNLPLDVSQLQKVNLKELVNPTLGQSKDSDILYLWIKQKEARGLDAVVITDGRLEAPLGSTAGERFTDQQL # DALRVGNGDFTAGYDSYDSTEIPGFASNMTSSEMVTLFDESTDLTQTQRGALVHHIRVASEQEFRESVWQKTDNIVGMFQEAGGATKPMPQDLLLNAV # PDEYGGRCYPLVRAMSVALAQSDFAVDQLGIKLVSISTSSNADLLNAELFRQCLKDLHSSYPAAEASTLVGPTNLQDAVSKLSAEEGSSTIFALNTNI # HAMLLGATNRGGKISYHFYDPNFTLATFASQQELVDATTKFFVELGYADIYAADGTPSDPVFSLVQIDTDKMARIGFDFNLNVADFHESETLSETITI # RAAPELYLPDPARFTENRALSSGASLLEASELAEAWRDATAKLEASTGLGEHWMPILETLEDLDSGGYRVQFVNLEDLSETQWISTDDPEIKDFKAYL # DERLKALDHAYEFEGGTFVQKEDVTSAEAIDGLNAMFVVKTLIEHFNSRNNASEGNGNTNSNLAMALKVQSYLNLTQLGQQSLGDVVKVVELTQTIIR # SEQAAQSSLSTVVRAFGRISEGAGFLFGAANVVFDAYELSNAQNEIQKAVFGTQLAFDSASFLASAGSVGAGMLGASSAAAVLGGVSVILGGLAFGFG # ALASAFGQVAEDAQTVGRYFGDTEAAYKAGGYKYDEEHKILVPLVGAVISELDLTGDVQYDSQYIYRTHHGSTGSGYINYFFWVGDFPQMVRDKSQAI # NIREGIGAPASGKLANTADYTTVILPATPKSYISYEYMILPFATTRHDYGFDIIRRLEVDKRFDYDFYIFPSEYLIRRISHEYVETSVAVKLDGRSVR # VQAPSLPDNMHNVLKYTLQGAGADYTVGLMAGVGITLSSVENTRWILDCRDLANDTITVGDDTVSVGGVQVIVSNRDFSSMLAINKNAEVLQVDFDNH # TTFVVEEDASKFPAGNENILAYLNDLNDKHLLRGMFITVENYTTPSGQAVGRAFYDITNKRLLYTVDAPTELTENVQFGAEISTGEVYLYNVEHPGIW # RVDPATGTCLAKYDALCPSPNRTLMRVWQEGKRSSSDCKYHILIIYQKMIMPMLYSVTSSRKTNSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g861 ### # start gene g862 3 AUGUSTUS gene 3213924 3216149 0.39 + . g862 3 AUGUSTUS transcript 3213924 3216149 0.39 + . g862.t1 3 AUGUSTUS start_codon 3213924 3213926 . + 0 transcript_id "g862.t1"; gene_id "g862"; 3 AUGUSTUS CDS 3213924 3214232 0.43 + 0 transcript_id "g862.t1"; gene_id "g862"; 3 AUGUSTUS CDS 3214310 3214348 0.94 + 0 transcript_id "g862.t1"; gene_id "g862"; 3 AUGUSTUS CDS 3214638 3216149 0.96 + 0 transcript_id "g862.t1"; gene_id "g862"; 3 AUGUSTUS stop_codon 3216147 3216149 . + 0 transcript_id "g862.t1"; gene_id "g862"; # protein sequence = [MLSLIGSLQRDPFSSVHIPSNSTQNHREVEEEQEEQDVVDGFLNGMDEDHEGSDEDIESDQDGFEALNRKQNDVNAER # SWQTATEREKGEEEKQKKKKKRKAENYVVYLAPVELLCLSLGHRAYGAESKKSASNPRINGPKPPSPPSDASERYTVLQRKVDDLEKVHNDGKKAVCD # PSLMLVPSGTNTCSQHQAEVERLKLELARLQKANAELTDRLDKQKKQKEALDLRVDELRKNSNADKAEIKDLGVKLRMSEHQRTQMTAKHGNVADVKK # SLQSLETRRKEEMKERDRTIADLEKSLLTDKKKREMVESQLKETKAKHDFEIDKMKDTVEKLKREIVAARDEVQEIQHRLEATISKTSSNEESLLAQL # EDHKLMLNEVAEHYGLLASNTVSRLAFERLTFENYALRIQAARSSRKLGNTEGQVSELANLIRQSQEENQILRRNSKDMMQELSSFIENATSKPPSPP # SYDDLDEIITHLDRDHEAFQEEETRINIETLQLEAELHHLQHDALFFAYAEAETELHEALAIASKLPEVEQQRDIAQELLQATNITAQSLRLSSDKFK # LQVAELEEKLKTETRKSDEALQKEQANAHRLTTTVQKLRMAEDGLRAENEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g862 ### # start gene g863 3 AUGUSTUS gene 3223119 3223433 0.71 + . g863 3 AUGUSTUS transcript 3223119 3223433 0.71 + . g863.t1 3 AUGUSTUS start_codon 3223119 3223121 . + 0 transcript_id "g863.t1"; gene_id "g863"; 3 AUGUSTUS CDS 3223119 3223433 0.71 + 0 transcript_id "g863.t1"; gene_id "g863"; 3 AUGUSTUS stop_codon 3223431 3223433 . + 0 transcript_id "g863.t1"; gene_id "g863"; # protein sequence = [MDDNVGRSYKDNFPSSDSIHRYDSSQLSDGGWNSVNVQNTDNWNEQYTVESTIPTHRGSYCEELNSFDVICGDTYTAE # YVCNIMRASRAFSYGELFVIQYRICY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g863 ### # start gene g864 3 AUGUSTUS gene 3228980 3229971 0.7 - . g864 3 AUGUSTUS transcript 3228980 3229971 0.7 - . g864.t1 3 AUGUSTUS stop_codon 3228980 3228982 . - 0 transcript_id "g864.t1"; gene_id "g864"; 3 AUGUSTUS CDS 3228980 3229592 0.98 - 1 transcript_id "g864.t1"; gene_id "g864"; 3 AUGUSTUS CDS 3229746 3229768 0.92 - 0 transcript_id "g864.t1"; gene_id "g864"; 3 AUGUSTUS CDS 3229843 3229971 0.72 - 0 transcript_id "g864.t1"; gene_id "g864"; 3 AUGUSTUS start_codon 3229969 3229971 . - 0 transcript_id "g864.t1"; gene_id "g864"; # protein sequence = [MYLPADVEVNVSRILQLRPDLSREVRIIKLGDHKIHGTWMPFHMAESLAINPDFPSKCIEPIPTEHNRMHYKHRTTTS # HRTRKTHSETSTSASDDVPARIKWIYYRPSETTSVSTSPNSSRPPSHPSNPDGRYADMERLSPETYSTEHHSRNTRRPSQFVPSSSSNRTLPAIVPSI # QRMTFQTSTAIVRQNSPSVSASNSNNHQYGYANTDLMLSGRPTITLPPLSTMRDLNTVHVDDARIVLRRLQQNNDTFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g864 ### # start gene g865 3 AUGUSTUS gene 3255307 3256215 0.9 + . g865 3 AUGUSTUS transcript 3255307 3256215 0.9 + . g865.t1 3 AUGUSTUS start_codon 3255307 3255309 . + 0 transcript_id "g865.t1"; gene_id "g865"; 3 AUGUSTUS CDS 3255307 3256215 0.9 + 0 transcript_id "g865.t1"; gene_id "g865"; 3 AUGUSTUS stop_codon 3256213 3256215 . + 0 transcript_id "g865.t1"; gene_id "g865"; # protein sequence = [MLSKVLAPLFSPPNILAPAVSLMAPSAPTTMVLSTPASMVPFAPVSMVSSASASMIPTTPVLMVPTTPVLMVPTTPAS # MVPTTPASMVPTAPASMVPTAPASMVPTAPASMVPTAPASMVPTAPASMVPTAPASMVPTAPASMVPFIPAPAISLSIASTPEVQNEEPKGPEVITSA # LDFNQYCEMNGYNLSSAIYRTRENGSGQTTTAQTYFQWANTRDFLQQIVGYSGSLDLKHYKIYYNNGNGKVENLPSILLYRLSWNVGTFEATTRIFEP # AEHYACNFQWDPNCSVTETNFRTTTGEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g865 ### # start gene g866 3 AUGUSTUS gene 3258734 3261223 0.19 + . g866 3 AUGUSTUS transcript 3258734 3261223 0.19 + . g866.t1 3 AUGUSTUS start_codon 3258734 3258736 . + 0 transcript_id "g866.t1"; gene_id "g866"; 3 AUGUSTUS CDS 3258734 3259978 0.25 + 0 transcript_id "g866.t1"; gene_id "g866"; 3 AUGUSTUS CDS 3260555 3261223 0.76 + 0 transcript_id "g866.t1"; gene_id "g866"; 3 AUGUSTUS stop_codon 3261221 3261223 . + 0 transcript_id "g866.t1"; gene_id "g866"; # protein sequence = [MGTVQDTLCGIRKFTLQDTFLDWNQVQNILLWVPEWDGSIPIPAILKPKPLWTGKQILSLVIPCGINIHRSLDPKSSN # PVFDDGMLIENGEIVFGIVVKKTVGASQGGLVHVVFREKGPEVIRRLFTGLQTVVNYWLFHNGFSIGIGATIADKNTMSYITETIASRKANVSKIIED # ATHDRLKPAPGMTIRESFESLVERELNLARDTSGQHPQKSLKEDNNIRQMVVAGSKGSFINISQMSVCVGQQSVEGRHIPFGFRHRTLPRFTTDDFSP # ESRGFVENSYLRGLTPQEFFFHAMAGQEGLIDTAVKTAKTGYIQRRSVKALEDVMVCYDGTVRNSLGDLIQFVYGEDGMDGAFIEKQNIDTFSLNDQE # FEHNYRVDVTDPAGGFLPGVLQVGIDDSSLQLQNKLDEEYDQLFDPNLAKNVQQELAYTSLRTVTATVEIWYDPDPSSTIIEEDEVFVESFFAIPDEE # VESKLHLQSPWLLRLELDHAKMLDRKLTMAYVASRIAESFKSDLFVIWSEDNAEKLVIRCRVLGGADKDEDGTETLEEDIFLRQLENTMLNSVSLRGV # QGINRVFLTRHDLVETKDDGSIVAEKDKQWVLVGVNLKTAMCIDGVDFTRTYSNSCVEVFSVLGIEAAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g866 ### # start gene g867 3 AUGUSTUS gene 3261692 3262497 0.74 + . g867 3 AUGUSTUS transcript 3261692 3262497 0.74 + . g867.t1 3 AUGUSTUS start_codon 3261692 3261694 . + 0 transcript_id "g867.t1"; gene_id "g867"; 3 AUGUSTUS CDS 3261692 3261697 0.75 + 0 transcript_id "g867.t1"; gene_id "g867"; 3 AUGUSTUS CDS 3261949 3262497 0.92 + 0 transcript_id "g867.t1"; gene_id "g867"; 3 AUGUSTUS stop_codon 3262495 3262497 . + 0 transcript_id "g867.t1"; gene_id "g867"; # protein sequence = [MSDTELDPPVFSEEDLLTLYEEVLAHPDIHVQEEGDKKDMQIKTNEFGLELEFGNDPESQHGQDLDVLVEADSRLSSH # AGMKQQLRHTRFAAALLRESRLNEAPPKFTDTSTTSMTPAYQRVLNHTAHILQDIERVEESLISQPRNAEENSTTKLPIPLLSKQEWDALIRATVRFN # PFFVSAQD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g867 ### # start gene g868 3 AUGUSTUS gene 3268875 3270437 0.51 + . g868 3 AUGUSTUS transcript 3268875 3270437 0.51 + . g868.t1 3 AUGUSTUS start_codon 3268875 3268877 . + 0 transcript_id "g868.t1"; gene_id "g868"; 3 AUGUSTUS CDS 3268875 3270437 0.51 + 0 transcript_id "g868.t1"; gene_id "g868"; 3 AUGUSTUS stop_codon 3270435 3270437 . + 0 transcript_id "g868.t1"; gene_id "g868"; # protein sequence = [MLSHYRLYTWVSDSIEHVLDHPSSHWWYRLIKAVGEVVERGVYGTFDFDSSNFLPMIEPPRTYSWNFQRKKHDQRTAN # VLLSSRIIFHWLDLPLESDDKHNVQSLFLKSLMDSCGTASILLLDEVWTAYSAPRDLCSARSKQAYPSRIAMKKLAQMFLDHPILGCNRSLEIQQLIG # MLQAAHSQFIGLPASHNSPSSAIFAESLSTLSLPQPTLSNNTPLKVSLPISSMPISENDRVIFFRDWLLEIAEAYTQSPPLPMDQLNPEQRRVRENSD # SSCPFRELAYSRRRVSGPNGLFAHHTRAGTFSALLFRGILFNTEALRETGHTGFFESFEAWSQFKAQYADRGEKYICNSCAYGTTRGRTSSNDKYFWI # ASEVLHQKLQDPNISFTSIWQFIVNTKDNKKNKLFRSFGDLSAYLLTVDLTYARRIPWPHLDEVAQAVSVLAKGALHGLQKMNLVPTNAYTEDEVKEG # FKALYRLLDGDSKFKTVKGAVVFDPFMVEHALCKISKDRVYERANRNVGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g868 ### # start gene g869 3 AUGUSTUS gene 3273957 3275046 0.52 - . g869 3 AUGUSTUS transcript 3273957 3275046 0.52 - . g869.t1 3 AUGUSTUS stop_codon 3273957 3273959 . - 0 transcript_id "g869.t1"; gene_id "g869"; 3 AUGUSTUS CDS 3273957 3274841 0.82 - 0 transcript_id "g869.t1"; gene_id "g869"; 3 AUGUSTUS CDS 3274918 3275046 0.53 - 0 transcript_id "g869.t1"; gene_id "g869"; 3 AUGUSTUS start_codon 3275044 3275046 . - 0 transcript_id "g869.t1"; gene_id "g869"; # protein sequence = [MSGDNNGTNGDQLSRLLQSFMATPNAQALELMNQNQIPPMLLQNSPNQAPLFPSLSSTSSSSQAVTALSQTPHSTSAS # LPAQTISTSSYDPGMRSQTSPQPNQAQTQLSSQVSHRSVPLNLTQNQPVPITSSTSWAMPIQAPLSGSLSAAHFPSFTQQSDPSPDVEAQPLSVVRPA # ADQSSSALPGSSSLPPLPSACRPYNSMQVPRVSDGYGQINGFQGHPRVTTAAGFPGLTAIQRTNHSRLDHASQSLPHNPRKEKRRGKAIRPPGLSRRD # RVPSIDDCISMATGGIEIVSIDVLVYLPLPSTGDINVSHALCSIYFLLKHLSVSSPSKAAYLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g869 ### # start gene g870 3 AUGUSTUS gene 3277604 3278410 0.45 - . g870 3 AUGUSTUS transcript 3277604 3278410 0.45 - . g870.t1 3 AUGUSTUS stop_codon 3277604 3277606 . - 0 transcript_id "g870.t1"; gene_id "g870"; 3 AUGUSTUS CDS 3277604 3277799 1 - 1 transcript_id "g870.t1"; gene_id "g870"; 3 AUGUSTUS CDS 3277877 3278153 0.6 - 2 transcript_id "g870.t1"; gene_id "g870"; 3 AUGUSTUS CDS 3278266 3278410 0.73 - 0 transcript_id "g870.t1"; gene_id "g870"; 3 AUGUSTUS start_codon 3278408 3278410 . - 0 transcript_id "g870.t1"; gene_id "g870"; # protein sequence = [MQSGYGGGGYDPTGGGGGYGGGYDSSNMGGYGVPGNGGFNPDTDPNAPISTVGAVATTGALTVMIQGTKTAVHKTVQT # VNSTYHHTKEKMHNVTTHTLHPFGDNQEEKKKTDKDDHKGKKDESSIVHSSVHIHGAKVCLSNLSVDVDEQDSDSGKTRPHYERGDVFSSDSKIDSAS # SSQRHHWEITESDWEFGVSHDDSRVDYSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g870 ### # start gene g871 3 AUGUSTUS gene 3289214 3290431 0.47 + . g871 3 AUGUSTUS transcript 3289214 3290431 0.47 + . g871.t1 3 AUGUSTUS start_codon 3289214 3289216 . + 0 transcript_id "g871.t1"; gene_id "g871"; 3 AUGUSTUS CDS 3289214 3290431 0.47 + 0 transcript_id "g871.t1"; gene_id "g871"; 3 AUGUSTUS stop_codon 3290429 3290431 . + 0 transcript_id "g871.t1"; gene_id "g871"; # protein sequence = [MPTLPHDLMKKVKVTTKHLGYKRRHTLHHVATTTARNITFTSDKCGKVWIEEYFLKGELFPNIFRLILNHNVLNSEYK # IKLKHAADLPVIDVGTKKRTYLPAEICEIEPGQPFRGKLNEQQTSQMIKVACNPPKVNAEAIVGDGFQKLGLNTNPSTSPLHGFGVEVMNEMAAVPGR # ELPPPRLNYRVGNARVANGGWNILDVKFHRGAQLSSWSVLVVRDGPSVFSGPSDTRLRGLVDGLATKMRNSGMTVPPGPPSLHLANLPLPDQDPGRVR # ALNEIRKILQDHVQKAQGRKPAFVLVLLSRRDNFIYPGIKVRFCSIYTCIQIQIFMSFSQRIGDVELGVQTVHMQLSKVVDKEPNKQDQYFSNVVLKV # NTKLRGINHKVRSRSTIVCYSQIAHTEFLFAVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g871 ### # start gene g872 3 AUGUSTUS gene 3293459 3293839 0.99 - . g872 3 AUGUSTUS transcript 3293459 3293839 0.99 - . g872.t1 3 AUGUSTUS stop_codon 3293459 3293461 . - 0 transcript_id "g872.t1"; gene_id "g872"; 3 AUGUSTUS CDS 3293459 3293839 0.99 - 0 transcript_id "g872.t1"; gene_id "g872"; 3 AUGUSTUS start_codon 3293837 3293839 . - 0 transcript_id "g872.t1"; gene_id "g872"; # protein sequence = [MEQWEAAQSALETGAALGEVSDVAQNAEDLTDTQSTTRLSVPSQGTAKVNDHPPRAIEGLPPSDPSHSISETLLPPNE # EDVPPVYALGPNTTSLSQTQNLPPSSELIQAVADHPEPSRHEKFEYAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g872 ### # start gene g873 3 AUGUSTUS gene 3298821 3299150 0.57 - . g873 3 AUGUSTUS transcript 3298821 3299150 0.57 - . g873.t1 3 AUGUSTUS stop_codon 3298821 3298823 . - 0 transcript_id "g873.t1"; gene_id "g873"; 3 AUGUSTUS CDS 3298821 3299150 0.57 - 0 transcript_id "g873.t1"; gene_id "g873"; 3 AUGUSTUS start_codon 3299148 3299150 . - 0 transcript_id "g873.t1"; gene_id "g873"; # protein sequence = [MHQPLGKYVTPTAAKTLSDLYNKITSLPPQIQIIAITFVPIDNVVESKLPAHPKHMLKSPKKDILIVTHAFANTMARS # LPSATAGPPVKSFDVISEEIVAKPCAKSVIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g873 ### # start gene g874 3 AUGUSTUS gene 3303430 3304446 0.81 - . g874 3 AUGUSTUS transcript 3303430 3304446 0.81 - . g874.t1 3 AUGUSTUS stop_codon 3303430 3303432 . - 0 transcript_id "g874.t1"; gene_id "g874"; 3 AUGUSTUS CDS 3303430 3303854 0.91 - 2 transcript_id "g874.t1"; gene_id "g874"; 3 AUGUSTUS CDS 3303966 3304325 0.9 - 2 transcript_id "g874.t1"; gene_id "g874"; 3 AUGUSTUS CDS 3304443 3304446 0.84 - 0 transcript_id "g874.t1"; gene_id "g874"; 3 AUGUSTUS start_codon 3304444 3304446 . - 0 transcript_id "g874.t1"; gene_id "g874"; # protein sequence = [MPLLVSGSTALQFFNRDDYNGDLDTYCHFRLCKPVAEWLIGRGYLFEPVGKQTSEFDQTFSEICQKENTTTETIAVAD # DSDIRDYTFDTIAAVWNFVRGSSKIQLIGTRGSPIETIFSFHSKDKATMLIDLQAPLNFHDMCPIRKYENRGFDIIHRPTFQQACDPSSSISFLALRY # IGDSHCCRVPFCDMDGDLSAVDAIESNSWDMAYTRKFNTIDFCSLNVPGAIVDYVVGPHNIALARAQIRAINTVLQGGILQYVWCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g874 ### # start gene g875 3 AUGUSTUS gene 3305083 3306573 0.58 + . g875 3 AUGUSTUS transcript 3305083 3306573 0.58 + . g875.t1 3 AUGUSTUS start_codon 3305083 3305085 . + 0 transcript_id "g875.t1"; gene_id "g875"; 3 AUGUSTUS CDS 3305083 3306573 0.58 + 0 transcript_id "g875.t1"; gene_id "g875"; 3 AUGUSTUS stop_codon 3306571 3306573 . + 0 transcript_id "g875.t1"; gene_id "g875"; # protein sequence = [MNSLSILLQFVTRTQASLKSKTFGRNRTYVMENLHRRHQHQISVTTYIENSPVPLEQPQIQLIRNVADHLFNHRNGIK # QRPLLVFVDGKAGSGKTVTLNIIRKIFADQSSLHSLFIGSNSQSVAAISGGHHIEYNNPIPHHITNEKQYFIIDESQACATSTISCFGHFVTRLGADE # YKTWEFLVGKNILVFGHNGGWKDRDIDSWWTSPVVNAFTTFLHFSTCKTVEPSRHAHILRSARELFPEGVDYFHHPKQTPAEILITPWPFMQKTWNDE # AVKTFASSVNCPLHISRSIDNTSCDPIQVDSTSPSHSILSSLGPPHNEVSICMGMPVAIVAGKWSGYWGHVAAIGSEPDKDTIEWIRVRLGNEFNILD # PTIDQFITIKAITLQIKHRSRIRNYSNPIVVNRYQIPVMPRYALLEAEAAGQFFDCGFVDNCRGLENFHSLSFVLSRFRSAGGIRMIEPYSDADIAIL # THTMTDKEEDRLSDILSSRVRSMRLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g875 ### # start gene g876 3 AUGUSTUS gene 3310630 3312357 0.35 + . g876 3 AUGUSTUS transcript 3310630 3312357 0.35 + . g876.t1 3 AUGUSTUS start_codon 3310630 3310632 . + 0 transcript_id "g876.t1"; gene_id "g876"; 3 AUGUSTUS CDS 3310630 3311181 0.35 + 0 transcript_id "g876.t1"; gene_id "g876"; 3 AUGUSTUS CDS 3311518 3312357 0.44 + 0 transcript_id "g876.t1"; gene_id "g876"; 3 AUGUSTUS stop_codon 3312355 3312357 . + 0 transcript_id "g876.t1"; gene_id "g876"; # protein sequence = [MTPSIVRDPEGTSTPVPLQKQEEERKRLRKEESEESLRKRAKAKEPQKMAPPVSSAAYAKSISARGSGSKLRKERDTE # GDDGKKKKSSVIGGIFGRKKDKDEKDKNGSVPSFDVSDSGRPSQTSDESSGRVSGTDTLASSPTTQTAMQQQKQLQVAALRNSMDPRRLNNQPPQTPP # GKSTIPPEALKRFRLPAAEDSNDYYLTVKQVEGCSTILHDTEKPLAVFESLVEVAMEVPKVKRSSMGSISSISSNLSMHPAIKKLPMNDFLDDSVVKF # YLNRRSDPDGDSDVGHNEAGEDTTLIAADTSTISELEVGASPGHLTVSTQGNVSVERFSSPSFRFAMQVIIYPEVLPDDMVFDPLTKAIVFKHTLRDR # QQSSQSQSSGILMNLRRKVFVFPKNVTVAEVIEIELERFGIFESVVDGGDEVEDKLAKRRSSSRVRYGLSVDMGGQGVLYFPSIKVFFPHY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g876 ### # start gene g877 3 AUGUSTUS gene 3312776 3313750 0.78 + . g877 3 AUGUSTUS transcript 3312776 3313750 0.78 + . g877.t1 3 AUGUSTUS start_codon 3312776 3312778 . + 0 transcript_id "g877.t1"; gene_id "g877"; 3 AUGUSTUS CDS 3312776 3313750 0.78 + 0 transcript_id "g877.t1"; gene_id "g877"; 3 AUGUSTUS stop_codon 3313748 3313750 . + 0 transcript_id "g877.t1"; gene_id "g877"; # protein sequence = [MLSTQTNSVRGVDILLPGNVRLRSSRYDTDVRLRYSYVLPDDAPYDISDIVEEEWKDGTGHKRDLLEGVVGRGGVNEK # LKCILNKIKVGKRQGNLLLQKRVQCSSLRSDSVSSRYSYDDLVTVDAHAQVHSRSATPVSAARPGTTTPTNIPSNRRNPSVASVLLDGSGYITVNSHR # ITSPIERERSTPTPTSALIYAPPLTPLTPPSPSAPIPTLPYQQRKTPTPTTKRPPPIHIKEDFGVSHMLSVIEFRAMKPKTLNKPGGRSDNDVDPVND # MLFGRSIDLDSLHPKIRELYADSFKRLAEMDEVNHCPFYMFCSVPCLTCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g877 ### # start gene g878 3 AUGUSTUS gene 3313928 3314389 0.97 - . g878 3 AUGUSTUS transcript 3313928 3314389 0.97 - . g878.t1 3 AUGUSTUS stop_codon 3313928 3313930 . - 0 transcript_id "g878.t1"; gene_id "g878"; 3 AUGUSTUS CDS 3313928 3314389 0.97 - 0 transcript_id "g878.t1"; gene_id "g878"; 3 AUGUSTUS start_codon 3314387 3314389 . - 0 transcript_id "g878.t1"; gene_id "g878"; # protein sequence = [MAFAFAVEAAGNFVDFVLECEWGIGLESLENSREDILDAFDVQMNINDAERILAFGEPESFYLDFDLDCDSDTDAFED # EDYVVIDFDDYIDVDGDEVYDGDEDYVDIREDEGYVATDSGENALLGLGDEDNIIADLDWDKVRTETLKFNQVDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g878 ### # start gene g879 3 AUGUSTUS gene 3315559 3315882 0.76 + . g879 3 AUGUSTUS transcript 3315559 3315882 0.76 + . g879.t1 3 AUGUSTUS start_codon 3315559 3315561 . + 0 transcript_id "g879.t1"; gene_id "g879"; 3 AUGUSTUS CDS 3315559 3315882 0.76 + 0 transcript_id "g879.t1"; gene_id "g879"; 3 AUGUSTUS stop_codon 3315880 3315882 . + 0 transcript_id "g879.t1"; gene_id "g879"; # protein sequence = [MSRGNVLDIFQTLYDFFNQNCIQDCDSDNTKCEFATTLTTGNLTQNLSSTNDHHVINSSLSLFDLHFVHDIIPAYQEL # RRINSVEICNHIGSEEGQPFDLYHIPVNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g879 ### # start gene g880 3 AUGUSTUS gene 3317180 3317966 0.4 - . g880 3 AUGUSTUS transcript 3317180 3317966 0.4 - . g880.t1 3 AUGUSTUS stop_codon 3317180 3317182 . - 0 transcript_id "g880.t1"; gene_id "g880"; 3 AUGUSTUS CDS 3317180 3317636 0.99 - 1 transcript_id "g880.t1"; gene_id "g880"; 3 AUGUSTUS CDS 3317735 3317832 0.8 - 0 transcript_id "g880.t1"; gene_id "g880"; 3 AUGUSTUS CDS 3317958 3317966 0.42 - 0 transcript_id "g880.t1"; gene_id "g880"; 3 AUGUSTUS start_codon 3317964 3317966 . - 0 transcript_id "g880.t1"; gene_id "g880"; # protein sequence = [MSMPKNTIFQMFVSTYLKSMILKGVWFTLWTTRKFLWDITKSANGNPVNKPNRICSNIIRKLRVLPEDDDDMRLLFHT # EALNRVEGFERRSEQLRIAEEARELARREEVLRLEQTMAKAKAVADAKRKRLQELRVQSTSSSSSSVLAKRNGSNLFGEPDVPKRIQLDESANEIVYE # EGELINDISLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g880 ### # start gene g881 3 AUGUSTUS gene 3318243 3318696 0.26 - . g881 3 AUGUSTUS transcript 3318243 3318696 0.26 - . g881.t1 3 AUGUSTUS stop_codon 3318243 3318245 . - 0 transcript_id "g881.t1"; gene_id "g881"; 3 AUGUSTUS CDS 3318243 3318485 0.61 - 0 transcript_id "g881.t1"; gene_id "g881"; 3 AUGUSTUS CDS 3318541 3318696 0.45 - 0 transcript_id "g881.t1"; gene_id "g881"; 3 AUGUSTUS start_codon 3318694 3318696 . - 0 transcript_id "g881.t1"; gene_id "g881"; # protein sequence = [MQRVPSLSDRGGLWLVDSARDIVTVTVVAQISDSPADLKCSEYLDMNIYNREINLDSLRRASARLFFNQVFVPAESSG # EKAAIYDEHRSRFDSLLNFLQQATIQYLDSVKTMDGIEHSSMCYIISISDSSYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g881 ### # start gene g882 3 AUGUSTUS gene 3321702 3322052 0.83 + . g882 3 AUGUSTUS transcript 3321702 3322052 0.83 + . g882.t1 3 AUGUSTUS start_codon 3321702 3321704 . + 0 transcript_id "g882.t1"; gene_id "g882"; 3 AUGUSTUS CDS 3321702 3322052 0.83 + 0 transcript_id "g882.t1"; gene_id "g882"; 3 AUGUSTUS stop_codon 3322050 3322052 . + 0 transcript_id "g882.t1"; gene_id "g882"; # protein sequence = [MINNILRAPPPAEHGGLTSLPPNGSEQSIQNFNVGIRDRIDLGFWGTATGGDDTPTGHFSNEGRSHNIGGHAGQNGQL # EDSHSSLPNAGEQSGDRPLATYMNTLCEHTGDEHWVTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g882 ### # start gene g883 3 AUGUSTUS gene 3324015 3324335 0.72 + . g883 3 AUGUSTUS transcript 3324015 3324335 0.72 + . g883.t1 3 AUGUSTUS start_codon 3324015 3324017 . + 0 transcript_id "g883.t1"; gene_id "g883"; 3 AUGUSTUS CDS 3324015 3324335 0.72 + 0 transcript_id "g883.t1"; gene_id "g883"; 3 AUGUSTUS stop_codon 3324333 3324335 . + 0 transcript_id "g883.t1"; gene_id "g883"; # protein sequence = [MLGNCNMVKAGVLDKLPAHDDQEEASETLNNLKIMLKIHDQWQSTNPNDRAFTYMQSATASQSRIDRIGVTDSLLKTA # REWKIRESGVPNTDHNLVSVQLTSEEAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g883 ### # start gene g884 3 AUGUSTUS gene 3326962 3328011 0.3 + . g884 3 AUGUSTUS transcript 3326962 3328011 0.3 + . g884.t1 3 AUGUSTUS start_codon 3326962 3326964 . + 0 transcript_id "g884.t1"; gene_id "g884"; 3 AUGUSTUS CDS 3326962 3328011 0.3 + 0 transcript_id "g884.t1"; gene_id "g884"; 3 AUGUSTUS stop_codon 3328009 3328011 . + 0 transcript_id "g884.t1"; gene_id "g884"; # protein sequence = [MESASNAGGRVNGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAVSKQSRVSSRRLPTPPVQSLNLPPPRRGSSLSS # LLKSPAMNTPNWERTHAIHHSRTNFPVQPLSKMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEVLGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQW # LMTPANRSDFLWLYNVLLDPERMLELLEAEAHYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRILYRASNYRSGAVRFEPPPSRVNIPNYQAIQILR # NANLAEAAAKIDEESNEDANAIAAKNRRHRRYTRAHLLAPVESMPDQDSPVRVRSGQTVYTYTPMEAYAPASGEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g884 ### # start gene g885 3 AUGUSTUS gene 3329965 3330639 0.27 + . g885 3 AUGUSTUS transcript 3329965 3330639 0.27 + . g885.t1 3 AUGUSTUS start_codon 3329965 3329967 . + 0 transcript_id "g885.t1"; gene_id "g885"; 3 AUGUSTUS CDS 3329965 3330639 0.27 + 0 transcript_id "g885.t1"; gene_id "g885"; 3 AUGUSTUS stop_codon 3330637 3330639 . + 0 transcript_id "g885.t1"; gene_id "g885"; # protein sequence = [MKQMPEESFANFFIRFNEYAPLTGFNDEALITYLKKGVAPWLPLQVVTGREEPRSYNEWTRVFTKLDGAVRAQAESLR # NLHGEKPLQGWLSRFPGLELAPEAPYKSSLRREREPADVWTSNPKPAATGRFQNRSNWKEGRQRASAAWGKEKVTIARIERGTKTAVTAGMEENGLKQ # SSEQELPIPGGNGLLRKEQRSGGDEGRSSACVVDERNTGQRTALTQNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g885 ### # start gene g886 3 AUGUSTUS gene 3331109 3331768 0.52 + . g886 3 AUGUSTUS transcript 3331109 3331768 0.52 + . g886.t1 3 AUGUSTUS start_codon 3331109 3331111 . + 0 transcript_id "g886.t1"; gene_id "g886"; 3 AUGUSTUS CDS 3331109 3331768 0.52 + 0 transcript_id "g886.t1"; gene_id "g886"; 3 AUGUSTUS stop_codon 3331766 3331768 . + 0 transcript_id "g886.t1"; gene_id "g886"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTQLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIIQPGAEGGTEELGRGVNSEGIHEGTLQPPPEAPQQPPEAPQPPSEVPQQSPEAPLRAPRTGVKLEEVKDEEYEASQPG # PHKLFPSDRDLGPDDPILMGINEWLAFASESTEEEVEEILEPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g886 ### # start gene g887 3 AUGUSTUS gene 3332117 3334702 0.85 + . g887 3 AUGUSTUS transcript 3332117 3334702 0.85 + . g887.t1 3 AUGUSTUS start_codon 3332117 3332119 . + 0 transcript_id "g887.t1"; gene_id "g887"; 3 AUGUSTUS CDS 3332117 3334702 0.85 + 0 transcript_id "g887.t1"; gene_id "g887"; 3 AUGUSTUS stop_codon 3334700 3334702 . + 0 transcript_id "g887.t1"; gene_id "g887"; # protein sequence = [MDRLLREGNPAYFLHISPTKEESPTEEMLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELNKEESKCQETEELKKS # IPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCIDYRALN # KITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNL # QYFTTTKQLTARQARWAELLSGYNFVINYCPGRLGAKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATILMNEDLLIKRVREAPKDTSMIE # ALKRIAWNEEESLVWEDGLIKRGGCIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTRKLVSQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLR # PLPIGQRPWSSISLDHITQLPVTAGPEKYDAILVVVCRLTKQAIYVPCHTTDNAEDFANLFITHVFSKHGMPSDIVSDRGSLFVSQFWRELCRALGIK # SRLSTAYHPQTDGQTERVNQAVEAYLRIYCSYDQDDWDLLLPMAELVYNNTPNTTTGVSPFFANKGYHPKLSITLELVQGAEVNKYASNLKELHAYLQ # ERIRVANEVYAQYANQKRQEAPDWKEGDHVWLNMENVRTRRPMKKLDHKWTGPYSILAKIGSHAYRLDLPGNLHKIHNVFHVDRLKPHFHDKFKRQTS # PPPPIFIKGETEHFVEDILDSKPKKGQPEEVEYLVKWEGYSEEFNSWVGWEGMAGSLELLRSWHEKPPRKRQPSQRHWARLVKDAQEDEEDEREDRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g887 ### # start gene g888 3 AUGUSTUS gene 3334923 3337241 0.04 - . g888 3 AUGUSTUS transcript 3334923 3337241 0.04 - . g888.t1 3 AUGUSTUS stop_codon 3334923 3334925 . - 0 transcript_id "g888.t1"; gene_id "g888"; 3 AUGUSTUS CDS 3334923 3336158 0.81 - 0 transcript_id "g888.t1"; gene_id "g888"; 3 AUGUSTUS CDS 3336218 3336241 0.43 - 0 transcript_id "g888.t1"; gene_id "g888"; 3 AUGUSTUS CDS 3337056 3337241 0.06 - 0 transcript_id "g888.t1"; gene_id "g888"; 3 AUGUSTUS start_codon 3337239 3337241 . - 0 transcript_id "g888.t1"; gene_id "g888"; # protein sequence = [MDTVMLMWEDMIGAYVREVLGYPDSPGRILPPVEVPSTNDPLPATTSLGVDDPRPVLGASDSMRSYRGLLGISERFWK # VQEDLQNATRERRVAVEKLVTSTRKNSQLRTTLLHQQGLVDESNALATRQRRHVEEFPEEVHRVRGRAVFVEQMLKEYPDERYYEVVLPPLSQLEGDL # NQAHEDLRRVATFAHRLYRCDPATVLHHHHCYLGAIIEAVVAFLRRGLDSDDLDVIVHNFWLVLDYVQAAQGVHGDMYMRSISSIQWFFNNAVDKDEG # LYRMILEHSRFDSDSPFLTAAHHAGFVPPPDDSVEPPLHRRMLVLSTALPHSDGVGRWEDIVPALPSIDQLTADWEQMMLQYIHHITDTPLSGTDTQG # PMSSVGPANESLPEVLVRQSPEAPAALESTSSVGPQPRVPLFLPERESLTFPSPTLPPLFGSVANLVIDLTGDDDELYETEEVSAGRFSVTREVIDLA # VGQEVVKDKSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g888 ### # start gene g889 3 AUGUSTUS gene 3340017 3340664 0.97 + . g889 3 AUGUSTUS transcript 3340017 3340664 0.97 + . g889.t1 3 AUGUSTUS start_codon 3340017 3340019 . + 0 transcript_id "g889.t1"; gene_id "g889"; 3 AUGUSTUS CDS 3340017 3340664 0.97 + 0 transcript_id "g889.t1"; gene_id "g889"; 3 AUGUSTUS stop_codon 3340662 3340664 . + 0 transcript_id "g889.t1"; gene_id "g889"; # protein sequence = [MSLCTTCGRNKPRRHQAYGLLKPLPVPVRPWDSISMDFTERLPMSNGYITILVIVDQSSKQAIFIPTFDTITSEQLAE # LFVIHVFSKHDVRNHVTSDRDSEFVPAFLRALGKALSMELHYISGYHLEPDGQTKRVNQTLEQYIRIYCSYQQDDWSHLLPIAEFAYNNTPNASTGIT # PSFTNKGYHPNITVRPEVDMKSDLARNFVVNLDELHVFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g889 ### # start gene g890 3 AUGUSTUS gene 3342892 3350130 0.52 - . g890 3 AUGUSTUS transcript 3342892 3350130 0.52 - . g890.t1 3 AUGUSTUS stop_codon 3342892 3342894 . - 0 transcript_id "g890.t1"; gene_id "g890"; 3 AUGUSTUS CDS 3342892 3350130 0.52 - 0 transcript_id "g890.t1"; gene_id "g890"; 3 AUGUSTUS start_codon 3350128 3350130 . - 0 transcript_id "g890.t1"; gene_id "g890"; # protein sequence = [MESLQIIIRDLSNSVPPWLSPEHINACRLHLRKLHVRELLAGTRRIKHSDAVNIVVEKLLHFRSNYICFECNEKCLYY # AVHQQCIEEFGTVITSVLHCRFGKHCSVQRSDEDLINSNLLSVIIPVFQGISNDELLRLRQSLNICERKIKSNIVYCCPSIYYSSEVRSNDLYKLLAK # CFQRDYKYFFTMDDVTLSDRYLFEYHKPFSCTDLREIILQLLLSVGYTYGLLQDIVTAVGIVDKSKSKNSLYKKDRRRDVRIQRGIDEYNMLHNCLDD # WPQAVSGDIQMKCLYDYRNAIQYVPLSVCACCGSEDNMRTGTYLSQPNWPSLSQLKVMDSFVLANTPQSRFTYICKELDGLLLDKKGIRTVDIECCSF # ELYLCHSCNSSLQRSVLPRLALNNFLYRGELIDELKNVTWVEEMACSLYHTTAHVSRIYGSSDDSDPLQLHGNVCAHPLNICSIAKRLPWSPADLNDL # ITIVFVSKTKLRPQDLQKLKPYFVRRRIIRMLLSELYKHNRLYTGMHFMDNSALSMFPENGLLPGLEERIVYDHETIVDDCFGTESSGFDDHPADLLR # GSSHNDILLERSGLYDPESQDVPARFMTAASIHNIAQSLPSSSNKDVILPYDSDPIAEYNNPDLFPGMFPTLFPLGIGGFEDKRRCPAISLEAHVEYL # LDQSSREFRYHHFFSFVALNLIQRRKAHLHTSLWMSSAQFAEVAPDLINVSATVLSDLADKLKNENNKNDFSNDELHAFQLLNQVNIISSKIPGSQAS # KTVTRNQIRSFYSYFGLPHLFVTLNPSAVHSPIFQVMYGETNIDLNEHYPYVVHPRSERACRVAKDPVAAADFFDFMYHAIFEHLFGWDFKSGKSCKD # GGLFGHLRAFFGCAELTERGCFHGHYLLFLRGGLNPSDVHKKMIEVESYRKQFMDFFDGIIHHHLPNIDVSVGDGYEPRVEMPPDVPIINSSKGSFED # LDNWHRQFNDEHKKIGERFQRHVCRPVCHKGQSSTDICRFGFPHEIIESSTFDVKNNSIIFARKESDVNGHNPYVLVYTRHNHDIKCILSGKAAKAAM # FYISDYITKMPLSTDILLSTLSKAVASLVSDEINDGPVLDAKKLLHRCLTHFGRKQQIHAQQCARYLRGLGDNMISHSTVSLPSANLMSFVNQMYLQN # IENKDEDNFDVMLSLGFKNGKIVSYSQVVNYWYRDDLLSDMCFYDFIRYVSLQACSKTRTTNTSDTRLGVLSRYKLLVGHPLHETHELIRHTNYKQGD # VGREFVPVMVGLVPPRRNSAEYALFVIAHFKPFSVSHSLLEKDGETEYKNLALCNEHQRILHNWEEIHECVDQRDAERLRKRSDHLTKVLNLSEDIQD # ILDTDDDTANIFVFPNKVKHADIKMIHDDHELKLLQIDLKYAAWLKESPVSLKNNIYKNSISNVTLPELNSVNIQKWLKEGKQIAEKFASARYSHGNL # SNQQSIDNVTDIDNENLYRGKNISLADPIAMVESYTPAELKSKIGKEFGLNSEQQIAFDIISSMVIYREILKVPEWITKPALVMNLTGPGGTGKTHVI # CAVQEIMKHYGVEYAYRALAPTGNAASLVNGKTIHSGLNIAVKEYKNGRSKRPLGESTETGIVFATVKKNNALRREWKDVCLLLIDEVSMVDAILLAD # IDGSLRYAKEKPDDFFGGINVIFCGDSFQYPPVGTPLYTPIHLSAKQTDDELMRRLGRLAWKSINTVVELHEQKRMEGDVEYAAAVGRLRVRQCNEDD # VKLFNARAIKTPSNPDGVIMEDEIQYCASLIVSKNAMRRALNECKALAICHGSNSPELIRVVAYDEIQYKKVAEQLSKKDRVRPNSFEQAQLLSIDTS # SGKLRAGLPGILYLYIGMPVILKHENLNTELGITNGARGILRKLEMSTDHNGLTYCKYALVEFPDSKAELSGLPKGYFPIKSRSWHFSSYIKNDKNEK # VLVSVVRMQLPFEPAFALTGQGAQGRTLLAILCMLHLGGYGAYVSASRPKNRSGLFITKKVTVDDLNFPAIPYDLWFEHQRFQIMAYNTKIVWGYSQG # ELKDVPDAECEQKIKHSSVHYDFANYKEMKRHGDDNVQIQKSSKKSKVSHADYTNITNRIVGQNQHIGYGVDINDNVHVCQYGSRGPSWDASNWSCCF # DTAIVVLYNCFVRLSKTSCQQWIDQCQHQDIFQYFKDLEINLVNQGSLTVWNNIRDAWRVKISHVFGEGYVQSGHTMLPISTIIQCHLYNSNKKHLSV # VAHCGQHNSYIRYNSSVKCYNLVSVQLDPLYSHGHLINSTQSFIDIVLLQDAGGFSRQIAHEDMCNAECALSMQISCNDVQFIVFELNGVSDMEPSSQ # ISVRFHDTSIILHYRLSAIIYYGSGHFTARVFNASGVWLYDGQVEDGIFVSDTSSVGKISGDLNDLNNRKAHIYIYTYLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g890 ### # start gene g891 3 AUGUSTUS gene 3350888 3353659 0.07 + . g891 3 AUGUSTUS transcript 3350888 3353659 0.07 + . g891.t1 3 AUGUSTUS start_codon 3350888 3350890 . + 0 transcript_id "g891.t1"; gene_id "g891"; 3 AUGUSTUS CDS 3350888 3350965 0.24 + 0 transcript_id "g891.t1"; gene_id "g891"; 3 AUGUSTUS CDS 3351034 3351592 0.22 + 0 transcript_id "g891.t1"; gene_id "g891"; 3 AUGUSTUS CDS 3351747 3353659 0.5 + 2 transcript_id "g891.t1"; gene_id "g891"; 3 AUGUSTUS stop_codon 3353657 3353659 . + 0 transcript_id "g891.t1"; gene_id "g891"; # protein sequence = [MLLRLSTEAINALQSDPNAKPNVDFVSRIVIGESSFSLQSQTEEIPHDLYLRSASAAKPFVPLKFYANVIGKLTISER # ELDDELADRIRKSTAAAAEKRHNPKTKFIDANNLPQPTTKSAAKKKSDLFRKPLRPSDRLKPTPLSTSTSSAPSPRPSHAPKPPQDGTTSLGRRLIHY # LALAERTSEDAVKAVGGSNCDAKIRQDILDALHLVRNRTNLARGARKALSSLGIPESDPRWEHAKYRPPANIARNDSPIPAPSSLSASNSASAPKRGI # SSKEAREKNARKPDTKTEILIKDETKPRPNHVASSANALGSNSMKPAAKTSKAPTPPTTNGTPSTRLTPNMRRLPGSGYKLPTKAVDLSRSQNQSKDG # SITPSISSSSAASKDVDVAMKDMTRRPNEDKQKDDQRLPTSRSNIKKEEGELSTSSSGTGGIGARTNDGPAPVKRVKHLRDEAMESDQDKIKDNSKGK # NRERAEGRSRDTDRSRERVKDSDRGGSKERERSLERDHHRDREPTRRNSEASSQKRKKVKEEDEEHDEGIFRTGGKRRKTENGMEVLSMGGPVRGDRV # NERDRDRERQRGKDNEQRDREIHRGKDKERERGRDETRERGKDRERERERERYRDRERDSPQKGRDARSNKFVNEPTTDRKSSANSQSHSGKGKTMKK # EPSLPPLPAKKVKKELSPVPRHTSPISNHSNKSSSTKGAKFRRKSPIYTSSEDEDNQRHPSPALPTPTASSSSAGSRRSHLSTNDALTDGNLNEHSHE # ADHRNALRSKYTASYVKYLSTFQTLVSQKQEIERLLNRASSRSSDSDGDVELLDFEGLTKTLSQNKQQWEELQSIQLEHEREMLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g891 ### # start gene g892 3 AUGUSTUS gene 3358104 3359728 0.4 + . g892 3 AUGUSTUS transcript 3358104 3359728 0.4 + . g892.t1 3 AUGUSTUS start_codon 3358104 3358106 . + 0 transcript_id "g892.t1"; gene_id "g892"; 3 AUGUSTUS CDS 3358104 3358125 0.66 + 0 transcript_id "g892.t1"; gene_id "g892"; 3 AUGUSTUS CDS 3358269 3358534 0.68 + 2 transcript_id "g892.t1"; gene_id "g892"; 3 AUGUSTUS CDS 3358853 3359728 0.71 + 0 transcript_id "g892.t1"; gene_id "g892"; 3 AUGUSTUS stop_codon 3359726 3359728 . + 0 transcript_id "g892.t1"; gene_id "g892"; # protein sequence = [MDISSILAAAVLPTSISSVTDTTSIIIPSTTSSTTSSTPDVSSTTTSTSIFTTTSSSSSPSSIDSSSTSSSTVSPTTS # SITLTSTVLPTSSTSSTPENEAAAAEAANATAPAFLDDDDHPIYRRDYLHAGDMSSGGYSGYEGGGPIYTGAVPSASSHGTFNQPPMGIQPNENYPMA # EFGSLLYPGASPYPITMAPGQNPQQNNYYDHGFVGNEPLSASTMKTVRPTSGDFDILEQQQQRNEGGSDATNYTSTGTPHTTPSVSRGHSTTTSTSHS # RTDLFRNKSQGSRSLIDGYYSKAPSTTGGHDMVSPHSGESYAAHYQPGFSGMPKSSPSRRSTFGYDEAPPLPNLFSKTIDDEAVDESDDEVFQQKKVL # KVCEFYIDAISYIMD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g892 ### # start gene g893 3 AUGUSTUS gene 3360038 3361146 0.2 + . g893 3 AUGUSTUS transcript 3360038 3361146 0.2 + . g893.t1 3 AUGUSTUS start_codon 3360038 3360040 . + 0 transcript_id "g893.t1"; gene_id "g893"; 3 AUGUSTUS CDS 3360038 3360283 0.23 + 0 transcript_id "g893.t1"; gene_id "g893"; 3 AUGUSTUS CDS 3360643 3361146 0.56 + 0 transcript_id "g893.t1"; gene_id "g893"; 3 AUGUSTUS stop_codon 3361144 3361146 . + 0 transcript_id "g893.t1"; gene_id "g893"; # protein sequence = [MFLIIKGIRSLIKAFCGSSSQQEPSQQQQQQQWHPQQQQPQYPTVQQPTPVYPPTQPLSQQPHPKPTRPQQHPSPYPH # SPRPKITRFVVSCLRNIHHAAASIQDSKPGEIDLHGLYVKEAIERTDYAIQDAKRRGDTEVHLIVGTLSFEVSISTVLYQSAAAGKGLHSSGGVAKIK # PAIEELMQKSVLLGYGIKALTNMGPSRHQLVAELDPNNAGVLLVQLGGHRDRAVGPDEIARRLNRDEEGCIVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g893 ### # start gene g894 3 AUGUSTUS gene 3366793 3367584 0.98 + . g894 3 AUGUSTUS transcript 3366793 3367584 0.98 + . g894.t1 3 AUGUSTUS start_codon 3366793 3366795 . + 0 transcript_id "g894.t1"; gene_id "g894"; 3 AUGUSTUS CDS 3366793 3367584 0.98 + 0 transcript_id "g894.t1"; gene_id "g894"; 3 AUGUSTUS stop_codon 3367582 3367584 . + 0 transcript_id "g894.t1"; gene_id "g894"; # protein sequence = [MADAPRGRGGFGRGRGDRGRGRRGPRRGARKDDEKEWYVESTGVEGCISSSSYRVPVTKLGRLVKDGKIKSMEEIYLF # SLPVKEYQIVDFFLPKLKDEVMKIMPVQKQTRAGQRTRFKAFVAIGDSDGHVGLGVKCAKEVATAIRGAIILAKLSVIPVRRGYWGTALGEPHTVPSK # VSGKVGSVMCRLIPAPRGTGIVAAPASKRLLELAGVQDVYTQSKGSTATMGNFLKATFAAVSFLFLFAFFSQCFAIIDHKNICLPYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g894 ### # start gene g895 3 AUGUSTUS gene 3368345 3369379 0.72 + . g895 3 AUGUSTUS transcript 3368345 3369379 0.72 + . g895.t1 3 AUGUSTUS start_codon 3368345 3368347 . + 0 transcript_id "g895.t1"; gene_id "g895"; 3 AUGUSTUS CDS 3368345 3369379 0.72 + 0 transcript_id "g895.t1"; gene_id "g895"; 3 AUGUSTUS stop_codon 3369377 3369379 . + 0 transcript_id "g895.t1"; gene_id "g895"; # protein sequence = [MKSSPLFTLADTGSAPDLSNIIARKRWGAVQGFIDTQAEFRKTRNKADSLIDLEADLDFTPPFEQSSDSYRGRIDGLA # KELQPVIRPGTLEPPLPPWIARRDSDTCQESPFLLPAASKSSLLLGNKTSSRPAYYQSTQKQSVPSPALYSFPSSSSSAKNVSTPSERLPQLVLPRRI # SKMRSLKFAPECNPSSDRLDISNHDSKPHKPLFRGRSISMDFNNNSRSRPLSMFAGNQGMSASTSYLSKMGRTPPTGPLVKESSDYPLNRGRDVGLST # PFLHRPVNSNTPVRHQRRLHHSMMPSPGLKSFMDITPEQVQRKPTAHKDKVRKLLSRASQVFDWRKKKGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g895 ### # start gene g896 3 AUGUSTUS gene 3370079 3370438 0.2 - . g896 3 AUGUSTUS transcript 3370079 3370438 0.2 - . g896.t1 3 AUGUSTUS stop_codon 3370079 3370081 . - 0 transcript_id "g896.t1"; gene_id "g896"; 3 AUGUSTUS CDS 3370079 3370438 0.2 - 0 transcript_id "g896.t1"; gene_id "g896"; 3 AUGUSTUS start_codon 3370436 3370438 . - 0 transcript_id "g896.t1"; gene_id "g896"; # protein sequence = [MQERLRAELLTVLPPTAPTNLSELTEEETQSLYAEVSELPYLHNVMREALRLIPPLHSTLRVATKDDEIPVSYPVHRS # DGSVDESAQSIHIAKGTFVHVSVEAFNLDQDVWGEDAWSFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g896 ### # start gene g897 3 AUGUSTUS gene 3372866 3373828 1 - . g897 3 AUGUSTUS transcript 3372866 3373828 1 - . g897.t1 3 AUGUSTUS stop_codon 3372866 3372868 . - 0 transcript_id "g897.t1"; gene_id "g897"; 3 AUGUSTUS CDS 3372866 3373828 1 - 0 transcript_id "g897.t1"; gene_id "g897"; 3 AUGUSTUS start_codon 3373826 3373828 . - 0 transcript_id "g897.t1"; gene_id "g897"; # protein sequence = [MPVFSESLGCLDASYLYNGGETTISIPVGDRYDHAVDVHGDGVGTFTVTEAPADITEVQYKLTIQTNDQSLLDQVTLQ # YPAAKSDGSSDGNSRLLIGTPRLNQDSSSCIRYDVTMYIPKTLKKLHILPHTVAQVRFDPQAHIDLEDTFVTLYKMDRLNIIEPHENLRSTSLALEVY # RGWIVGHAAIVNETAITTQRGDGVMNVHIHPTAPADPTNPEPVSLRTTTGAGRTDLFYDNDKAYPHRPIRSVHLSSRNADVYLTYKNAEFDGNVKLDS # SSFTTTGSKPYSLGGQAKGQWTHWVGDMDGNDEISIKSKGWTGLYF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g897 ### # start gene g898 3 AUGUSTUS gene 3375112 3375495 0.87 - . g898 3 AUGUSTUS transcript 3375112 3375495 0.87 - . g898.t1 3 AUGUSTUS stop_codon 3375112 3375114 . - 0 transcript_id "g898.t1"; gene_id "g898"; 3 AUGUSTUS CDS 3375112 3375495 0.87 - 0 transcript_id "g898.t1"; gene_id "g898"; 3 AUGUSTUS start_codon 3375493 3375495 . - 0 transcript_id "g898.t1"; gene_id "g898"; # protein sequence = [MKATVIKVCTSVPSINALTDHIHNCTQMVKAGVPVFFGCDVGKSSERNLGLMDTTLFQYEDTFDITLGLTKAQRLEIG # ESAMTHAMVISGVHLDANGKPVRYKVENSWGEVPGNKGYFVMTDEWFNE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g898 ### # start gene g899 3 AUGUSTUS gene 3375686 3376776 0.65 - . g899 3 AUGUSTUS transcript 3375686 3376776 0.65 - . g899.t1 3 AUGUSTUS stop_codon 3375686 3375688 . - 0 transcript_id "g899.t1"; gene_id "g899"; 3 AUGUSTUS CDS 3375686 3376183 0.81 - 0 transcript_id "g899.t1"; gene_id "g899"; 3 AUGUSTUS CDS 3376288 3376776 0.81 - 0 transcript_id "g899.t1"; gene_id "g899"; 3 AUGUSTUS start_codon 3376774 3376776 . - 0 transcript_id "g899.t1"; gene_id "g899"; # protein sequence = [MFLGSYKAWLPDTPTFALLLAMGSSPSKPVKPSPVLQQQHAENEKHAPAEIATAFSALSVWTPTSVDGSVSLQNVSSW # ESDISHDPKARLARTVLSHSDIRDALVSRKATVATTHIFNNEIDFKTGPITNQKSSGRCWLFATTNVLRYEVMKKLKLKDFQLSQLMIENADLSVDDR # VISHLSGDLISDGGQWDMAVNLLETYGVVPQSVYPESFHSSLSSPLNALLKTKLREDALILRKLVVDMKAAGASAQATVSATRAEKEKLMKEIYTIMT # AALGVPPLPDATFTWEYYDENDKAGTWSGTPLEYYKTFAAKPYSVSALTRDLNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g899 ### # start gene g900 3 AUGUSTUS gene 3379492 3380469 0.66 + . g900 3 AUGUSTUS transcript 3379492 3380469 0.66 + . g900.t1 3 AUGUSTUS start_codon 3379492 3379494 . + 0 transcript_id "g900.t1"; gene_id "g900"; 3 AUGUSTUS CDS 3379492 3380469 0.66 + 0 transcript_id "g900.t1"; gene_id "g900"; 3 AUGUSTUS stop_codon 3380467 3380469 . + 0 transcript_id "g900.t1"; gene_id "g900"; # protein sequence = [MSSVYQCFYSRKSFMFPERQLGPHRDWQQEVQFLDNIFPNGAAYNVGKVNGDHWLLYMKTPSDDSGAFRSSPHLESPV # IGNAFPDYTIEILMSDLSPAAREPFFSTFSSPETPSSHALSLSRSFGITDIFPPHLTTLDAYSFSPCGYSSNALIKWGEDPFFFSSPDMADGTSTVGE # GYYTIHVTPEEGWSYASFECNVPLHPNRPSSAPDANTIPDLKTLVQRVVSIFQPGRLSLTLFISSEDNESDETGESPVEAAQRAFRAALCASVMEEKI # PSQTNGTNGEISDDNAPSQKVGKRYRRTDKINYEFGAYDLAFASFELSDHK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g900 ### # start gene g901 3 AUGUSTUS gene 3380900 3381844 0.85 - . g901 3 AUGUSTUS transcript 3380900 3381844 0.85 - . g901.t1 3 AUGUSTUS stop_codon 3380900 3380902 . - 0 transcript_id "g901.t1"; gene_id "g901"; 3 AUGUSTUS CDS 3380900 3381844 0.85 - 0 transcript_id "g901.t1"; gene_id "g901"; 3 AUGUSTUS start_codon 3381842 3381844 . - 0 transcript_id "g901.t1"; gene_id "g901"; # protein sequence = [MPACNQCQLQGKPSQCAYLPRRRRNAEEKITFEDDIGTTAGTILKFGFVDQNTNDYEPSQSNIQDQAPSSVSTPIRRF # TTTSPSDYQGGSSSSHRDSDARSTRGSVRSGSTSSASRLQQSSNGNAIFTRSQRSLPQFSPLPSVILRTLSEKQEAEMPDREAFNKSIKVFLKTLMPE # MQESASLSPATYAGVAKYLVTGEIPPHASPYLQTWMTTHRLLPGSQTHPLILIPRDPIPENLAISLQEYQADPVRYTHGDGTTLPEQSIFDRLPVQDE # LYDILAYAHRAHKNSNIMTDEVRQSGFVSDPWFFKRNEVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g901 ### # start gene g902 3 AUGUSTUS gene 3387589 3387945 0.49 - . g902 3 AUGUSTUS transcript 3387589 3387945 0.49 - . g902.t1 3 AUGUSTUS stop_codon 3387589 3387591 . - 0 transcript_id "g902.t1"; gene_id "g902"; 3 AUGUSTUS CDS 3387589 3387945 0.49 - 0 transcript_id "g902.t1"; gene_id "g902"; 3 AUGUSTUS start_codon 3387943 3387945 . - 0 transcript_id "g902.t1"; gene_id "g902"; # protein sequence = [MDYGRGSKSVRPRSFPTHERTLTAWSDNFDDYWRVASKVTPTTAPTRAQSPAPPSSSASMVNRPPSADPGGPSERDGA # YNVRSIPVRLYLPDGPVIQDLVPPMVDDSKFVTSSSRCAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g902 ### # start gene g903 3 AUGUSTUS gene 3389930 3390641 0.37 + . g903 3 AUGUSTUS transcript 3389930 3390641 0.37 + . g903.t1 3 AUGUSTUS start_codon 3389930 3389932 . + 0 transcript_id "g903.t1"; gene_id "g903"; 3 AUGUSTUS CDS 3389930 3390372 0.37 + 0 transcript_id "g903.t1"; gene_id "g903"; 3 AUGUSTUS CDS 3390440 3390641 0.43 + 1 transcript_id "g903.t1"; gene_id "g903"; 3 AUGUSTUS stop_codon 3390639 3390641 . + 0 transcript_id "g903.t1"; gene_id "g903"; # protein sequence = [MNNLRRRESLEAETGNEQCFDFGDPDSACASGYLASGNGGYIAASGNSVGITSTTGTTSTTESNFGLGSKLSAKLKAF # ADQQVPTSLKTGRRDSIKGNMGLLHFPKGVSAWAFEEPRALTTSSFQNERRDQNQVIVKVVAKNLRTSSSSRHRKFAKEDAHFAELDIVLSTVKRKTV # VDIMRERDARFSREDDTEEDPFLDNSGTRMPDVDLDDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g903 ### # start gene g904 3 AUGUSTUS gene 3393957 3394355 0.83 + . g904 3 AUGUSTUS transcript 3393957 3394355 0.83 + . g904.t1 3 AUGUSTUS start_codon 3393957 3393959 . + 0 transcript_id "g904.t1"; gene_id "g904"; 3 AUGUSTUS CDS 3393957 3394355 0.83 + 0 transcript_id "g904.t1"; gene_id "g904"; 3 AUGUSTUS stop_codon 3394353 3394355 . + 0 transcript_id "g904.t1"; gene_id "g904"; # protein sequence = [MTDLDRVSNAHTHKRHPSQPNTDPSANAKITNDILPILHRLNPALPQIPHILTRLRTLSTLHTSAGEFRKDLESLEDE # QAQIKESLEELESAVETVEKSLEENRKIVGGNVEGLERRVDDLSRRLDELERIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g904 ### # start gene g905 3 AUGUSTUS gene 3396015 3397779 0.27 + . g905 3 AUGUSTUS transcript 3396015 3397779 0.27 + . g905.t1 3 AUGUSTUS start_codon 3396015 3396017 . + 0 transcript_id "g905.t1"; gene_id "g905"; 3 AUGUSTUS CDS 3396015 3397220 0.27 + 0 transcript_id "g905.t1"; gene_id "g905"; 3 AUGUSTUS CDS 3397294 3397779 0.36 + 0 transcript_id "g905.t1"; gene_id "g905"; 3 AUGUSTUS stop_codon 3397777 3397779 . + 0 transcript_id "g905.t1"; gene_id "g905"; # protein sequence = [MSLSNSKSLLLSIPTTPVSSHSSNNMIHVLEYSPHEGEIGVPITVRLHFNPNNSSDAVFLRLVVGSTPMPTKVRELSE # LTYGRWQLDAIAPAFENPALGSDRVPLSVEALDKNSHVIDTVTFGEFAFWTPNSKRKLLFLLPIPSDLLTFSIICLLCYVAFQPSSSNIHNRRQSSAD # ARLNPPNAAPSSAFVGRRRANTTSSTFVKSESPNPRAYTKEGSRRVRVNSLMRAKYPVCKDVDEELYAQTPLLQLVTSLDSMCVAWEPSEKRVGRRLV # RFTKVQDGRKLIVSCEAISQDDYRESDSVISCIYREETLTYYVTSVDIIYLLERLTNDEFPVEEKNRIRRNLEGLRPTTVSKHKQGFENFFQRIMEFP # DPKPRNIEKDLKVFEWSLLGQALDKILSKYHVYTSSPTDSTVSLPMEPSEDVPYLRNVDHQVAHDAKLDRYPELVHPTPTSTMKFEPGLYEDRSLLFL # QPHSDNMECLSHPATPFVHHGSAVDTRGTPDYQSGHWTPPDRMVSSELAIGEYRHLPDFQYPGPHPNGDGSDYGTYLGSYSFPGMTETPLAYY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g905 ### # start gene g906 3 AUGUSTUS gene 3399033 3399545 0.55 - . g906 3 AUGUSTUS transcript 3399033 3399545 0.55 - . g906.t1 3 AUGUSTUS stop_codon 3399033 3399035 . - 0 transcript_id "g906.t1"; gene_id "g906"; 3 AUGUSTUS CDS 3399033 3399545 0.55 - 0 transcript_id "g906.t1"; gene_id "g906"; 3 AUGUSTUS start_codon 3399543 3399545 . - 0 transcript_id "g906.t1"; gene_id "g906"; # protein sequence = [MLTFISDINLFSYSRPVKRIARDGTEEFWIEKVYFTTEESFPTVLRRSQVIDLTVVDISPVENALSEVEMKTKELSAL # KLRYENVAKTTQEVSTNALSMALNSAVDTPLNTGISAYRHMFFNPARNPDQAELVEKLRGAIDEQVGLCGSAILTICELTKNGFRSRLLTAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g906 ### # start gene g907 3 AUGUSTUS gene 3400508 3401690 0.97 - . g907 3 AUGUSTUS transcript 3400508 3401690 0.97 - . g907.t1 3 AUGUSTUS stop_codon 3400508 3400510 . - 0 transcript_id "g907.t1"; gene_id "g907"; 3 AUGUSTUS CDS 3400508 3400909 0.99 - 0 transcript_id "g907.t1"; gene_id "g907"; 3 AUGUSTUS CDS 3401151 3401690 0.97 - 0 transcript_id "g907.t1"; gene_id "g907"; 3 AUGUSTUS start_codon 3401688 3401690 . - 0 transcript_id "g907.t1"; gene_id "g907"; # protein sequence = [MAPESVRALERTPSTKSIVPVVFPESYPFSLLIYLPQPPSNSKRITSEAHSFNPGLAEAAVVLLVLILSSPPKAISEF # LESSLDIEGRDRFVALLSHFFTVSISILENECFPKTWLNINILAHQVLVKMMNPISTLLNHEFIPPQEAEATFDPSLWKEAFTMLLKLLSSEQLCIEE # FSPQGYQVYLNTLVGSVVSLCLSHHEQLRNNAVQMLYSMIVSEYHTSGNFEEIENELVTRLDFLFMSESSKDDISGAFFVGQLRHLFESTEGDEQLRD # RVSSFLDSVDLFLELLLSVRALPEGDEFADERVIATVSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g907 ### # start gene g908 3 AUGUSTUS gene 3401765 3402988 0.52 - . g908 3 AUGUSTUS transcript 3401765 3402988 0.52 - . g908.t1 3 AUGUSTUS stop_codon 3401765 3401767 . - 0 transcript_id "g908.t1"; gene_id "g908"; 3 AUGUSTUS CDS 3401765 3402988 0.52 - 0 transcript_id "g908.t1"; gene_id "g908"; 3 AUGUSTUS start_codon 3402986 3402988 . - 0 transcript_id "g908.t1"; gene_id "g908"; # protein sequence = [MYRADKLAQVTPDQYLSSPAWLLLNQKPESIVVSPEMQRNAPPLRDTLIIRSSLCSTKYTQNPVLLSLLNWEKLSDKK # LLSQVLAAFTFVGEVEIVKFLRDIFDSLFGILVSPDNQVGDMEHLVFNAIVIVLGIVQDRRFSNFRPVVELYIEKHFGWAAASSHIIHSMNRLLSNPA # TTENATQLRNALKVWHYIIKFIARSRELQKSKELGMGSDATAEHLESAFKRELRAHLSEVTRMMSTTTPPSMIGTQTIALQNFTSVLPELAQIFSTVD # LVSIVTTFATNAVPGAKGKIVIWKLIMYLQIVKGFLFDNPESRPLLVEAVVQWIKPHFGRYDEYVHTQSNDSETARDAARVGWLESIRLCVTIVAVML # DKLQASLVSPEVIQDRRRLVLEKDNVECLLPLLPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g908 ### # start gene g909 3 AUGUSTUS gene 3403584 3405548 0.7 - . g909 3 AUGUSTUS transcript 3403584 3405548 0.7 - . g909.t1 3 AUGUSTUS stop_codon 3403584 3403586 . - 0 transcript_id "g909.t1"; gene_id "g909"; 3 AUGUSTUS CDS 3403584 3405548 0.7 - 0 transcript_id "g909.t1"; gene_id "g909"; 3 AUGUSTUS start_codon 3405546 3405548 . - 0 transcript_id "g909.t1"; gene_id "g909"; # protein sequence = [MWEPLPLIAYGYAVHPLIPSTRRDTRYSTRSHHTIGSADAGDEQIHRDVVSLEVGDEIYAFEKYTPKGKETEGIWYRG # YAEFAFDFYSIVLIISLTLYHSYVVCTARRPPVTWALSGEASSSKSIPKIEEPQQVFIGIFPASHVYVRDELSDAEGTLQNLAKSLDGGSQINGFSNS # TTDSYSQWSRSNFMSVLREEDEDLDAASIMTGVRLPRMDQKTLSHAGAPVYSSSRSARSLRSSSPTESQMMKPLPPRPSLKSGDDTASGVAQPIIDEI # ASALREWHIFLFQYLARRDYRLFQIVREHIEALHLGRRQLLAQTLSTEETINMRQDCVVRLVKGNLVQGLDVIVRHPTWGGLVTVDIQGEIDSRTWVS # AVRMYSMQVALAYLNVDEPPLVLPNPGPLPTPAHSVFPELAHKSRMRSLTKLGPPSSLKASTAKFYHVFLDLRAFVASFCSPGETAELLFSLYRLGSQ # AQFTQFITEDFCAVLNHNGVLARNPTARIRTLFTDLSLSDLQEPIYLVCRVIRNGALKIGATFSSGVPPESGRRGSETRVDPNTPSNWTDAYGPVSPS # SPRLYPSGDTQFRRPFGCAVLELTQLAQMSADDSDVHGPKEYSMPIYVPTNETSFSVLHQNIINNNTKEFEKFVRYITALVMIRFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g909 ### # start gene g910 3 AUGUSTUS gene 3405718 3406083 0.98 + . g910 3 AUGUSTUS transcript 3405718 3406083 0.98 + . g910.t1 3 AUGUSTUS start_codon 3405718 3405720 . + 0 transcript_id "g910.t1"; gene_id "g910"; 3 AUGUSTUS CDS 3405718 3406083 0.98 + 0 transcript_id "g910.t1"; gene_id "g910"; 3 AUGUSTUS stop_codon 3406081 3406083 . + 0 transcript_id "g910.t1"; gene_id "g910"; # protein sequence = [MSALSDHIDRLAQSTRSIKSISASCGSSATGLFTRAILSAELGDLIRDVDSSELGLFTITTPSTVVAHDKETRNQSGV # EITRVEFHGATPLRRPTGRRDELKSKEIPPDVYAEAALKYMER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g910 ### # start gene g911 3 AUGUSTUS gene 3407500 3408408 0.51 - . g911 3 AUGUSTUS transcript 3407500 3408408 0.51 - . g911.t1 3 AUGUSTUS stop_codon 3407500 3407502 . - 0 transcript_id "g911.t1"; gene_id "g911"; 3 AUGUSTUS CDS 3407500 3407732 0.69 - 2 transcript_id "g911.t1"; gene_id "g911"; 3 AUGUSTUS CDS 3407808 3408408 0.7 - 0 transcript_id "g911.t1"; gene_id "g911"; 3 AUGUSTUS start_codon 3408406 3408408 . - 0 transcript_id "g911.t1"; gene_id "g911"; # protein sequence = [MLSKPPASHPYVPSSRRGFGLSLLTHIRNPSRLAQELYLTPSAAPHVFLSGNNAENIAESLGMTLVDPSYFFSEARWK # EHRRGLGLPDMPYPPGSHGSGGEIEENLSPESLGSLDMYSTGTVGAVALDVRGCICAVTSTGGRTNKLVGRIGDTPVMSAGYWAEEWEIKSGWLKKAW # NTFTGKENPSKMAVGISGTGDGDVPTASTIARRVQLLGEPIATAAQVAVETLRRDGGIGGVIVLDIEGNVATPLNCEGMYRGLIREDGVAKTAIFEDE # VLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g911 ### # start gene g912 3 AUGUSTUS gene 3408580 3409988 0.46 - . g912 3 AUGUSTUS transcript 3408580 3409988 0.46 - . g912.t1 3 AUGUSTUS stop_codon 3408580 3408582 . - 0 transcript_id "g912.t1"; gene_id "g912"; 3 AUGUSTUS CDS 3408580 3408979 0.73 - 1 transcript_id "g912.t1"; gene_id "g912"; 3 AUGUSTUS CDS 3409068 3409255 0.73 - 0 transcript_id "g912.t1"; gene_id "g912"; 3 AUGUSTUS CDS 3409317 3409523 0.79 - 0 transcript_id "g912.t1"; gene_id "g912"; 3 AUGUSTUS CDS 3409579 3409706 0.96 - 2 transcript_id "g912.t1"; gene_id "g912"; 3 AUGUSTUS CDS 3409793 3409988 0.65 - 0 transcript_id "g912.t1"; gene_id "g912"; 3 AUGUSTUS start_codon 3409986 3409988 . - 0 transcript_id "g912.t1"; gene_id "g912"; # protein sequence = [MEAKLKSLKVVDLKQILTRASAVPAGKANKADLIAKIIATPAAVDAFNALHPSKPAPHSHDDLVRSHSPDFPLEISLD # WTVDEVPPSKSDEAASEPTTETPAPLAAELTTAPISAQDIAPEPQVANTAESTSYPADAELEKRKQRAARFGIPLVETKPRQRLATAIKTNVTATQPS # DDAEKIKARAERFGLKIAANGKTGPSKDNQTSPGSKRKRGAVAPPPEVEVDLEELERRRKRAERFPVRTFIIMGCCINSTTYVVTRYAFVIVECVSAT # VEVGIFTRKLLSFSTLMNGSEKEEQPLLARSAGRAKSKYVLIIHGGAGTMSRKKSTDAQLKAYHDALCVALKAGHEVLKSEGEAMDAAVAAVVALEGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g912 ### # start gene g913 3 AUGUSTUS gene 3410455 3410946 0.82 + . g913 3 AUGUSTUS transcript 3410455 3410946 0.82 + . g913.t1 3 AUGUSTUS start_codon 3410455 3410457 . + 0 transcript_id "g913.t1"; gene_id "g913"; 3 AUGUSTUS CDS 3410455 3410946 0.82 + 0 transcript_id "g913.t1"; gene_id "g913"; 3 AUGUSTUS stop_codon 3410944 3410946 . + 0 transcript_id "g913.t1"; gene_id "g913"; # protein sequence = [MRRPRGPGGRFLTAEEIAAQRSGQEGEAGPTLNTNAHDNDEDMAEDDHSPPTEPILQRSTSELQSQHIHSHEESPPDP # ISILNLSHSSTPIHHMQHNINVSLPSSVPIAVSPQAMYIQQQQQPQHPQVRNGHQHSLPQPNVDGMTSSAPVTLTSPYPYRMVSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g913 ### # start gene g914 3 AUGUSTUS gene 3411810 3412601 0.94 - . g914 3 AUGUSTUS transcript 3411810 3412601 0.94 - . g914.t1 3 AUGUSTUS stop_codon 3411810 3411812 . - 0 transcript_id "g914.t1"; gene_id "g914"; 3 AUGUSTUS CDS 3411810 3412601 0.94 - 0 transcript_id "g914.t1"; gene_id "g914"; 3 AUGUSTUS start_codon 3412599 3412601 . - 0 transcript_id "g914.t1"; gene_id "g914"; # protein sequence = [MASIAATPYFSHPWFNKPSMKRRRSTSPGEDDALDKTLSPISAKRRRVTMLEKGFSNLSLHHPPPVASTSSANPDSVT # TFFDMNHSGALPSSSPLLLPDTLTAMEVEYSSISPSIQPDSVEEPTSPSLAVPEIRMKGSSWYEPEPDREFSKSLTIPQTTKPRFSGIVVTDLDSSDD # EYENDSDPVRPLVSPTLLERIRQRELSNVLPLPSSLDQHALVLYRPLTRPSNNLEPEDTELVSNQDAVPNAVSLSSTAQDVEMMDVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g914 ### # start gene g915 3 AUGUSTUS gene 3414869 3415760 0.56 - . g915 3 AUGUSTUS transcript 3414869 3415760 0.56 - . g915.t1 3 AUGUSTUS stop_codon 3414869 3414871 . - 0 transcript_id "g915.t1"; gene_id "g915"; 3 AUGUSTUS CDS 3414869 3414917 0.57 - 1 transcript_id "g915.t1"; gene_id "g915"; 3 AUGUSTUS CDS 3415216 3415760 0.58 - 0 transcript_id "g915.t1"; gene_id "g915"; 3 AUGUSTUS start_codon 3415758 3415760 . - 0 transcript_id "g915.t1"; gene_id "g915"; # protein sequence = [MLLVSAARSVPFARIAGRRSVSAIASKYSNAVYNAALAKSPQTLTQVHTELSSFTATLKQNKDVEAFVHNPTLSAKDR # ATGLASVFKTLEGAGSKKESVSDITKNLLTVLSENGRLAEVEGVVDGFNELVSQYNGELNVTVTSAAPLPKDILSRLESTLKQSQTAQKAKTLKVTNK # VCSSALALSDISSPHGAICPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g915 ### # start gene g916 3 AUGUSTUS gene 3420781 3421161 0.83 + . g916 3 AUGUSTUS transcript 3420781 3421161 0.83 + . g916.t1 3 AUGUSTUS start_codon 3420781 3420783 . + 0 transcript_id "g916.t1"; gene_id "g916"; 3 AUGUSTUS CDS 3420781 3421161 0.83 + 0 transcript_id "g916.t1"; gene_id "g916"; 3 AUGUSTUS stop_codon 3421159 3421161 . + 0 transcript_id "g916.t1"; gene_id "g916"; # protein sequence = [MQLHPRNLTTQFYLTPPPGTTRDSTTKRRPTMTSISSMETITADTHPHSSSSPSDDEDLGRRRIWENGDEDHTPRVSS # KGKQKENGFTDTDRDGSEETVLEPPDSGLYPPTTDEEAETRRIEEVSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g916 ### # start gene g917 3 AUGUSTUS gene 3421231 3421881 0.85 + . g917 3 AUGUSTUS transcript 3421231 3421881 0.85 + . g917.t1 3 AUGUSTUS start_codon 3421231 3421233 . + 0 transcript_id "g917.t1"; gene_id "g917"; 3 AUGUSTUS CDS 3421231 3421881 0.85 + 0 transcript_id "g917.t1"; gene_id "g917"; 3 AUGUSTUS stop_codon 3421879 3421881 . + 0 transcript_id "g917.t1"; gene_id "g917"; # protein sequence = [MQKRKAARESISKPSQTAPDGGWRASSLWQKPSHRQRDLGKHTALGSEDSIEHLPLENLVNTPGPSPSPSPLPSPLPP # DLEEYPENPFANPPASPFEDSQQVTAVMSSSEPPSDISTLAVVAPTPERPTLLAKSASFSRPPPPKPINIPPPKTPPPPVNVPPLAVSPLSLEGAPPH # HHQEPEKETRWWHEWLCGCGEDRDADNQVSFMWTIFSSNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g917 ### # start gene g918 3 AUGUSTUS gene 3426225 3429440 0.37 + . g918 3 AUGUSTUS transcript 3426225 3429440 0.37 + . g918.t1 3 AUGUSTUS start_codon 3426225 3426227 . + 0 transcript_id "g918.t1"; gene_id "g918"; 3 AUGUSTUS CDS 3426225 3427157 0.37 + 0 transcript_id "g918.t1"; gene_id "g918"; 3 AUGUSTUS CDS 3427248 3429440 0.6 + 0 transcript_id "g918.t1"; gene_id "g918"; 3 AUGUSTUS stop_codon 3429438 3429440 . + 0 transcript_id "g918.t1"; gene_id "g918"; # protein sequence = [MTRSLLLLLSVHVAWASLPLVDFDRMGKVGLAGAFSGLDLFQNQSHTFDSSTSTLLARASNGSLSPIASTNSGGRILA # GCTLDDSFYLAGSFSSIGSTSASNIASYTASSGKFSSLGSNGPNGEIDAIFCDAKNKKVWVGGLFTSPGAAVAVWDTSANSWSKPPFNGLTGAEGRVL # SITSNSSDSSLFFAGSFITSFQGNGTTLNDTNNPNVPFSPGASPFSSSLVPIPLQGAQIVGSPSSTDAQFSNVSNILCPAGSDGPGNTWFAGDGNQAV # ITVRDFSFLQASGVRLGNTFQSNHGTTGFRQVRRSPAQNNTCSTTCPLSTDSSILYQDFLFDSPLSITGVAITLSEWTGDGPGLHILQLLSSGAFASA # IDSNNVQSCFAPNPSNITRTGNWEVKVAQTNISGTTQSVLVSDVAVGTSASAGPSLTWQPYVSASGDYNVNMLVPGCTNFQDCAARTTVQVTIFPGNG # LNPTVMNVDQTNTEDASVSIYNGPILPTTPDFVTTITMTLAADPTGSGSNGQYEIVADRIELVLTSANATSSNSSGSASSDSSGSNQGFGFFEWPLSS # TSSVDATSTLANSTETSADEAAIGLFNGIGGNGTISSENAAIASVAHHSSGTIFLAGNFTISSNSNNIVSYKDGSISALPENGLDGSVTALALDGDNL # FVGGSFMDTSSASTNGLKGVALYNVQSQKWSALGAGVNGKVSSLAVSGSQLFVAGNFTQLFTSSSDTAGYDAPGFAVWNISNSVWVNSGGFVVGSMTF # VANETSPQYIAGNVVVSESFGASGMVMVQNSASDVPSISPLGVQLDGSIASASTTSTRRRSIVSRTSWIAHVRLSHLFFKRQTSSSTLVALPDALPAV # APAVLAGSFWTNSTSNDEVVIIGGNFSFLPSGSSFGSTEAANLGIYDQSLATITALQGNQVNGTVRSLLVNGDTLYVGGQFTISGLNVDGFAIYDLAK # QQWDVSGVQALQPSSGSSVVVRSITISTSKSNTIIVAGTFAQAGSLTCQAICSLDTSSNQWNSLGSGINGEVSSVSYAGVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g918 ### # start gene g919 3 AUGUSTUS gene 3429570 3430709 0.13 + . g919 3 AUGUSTUS transcript 3429570 3430709 0.13 + . g919.t1 3 AUGUSTUS start_codon 3429570 3429572 . + 0 transcript_id "g919.t1"; gene_id "g919"; 3 AUGUSTUS CDS 3429570 3429670 0.44 + 0 transcript_id "g919.t1"; gene_id "g919"; 3 AUGUSTUS CDS 3430262 3430709 0.13 + 1 transcript_id "g919.t1"; gene_id "g919"; 3 AUGUSTUS stop_codon 3430707 3430709 . + 0 transcript_id "g919.t1"; gene_id "g919"; # protein sequence = [MSWAEVGSGSDIPGPVTALEVNNANASSIFAAGKRDRDDKKQFDAADDDDDSIHHRPSSLLEHINAATRGTIIGASPF # APHSSEKEEEKLEGDGMEPEYTHDGDNYVRAETPSAYGGAMGTEEASRPAHARYSFDGAGEGELALTAGAEVEILDDRDHAYVIKCLRSARLIFCSPD # GGMLEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g919 ### # start gene g920 3 AUGUSTUS gene 3430967 3432306 0.92 - . g920 3 AUGUSTUS transcript 3430967 3432306 0.92 - . g920.t1 3 AUGUSTUS stop_codon 3430967 3430969 . - 0 transcript_id "g920.t1"; gene_id "g920"; 3 AUGUSTUS CDS 3430967 3432128 0.99 - 1 transcript_id "g920.t1"; gene_id "g920"; 3 AUGUSTUS CDS 3432182 3432306 0.92 - 0 transcript_id "g920.t1"; gene_id "g920"; 3 AUGUSTUS start_codon 3432304 3432306 . - 0 transcript_id "g920.t1"; gene_id "g920"; # protein sequence = [MKRRVAGLPPVSAAVFNEKVTERRTETAIMSSLKGSVCEVCNKTYSTENAYRSHINSKKHKETELQASVKLAYKLAKK # DGLEEEYEAEVKTFNKNPSKLESQETPVPLDVNDSAEDEQNQTIDQKIAAARSRLSPAHCLFCSSEFSDLQANLLHMASAHSFFVPDADYLVDAEGLI # GYLGEKIAVGNVCLFCNEKSREFRTLDAVRKHMVDKSHCKVAYDTQDDRLEISDYYDFTSSYPDAHLRKKKANVGEDEEEWEDSDGSDYDEIIEVDED # KEESDEEDLPGGQVTYGDSQYELVLPSGARIGHRGMRRYYAQSFPGTPRGEVDPNSGAAIVRRLLGDKKSLLVPRKGGFGAFGAGTDVVKARNRGEAR # EAGRHIREFRDQARRENFKTKVGFRHNAQKHYRDPRKFLSFVNFRRVIYHQSLVLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g920 ### # start gene g921 3 AUGUSTUS gene 3654450 3655124 0.16 - . g921 3 AUGUSTUS transcript 3654450 3655124 0.16 - . g921.t1 3 AUGUSTUS stop_codon 3654450 3654452 . - 0 transcript_id "g921.t1"; gene_id "g921"; 3 AUGUSTUS CDS 3654450 3655006 0.47 - 2 transcript_id "g921.t1"; gene_id "g921"; 3 AUGUSTUS CDS 3655076 3655124 0.16 - 0 transcript_id "g921.t1"; gene_id "g921"; 3 AUGUSTUS start_codon 3655122 3655124 . - 0 transcript_id "g921.t1"; gene_id "g921"; # protein sequence = [MDALNALHVATTSSTLNLTNSLRRTQKLRTQLDRLGALFDQARQSFLRSFLDLQQAGQDPIVVLEALKAAEPQRESIS # VEDWTLLATLFQWSSPFNLNGLKFDNRTPAEWIDLLRSIHSGATSATVTVDGHLVDTSQPPEADVEVSEALDPQGSLPNTVVEKVSGVEDLASLSEGS # PIQTELDLPQIESLTESTLAPEKGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g921 ### # start gene g922 3 AUGUSTUS gene 3659137 3660819 1 - . g922 3 AUGUSTUS transcript 3659137 3660819 1 - . g922.t1 3 AUGUSTUS stop_codon 3659137 3659139 . - 0 transcript_id "g922.t1"; gene_id "g922"; 3 AUGUSTUS CDS 3659137 3660819 1 - 0 transcript_id "g922.t1"; gene_id "g922"; 3 AUGUSTUS start_codon 3660817 3660819 . - 0 transcript_id "g922.t1"; gene_id "g922"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNYDDLDDDSGGLPRGEPG # DPSGPGGPGGPGDPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRP # KYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGVYDAQGEAEDALGNLKMKETENIRKYNIRFNTLAASTNWDSAA # LKWAYGRGLAERIKEEMARLPEPATLANYRQEVPRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSSNQHNNSQPSGSSVPFTPKPKPFSGGK # PNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g922 ### # start gene g923 3 AUGUSTUS gene 3662023 3662829 0.8 + . g923 3 AUGUSTUS transcript 3662023 3662829 0.8 + . g923.t1 3 AUGUSTUS start_codon 3662023 3662025 . + 0 transcript_id "g923.t1"; gene_id "g923"; 3 AUGUSTUS CDS 3662023 3662829 0.8 + 0 transcript_id "g923.t1"; gene_id "g923"; 3 AUGUSTUS stop_codon 3662827 3662829 . + 0 transcript_id "g923.t1"; gene_id "g923"; # protein sequence = [MPPSRPKAGRPTRFEALRKAPLKTRKVNDETEARIEKAREEFLQNRHPTHKAAAVANGVPYHTFIRRMKGTALPKKRA # HDNQALLNWSEKKALVEWVKYLGLTGHPVNKRTIRPKVQAIMRQNGKVVNAKTVSKSWIRNFLKEFDNDLRLGRGSGLDPKRAQAFNYTTVHHHFNLL # SNYLKDNDIPWENVYNMDEKGVQLGGGRKNSQIRYFFSRDDHMMYRGKSDDLQLVTILDCVCADGTADIKPGFVFSGVGKFGEWFEVHDDIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g923 ### # start gene g924 3 AUGUSTUS gene 3663344 3664756 0.84 + . g924 3 AUGUSTUS transcript 3663344 3664756 0.84 + . g924.t1 3 AUGUSTUS start_codon 3663344 3663346 . + 0 transcript_id "g924.t1"; gene_id "g924"; 3 AUGUSTUS CDS 3663344 3664756 0.84 + 0 transcript_id "g924.t1"; gene_id "g924"; 3 AUGUSTUS stop_codon 3664754 3664756 . + 0 transcript_id "g924.t1"; gene_id "g924"; # protein sequence = [MQLPASYPTRLPRGPDVASSDAEFDGEVLEGRERRRNAEGSDSDSSDSDYRTDESSSESSDESDDSEGPSCHHSLSPP # QDRDVDTQSTPLTRSHQISNRQVPMTPTPLTPLISSTPTPSIPDPSGSHFRATVSLREIELMRQVADLERSLAITKAERDAATVYAVCSGQEASIYKH # HLNSRTNKKDASKRFPTLARVVTSRDGRIQAKEDDVRRQAKVQVDEERARKKKDKERDDIIRRAAQEKEGTEFEGSFNSKNKTELEDIAFSLGLDIDA # TAIVLKIRIDAHFNATLSLKQDPRYVGLFTRKRKRAPVRSENDDIRPSSSRRLLSPVLSPNPRSPSPSYDFLHHRSHSPPSRYHSPSPLLHSNFPHRQ # FGSTVNNFIPSSSSTHPSNNTFPPSSFPHYNLNISPTPIIPRPQPRPLPLQPHSSTSTAPHTSSFPYMYIPSYHHPFTSQYNTHSGTYSQPENPSNNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g924 ### # start gene g925 3 AUGUSTUS gene 3667187 3668821 0.84 - . g925 3 AUGUSTUS transcript 3667187 3668821 0.84 - . g925.t1 3 AUGUSTUS stop_codon 3667187 3667189 . - 0 transcript_id "g925.t1"; gene_id "g925"; 3 AUGUSTUS CDS 3667187 3668821 0.84 - 0 transcript_id "g925.t1"; gene_id "g925"; 3 AUGUSTUS start_codon 3668819 3668821 . - 0 transcript_id "g925.t1"; gene_id "g925"; # protein sequence = [MKFALVHIATQTLQHRTSLKPETPSATPIPPHKISQIGSKCTSITAAIQSLSVKPLNIVKRGDVSGPPLTGIRPPTVR # PAVIRDVSKPPTATSAAPLRTDSATVAVSAFPAFGFLNSPAESTSTISKHRRRSRSSNALFTSQLPTARTRMNSEHFKVSELSEPGHDPKVPTTVSNP # ATPTICQHHNKSPTPNTTVTTLGTPNFASKDVVRAPSATPTLRKRVSGDIQRTTESVNRRCTSKYFKSSSTATASRENLSESRIPSSKLKLAFHPHTL # DPVLLKPKHGITHSVDIVNLNPRLLQTPRIRQYQDVRNVFPRCVEPPTAVEKSQSIESVTVTPSPPLGRRSVLKSELPSKRHAIYTRSLYVGKAEKNS # SNYLRALEGMITSHSSLHSQVTDHEEVSTSSDSLESILQVYQDAVNDEAHPHSRSFSMGLPTSHSEPTLYDINVTPLAVACTGNTPSDENQSKFPVAS # VSLSSLASVYSQDSWASGERQVIQLSIVAGINAINFSEHKLERKIGHHPIVWELLEKLESAQRTWLWDTGSDKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g925 ### # start gene g926 3 AUGUSTUS gene 3670581 3671171 0.62 + . g926 3 AUGUSTUS transcript 3670581 3671171 0.62 + . g926.t1 3 AUGUSTUS start_codon 3670581 3670583 . + 0 transcript_id "g926.t1"; gene_id "g926"; 3 AUGUSTUS CDS 3670581 3671171 0.62 + 0 transcript_id "g926.t1"; gene_id "g926"; 3 AUGUSTUS stop_codon 3671169 3671171 . + 0 transcript_id "g926.t1"; gene_id "g926"; # protein sequence = [MYALTEIKGVGRRYSNIVCKKADVDLNKRCATFSLIARYPFDNGFSKSAGELNSDELERIVTIMQNPTQFKIPTWFLS # RQKDIVDGKDYQILSNNVDSKLRDDLERLKKIRAHRGLRHYWGLRVRGQHTKTTGTFLESCCLSNNINLFQVVVERLLVCRRSVVKCVYHYVFFPYDN # LVLWNAYAMSPDESNRRRLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g926 ### # start gene g927 3 AUGUSTUS gene 3671280 3672764 0.37 - . g927 3 AUGUSTUS transcript 3671280 3672764 0.37 - . g927.t1 3 AUGUSTUS stop_codon 3671280 3671282 . - 0 transcript_id "g927.t1"; gene_id "g927"; 3 AUGUSTUS CDS 3671280 3672134 0.81 - 0 transcript_id "g927.t1"; gene_id "g927"; 3 AUGUSTUS CDS 3672414 3672451 0.68 - 2 transcript_id "g927.t1"; gene_id "g927"; 3 AUGUSTUS CDS 3672563 3672764 0.49 - 0 transcript_id "g927.t1"; gene_id "g927"; 3 AUGUSTUS start_codon 3672762 3672764 . - 0 transcript_id "g927.t1"; gene_id "g927"; # protein sequence = [MRNIEQDGWEALEGGWSGSFTAPENGKVGRDKEIMCFTTRPVETFEVLNDLVVDRGPSPYVSLLELFGSTAYSVSQIA # LIGDHIKVTASKYPFPTVCADKQSTDWFHAISRTLKWNERERQKSFVVVEEGPEKVKKQKKVEKTGRDGTPKPTQVEEAESLDDEEEDEVSDEEEEDK # FDIDDSSPEAAAAASVISGQVTNVLSKRDQAVGHEKANELVAEEQLHKALSLSGLKPRRHTPRSRSASPSGLRSGIDSPSRYAGLPPHPPVSVPRHVE # FAPESSDESYGRNGARDELFAHRKASAKSRIPKEREDVKTPTASNSVYPRNRSRGRAHSRTRSGEYVGHRAFAVWGQDESDSNASDSDAN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g927 ### # start gene g928 3 AUGUSTUS gene 3673556 3674191 0.99 - . g928 3 AUGUSTUS transcript 3673556 3674191 0.99 - . g928.t1 3 AUGUSTUS stop_codon 3673556 3673558 . - 0 transcript_id "g928.t1"; gene_id "g928"; 3 AUGUSTUS CDS 3673556 3674191 0.99 - 0 transcript_id "g928.t1"; gene_id "g928"; 3 AUGUSTUS start_codon 3674189 3674191 . - 0 transcript_id "g928.t1"; gene_id "g928"; # protein sequence = [MSLSPEIETFSTPPTTPGFAFQDASIRPSLSRKGSRPSSLQLAHQGWNPDIVVEESSPVLTRKPENGQSITSSMSRDQ # TATPTSTTSTRASSTLPSIPSSSSSTTHLANGHTHRPLDSPCFVHSQLDKGASLSDWLRNKQNGILNNGSSDVGVSKSLQDSSPTSTSGMSSASSLMS # SIDDEDEFGGNLTKQLAETAVGVREMSKQLGTSHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g928 ### # start gene g929 3 AUGUSTUS gene 3676710 3677693 0.62 - . g929 3 AUGUSTUS transcript 3676710 3677693 0.62 - . g929.t1 3 AUGUSTUS stop_codon 3676710 3676712 . - 0 transcript_id "g929.t1"; gene_id "g929"; 3 AUGUSTUS CDS 3676710 3677693 0.62 - 0 transcript_id "g929.t1"; gene_id "g929"; 3 AUGUSTUS start_codon 3677691 3677693 . - 0 transcript_id "g929.t1"; gene_id "g929"; # protein sequence = [MSDFLSSHSRRTVLDNDPQQGVGRHDPVPPVPQQPAPGQLAGGIGAQGLNGPAVAVNNPLGLMGRLFGVQAQARRALD # GGQLPNDTNATGQSGGIVIQYNIHYQPGQQHFNPQTQAEPLQPVPQLQGFRGPRDIWHAWPQPGIGEAGRDNAPVEDPVASQSVESGVSPREAAALAA # SRRMTEKTGSDFYRDASVNHSSNIGRASHPTAPALIPLFDFDSQSLELNSTLSRTEHSTPDDAFPSGPSSLVASLSDQQLALMDQTTREAIDERLIVL # EGVSTAVYRCIDDLVRMRSALPPLGDISSAQLSQAATTLAESAEDTDPHSSSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g929 ### # start gene g930 3 AUGUSTUS gene 3687671 3688974 0.19 - . g930 3 AUGUSTUS transcript 3687671 3688974 0.19 - . g930.t1 3 AUGUSTUS stop_codon 3687671 3687673 . - 0 transcript_id "g930.t1"; gene_id "g930"; 3 AUGUSTUS CDS 3687671 3688008 0.69 - 2 transcript_id "g930.t1"; gene_id "g930"; 3 AUGUSTUS CDS 3688450 3688587 0.27 - 2 transcript_id "g930.t1"; gene_id "g930"; 3 AUGUSTUS CDS 3688656 3688974 0.27 - 0 transcript_id "g930.t1"; gene_id "g930"; 3 AUGUSTUS start_codon 3688972 3688974 . - 0 transcript_id "g930.t1"; gene_id "g930"; # protein sequence = [MVGSEVYSTEVKKTEVLAESFRRAIGLRIKETKEVYEGEVTEMTPSESENPLSGYGKTISHVVVGLKSVKGTKQLRLD # PSIYEAMLKEKIVVGDVIYIEHSGAVKVHAYASSYDLESETYVPLPKGDVHKRKELVQDVTLGDLDAANARPQGEPYAKEQVAKVLQLRANIEGLKLA # EGVLDKLATEGEKSSLRYLALNTLPPAVRIHTLHFCRYALQLLAPASIIASINDRSEISLEDVGEMNELFLDAKTSAAMIGASENVKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g930 ### # start gene g931 3 AUGUSTUS gene 3692312 3694417 0.47 + . g931 3 AUGUSTUS transcript 3692312 3694417 0.47 + . g931.t1 3 AUGUSTUS start_codon 3692312 3692314 . + 0 transcript_id "g931.t1"; gene_id "g931"; 3 AUGUSTUS CDS 3692312 3692740 0.77 + 0 transcript_id "g931.t1"; gene_id "g931"; 3 AUGUSTUS CDS 3692901 3693314 0.91 + 0 transcript_id "g931.t1"; gene_id "g931"; 3 AUGUSTUS CDS 3693412 3693642 0.63 + 0 transcript_id "g931.t1"; gene_id "g931"; 3 AUGUSTUS CDS 3693690 3694084 0.93 + 0 transcript_id "g931.t1"; gene_id "g931"; 3 AUGUSTUS CDS 3694144 3694417 0.99 + 1 transcript_id "g931.t1"; gene_id "g931"; 3 AUGUSTUS stop_codon 3694415 3694417 . + 0 transcript_id "g931.t1"; gene_id "g931"; # protein sequence = [MNLYNRQPSEIHYDRIGGRNAAHLVNQDDPDVLEIWNNVFIQFNREEDGSLKSLPSKHVDTGMGFERLVSVVQDKRSN # YDTDVFTPIFAKIQELTGVRPYEGRFGVDDQDGIDTAYRVVADHVRTLTFALSDGGVPNKDGRGYGHIFPEITTKTVEIKEILDEEEESFSRTLDRGE # KLFDQYSAHVKQQGSNILSGKDVWRLYDTYGFPVDLTRLMAEELGLEINDAEFNEAQAASKEASKATLKKGAGNIVKLDVHDLAYLENAGLPKTDDSA # KYGILFSSTVEIPSESIFGIILDKTNFYAESGGQEYDTGNIVIDGLTDFEVTNVQVYNGHVLHTGFLKYGQLELGNQVVSSYDELRRWPLRNNHTATH # ILNFCLREVLGDHIDQRGSLVAPSKLRFDFSHKAQITIPDLTKIEAMSIDWVQKNVKVYSKELDLHNAYKIPGLRAVFGESYPDPVRVVSLEYDVDDI # AKDIENPMWRKTSIEFCGGTHVAKTGDIKEFVITEESGIAKGIRRIVAVTGHEAQEMNRLVQDFKFRIDQVSHLSDKEQDAALKALSVVSKGILCPFD # SPLPPFSGNRSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g931 ### # start gene g932 3 AUGUSTUS gene 3700659 3701261 0.19 + . g932 3 AUGUSTUS transcript 3700659 3701261 0.19 + . g932.t1 3 AUGUSTUS start_codon 3700659 3700661 . + 0 transcript_id "g932.t1"; gene_id "g932"; 3 AUGUSTUS CDS 3700659 3701261 0.19 + 0 transcript_id "g932.t1"; gene_id "g932"; 3 AUGUSTUS stop_codon 3701259 3701261 . + 0 transcript_id "g932.t1"; gene_id "g932"; # protein sequence = [MIEPVKMTTNNYGMPALSAEAKAEIDKANAKLPRKYKTVPLFDITDRSQIIPWFEATESIFEYGGITSDKAKVRLALE # WTSYKTRQALRVFDSVKKLNWDQFKKDLKNMFLQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAKMKKLMDKPKMIMNSDAVRLFLAPM # TPEVRRGVLEMVVKDVSVTSILNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g932 ### # start gene g933 3 AUGUSTUS gene 3703173 3704864 0.99 + . g933 3 AUGUSTUS transcript 3703173 3704864 0.99 + . g933.t1 3 AUGUSTUS start_codon 3703173 3703175 . + 0 transcript_id "g933.t1"; gene_id "g933"; 3 AUGUSTUS CDS 3703173 3704864 0.99 + 0 transcript_id "g933.t1"; gene_id "g933"; 3 AUGUSTUS stop_codon 3704862 3704864 . + 0 transcript_id "g933.t1"; gene_id "g933"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPDGPGGPGGPGGPGGPGGPRSPNSPDIPNEQRAMLDLLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGVYDAQGEAEDALGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLAAYRLEVLRIDNRYWKREETKKREAGKPFIARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSANSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g933 ### # start gene g934 3 AUGUSTUS gene 3705679 3708759 0.88 + . g934 3 AUGUSTUS transcript 3705679 3708759 0.88 + . g934.t1 3 AUGUSTUS start_codon 3705679 3705681 . + 0 transcript_id "g934.t1"; gene_id "g934"; 3 AUGUSTUS CDS 3705679 3708759 0.88 + 0 transcript_id "g934.t1"; gene_id "g934"; 3 AUGUSTUS stop_codon 3708757 3708759 . + 0 transcript_id "g934.t1"; gene_id "g934"; # protein sequence = [MEPILLRAIHSEVAARAADRSSATPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYP # LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDE # WKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYIL # SPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETD # ASDYTIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNM # VIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLELAKDPS # NERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRP # WNSISMDFIEQLPMSNGFTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEA # DGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRY # KEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDG # EEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g934 ### # start gene g935 3 AUGUSTUS gene 3714909 3716733 0.81 + . g935 3 AUGUSTUS transcript 3714909 3716733 0.81 + . g935.t1 3 AUGUSTUS start_codon 3714909 3714911 . + 0 transcript_id "g935.t1"; gene_id "g935"; 3 AUGUSTUS CDS 3714909 3715490 0.81 + 0 transcript_id "g935.t1"; gene_id "g935"; 3 AUGUSTUS CDS 3715561 3716733 0.87 + 0 transcript_id "g935.t1"; gene_id "g935"; 3 AUGUSTUS stop_codon 3716731 3716733 . + 0 transcript_id "g935.t1"; gene_id "g935"; # protein sequence = [MKCVSPLTLAQKAHEGTGLTVEELMYKLNDECMAAGLPASFDLPTRPVPQPPEPTERAGPTKPVKWRICQNFMAVNKL # TEIAPMPQGNIRSKQQSLSGHMYICLFDFASGFYACEVAKESRPYTAFYVEGKGYFWCAKLPFGLTGAPSTFANMTALHLDDLIADGTIELLVDDGGS # ADDDFNTMFTKLQRILDQGGKISKDGVTVDPAKLTTIVEWKQPEDALNLASFVGLTGHFRDLIRNYAHIEGPLRNLLKSVPLPQNYTKLTYRKAMESF # KLAHKWTLDHTKAFLALKKALVSEPVLKAPRWDGSSFIVTTDGCKEGFAAVVAQRFEVVHPNGTTTYKTHPVGFASKRTSTSEQNYKPLLLEFAVLKF # GLDKFSDMIWGFPIEIETDCQALRDVLANDKLNAAHSRWRDGVLAYHIVDVRHIPGKLNVVADGLSRMWEGQDRVMGDGSEWTVSEDWEAVTGLVNDV # FGVSIAEGMMEEGEVTNWEALSGRFMGEPVFMEVIDALQVLESPADDKAKQRAKHKAACYMVLKETALVEVEIHWSALQLTQTVCHPAQCRECQCLNT # SSVGCATESCSCSVLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g935 ### # start gene g936 3 AUGUSTUS gene 3717448 3718226 0.65 - . g936 3 AUGUSTUS transcript 3717448 3718226 0.65 - . g936.t1 3 AUGUSTUS stop_codon 3717448 3717450 . - 0 transcript_id "g936.t1"; gene_id "g936"; 3 AUGUSTUS CDS 3717448 3717804 0.77 - 0 transcript_id "g936.t1"; gene_id "g936"; 3 AUGUSTUS CDS 3717955 3717986 0.77 - 2 transcript_id "g936.t1"; gene_id "g936"; 3 AUGUSTUS CDS 3718053 3718056 0.77 - 0 transcript_id "g936.t1"; gene_id "g936"; 3 AUGUSTUS CDS 3718209 3718226 0.67 - 0 transcript_id "g936.t1"; gene_id "g936"; 3 AUGUSTUS start_codon 3718224 3718226 . - 0 transcript_id "g936.t1"; gene_id "g936"; # protein sequence = [MTRVNILMITRSDEALCNPMPIFTHREVFSHKLGQSPIKLNASCVKVMTENKVTRLGIEPRTFWLYSRCSNQLSYPTM # VQLMRLMHMVTLTVQSTLLGLTLSSALDDMDMYTQHLPLIMLGLMTNSNPDTLMRGKC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g936 ### # start gene g937 3 AUGUSTUS gene 3726548 3727123 1 + . g937 3 AUGUSTUS transcript 3726548 3727123 1 + . g937.t1 3 AUGUSTUS start_codon 3726548 3726550 . + 0 transcript_id "g937.t1"; gene_id "g937"; 3 AUGUSTUS CDS 3726548 3727123 1 + 0 transcript_id "g937.t1"; gene_id "g937"; 3 AUGUSTUS stop_codon 3727121 3727123 . + 0 transcript_id "g937.t1"; gene_id "g937"; # protein sequence = [MSFGSDSGSFLEYALSLPDPVGPDPETSDSSDQSSPSDHNSEQESVQSGTISDPDQSSYDSEFPGPFDYDYLHESSDF # DSDHPGPYDLRYLHSYPSSSASDSVESFHSFASDNSEAPELRPGDDRSGHPHLGPDGRLLDSERERRRVLGLCFYCGGEHMKVDCLKLQARTGQNYDA # DNSESDVPGSDDGSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g937 ### # start gene g938 3 AUGUSTUS gene 3731273 3732733 1 + . g938 3 AUGUSTUS transcript 3731273 3732733 1 + . g938.t1 3 AUGUSTUS start_codon 3731273 3731275 . + 0 transcript_id "g938.t1"; gene_id "g938"; 3 AUGUSTUS CDS 3731273 3732733 1 + 0 transcript_id "g938.t1"; gene_id "g938"; 3 AUGUSTUS stop_codon 3732731 3732733 . + 0 transcript_id "g938.t1"; gene_id "g938"; # protein sequence = [MAPERSTSPDPLASYDISPSAPQIALDKAQIASDKPLQRSQTLPSTSSTQISLDKGKVRAQPTQSTSYIASRPSPELR # SVRIRPRTLQERLQVIPEAGTAPQVTGSEHREASIAFSTHSHHSSHHIPLQDHISAAPTPPDALEQVRLTAEALGQVVEQYRNNDLSPNDAFRALRSL # TDDLTVVRDFIGQIQEIQRDHLRASRERVAAAKAARVAAAAASKSRISDGPLVSTEKAVNEAAWALMERELAENALQLAAAEAEADQMEQDAHQDRSN # SLQQAFLKLVGQTQSSSSPGTSSGLPPSLLEAAPHLSALTSSDILSPTVSETWKLRMLFTVDSHVDTTVSLLSAQPFTDPLPQSLLKLIVKDRYVDFE # KIHASITSYTSIFDDSTTFGSEYKLVKKEHSIRSLPVTSEAQWLRVFDAWLAPVLKIYPHRQSELSAYKASIMEFFRAAPSDPSIAFRVDREVRQKAS # NTPFDLGNAENFRLST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g938 ### # start gene g939 3 AUGUSTUS gene 3734304 3735872 0.83 + . g939 3 AUGUSTUS transcript 3734304 3735872 0.83 + . g939.t1 3 AUGUSTUS start_codon 3734304 3734306 . + 0 transcript_id "g939.t1"; gene_id "g939"; 3 AUGUSTUS CDS 3734304 3735872 0.83 + 0 transcript_id "g939.t1"; gene_id "g939"; 3 AUGUSTUS stop_codon 3735870 3735872 . + 0 transcript_id "g939.t1"; gene_id "g939"; # protein sequence = [MTLTKVTVPLPEPSPSVSPTILETPPGDSPHSRSRSRSRTLRAKPLLSKFPFEPIYSYPTVSQFAAQLETPEVDIALI # SAAVFNRACKDAGMEPILLRAIHSEVAACATDRSSTTPIVPPLHHSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELV # ALKDFIDKQLATGAITPSSSPHGAPVLFVLKKDGKLRLCVDFRGLNCITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRT # RYGSYEWKVMPFGLTNAPAVFQRFVNDIFSNMLDVCVIVYLDNILIYSDTPEEHREHVKEVLRRLRKHQLYANPEKCEFNMDTVEYLGYILSPNGLTM # SKEKVQTALEWPVLRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKTAFTSAPILAHCVKVMTENNVKVMTENKVT # RLGIEPRTFWLYSRCSNQLSYLTLVQLMRTLHMVTVAIQTTPLGLTIFFCLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g939 ### # start gene g940 3 AUGUSTUS gene 3736234 3737382 0.7 + . g940 3 AUGUSTUS transcript 3736234 3737382 0.7 + . g940.t1 3 AUGUSTUS start_codon 3736234 3736236 . + 0 transcript_id "g940.t1"; gene_id "g940"; 3 AUGUSTUS CDS 3736234 3737382 0.7 + 0 transcript_id "g940.t1"; gene_id "g940"; 3 AUGUSTUS stop_codon 3737380 3737382 . + 0 transcript_id "g940.t1"; gene_id "g940"; # protein sequence = [MVIRFRPGKLGEKPDSITRCWDVYPKEGDIGYAQVNPHNFHPIFTNEQLTASLRATFLEGPALRASIIMDIEALHQAI # ILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGNLRLQVLRYFHDHPLSGHFGQNCTLEAVRRQYTWPKVRDFVRDYVTSCTICGR # NKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILIIVDRSSKQAIFIPTYNTVTSEQLAELFVIHVFSKHGVPNHVTSDCGSEFVSAFF # RALSKALSMELHYTSGYHPEADGQTKRVNQTLEQYIRIYCSYQQDDWSPLLPIAKFAYNNAPNASTGITPFFANKGYHPNITVWPKVDMKSDLARDFI # VNLNELHAFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g940 ### # start gene g941 3 AUGUSTUS gene 3737748 3738383 0.73 + . g941 3 AUGUSTUS transcript 3737748 3738383 0.73 + . g941.t1 3 AUGUSTUS start_codon 3737748 3737750 . + 0 transcript_id "g941.t1"; gene_id "g941"; 3 AUGUSTUS CDS 3737748 3737765 0.73 + 0 transcript_id "g941.t1"; gene_id "g941"; 3 AUGUSTUS CDS 3737918 3737921 0.83 + 0 transcript_id "g941.t1"; gene_id "g941"; 3 AUGUSTUS CDS 3737988 3738019 0.83 + 2 transcript_id "g941.t1"; gene_id "g941"; 3 AUGUSTUS CDS 3738060 3738383 0.94 + 0 transcript_id "g941.t1"; gene_id "g941"; 3 AUGUSTUS stop_codon 3738381 3738383 . + 0 transcript_id "g941.t1"; gene_id "g941"; # protein sequence = [MTRVNILMITRSDEALCNSYELKLPDYLRRIHPVFHISQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAKILDSKYK # RCPLRYYIRWASYEGTNDEFSWVAADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g941 ### # start gene g942 3 AUGUSTUS gene 3738737 3739913 0.81 - . g942 3 AUGUSTUS transcript 3738737 3739913 0.81 - . g942.t1 3 AUGUSTUS stop_codon 3738737 3738739 . - 0 transcript_id "g942.t1"; gene_id "g942"; 3 AUGUSTUS CDS 3738737 3739405 0.98 - 0 transcript_id "g942.t1"; gene_id "g942"; 3 AUGUSTUS CDS 3739458 3739913 0.81 - 0 transcript_id "g942.t1"; gene_id "g942"; 3 AUGUSTUS start_codon 3739911 3739913 . - 0 transcript_id "g942.t1"; gene_id "g942"; # protein sequence = [MSTSRTITTTTNKSLTAGPSRSRPAPTPPIDLTAHDEEGLEEEDEDDIIRKAQERVERIRARKAAAAAKKAAEEKAAR # AAAARERAAQEAREWALRARQQEEEVLERRRLLAEAATARSQRGTSPSEMSASPRRPVVEVRRVAKGKGKAKAQPVGGDPDDGDDGDDDDDNEEDRAP # CEWCKAKKLPCQMQAGKRSSIICKPCHDAKVRCSYLGHPTTSKQREGGSGERITIMESQMAQSLADLRALREADSKTHQYLRQPLRRQEDDHARLIAM # ETRMAMMGMGEGTAMAGPSRRITERRRPLKRRRIVGESDEEEEEEEEKEKEVEQVMEADGEGEEEEEGGGMEAEGEGEAPEPTTAKAVASEKGKEKEV # VE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g942 ### # start gene g943 3 AUGUSTUS gene 3745308 3745646 0.65 - . g943 3 AUGUSTUS transcript 3745308 3745646 0.65 - . g943.t1 3 AUGUSTUS stop_codon 3745308 3745310 . - 0 transcript_id "g943.t1"; gene_id "g943"; 3 AUGUSTUS CDS 3745308 3745646 0.65 - 0 transcript_id "g943.t1"; gene_id "g943"; 3 AUGUSTUS start_codon 3745644 3745646 . - 0 transcript_id "g943.t1"; gene_id "g943"; # protein sequence = [MLVRIKWTEEGRGGDVPEDAEGEEAEKEEDDNVPDGSAESSKATTATTTTTSISLASNTCNLIWEGLLPHRSFAGFKP # KVCPTDGAAREALGEKLRGYWDVARAWRVEEDVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g943 ### # start gene g944 3 AUGUSTUS gene 3745730 3747076 0.64 - . g944 3 AUGUSTUS transcript 3745730 3747076 0.64 - . g944.t1 3 AUGUSTUS stop_codon 3745730 3745732 . - 0 transcript_id "g944.t1"; gene_id "g944"; 3 AUGUSTUS CDS 3745730 3747076 0.64 - 0 transcript_id "g944.t1"; gene_id "g944"; 3 AUGUSTUS start_codon 3747074 3747076 . - 0 transcript_id "g944.t1"; gene_id "g944"; # protein sequence = [MDSLPKKPTPSDSVTPVLPADLARRVAEAKRKVAEYQTKLAVKDNPYMSGGGGGGKPGKMTQVEPTQQGSGLKMTAHP # LLLEQTTGVLVQSKKDRYKPIQPKFASIKANARNIQTPPPIVHSPSPSSNPYATSTDISSSATTAFPAPAPRPTRSTFRFNPKGKYVALGNQIRQDLQ # LEALKNRIAESARKAGMDGDMGIGGIGGVERSIKRPPPSAAQAEWWDIPLLPNKTYADIELYGIEGLNVRNGETSPITIYVQHPIKIPPPGSGGGGGG # GLKPLMLTKKEQKKMRKLRRAGELQDKRDRIRMGLLPPDPPKGILAVSIHFHINLRLLLLVRLSNLMKVLTSDAIQDPTRVEAKVRREVAMRKHQHEK # MNAERKLTDEQRREKIESKKLEEEKKGIYGAVFKSVTNSSSLFLFHILMRVLDTESKPSPPPPTDSKFRKTRSRWA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g944 ### # start gene g945 3 AUGUSTUS gene 3747456 3748130 0.95 + . g945 3 AUGUSTUS transcript 3747456 3748130 0.95 + . g945.t1 3 AUGUSTUS start_codon 3747456 3747458 . + 0 transcript_id "g945.t1"; gene_id "g945"; 3 AUGUSTUS CDS 3747456 3748130 0.95 + 0 transcript_id "g945.t1"; gene_id "g945"; 3 AUGUSTUS stop_codon 3748128 3748130 . + 0 transcript_id "g945.t1"; gene_id "g945"; # protein sequence = [MFSLSRLFRPSFTQTRLRSQLAPRQVKYIKRHKGVIPIPIGGSISGTTLTSSAQWGIRIKSTGVRLTAKQLTTAEDVI # KRKLKDVVKGGKVWLRVFPDIPVCIKGNETRMGKGKGTFEFWATRVPVGRVIFEIGGKDIREELARDSECHDYPYTHSLTLSLVLRQAASKLPTKMEF # ISRDTPPRLGNLVLYPPKPVKRIAEESVPGVDRGPIAEALATHPTTAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g945 ### # start gene g946 3 AUGUSTUS gene 3750040 3750396 1 + . g946 3 AUGUSTUS transcript 3750040 3750396 1 + . g946.t1 3 AUGUSTUS start_codon 3750040 3750042 . + 0 transcript_id "g946.t1"; gene_id "g946"; 3 AUGUSTUS CDS 3750040 3750396 1 + 0 transcript_id "g946.t1"; gene_id "g946"; 3 AUGUSTUS stop_codon 3750394 3750396 . + 0 transcript_id "g946.t1"; gene_id "g946"; # protein sequence = [MSPKEVKKSQKKKEKEEEKKKRRLDAAKSKKGKAKDNDNDPANAELDVEPETETVHPHIPPKSVNVRLTKVEVGKLTR # INSLALPEVGQATATTPEEKTKSTKGNMRLKSLQPTVEGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g946 ### # start gene g947 3 AUGUSTUS gene 3752442 3755007 0.25 + . g947 3 AUGUSTUS transcript 3752442 3755007 0.25 + . g947.t1 3 AUGUSTUS start_codon 3752442 3752444 . + 0 transcript_id "g947.t1"; gene_id "g947"; 3 AUGUSTUS CDS 3752442 3752829 0.7 + 0 transcript_id "g947.t1"; gene_id "g947"; 3 AUGUSTUS CDS 3752965 3752987 0.51 + 2 transcript_id "g947.t1"; gene_id "g947"; 3 AUGUSTUS CDS 3753066 3753229 0.5 + 0 transcript_id "g947.t1"; gene_id "g947"; 3 AUGUSTUS CDS 3753282 3755007 0.96 + 1 transcript_id "g947.t1"; gene_id "g947"; 3 AUGUSTUS stop_codon 3755005 3755007 . + 0 transcript_id "g947.t1"; gene_id "g947"; # protein sequence = [MDVAVKTEAPSPSSKALKVPKTADVVSGNDEVTRIPKKRGRKPKNRATNASEVPKTADVVSGNDTVKPIPKKRGRKPK # NSITDKPRRLGKTSGDATASQTAMIQKKGVEVSLDLGKTSKHSEGKKPRDDALRPTRTHSKEELLAILPELGNPKLVGTSPVPVILIEANEGMSISDS # KLSNEDRTVVDLCVYVERDFVCLVSDLTVSSNSSSSVPMTEIHSSSIPSPQSAENLEELCKGEVKLPREPIQQHTETNMIPLTLQTLPPNENEEPSED # IQPECTHVTRLSNSCIEPDAEKTVSASHDVPGSQSISVNYEEPPVGMISGWSHDKDSAQLPAGITEITPKALDVEPGLDSEDQTSSKLGEKSIAEALN # FAGLNNSVRPPIPKLLPEKRGKLPSIRRDPSSGILDVPLLIEQQKSSIKIINKSVKISSLRDSTGRRKYHASSKNKQRIGPVTRAQTIRADESLLESR # NQRSKRVLRPRIKREKSQTQDLPIPITLPHITPTSRVPQKSNIRLTISIPSAHIPRLDDPPYPSIPALAVSDLQNVYACRSSPSPQPIPSLERTESSS # LSPLTPLEEDDDYSPVKNWKNVYDMVAEDTMDCSSPLTPLTDDSSPLRDRETYDTCAESKPMGGDGQENVHKSSSSSTVSCLQGSSPVSVRKSINNTN # IQPTLGQKQVDISLIPSPSIPSNEESLPVQGWNDSLYGGSKNVMKNLKFNKKKETLQTPQDGSSTDAIESHSTLSSTKEQMSRKSAVNNQPIAKKRFG # TT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g947 ### # start gene g948 3 AUGUSTUS gene 3755147 3755920 0.51 + . g948 3 AUGUSTUS transcript 3755147 3755920 0.51 + . g948.t1 3 AUGUSTUS start_codon 3755147 3755149 . + 0 transcript_id "g948.t1"; gene_id "g948"; 3 AUGUSTUS CDS 3755147 3755920 0.51 + 0 transcript_id "g948.t1"; gene_id "g948"; 3 AUGUSTUS stop_codon 3755918 3755920 . + 0 transcript_id "g948.t1"; gene_id "g948"; # protein sequence = [MMASSHNWGLAPLESELQTPRYLPVHYSSSEFASLSSASLSASPFSVYTPPTPFTSPASGYSGPMSTAAFSQYSSPSI # ASRMSLAPTTTSEPTLNTSPESLLSIPYTAKSENLDASIRPLRPISPTPVSSFSPASLSSKVPFLPKAKHDRKRKIPGMEAFNSIPPLKRICLPAEDE # LVGPATLDTRVPTQVPPEIRVLIDAYTQNTPILVIASRDATLAYCGESISKNLPTEFQYMYMGFFKVSSIKVSDISLLEFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g948 ### # start gene g949 3 AUGUSTUS gene 3757474 3758247 0.99 + . g949 3 AUGUSTUS transcript 3757474 3758247 0.99 + . g949.t1 3 AUGUSTUS start_codon 3757474 3757476 . + 0 transcript_id "g949.t1"; gene_id "g949"; 3 AUGUSTUS CDS 3757474 3758247 0.99 + 0 transcript_id "g949.t1"; gene_id "g949"; 3 AUGUSTUS stop_codon 3758245 3758247 . + 0 transcript_id "g949.t1"; gene_id "g949"; # protein sequence = [MALGHELGIRIVPKSGFPANILRAKKINVIEDATSEKLELPIAIEGVPVTNDSFAMAIDAICSTQVDTSNDGPFTVEN # DVDVSIVSMESESTLSPLVDVIMREAPSMSMADLRHECNEHSNSNQLSEPDVNADQSSQMIAKESTSSNELMLIETNFDGLIRMEFPEAVATFQEGVY # NDYEDDPHAVTSSWPEEVTDNTNETEEPSLELPSKSQNATAKRKTYVREDMHFILVHGDALVLSGDDFEYAIERKGMGLCE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g949 ### # start gene g950 3 AUGUSTUS gene 3759242 3759550 1 + . g950 3 AUGUSTUS transcript 3759242 3759550 1 + . g950.t1 3 AUGUSTUS start_codon 3759242 3759244 . + 0 transcript_id "g950.t1"; gene_id "g950"; 3 AUGUSTUS CDS 3759242 3759550 1 + 0 transcript_id "g950.t1"; gene_id "g950"; 3 AUGUSTUS stop_codon 3759548 3759550 . + 0 transcript_id "g950.t1"; gene_id "g950"; # protein sequence = [MDKDKDNDYPLDYDGGTDELVNSQPLQDDDTDNNRSQTVPEEDFQISTDYDHEPSSAIAPTVFLSDPAALALHMLQLS # RALRRWAQPSRVTTNPSPVRPGSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g950 ### # start gene g951 3 AUGUSTUS gene 3761804 3762613 0.6 + . g951 3 AUGUSTUS transcript 3761804 3762613 0.6 + . g951.t1 3 AUGUSTUS start_codon 3761804 3761806 . + 0 transcript_id "g951.t1"; gene_id "g951"; 3 AUGUSTUS CDS 3761804 3762613 0.6 + 0 transcript_id "g951.t1"; gene_id "g951"; 3 AUGUSTUS stop_codon 3762611 3762613 . + 0 transcript_id "g951.t1"; gene_id "g951"; # protein sequence = [MLDEQDAVDADQQELQQFLTLQQNEAAVAAKRKRNCSPMPVAGPSSKKIWSDAPKKCSRRKSPAVEVNVEPFRHVRLV # VPPVRSVAPTSPPVPPPASPSLMGVLNRDLPTQGPSDLVRLATVAELHSGLVQQSVSSPSARTPIKGAGQDLLSSPMPPTPRPALVPRTFTAHPYCAE # NQHLAARVCELESQLADSQRENSSLTSALRDTLHALESRQREVEQLRSSNREQEVEYRGVLDQFRALDEALPGTPGQVSLSSFPNFFFLAYLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g951 ### # start gene g952 3 AUGUSTUS gene 3768877 3769416 0.98 + . g952 3 AUGUSTUS transcript 3768877 3769416 0.98 + . g952.t1 3 AUGUSTUS start_codon 3768877 3768879 . + 0 transcript_id "g952.t1"; gene_id "g952"; 3 AUGUSTUS CDS 3768877 3769416 0.98 + 0 transcript_id "g952.t1"; gene_id "g952"; 3 AUGUSTUS stop_codon 3769414 3769416 . + 0 transcript_id "g952.t1"; gene_id "g952"; # protein sequence = [MILSVVNVLSTAIKANAAVVLQMLDKLLALGVEQRAIVEAVSELEDSAATGVAGGDMMNTRSTTEMGKSTKFMMNMDV # VRLSLSSKISSLIADYSIGSSSLPASQMVAGGITAPGIVGSDGDDELGLQDAFSRPQRSIRLEIRFQGPQSPDAYGVPASQIIQSGQGKVSSSKSTVI # TYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g952 ### # start gene g953 3 AUGUSTUS gene 3772574 3773308 0.57 - . g953 3 AUGUSTUS transcript 3772574 3773308 0.57 - . g953.t1 3 AUGUSTUS stop_codon 3772574 3772576 . - 0 transcript_id "g953.t1"; gene_id "g953"; 3 AUGUSTUS CDS 3772574 3773308 0.57 - 0 transcript_id "g953.t1"; gene_id "g953"; 3 AUGUSTUS start_codon 3773306 3773308 . - 0 transcript_id "g953.t1"; gene_id "g953"; # protein sequence = [MNEGNTKQDSQLQRQEGQLQRQEAQMAELQRTQEQILSHLHLASPLASTTRAVPVNTSFDPSRPFAPAAGGVNTQSSV # PSGFRPFAPSASGPVPVPGGASGSVPDNSTGPTTGTGTPGPGGFRSTGIANPVGSATAPAGATGVPNADNLPSGNEWGKFPAGYRATNPPITGPNSLW # NVELQVKDRTPVHKSPDQIARQVSTLIESDLFHGLSLISLSEIDATMGRHGLGGTSQSPQTNCHNRGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g953 ### # start gene g954 3 AUGUSTUS gene 3774621 3775246 0.36 - . g954 3 AUGUSTUS transcript 3774621 3775246 0.36 - . g954.t1 3 AUGUSTUS stop_codon 3774621 3774623 . - 0 transcript_id "g954.t1"; gene_id "g954"; 3 AUGUSTUS CDS 3774621 3775031 0.9 - 0 transcript_id "g954.t1"; gene_id "g954"; 3 AUGUSTUS CDS 3775121 3775246 0.36 - 0 transcript_id "g954.t1"; gene_id "g954"; 3 AUGUSTUS start_codon 3775244 3775246 . - 0 transcript_id "g954.t1"; gene_id "g954"; # protein sequence = [MLSIFSRWPTADQLPPPLDSLEELHQYKPAIAIAFGALVGAVLLNYLFGWEGEAFKEGWEQLSSNVLLTNENFLVDFF # QDIGPVASDQCLIDDGRDRELSRRENEILRRERELHRQLMSFEQRRARFHRETAQYHAQQAAIHQFQARFGKDLETKGLALRTGAPAISESSERELDV # EA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g954 ### # start gene g955 3 AUGUSTUS gene 3779533 3780645 1 + . g955 3 AUGUSTUS transcript 3779533 3780645 1 + . g955.t1 3 AUGUSTUS start_codon 3779533 3779535 . + 0 transcript_id "g955.t1"; gene_id "g955"; 3 AUGUSTUS CDS 3779533 3780645 1 + 0 transcript_id "g955.t1"; gene_id "g955"; 3 AUGUSTUS stop_codon 3780643 3780645 . + 0 transcript_id "g955.t1"; gene_id "g955"; # protein sequence = [MSSTTISTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ # VPIKAHQEDPIRMWSILEKQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALI # RALPEEYRHLSSNLLMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPINPHNKRKG # IQANKAKVTEVDDDGVTESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRNWIRNYTPHRVPIRLADHTVVYSEAYASFHSGEVCLAKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g955 ### # start gene g956 3 AUGUSTUS gene 3784328 3786703 0.98 + . g956 3 AUGUSTUS transcript 3784328 3786703 0.98 + . g956.t1 3 AUGUSTUS start_codon 3784328 3784330 . + 0 transcript_id "g956.t1"; gene_id "g956"; 3 AUGUSTUS CDS 3784328 3786703 0.98 + 0 transcript_id "g956.t1"; gene_id "g956"; 3 AUGUSTUS stop_codon 3786701 3786703 . + 0 transcript_id "g956.t1"; gene_id "g956"; # protein sequence = [MSSTTISTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ # VPIKAHQEDPIRMWSILEKQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALI # RALPEEYRHLSSNLLMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPINPHNKRKG # IQANKAKVTEVDDDGVTESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRNWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEAR # QVLFSRVLHVPSLNNNLLSVLYLTKHKGFTVQILKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYG # DVSKLSKNKMVEGFKLESSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFK # RFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQDEGIEVQRTARNRPQQNGVAERLNRTLAELLTAMLLESGLPKTFWVECLAALVYVLNRCPTSA # VPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSVEHTVVIEHFLH # TLHSASSLLVITVVTYLVYKVLTDIIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g956 ### # start gene g957 3 AUGUSTUS gene 3787203 3790304 0.75 + . g957 3 AUGUSTUS transcript 3787203 3790304 0.75 + . g957.t1 3 AUGUSTUS start_codon 3787203 3787205 . + 0 transcript_id "g957.t1"; gene_id "g957"; 3 AUGUSTUS CDS 3787203 3790304 0.75 + 0 transcript_id "g957.t1"; gene_id "g957"; 3 AUGUSTUS stop_codon 3790302 3790304 . + 0 transcript_id "g957.t1"; gene_id "g957"; # protein sequence = [MSSTTISTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ # VPIKAHQEDPIRMWSILEKQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALI # RALPEEYRHLSSNLLMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPINPHNKRKG # IQANKAKVTEVDDDGVTESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRNWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEAR # QVLFSRVLHVPSLNNNLLSVLYLTKHKGFTVQTLKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYG # DVSKLSKNKMVEGFKLESSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFK # RFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQDEGIEVQRTARNRPQQNGVAERLNRTLAELLTAMLLESGLPKTFWVECLAALVYVLNRCPTSA # VPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVP # PETTPKQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDEQPIAIRRPVRTRKPPGEWWKTKPSTSRVPA # NNDDSDDSNDDYYGDAELAASTTLQVEPRNYREAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLPPGAKAIGSTWVFRIKHNADGSIERFKARLCAQ # GFSQRPGFDYLETYASTLRWSSLRLVLALAAIDDMELRSVDISHAFINSDIDTTIYMKQPEGFKQGGPEKSAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g957 ### # start gene g958 3 AUGUSTUS gene 3790655 3791449 0.52 + . g958 3 AUGUSTUS transcript 3790655 3791449 0.52 + . g958.t1 3 AUGUSTUS start_codon 3790655 3790657 . + 0 transcript_id "g958.t1"; gene_id "g958"; 3 AUGUSTUS CDS 3790655 3791449 0.52 + 0 transcript_id "g958.t1"; gene_id "g958"; 3 AUGUSTUS stop_codon 3791447 3791449 . + 0 transcript_id "g958.t1"; gene_id "g958"; # protein sequence = [MQDSKPVKTPLNPNVTLSKEDSPQTPEDKEAMINVPYMSAVGSLLFLSMIIRADTAYATGVLTRFNSNPGPAHWLAVK # HLLRYLKGTIDYELELGPDPTAPDLITAISDSDLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYK # VASPTIIHVDNQSSIQVAKNPEHHGRMKHLDRTFYWLREQVIHGKLAPSYLPTEDNPADLLTKALAIPKVDKFRTMIGLVKPITSDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g958 ### # start gene g959 3 AUGUSTUS gene 3791764 3794028 0.69 + . g959 3 AUGUSTUS transcript 3791764 3794028 0.69 + . g959.t1 3 AUGUSTUS start_codon 3791764 3791766 . + 0 transcript_id "g959.t1"; gene_id "g959"; 3 AUGUSTUS CDS 3791764 3791767 0.74 + 0 transcript_id "g959.t1"; gene_id "g959"; 3 AUGUSTUS CDS 3791930 3794028 0.72 + 2 transcript_id "g959.t1"; gene_id "g959"; 3 AUGUSTUS stop_codon 3794026 3794028 . + 0 transcript_id "g959.t1"; gene_id "g959"; # protein sequence = [MRIDILCTELGGILFGLAEGRSSVFQLQQVQSPSTKSPDKPTLRKDYVPPETTPKQQPLKVTSSAPNELFTLPIPIDE # SESDSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDEQPIAIRRPVRTRKPPGEWWKTKPSTSRVPANNDDSDDSNDDYYGDAELAASTTLQVEPR # NYREAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLPPGAKAIGSTWVFRIKHNADGSIERFKARLCAQGFSQRPGFDYLETYASTLRWSSLRLVLAL # AAIDDMELRSVDISHAFINSDIDTTIYMKQPEGFKQGGPEKVCRLNKSIYGLKQSPRLWSEKLCSVLVKLGFKRLESDPCVYLFQRGDIKVIVPVWVD # DITLASKNSGVLNKFVIELSKELKLRDLGETTFLLGIGIRRDRPNRKLYLNAKQYIIRKLDEFGMQDSKPVKTPLNPNVTLSKEDSPQTPEDKEAMIN # VPYMSAVGSLLFLSMIIRADTAYATGVLTRFNSNPGPAHWLAVKHLLRYLKGTIDYELELGPDPTAPDLITAISDSDLGGNKDNGKSTTGYIIKIGSG # AVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVASPTIIHVDNQSSIQVAKNPEHHGRMKHLDRTFYWLREQVIHGKLAPSYLPTE # DNPADLLTKALAIPKVDKFRTMIGLVKPITSDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g959 ### # start gene g960 3 AUGUSTUS gene 3798525 3799835 0.18 + . g960 3 AUGUSTUS transcript 3798525 3799835 0.18 + . g960.t1 3 AUGUSTUS start_codon 3798525 3798527 . + 0 transcript_id "g960.t1"; gene_id "g960"; 3 AUGUSTUS CDS 3798525 3799114 0.33 + 0 transcript_id "g960.t1"; gene_id "g960"; 3 AUGUSTUS CDS 3799699 3799723 0.63 + 1 transcript_id "g960.t1"; gene_id "g960"; 3 AUGUSTUS CDS 3799818 3799835 0.93 + 0 transcript_id "g960.t1"; gene_id "g960"; 3 AUGUSTUS stop_codon 3799833 3799835 . + 0 transcript_id "g960.t1"; gene_id "g960"; # protein sequence = [MEDSVAGGDLLVCRGLQKRSLPLESAFMSTSRERVAAAKAARVAAAAASKSRISDGPLVSPEKAVNEAAWALMERELA # ENALQLAAAEAEADQMEQDAHQDRSNSLQQALLKLVGQTQSSSSPGTSSGLPPSLLEAAPHLSALTSSDILSPTVSETWKLRMLFTVDSHVDTTVSLL # SAQPFTDPLPQSLLKLIVKDSRNTCLFGLLSYEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g960 ### # start gene g961 3 AUGUSTUS gene 3800057 3804304 0.99 - . g961 3 AUGUSTUS transcript 3800057 3804304 0.99 - . g961.t1 3 AUGUSTUS stop_codon 3800057 3800059 . - 0 transcript_id "g961.t1"; gene_id "g961"; 3 AUGUSTUS CDS 3800057 3804304 0.99 - 0 transcript_id "g961.t1"; gene_id "g961"; 3 AUGUSTUS start_codon 3804302 3804304 . - 0 transcript_id "g961.t1"; gene_id "g961"; # protein sequence = [MSSTTTSTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ # VPIKAHQEDPIRMWSILEKQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALI # RALPEEYRHLSSNLLMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPINPHNKRKG # IQANKAKVTEVDDDGVTESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRNWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEAR # QVLFSRVLHVPSLNNNLLSVLYLTKHKGFTVQILKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYG # DVSKLSKNKMVEGFKLESSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFK # RFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQDEGIEVQRTARNRPQQNGVAERLNRTLAELLTAMLLESGLPKTFWVECLAALVYVLNRCPTSA # VPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVP # PETTPKQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDEQPIAIRRPVRTRKPPGEWWKTKPSTSRVPA # NNDDSDNSNDDYYGDAELAASTTIQVEPRNYREAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLPPGAKAIGSTWVFRIKHNADGSIERFKARLCAQ # GFSQRPGFDYLETYASTLRWSSLRLVLALAAIDDMELRSVDISHAFINSDIDTTIYMKQPEGFKQGGPEKVCRLNKSIYGLKQSPRLWSEKLCSVLVK # LGFKRLESDPCVYLFQRGDIKVIVPVWVDDITLASKNSGVLNKFVIELSKELKLRDLGETTFLLGIGIRRDRPNRKLYLNAKQYIIRKLDEFGMQDSK # PVKTPLNPNVTLSKEDSPQTPEDKEAMINVPYMSAVGSLLFLSMIIRADTAYATGVLTRFNSNPGPAHWLAVKHLLRYLKGTIDYELELGPDPTAPDL # ITAISDSDLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVTSPTIIHVDNQSSIQVAKNPEHHG # RMKHLDRTFYWLREQVIHGKLAPSYLPTEDNPADLLTKALAIPKVDKFRTMIGLVKPITSDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g961 ### # start gene g962 3 AUGUSTUS gene 3806713 3807726 0.97 + . g962 3 AUGUSTUS transcript 3806713 3807726 0.97 + . g962.t1 3 AUGUSTUS start_codon 3806713 3806715 . + 0 transcript_id "g962.t1"; gene_id "g962"; 3 AUGUSTUS CDS 3806713 3807726 0.97 + 0 transcript_id "g962.t1"; gene_id "g962"; 3 AUGUSTUS stop_codon 3807724 3807726 . + 0 transcript_id "g962.t1"; gene_id "g962"; # protein sequence = [MERVLLEALGGQSRRNGPSVHPPMDLNKLDDLVLFLQSHAIEQSTKNNYSTGARDYVRFCTSHKLPLDPTPSTLSRYI # AFTSRHKASGPKYLTGARHYLKDVYPHFDESRSHPLVQATIRGSKKVRADPVKRKPPLRTSHLQQFLELKTKSYNHLLFATLISCCFYGCHRVGELTF # PNQKSLRDWRKVIKRSTLKFEAGRAGYHLPYHKGDPFYQGTDILFCSQQVADPVTLLKEYATARDKLHGARPALFILEDGNVPTRGWFDSMFFAVLSK # EFGGHSGRAGGATFYAGLGLQEMIIMALGRWSSSAWKIYIRDNPAVRAELELAAIRRHQSSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g962 ### # start gene g963 3 AUGUSTUS gene 3811610 3813979 0.89 - . g963 3 AUGUSTUS transcript 3811610 3813979 0.89 - . g963.t1 3 AUGUSTUS stop_codon 3811610 3811612 . - 0 transcript_id "g963.t1"; gene_id "g963"; 3 AUGUSTUS CDS 3811610 3813979 0.89 - 0 transcript_id "g963.t1"; gene_id "g963"; 3 AUGUSTUS start_codon 3813977 3813979 . - 0 transcript_id "g963.t1"; gene_id "g963"; # protein sequence = [MIYSLATSESLTTEPPHFHAVIDSDVFTFIGPRPASFPFVSPKTTHLKPSPREATMPNFFTPGWVTSSLPYMGFAPSS # NPFKCDFFRCLDFSAQALPIVGDADCGYGLKPSLKTDWDSLERNIRVFLRACMKVNGVGVPDDLRLWSFPLQYGYSRTYTTLDDARAAAYRSRQAFIP # LIASVSFFLHLLYHMQNKWVTLLATDTRVGLPNPNPFWSARQNAEAERRRGPVPSKWNWQERLQKETFISTEWLSYFYEIMEIPMVGVFMDVHNSGCL # PWLNIFLETKMPVALYWGTVQNWSIPGALSPALPFPTGVMVKSLISKQSPYSPIEPILLNTQHRSTRTRQLRLPRIDGGTQPRRNEGVFEFLKRRASD # KDRAIAESAKDRQSRLQREENASKDMPPGRKGARVYYWDLVEGIRVRTAVGRSNYEDIWERYGPRQRCYDAVADEWDICTELDPNDEPSFGDDDDEDD # DDYFITPQSIINQEIDHHHHLSSSNAYLARLQSSSRSRDPVIFNEEIDNVVKHRFGFILRDNHSNRPVKFSAGVWGQALALIGYGRQPRPSLRDSQSE # LALCSFLFDLLKATNLASAPRNFDLVSLQPPLPFEVDVLPSRDRLYFLLQAPEAHDNEPFHLAFSSAGTVMEIARRNWGPRTADLLQNLIKGGFSFNT # LSVYYPPTGYLPPPQRKSVLLGRRPCGFSPGLEEYRSYEHRRDIFLRSVRGRAAILAGGLIARLAREVVNVNDVLDGPTERALHGQNALCVWDPRQKA # AFWDDELTEDEIDLICGTYEIATGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g963 ### # start gene g964 3 AUGUSTUS gene 3820214 3820600 0.67 + . g964 3 AUGUSTUS transcript 3820214 3820600 0.67 + . g964.t1 3 AUGUSTUS start_codon 3820214 3820216 . + 0 transcript_id "g964.t1"; gene_id "g964"; 3 AUGUSTUS CDS 3820214 3820600 0.67 + 0 transcript_id "g964.t1"; gene_id "g964"; 3 AUGUSTUS stop_codon 3820598 3820600 . + 0 transcript_id "g964.t1"; gene_id "g964"; # protein sequence = [MLEEEIFARSHAASQSSSKLVFISPPNKDTSFVLPDPESLTSANCGQFALKTTAPANREFLEHEAWFCGAVIQLRLMP # RGDGDEASILEDYALDALTSLNQHKKSQWIQQSDPIGAHIIDNRGSAALY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g964 ### # start gene g965 3 AUGUSTUS gene 3820739 3823859 0.25 + . g965 3 AUGUSTUS transcript 3820739 3823859 0.25 + . g965.t1 3 AUGUSTUS start_codon 3820739 3820741 . + 0 transcript_id "g965.t1"; gene_id "g965"; 3 AUGUSTUS CDS 3820739 3822055 0.57 + 0 transcript_id "g965.t1"; gene_id "g965"; 3 AUGUSTUS CDS 3822444 3822776 0.92 + 0 transcript_id "g965.t1"; gene_id "g965"; 3 AUGUSTUS CDS 3822852 3823256 0.84 + 0 transcript_id "g965.t1"; gene_id "g965"; 3 AUGUSTUS CDS 3823320 3823859 0.45 + 0 transcript_id "g965.t1"; gene_id "g965"; 3 AUGUSTUS stop_codon 3823857 3823859 . + 0 transcript_id "g965.t1"; gene_id "g965"; # protein sequence = [MRVVLALHRGILRATESPNAIDAASNLPKDVHTIIDHYDLDPHCHARLACPKCFKLHEFSPQSIQRNEESYRADKKLD # KCVACSTTLWRIQRIGNRFFVVPIRKQLFQDLKQWFGRILAVPGMEEAMENHLRSSHDDGILRDIRDSPVFKEIPGPDGKPFMQLDENSHDLPVMFSL # GYDAFHPFHFSNEKSHISSTAIYMVNLCLPEHLRYKKGYMALVTVFNGDPNVNDINHILDWIVDLLLPFWDGIYFTQTCSHPLGRVVRGILIPIVCDV # VGAHHVSGFGSHSHKLFCTQCLLLKSDINNIDMATWPKRNLQEHRLRAQEYHKATSDEERDHIVNTYGVRWTALLRLPYWNPIAHTVIDGMHLCKGLA # ETHVRGVLGIEGDAKPKATLKSKFKPPAALLRSLWDGIRKAPENLSQWLDSKVNKNTTVFLCSCLPDDTDSRESSVLSTASSLQSILPSPSTPNKDPE # PAHSVPMADRDHVDEKKFSNLKAKLLDHNNQQQTEKLLPQTVTKAYLHALCDDLRIPYRKSEKRNLTDTKPHLITRIDYWGFHNPDTPAREPSTSSAV # SSTNPPSSSVNLAIGSFALSPSSIPSPIPSPAPGLSSAVSPALDSSTSKPLPEMVPQSSFDSAGYQALKRKFLEDTKPLSISSLSKYAKDSLVRLCKE # FSVPTYGDKALLAENLLLWHAEHRDTPIPHTPFSGNLLTSSIMEEVRIDIQRSILPTWIQPAPLAWGTPSGGKLSADHWKVICTIHLVVTLIRVWAYG # NDGTKLPLLQNFLHLVRALQILNLRSTSKQLSEAYTSEMLQYLATLQELFPNWEFVPNQHYSLHMGEFLQTMGPLHARDTSAFERVNHELQDTTTNRR # IG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g965 ### # start gene g966 3 AUGUSTUS gene 3823931 3824638 0.38 + . g966 3 AUGUSTUS transcript 3823931 3824638 0.38 + . g966.t1 3 AUGUSTUS start_codon 3823931 3823933 . + 0 transcript_id "g966.t1"; gene_id "g966"; 3 AUGUSTUS CDS 3823931 3824638 0.38 + 0 transcript_id "g966.t1"; gene_id "g966"; 3 AUGUSTUS stop_codon 3824636 3824638 . + 0 transcript_id "g966.t1"; gene_id "g966"; # protein sequence = [MLTSYCRLGNLRLLIDNRQELHDRIGETLNVLDDIACEDHRGMFADTQTLAWTSTKFKSRKVLISSDVLQHIQDYLCL # NYQVLAEKWPTNLTTEVTEVDGVSVGRAIYTSFQHQHHNSFIILELQRNQYFAARIQQIFYHTHQHPHNPHLSVSEIYTSVDLLNPLDTDVLPDWYRQ # FKMGWLCCDPSNPSTPTPVQVTVPLKYAVSHCVWTPFEINNHAILHVLPVPKVRISFTC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g966 ### # start gene g967 3 AUGUSTUS gene 3826377 3826865 0.7 - . g967 3 AUGUSTUS transcript 3826377 3826865 0.7 - . g967.t1 3 AUGUSTUS stop_codon 3826377 3826379 . - 0 transcript_id "g967.t1"; gene_id "g967"; 3 AUGUSTUS CDS 3826377 3826865 0.7 - 0 transcript_id "g967.t1"; gene_id "g967"; 3 AUGUSTUS start_codon 3826863 3826865 . - 0 transcript_id "g967.t1"; gene_id "g967"; # protein sequence = [MLDSKEWGFKEADIVLYCNACPTGMGFWFHYDDKTLGYQCMIPDDHEKPIFYFEALTVVSAILHTIKLPFVPRVFVFT # DNTNTVDMFHSLKAKQLYNPLLLTTVDHAICSNIQFRVAHIRGEENGIADALSRFDYTRLMHLAPSMKIYNFTPPQLVLGAEQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g967 ### # start gene g968 3 AUGUSTUS gene 3827270 3829072 0.64 + . g968 3 AUGUSTUS transcript 3827270 3829072 0.64 + . g968.t1 3 AUGUSTUS start_codon 3827270 3827272 . + 0 transcript_id "g968.t1"; gene_id "g968"; 3 AUGUSTUS CDS 3827270 3827971 0.64 + 0 transcript_id "g968.t1"; gene_id "g968"; 3 AUGUSTUS CDS 3828041 3829072 0.99 + 0 transcript_id "g968.t1"; gene_id "g968"; 3 AUGUSTUS stop_codon 3829070 3829072 . + 0 transcript_id "g968.t1"; gene_id "g968"; # protein sequence = [MSDSTLSMPMHDQSTLFTSDFGSELNYTGGIDLSDLCLVDDFYSHSGLSSPLFPAYPTSLNPMPTSPSPSPRLPTPIL # PTPILPVPQVQPTTLAQSTPISPPSTASPAISPTPISKAFKCGNRGCSRTTMSKHCTTKLCTKCCQTRTDLQCPHHQKNSQKPSTVPQLALVPIPQPG # SLTESNTQSDPLPIRTLSKQMPQDMAARFKQQQERKEEARRVEEKQRQLKADQKRTAHDDAEPLLFIPTAISDYPYLNLYSTQTHFDTTARSLLQRLA # LSPDDDVDVWSHDQHIWSADVVKRTFELDGRPILLRLPGVKPSAEFNQLVQRNITEAIPVWKVLKRTLSSGMDILDPALLKRPCTPIIKARSSTVAPY # SRSVASSATSPIGSYSSPHSRTPSPPYDDSDVYFSEPNCRDNERYIRDECSNSSELEANEIVASFAKVLESYANSQPFLDVDNDHRDIYRVCVDGVKS # ADGETSWPEGMRVKDMVRSFILVDSPHWVRRLPQKLDRIREVYGGLPVTLRTFSKQHQAWKSMSVSEWEDANGASAHKLWCDWRKGTQGWRITLDANK # SRYKQRKTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g968 ### # start gene g969 3 AUGUSTUS gene 3833899 3835392 0.68 - . g969 3 AUGUSTUS transcript 3833899 3835392 0.68 - . g969.t1 3 AUGUSTUS stop_codon 3833899 3833901 . - 0 transcript_id "g969.t1"; gene_id "g969"; 3 AUGUSTUS CDS 3833899 3835392 0.68 - 0 transcript_id "g969.t1"; gene_id "g969"; 3 AUGUSTUS start_codon 3835390 3835392 . - 0 transcript_id "g969.t1"; gene_id "g969"; # protein sequence = [MPDNDGMTSQQEEQSPPQSQDGDQQQQNISEGRSHRLGGIDDPLHCPRVVYQSYKNSSVARMSKSQFCSRSKLSLLQR # ISLKKPSHKVSRYISNSLIPLRIEKVKQLSMEETESPTLLQRIGSDPSMRRKKSQRMTSIHRVPLVGRLMKQSYPGSTEHLLPTELSFLNLLKRPESS # SQISLENQSMLDPPFNPSLIVPSSLPKTGMISLMENQHVLTTSSPQCMRPLLTNARPRRLVRSSSNSDRQSLEKGLTTPETGRLSLPSTPKPSHLSFP # IEQMSSKNTASISLDSLEPFPNSIMTKSSTMTRPSVIESLNLDNMSSPILVSSRTSSCIGSKPLPPKLENQDKEKISLEGANLARGTMKVNAQTQPSP # VGTNTSAESVTKMTIPVQNAQTKYWSRRPRYARALMWDDVEKPTENMSLADSSVYMTPLPQPPRDVILDDTVLDTIRKKSSSFQHYDTYKCQSLSNPS # KLSSKSRICGIRVYRFPARFLASSIWQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g969 ### # start gene g970 3 AUGUSTUS gene 3836040 3837253 0.61 + . g970 3 AUGUSTUS transcript 3836040 3837253 0.61 + . g970.t1 3 AUGUSTUS start_codon 3836040 3836042 . + 0 transcript_id "g970.t1"; gene_id "g970"; 3 AUGUSTUS CDS 3836040 3836817 0.76 + 0 transcript_id "g970.t1"; gene_id "g970"; 3 AUGUSTUS CDS 3836871 3836987 0.82 + 2 transcript_id "g970.t1"; gene_id "g970"; 3 AUGUSTUS CDS 3837165 3837253 0.67 + 2 transcript_id "g970.t1"; gene_id "g970"; 3 AUGUSTUS stop_codon 3837251 3837253 . + 0 transcript_id "g970.t1"; gene_id "g970"; # protein sequence = [METPTAIPIIPRLRVSRHHQSTAYDYSGSVNLSEAGPSRLPNSTDFLEPNLHAENTDDDEQDTPKLHPISALPTDSSS # PYPEDTPAARLKAVLERTSARSRPPPAPIPSSGSTTDLESDFDLPTIGSSQPSLARENLNSLFSRALREPGDTPQKSFKGKIRRRNSVDTSEFESSPR # VAKVKDDRRVVEGKRRSLSDDELSSSNSALYFTRFQAGSNYNAVSIDRSQAAVFNTLRQRLNSSNQRKQKTQASEQQNTSDLDPDESLDTVKDLDDIQ # FTPPLVTSTPQHSLKMSVNSQFQSIDSSRVARSNFNESTVGVEQSQSAFGIFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g970 ### # start gene g971 3 AUGUSTUS gene 3838951 3840048 0.53 + . g971 3 AUGUSTUS transcript 3838951 3840048 0.53 + . g971.t1 3 AUGUSTUS start_codon 3838951 3838953 . + 0 transcript_id "g971.t1"; gene_id "g971"; 3 AUGUSTUS CDS 3838951 3840048 0.53 + 0 transcript_id "g971.t1"; gene_id "g971"; 3 AUGUSTUS stop_codon 3840046 3840048 . + 0 transcript_id "g971.t1"; gene_id "g971"; # protein sequence = [MTRQTVILLVSQNLSATTRISDNFSIDTDTEAEESNQLVQENTPTLRPNGALPSIEAPDPVEASSAYVSFETGASLQK # IIASPPSPPLSSPSDGPSTPEAEVSFSFPSTPPRRDSRNPTKLEFQTPSPPKNLPDLPDPPSDSSDHEDHEYPAPIKGNLSSLKTPKPPGAWTATPLP # PRTHALLRSNSLPTDDENDSGLATPAASLSRAATMPPRTPALPGGWMNTPANRKSVRFHEETAAGSLKAETVAPKVEEAVHAVVKSLGSSPNSKVGTT # GDDNRQTSPSLAHSPRKATTIRVVDAFGREEKKGISDSIRIVDAMGQIVVEDSMESGSSIVPGIPPTRQKALEHVRNGLHELVEEMNDEEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g971 ### # start gene g972 3 AUGUSTUS gene 3841239 3841646 0.95 - . g972 3 AUGUSTUS transcript 3841239 3841646 0.95 - . g972.t1 3 AUGUSTUS stop_codon 3841239 3841241 . - 0 transcript_id "g972.t1"; gene_id "g972"; 3 AUGUSTUS CDS 3841239 3841646 0.95 - 0 transcript_id "g972.t1"; gene_id "g972"; 3 AUGUSTUS start_codon 3841644 3841646 . - 0 transcript_id "g972.t1"; gene_id "g972"; # protein sequence = [MVIFTKVSEETVDRSTPAKGSRPTIRKTTKRRYEFLLTNKDRVSFINCGSPNTIRYLKISITGRPENSVDDNQMEKIL # RLLSEGAGGRSIGANYQIKLDWDWGSNSDTSKERTEKSNETETSHNEDVRKKDGKLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g972 ### # start gene g973 3 AUGUSTUS gene 3853520 3853828 0.34 + . g973 3 AUGUSTUS transcript 3853520 3853828 0.34 + . g973.t1 3 AUGUSTUS start_codon 3853520 3853522 . + 0 transcript_id "g973.t1"; gene_id "g973"; 3 AUGUSTUS CDS 3853520 3853828 0.34 + 0 transcript_id "g973.t1"; gene_id "g973"; 3 AUGUSTUS stop_codon 3853826 3853828 . + 0 transcript_id "g973.t1"; gene_id "g973"; # protein sequence = [MLIMTSIIRVGHAKSSPALGAPLVQIDEDSTERIMNCIQTLSELSGGAKVDTDDEEAIVKEIFLRDTKKAFQRMISAQ # EVRIFFPVDDKIALSSFELSETCC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g973 ### # start gene g974 3 AUGUSTUS gene 3855216 3857997 0.4 - . g974 3 AUGUSTUS transcript 3855216 3857997 0.4 - . g974.t1 3 AUGUSTUS stop_codon 3855216 3855218 . - 0 transcript_id "g974.t1"; gene_id "g974"; 3 AUGUSTUS CDS 3855216 3857304 0.63 - 1 transcript_id "g974.t1"; gene_id "g974"; 3 AUGUSTUS CDS 3857384 3857997 0.4 - 0 transcript_id "g974.t1"; gene_id "g974"; 3 AUGUSTUS start_codon 3857995 3857997 . - 0 transcript_id "g974.t1"; gene_id "g974"; # protein sequence = [MSRSLMDNLASIRTDISLTETEDSWEKICRGIVSFSEFIRASSTNGTHEIITKARELHRPIINAMKSERTRLSGPAID # LISTLASELGTDFEPLLHLFFPTLLLLCARTSKVVVGRARSCILCIIETTQLVTVIPYFIQAIRDKSVSLRTVAAESTLACLNSLNPPDLEKEERTKD # IEAFIKMSVRDANAEVRKIGKQIYQAYEFFIAPLTPTSKKYLGLSSRPKSAIELGGVSGPPPHLSSSSSSRVPDSKPQAPKLVKKASQASLPSSVSSR # TQPGPHVQRGIANSTSRSRPHSAMDLHAGPTREDTHLAHLSQNNPVRPNLPLSRSESAATSNGHFRSTSTTLLAHNTSCKPTNVSAAPQRVLVAPVPN # VPAPSFKSTSGPVRVDPRAVRDHNPPGSKKPALSSDESAVTAKKPDVESVQDKVESKKTELPKLVRESKEESRKEGSNSLTNKRSLRSLNKIQQPPHG # KNGQNSRDALKTSTSSVTTASTSKIPSVSSQTKNAPHYTQPVASSRARTVSASTSVSVAARAPFPRTRAISSSASTSSLDVSAKTRPPAVRARTASST # AASTSAATVAVARSGETTTSNSIDANSSRSATSSKTLSKPVWGSSSGTRSVVPVPGKRVARTDVPKPSITGGKRSGKQKRPSVVPEELDEVATPHDDE # DEVVAPHDDENDFKSADTSITEGEGVEETASVDKVIVQTNELDAESLEGEDKSSELSLNTRTGARESESPLIDFSVMQEGESTTRSALVTPENEGVGS # AALVTHVTNQTPGLTQAGAPNQDRTTSPLPVKVTVTPSSSLLLETPVRVHDLTTPMGVQATPISALLSSIQRGFLFTPATPLSPPDSYLPKEVGGLPT # IPFPLFSNINTRTKEDVEREHSSLDWKGRQALETMDMN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g974 ### # start gene g975 3 AUGUSTUS gene 3861541 3862701 0.41 - . g975 3 AUGUSTUS transcript 3861541 3862701 0.41 - . g975.t1 3 AUGUSTUS stop_codon 3861541 3861543 . - 0 transcript_id "g975.t1"; gene_id "g975"; 3 AUGUSTUS CDS 3861541 3861783 0.47 - 0 transcript_id "g975.t1"; gene_id "g975"; 3 AUGUSTUS CDS 3861838 3862701 0.41 - 0 transcript_id "g975.t1"; gene_id "g975"; 3 AUGUSTUS start_codon 3862699 3862701 . - 0 transcript_id "g975.t1"; gene_id "g975"; # protein sequence = [MKVIYDQLHSLEQQSAYFLIRSSGSNEINVVAIEDYSPDTDTIETTTIGFIDPSAQPQNPGWPLRNLLAYFRALYPQS # TSKLRILSWRDAEFPRGEEGWKSRVGVIFIGPDGVSTEESDAKTRPNAVGWEKNVQGKLGPRMADLAPMMDPVRYGIPLPHLLPPSNLAFRLANQAVD # LNLKLMRWRILPELNLEKISETKCLLLGAGTLGCYVARCLMVNPTSHLSLVLIFNGSIQGWGVRTITFVDSSKVSFSNPVRQPLFKFEDCLNGGKPKA # ECAAERLKEVWPGINTTGYTLSIPMPGHPIPASPPSVLEQTKKDVAKLEELIESHDAVYLLMDSRESRWLPTVIARAKDKVSAGSDDRPRSLFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g975 ### # start gene g976 3 AUGUSTUS gene 3864342 3868470 0.55 + . g976 3 AUGUSTUS transcript 3864342 3868470 0.55 + . g976.t1 3 AUGUSTUS start_codon 3864342 3864344 . + 0 transcript_id "g976.t1"; gene_id "g976"; 3 AUGUSTUS CDS 3864342 3864425 0.57 + 0 transcript_id "g976.t1"; gene_id "g976"; 3 AUGUSTUS CDS 3865228 3868470 0.96 + 0 transcript_id "g976.t1"; gene_id "g976"; 3 AUGUSTUS stop_codon 3868468 3868470 . + 0 transcript_id "g976.t1"; gene_id "g976"; # protein sequence = [MDPEGRFVEAFGQTAEKEEMVDKIRQFVALTTDDIVPDLADSAPSTPPLARRNSTASVTRPDTPPIDTLPPPLPVPET # LPPIVNQTDNLHNTHTSQSSDHYRAFVHARSSGDHEVALLAVNNFRAALAAKLVDPSIYEFNAALEALYHTRPRGSPLADIQDLYNSMISLGIHPNVR # THITLILAHCDRDHEVVWALNGIEQKLKSQRILNPSAEYSLSSEDQARKDALEKENNFASAVSLFQILRTMPHKEHLQIQLFSSLLSCCAHYGAVDIA # IMVWEIVEQHSLQPSAVLYKSMIQTFARVGELNAAEDVFADFREQSAAGRIAWGSSGSQPSSRAAVRIWNVMMEAYFKCGKPDMAVGLLQEMLEPRQS # EANADTRPELPSPAPSTYTTIIAGFCNSGMTIVLYRSLSLLTSNIGDYQSAMTWFNTLVTQSSSPGFSFDPSPLPSRPDALAYRVLLETLSQRTDALP # EMNAVWSKLLEFSAQDGIEIRLLDRCYVAQTNLAAVRSLLTAVSGEALSGECLKECSEHLAVAQSTVLSQSPISTYVAGIWEAYFDLGLPTHAMDFAM # PLFNQQTSISPGFRAHLTHFAQLAAAQNWEKCSSGLVSFGYAIALINLMYRSRMEVHPRLHLYLMQQYYYAREQSMTKMELSHKQLKALCVAGATLEM # VEPHHRPNFAGLVPLLEDLVQQKYNISQPLGEHDVRQHVFSALMYDRSAYQVKSLIGELGLETVFKTYLDTTEPAAATPSPSIALSPISDNDFSEAEP # DTPLTNPSISSDDLSRPTPQNLVYGLKNGGTPKPLTIDREVTRKADRVLLESPEVMWDFFTRNLGKGKVPAPYTLSRLCQVFGRAKDVEKVKVIYNVA # QSVLASMESNKQLQSDAWFLFEDGMIIAMAQAGEIDAAHVHRQRILEQGGAPSADAYGGLILNVKDTTDDTSNAMALFNESQSLHVVPNHYLYNNIIS # KLAKARKADAALDLFTRMKASGIAPSSITYGAVIGACARVGDAASAEALYAEMVSVPNFKPRIPPFNTMMQLYTTTKPNRDRALFFYHELLKYNVHPT # SYTYKVSCCHFTSAELINLSSSYSWRHMLLSLSIYPEWRQYSRSLLTITE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g976 ### # start gene g977 3 AUGUSTUS gene 3869876 3871477 0.59 - . g977 3 AUGUSTUS transcript 3869876 3871477 0.59 - . g977.t1 3 AUGUSTUS stop_codon 3869876 3869878 . - 0 transcript_id "g977.t1"; gene_id "g977"; 3 AUGUSTUS CDS 3869876 3871477 0.59 - 0 transcript_id "g977.t1"; gene_id "g977"; 3 AUGUSTUS start_codon 3871475 3871477 . - 0 transcript_id "g977.t1"; gene_id "g977"; # protein sequence = [MVTRRPIELTLVHTPTPPGETPSEYGEFPALGLGKIHSFTDIQRTLTDMNLAVPASEAVSNDPIDLRIYSPFVPDLTL # IDLPGYVQIASLDQPESLKEKIAGLCDKYIREPNIVLAVCAADVDLANSPALRASRKVDPLGLRTIGVVTKMDLVSPEEGAAILGGNRYPLHLGYVGV # VTKAIGKNKSERTGEVVKRREDDFFGAHKAIYGSGSLMVGTSTLRKRLMEVLESSMASSLHGITNAVQLELEEATYQFKVQYNDRRITAESYVAETMD # VLKARFQTAKAEFRKPIIREKLKMMLDDKVMDVLEQLYWLDKRAKELGDLAVDSRVKGPEDVDSYWKHKLDAAGSLLTKSGVGRDSTLLVADGLRAMI # DSIASGEPFTYHSRAAERLISFSHDILRDRIGVAADQVENCIKPYKYEVEVEPREWELGRERAIGLFEKEIAMCEGKLKDIRKKVGGSRRLGALVGYV # QNLEEKEKERKERKLRAVTANSNDDAAEEFEEPLAESYRFPAAQILDGEFVPSNSTRSVIYCI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g977 ### # start gene g978 3 AUGUSTUS gene 3871560 3872051 0.55 - . g978 3 AUGUSTUS transcript 3871560 3872051 0.55 - . g978.t1 3 AUGUSTUS stop_codon 3871560 3871562 . - 0 transcript_id "g978.t1"; gene_id "g978"; 3 AUGUSTUS CDS 3871560 3872051 0.55 - 0 transcript_id "g978.t1"; gene_id "g978"; 3 AUGUSTUS start_codon 3872049 3872051 . - 0 transcript_id "g978.t1"; gene_id "g978"; # protein sequence = [MNAVQDSAVDLFDSATDRVNKARTRVSGIRLPEFQAPQFLKNLFTEGDQDRTGKNQGEDGKRDNDGSSDSKQRPPSDN # ATIAALLAATMSSPSDSKTGNNGQLESQPNGLMNLTKKLIEIRSMLLSIDQNDSLKLPSIVVIGSQSSGKSSVLEAIVGHEFLPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g978 ### # start gene g979 3 AUGUSTUS gene 3876485 3877253 0.49 - . g979 3 AUGUSTUS transcript 3876485 3877253 0.49 - . g979.t1 3 AUGUSTUS stop_codon 3876485 3876487 . - 0 transcript_id "g979.t1"; gene_id "g979"; 3 AUGUSTUS CDS 3876485 3877028 0.99 - 1 transcript_id "g979.t1"; gene_id "g979"; 3 AUGUSTUS CDS 3877096 3877253 0.49 - 0 transcript_id "g979.t1"; gene_id "g979"; 3 AUGUSTUS start_codon 3877251 3877253 . - 0 transcript_id "g979.t1"; gene_id "g979"; # protein sequence = [MYKLALKEAPPSNYEGHIIQDRVVTKIPYTKSGGKKIPPPDPPHLEHPIRSMRYLKTQILPILQGHKEIRKATGKRFH # AVPEAKVDTGNAKTKTKAKGKGNSNSGIAGHSQSSASTPSAPIPYTVHLWMPTQKPKVIKDAVASPAMTVDLGAEVGVGADWDHLNKRRQRARGEKVK # RDLGIASQVRKSERQERKRAVWEVLMLKEEQGKAGSSAAPKVTVDDVDANSKPPHPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g979 ### # start gene g980 3 AUGUSTUS gene 3878722 3883584 0.91 - . g980 3 AUGUSTUS transcript 3878722 3883584 0.91 - . g980.t1 3 AUGUSTUS stop_codon 3878722 3878724 . - 0 transcript_id "g980.t1"; gene_id "g980"; 3 AUGUSTUS CDS 3878722 3883584 0.91 - 0 transcript_id "g980.t1"; gene_id "g980"; 3 AUGUSTUS start_codon 3883582 3883584 . - 0 transcript_id "g980.t1"; gene_id "g980"; # protein sequence = [MPPAFTTLLDDTVTYAKWKPSGNGMPGTMSCGKITVETLELAKRDLRIFLTNNRKLAPSDYVTKCLNVWEDPRVSNWI # DQNRENFAKLDFDKFFTVLRDRVLEHDWQDSTFRKMRAVRMPEGLNTSISDLAVQLLVLNNLLQGTPRFQSEENLKIMLIDATDSHLREAYNKEVEDH # ASNPAHGIHSKDFDTFTKAIQVLDNSRHRQLLMARQMAEHMLRSRPGSRATTPLSSSSVANTQNCRNGTSAGTSSNSGRLPPLTTNERRLLSENDGCF # KCRSFFVKCRTSSNDHEFPLPVGNGYKELTISDVESARKLRGPAVETNKKARTAAIATIAAVAENSDDDMVASIMPSAVLGDGTDSEEEVSGPFSVSH # LRWKCHVSGPKTVFPITVNSLIDNGAHLALIHPDLADRLGLQRQLLKKPEPVSAAFQANKQSSIPALTEYVSLKLSSIDGTFTSRKVPFIIAPGLCTQ # LLLGLPWLTHNHITIDYATRSCIHKPSGCNLLKPPAVTRMFSFQSKSVENIHASLRKSGNRAKDARRKLLVELKDVCSTIRHKFPPCAVSPDTTTTQI # IASIRERVENLATLSTLREHESRLMEKYHSIFEPIPHVDDLPTTVTAKIQLIDASKSIASRSYRCPRKFRAAWQTLIQKHLDSGKIRPSDSPYASPSF # VVPKSDPNALPRWVADYRQLNDNTVVDAHPLPRIDDILADCAKGRIWGKIDMTDSFFQTRMDEDSIKLTAITTPFGLYEWTVMPQGLKNSPAIHQRRV # TSALRHLIGKICYVYVDDIIIWSKTVEEHIANVERVLLALRMARLYCNPKKCELFSFDVHFLGHSISSAGIAADDKKVERILDWPTPKTLKDLQSFLG # LVRYVATFLPRLAELTDILTGLTSNCVDKNRLPWESRHQTAFESIKQLVASRECLTVIDHDQLDANKIFVTTDASDRCSGAVLSFGPTWETARPVSFD # SSTFKHAELNYPVHEKELLAIIRALKKWRADLLGVPFVIMTDHRTLENFHSQPDLSRRQARWMEFFSQFDCKIVYVAGDKNTVADALSRRTDLCLQDN # ASESRTLLESSAEAISASRHPYTYCSDSDDDQNLPILCILPDSAWSGAHALSDYITTSPCLPIATTLSLTSNASLLRDIRTGYTTDAWCKDLPSMASS # MPLVRLDPKSKLWYIGDRLIIPRSGHIREELFRLAHDNLGHFGFDKSYAALRDSYYWPGMRRDLLKAYIPACDECQRNKSTTQKKPGPLHPLPVPDRR # FSSVAMDFIGPLPEDTGSNSILTITDRLGADIRIIPCRTDLTASECAQLFFDFWYCENGLPDDIVCDRDHLFVSKFWEALRTLSGIRLRMSTSYHPES # DGSSERSNKTVVQMLRYHVERNQKGWKRALPCIRFEIMNTVNSSIGMSGFQLRSGFSPRLIPPLIPNPPPTSTKHEFDAHSFLTGIQIDVLEAQDALL # SAKLDQVRSHNRHRRADPGFKINDRVLLKTKHRKNEYKRKGEKRAAKFFPRYDGPYTITDIHPQFSAYTLDLPPSLNIFPTFHADELKLYTDNDPELF # PNREFPRPGPIVTADGLLELEVDRILDERKVGRGRRYLVRWRGYGPEFDSWEPGRSLQECEALDVWEGLVDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g980 ### # start gene g981 3 AUGUSTUS gene 3884443 3884895 0.9 + . g981 3 AUGUSTUS transcript 3884443 3884895 0.9 + . g981.t1 3 AUGUSTUS start_codon 3884443 3884445 . + 0 transcript_id "g981.t1"; gene_id "g981"; 3 AUGUSTUS CDS 3884443 3884895 0.9 + 0 transcript_id "g981.t1"; gene_id "g981"; 3 AUGUSTUS stop_codon 3884893 3884895 . + 0 transcript_id "g981.t1"; gene_id "g981"; # protein sequence = [MRASSDDIAVLIVGPDHTFAATTPGYDPATTPGTFIQPPVDDIPKATRGMSRLNGEYYMLLELETKFSFTRVELDEEA # IFNTLRDSSQLDVAVGPPVDKDNLDLDYIDRALKLLKQVGGLKGDVANWPGVRQKIMSDRDQAKAKAKKGQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g981 ### # start gene g982 3 AUGUSTUS gene 3885478 3886239 0.62 - . g982 3 AUGUSTUS transcript 3885478 3886239 0.62 - . g982.t1 3 AUGUSTUS stop_codon 3885478 3885480 . - 0 transcript_id "g982.t1"; gene_id "g982"; 3 AUGUSTUS CDS 3885478 3886239 0.62 - 0 transcript_id "g982.t1"; gene_id "g982"; 3 AUGUSTUS start_codon 3886237 3886239 . - 0 transcript_id "g982.t1"; gene_id "g982"; # protein sequence = [MSEVRAYAISAIGKLPDIDPVDKIVLARTYDIPTWLAPSFNEILQRSQSLTESDVDKLGIPTIVRLMELRDRVRPHIY # SPNGAWILGSARMETSVDFTAVICTVFPESQVEGMSDPIDEGIRDHDLDCNSRVVSSPTPVQSTNATGPVAAGSKAGSARALSPAELPTVDPMSQNRC # PTPLGSSSKAKHRPEPESTLSQDPRPASPWGLHKAPSTLAPFYGVATTLALDPSLDASNPISMTAGTNIKNRKKSTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g982 ### # start gene g983 3 AUGUSTUS gene 3888622 3889110 0.74 - . g983 3 AUGUSTUS transcript 3888622 3889110 0.74 - . g983.t1 3 AUGUSTUS stop_codon 3888622 3888624 . - 0 transcript_id "g983.t1"; gene_id "g983"; 3 AUGUSTUS CDS 3888622 3889110 0.74 - 0 transcript_id "g983.t1"; gene_id "g983"; 3 AUGUSTUS start_codon 3889108 3889110 . - 0 transcript_id "g983.t1"; gene_id "g983"; # protein sequence = [MIPSPKVPTYDKDPKMSVKDVANKVAEVVRESKHEFVMCNFAPPDMVGHTGVFDAAVEAISHTDEAVGTVYKACQDAG # YILLITADHGNAEQMKNLETGAPHTAHTTNAVPFIMTGDTEKFKFTEDKDDGEQEPGALCDVAPTVLDLLGLEQPKGVLCGSFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g983 ### # start gene g984 3 AUGUSTUS gene 3893970 3895116 0.28 + . g984 3 AUGUSTUS transcript 3893970 3895116 0.28 + . g984.t1 3 AUGUSTUS start_codon 3893970 3893972 . + 0 transcript_id "g984.t1"; gene_id "g984"; 3 AUGUSTUS CDS 3893970 3894484 0.4 + 0 transcript_id "g984.t1"; gene_id "g984"; 3 AUGUSTUS CDS 3894540 3894738 0.62 + 1 transcript_id "g984.t1"; gene_id "g984"; 3 AUGUSTUS CDS 3894802 3895116 1 + 0 transcript_id "g984.t1"; gene_id "g984"; 3 AUGUSTUS stop_codon 3895114 3895116 . + 0 transcript_id "g984.t1"; gene_id "g984"; # protein sequence = [MPKLTLLTLSSKPKSIQIRRILLGLCRWQERGAIIINNHRIYEWILKLPHRPEVLVTHSKDLGQILKAIHTTSSKVGG # AIDIPTAIAVAQLALKHRENKNLRQRIIVFVGSPLEGPAADEKGMVKLAKKLKKNNVAVDVVCFGDGIEEPVSGQEDKSVLKSFVENATSSDNSHLVV # VPPGPRLISDALISSPILSDDRSASIPTELGGTGGDGPSASSGGDFEFGVDPSLDPELAMVSALRISMQEAQAREVAASTEASSSDASQPATTSSTVP # AESTEDEEEALLAQAIKMSSEEDVDMESAGTTKPSETDAPMNEDDEDEEAAIARAIAMSMQQDEQDKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g984 ### # start gene g985 3 AUGUSTUS gene 3899886 3900353 0.67 + . g985 3 AUGUSTUS transcript 3899886 3900353 0.67 + . g985.t1 3 AUGUSTUS start_codon 3899886 3899888 . + 0 transcript_id "g985.t1"; gene_id "g985"; 3 AUGUSTUS CDS 3899886 3900353 0.67 + 0 transcript_id "g985.t1"; gene_id "g985"; 3 AUGUSTUS stop_codon 3900351 3900353 . + 0 transcript_id "g985.t1"; gene_id "g985"; # protein sequence = [MDDIVVLIIGSDQAFAATTHVTDKAAAGPLEKTMTLIQPSLSISKIPKWKMHIQAVYYVTLQNQDAFFFCEKCQFDEQ # KTFDILRSSSQLEAEVGPPVDMENLDLDYIDRALKLFRKVGWLKGDLAQEKWHGFREEIRSGRVSAMAKEKEKKKAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g985 ### # start gene g986 3 AUGUSTUS gene 3901375 3902481 1 + . g986 3 AUGUSTUS transcript 3901375 3902481 1 + . g986.t1 3 AUGUSTUS start_codon 3901375 3901377 . + 0 transcript_id "g986.t1"; gene_id "g986"; 3 AUGUSTUS CDS 3901375 3902481 1 + 0 transcript_id "g986.t1"; gene_id "g986"; 3 AUGUSTUS stop_codon 3902479 3902481 . + 0 transcript_id "g986.t1"; gene_id "g986"; # protein sequence = [MLAPPAAPSPSFSINISSKLASKPGKIPLHFYVPESYNSDETTQTKRVFPIVINFHGGGFTIGRATDDARWARAVVHY # ADAVVVSVDYRLAPEHPFPIAIEDGVDATLYLIEHAEELKIDPHRIAYSGFSAGGNMSFSVPIRLAEEYRIRKTKRDAGSDTSSAMTQEGTVIAISSW # YPSIDYTNTRDERRKTNVRSDKDLPKFFTNLFDSSYLYPVNGVDLKSPWLSPGIAPSEMIKDLPENIVFYTCEWDELCAEADRFHHRLVNDFGKKVVY # KKVMGVTHAFDKTPNPLHWDPKIETMYRDACRELRTVFYGSSSDSALEEAVAEGKEGQQATVTTRMEDIKFPSSQDSLATVGSRYQEPVAGSTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g986 ### # start gene g987 3 AUGUSTUS gene 3907073 3908563 0.85 - . g987 3 AUGUSTUS transcript 3907073 3908563 0.85 - . g987.t1 3 AUGUSTUS stop_codon 3907073 3907075 . - 0 transcript_id "g987.t1"; gene_id "g987"; 3 AUGUSTUS CDS 3907073 3908563 0.85 - 0 transcript_id "g987.t1"; gene_id "g987"; 3 AUGUSTUS start_codon 3908561 3908563 . - 0 transcript_id "g987.t1"; gene_id "g987"; # protein sequence = [MYRFAGMTQHVADVLAHKVFNILDDPEDDSKRISASGFGTWVRDLPDLLADDPKPRKGHQRNVSISSATQGFSISAST # PMSHRPQSRQASGSTTVRTPAIPSRSLSRAPSLGPAYEHPGASELSTVFDQEIEVEEVEARKYEDREECADVISEEGLNSRSQSAHKRRKRGARKGKG # AATAPNTPKDETLATLAVASQSLAREISKTSKLSGRTGSSTSLSASASSRRSRPYEPVSMYPLPTPLLSSTKPLVSRYPPTSASSMPAAPSSAPATAT # SVNKKPSKWKLSFGKASAAALVPGGALHDDASSMLSTDSNSPMSGTASNVTSLIMALEAPAINSASITNLNDEDGLSTFNRGRRGRGSPPSSLYHDAH # HSSRSPMPPRSPNRDRWDDRRSDRAISPNSTRSGRPLASSASSVVSSNWRSSMSTNASMSSSAFTRYSNSSIRSVSTAATSVSSNSWRTNGKYATSST # SSYHAAHPGLPKNVKSESVKATFRIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g987 ### # start gene g988 3 AUGUSTUS gene 3909369 3910175 0.52 - . g988 3 AUGUSTUS transcript 3909369 3910175 0.52 - . g988.t1 3 AUGUSTUS stop_codon 3909369 3909371 . - 0 transcript_id "g988.t1"; gene_id "g988"; 3 AUGUSTUS CDS 3909369 3910175 0.52 - 0 transcript_id "g988.t1"; gene_id "g988"; 3 AUGUSTUS start_codon 3910173 3910175 . - 0 transcript_id "g988.t1"; gene_id "g988"; # protein sequence = [MLQYSTYPSLSSQASTKSAIGKDNSDYFRHNEPSSTRLSSSVNNKRVHRDSLSNRSSYAFSNPLSITTNLLSSPTASS # PSTMSSKPPRSPYISSRQALSPSPSAHPWSSSSAAKTPVDSRPTSPTQSVNSMALEDVLAAGDIVGEGATLQDETITLVSIGDPVSVRSDTPDYEQPA # KEFEVVRRLGAGSYAVVYLVCEVLYRPPPSEDGHTFGTLDLDDVSSQRPKTVYGREYALKCLSKANLDEEALAAQMSEVCYLQRMMCLHLLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g988 ### # start gene g989 3 AUGUSTUS gene 3912245 3912622 0.44 - . g989 3 AUGUSTUS transcript 3912245 3912622 0.44 - . g989.t1 3 AUGUSTUS stop_codon 3912245 3912247 . - 0 transcript_id "g989.t1"; gene_id "g989"; 3 AUGUSTUS CDS 3912245 3912622 0.44 - 0 transcript_id "g989.t1"; gene_id "g989"; 3 AUGUSTUS start_codon 3912620 3912622 . - 0 transcript_id "g989.t1"; gene_id "g989"; # protein sequence = [MELGFIESLRRRWDVLGITREGTGVSQNVKNIVSEKDQFLDVDMDEGTTTAGTEKARDAELERLDQEGDEGTAARKQI # LDGVIVKAVMDSAVQGELFLSMLPVISFPTALRIGVFISRTCVAPAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g989 ### # start gene g990 3 AUGUSTUS gene 3913543 3915034 0.92 + . g990 3 AUGUSTUS transcript 3913543 3915034 0.92 + . g990.t1 3 AUGUSTUS start_codon 3913543 3913545 . + 0 transcript_id "g990.t1"; gene_id "g990"; 3 AUGUSTUS CDS 3913543 3913722 0.92 + 0 transcript_id "g990.t1"; gene_id "g990"; 3 AUGUSTUS CDS 3913772 3915034 0.95 + 0 transcript_id "g990.t1"; gene_id "g990"; 3 AUGUSTUS stop_codon 3915032 3915034 . + 0 transcript_id "g990.t1"; gene_id "g990"; # protein sequence = [MGPKVHHRTTSSSRLGPNSRTTSATRLGANLQLTQKDPQFNTNKQPQPAQSKKNALGTHDNHGRTSTFQRVNSSHRIA # SKDQLPPFQPVPKRPTYTATAKANGTKAKRGFIIASSPSDEADDDEWVSSESGAATPNYVEGSDSGAESELVTPAEMAKLLERPTSTKSNATKEMVEE # QDRGRADGGVTPIPRVDIARPPQTLDPQLPRGKLPAEPELDSLRPAPPPPPAASQNYDRRASLPPMVTMINSVEPSPIDTPAVAPRPSHKRRPSTRPP # STHSISSRHEPLRPHPLIRGQSFGFPNNKLAPLAMTSDVASAQLSSTPPVNIEQSRHHPSPLSSSPATTISGSPPSPSNNNSLHHQLPSRRTSISSAR # SVATLPAHSLREPPRQGKDRNRTISTISISSSSAAISSLAHIPATRPPSPQRLSVVFPPPSHPQFHTAGVHSLLPPPYLTNHLTTLAHRTPLRESYDR # VRYAKLMARR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g990 ### # start gene g991 3 AUGUSTUS gene 3919088 3919372 0.76 - . g991 3 AUGUSTUS transcript 3919088 3919372 0.76 - . g991.t1 3 AUGUSTUS stop_codon 3919088 3919090 . - 0 transcript_id "g991.t1"; gene_id "g991"; 3 AUGUSTUS CDS 3919088 3919372 0.76 - 0 transcript_id "g991.t1"; gene_id "g991"; 3 AUGUSTUS start_codon 3919370 3919372 . - 0 transcript_id "g991.t1"; gene_id "g991"; # protein sequence = [MVVVDKRQDKTAYAPGANRAEVQAQLEQTRFSSGGNLESVALPVPAQVEVDLTSKMIHKTDGDHRGVWCITETPGPDA # LLETLLARVWGVQGCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g991 ### # start gene g992 3 AUGUSTUS gene 3924395 3926076 0.62 + . g992 3 AUGUSTUS transcript 3924395 3926076 0.62 + . g992.t1 3 AUGUSTUS start_codon 3924395 3924397 . + 0 transcript_id "g992.t1"; gene_id "g992"; 3 AUGUSTUS CDS 3924395 3924450 0.76 + 0 transcript_id "g992.t1"; gene_id "g992"; 3 AUGUSTUS CDS 3924536 3924696 0.64 + 1 transcript_id "g992.t1"; gene_id "g992"; 3 AUGUSTUS CDS 3924833 3926076 0.73 + 2 transcript_id "g992.t1"; gene_id "g992"; 3 AUGUSTUS stop_codon 3926074 3926076 . + 0 transcript_id "g992.t1"; gene_id "g992"; # protein sequence = [MPRVHPKSNGEEEVESVSAPLERDIYVLLANDALQLVVTSRATPECIQERRTTSVLFPAATRDVRDRTTYNNNNNASP # PASQQDYSLASEQPPLSPPPLVPVSIPAPSLSPPPLQSVRATGTDVRYSPPPDSPPPLAHATMTVAYHAHQRASPASSATSSPESTSFPSTNMISPPP # LAPVHSVHPSTSTQSNTYGFRTNGAYQDHSGTSTAYSYGQSESPTSENYQATSEGYTSNQYPLPRIETLAPKDELSASPSVAISNTSLTGVNSRHSIS # HISHSHPAYPRMMSSSMNSRPSTGPPSPASSHSTSHSVVSHSGPPTPNGYTTYDPESGQSSPYDQTSPPLSSHPGGPILEPSLSRYSPPPVLAPIHGF # TSHDSMEVMSRSGRVISDQYERRPSSRGDYPDRYAHYETRYAPDEPRYGRAVYGLGQERQDLSPVQTYMPHQSSSMSGFHDMYPPGGTVNLNHGAWKS # DHLSNRGMKSINALVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g992 ### # start gene g993 3 AUGUSTUS gene 3927245 3927952 0.75 - . g993 3 AUGUSTUS transcript 3927245 3927952 0.75 - . g993.t1 3 AUGUSTUS stop_codon 3927245 3927247 . - 0 transcript_id "g993.t1"; gene_id "g993"; 3 AUGUSTUS CDS 3927245 3927952 0.75 - 0 transcript_id "g993.t1"; gene_id "g993"; 3 AUGUSTUS start_codon 3927950 3927952 . - 0 transcript_id "g993.t1"; gene_id "g993"; # protein sequence = [MFSLPPSQRPTSFSFSSPRPTSSHSKAPSGTDQRLASEQQKEVVSTFESSSFPVVSFSRQPSARLSNQRSNVPIRKSK # KDDAKIGDNPLPQLLSELNKLRKESSLVHEKQQAILDELRRMGTEDRILEPMFAVIGIRNEADHGINVDPEGMLFVLLKAPGLNQLSSAAKIRLRAIE # QEITIERKRRNKAMDELRTIEREGRDPFVVPALLHAFISLSKLTTDTNQKLKNDYVQAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g993 ### # start gene g994 3 AUGUSTUS gene 3933972 3934978 0.83 - . g994 3 AUGUSTUS transcript 3933972 3934978 0.83 - . g994.t1 3 AUGUSTUS stop_codon 3933972 3933974 . - 0 transcript_id "g994.t1"; gene_id "g994"; 3 AUGUSTUS CDS 3933972 3934100 0.84 - 0 transcript_id "g994.t1"; gene_id "g994"; 3 AUGUSTUS CDS 3934154 3934482 0.87 - 2 transcript_id "g994.t1"; gene_id "g994"; 3 AUGUSTUS CDS 3934528 3934978 0.97 - 0 transcript_id "g994.t1"; gene_id "g994"; 3 AUGUSTUS start_codon 3934976 3934978 . - 0 transcript_id "g994.t1"; gene_id "g994"; # protein sequence = [MASTPPPQHEFEIPPMPHLPTPSGSRHRGSFGSSFSFGPQPLVDSYLEANSSTYSNNHSIALDPNRSILHASPLRSSP # RRTRKPKDSINRPHPLANDTTGIFQHSDDDADDEEEYEWGMVDRMRLWRHDALMQHLYETAAFWGDKIVSWTNDPNDAFWLAQTYFMQHQYSRAERLL # TRPFPTLAPKHPSTPPLNLTNGDVSTAVAKGKGKERDTLPLAIPIPRLPLDPAGMFEGTQDPHEIISRLVDMSVACRYLAAQCQVRQGNWSDATEMLG # EANPFRDLEQDRAAVPDIDGGIKVTLVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g994 ### # start gene g995 3 AUGUSTUS gene 3940910 3942157 0.87 + . g995 3 AUGUSTUS transcript 3940910 3942157 0.87 + . g995.t1 3 AUGUSTUS start_codon 3940910 3940912 . + 0 transcript_id "g995.t1"; gene_id "g995"; 3 AUGUSTUS CDS 3940910 3942157 0.87 + 0 transcript_id "g995.t1"; gene_id "g995"; 3 AUGUSTUS stop_codon 3942155 3942157 . + 0 transcript_id "g995.t1"; gene_id "g995"; # protein sequence = [MSGSFEHLAYFAFSELKAANGNPHLHRAIVRSLHKPLSVLLGSLSSMMLPLLSSPAFLTPPAPTVQSPHPNAIQLHAI # AIATFAGELLETFDELNLGHDNDVRGDGLKGIREGLVSVVSRVINPLVGGIRRELVPIIDALELSIPGKMTLGVKNVVLHSSVLTLQSIIPIYTQALR # RYTSSRTAQNLLATFVISLVWRSMVALCHRPTTPSPPSSPGLISATKKRRNSPSSTPPLTPPASRFTIKLPSSRPPSPPIPVLAPSLSPSTDARAIYD # LLVTLPTPVAETENGRLAKEAVDEAMNGLHALADLFDAAHHLLKVTSDSTIEDHALELERLTEKIPTLIALPVLLRAQNLDIRSEVVLGLSEEDYRNS # CLTGFGRADECATPVGLRVHDHIRTSGNTAPVLLAWLEKEIAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g995 ### # start gene g996 3 AUGUSTUS gene 3942644 3943231 0.6 + . g996 3 AUGUSTUS transcript 3942644 3943231 0.6 + . g996.t1 3 AUGUSTUS start_codon 3942644 3942646 . + 0 transcript_id "g996.t1"; gene_id "g996"; 3 AUGUSTUS CDS 3942644 3943231 0.6 + 0 transcript_id "g996.t1"; gene_id "g996"; 3 AUGUSTUS stop_codon 3943229 3943231 . + 0 transcript_id "g996.t1"; gene_id "g996"; # protein sequence = [MYVYSRSSQNIFTQDDDPYDEILSDVIGGIVIRTDFSNEEAWNAFSTRLKAAEDEISDGGQDTTEAGPSSVEGSAPTQ # VTDVDMEDGYDSDDSEEENVDGKLIKIINPTQPEQRAIFQNISNIRALRLFNDVDIRPAPPVPSGHKRFSPPHPLVDYAGWQEIYTGVTLWVYDSTSN # IDQSARLISAEGDIYGTAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g996 ### # start gene g997 3 AUGUSTUS gene 3947259 3947879 0.75 - . g997 3 AUGUSTUS transcript 3947259 3947879 0.75 - . g997.t1 3 AUGUSTUS stop_codon 3947259 3947261 . - 0 transcript_id "g997.t1"; gene_id "g997"; 3 AUGUSTUS CDS 3947259 3947879 0.75 - 0 transcript_id "g997.t1"; gene_id "g997"; 3 AUGUSTUS start_codon 3947877 3947879 . - 0 transcript_id "g997.t1"; gene_id "g997"; # protein sequence = [MTDYDPIRTCCSEADICKRCWGFIAIAVEVLDTAIRDQFGYTKLLWVYSGRRGIHLWISDKEAFELNDDQRKAMVEYL # TVIKNGKEPGKRVNVRFGMKDLPPTLKYVVASAVVIVRLKLFALREACQAINQTFDDLILQDQDCFGSQEGYETLLSLIPDAKLASRLREKWSQKPDS # PSYIKWDEMRTEILALKDKHARVRISFYLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g997 ### # start gene g998 3 AUGUSTUS gene 3950392 3951231 0.81 - . g998 3 AUGUSTUS transcript 3950392 3951231 0.81 - . g998.t1 3 AUGUSTUS stop_codon 3950392 3950394 . - 0 transcript_id "g998.t1"; gene_id "g998"; 3 AUGUSTUS CDS 3950392 3951231 0.81 - 0 transcript_id "g998.t1"; gene_id "g998"; 3 AUGUSTUS start_codon 3951229 3951231 . - 0 transcript_id "g998.t1"; gene_id "g998"; # protein sequence = [MPVETKMGVFDPFQHYPDIPASSLPSDIPPEYRKKILSILPELPGVKSVRNLSNAHRDANGNIHIDAPVVNRPWEWTE # NLGDYVGDYSQGRDVRNSGSLNLLNFGARLTGEGRIPEAYQKDARIEENLRTFEDGFSSESIFQRDWRETRVRPSVEELLGAEGLRTRLDENLPMSFV # AHRRKSSPAMSNSGASRSSGMSMRHSPGHGGLNRRSSSTISDIIDVDAIPSTSGGSSSRGKRKAAVESDDEVVFVEGPIAAPTKGGKKAKPTKTQTKK # STKRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g998 ### # start gene g999 3 AUGUSTUS gene 3957248 3958292 0.29 - . g999 3 AUGUSTUS transcript 3957248 3958292 0.29 - . g999.t1 3 AUGUSTUS stop_codon 3957248 3957250 . - 0 transcript_id "g999.t1"; gene_id "g999"; 3 AUGUSTUS CDS 3957248 3957664 0.62 - 0 transcript_id "g999.t1"; gene_id "g999"; 3 AUGUSTUS CDS 3957718 3957982 0.96 - 1 transcript_id "g999.t1"; gene_id "g999"; 3 AUGUSTUS CDS 3958066 3958292 0.5 - 0 transcript_id "g999.t1"; gene_id "g999"; 3 AUGUSTUS start_codon 3958290 3958292 . - 0 transcript_id "g999.t1"; gene_id "g999"; # protein sequence = [MQQDPEASIRTNTCILIGRLGPTLGYNTKKKVLVPAFLRALKDPFVHARVAGLMAFMATIDCFDVEDLATKVIPNMLV # RDQAFKTMELFTKKLESYAATMVWVSFYRSNDNLLKSSTKPETAAPNPFDQFTDPVAATSQGTLVTSAAGAAGALAGWAMSSIGKRLAPSDMQTTMAS # STGTGIDRPTSAPPPAEDSRIGNLKPSPLLTSMSAANSTATSPALPIRSNFQSSSKLKGMQLGASKVPSSIAAALAEQLAEEVAAEDGVDVSNPWGDD # DLMDVNADEGDWSKYQQERISFANNEFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g999 ### # start gene g1000 3 AUGUSTUS gene 3963214 3963693 0.88 + . g1000 3 AUGUSTUS transcript 3963214 3963693 0.88 + . g1000.t1 3 AUGUSTUS start_codon 3963214 3963216 . + 0 transcript_id "g1000.t1"; gene_id "g1000"; 3 AUGUSTUS CDS 3963214 3963693 0.88 + 0 transcript_id "g1000.t1"; gene_id "g1000"; 3 AUGUSTUS stop_codon 3963691 3963693 . + 0 transcript_id "g1000.t1"; gene_id "g1000"; # protein sequence = [MNVEIQFKTRGIPFTHVNHTASTSVSPELAYIQSSLARSVPGLCVQSSDILSGAPAAEAAMPNIRVIPLNWWSEKKAQ # VVTCVKLKYVQQPMGKSAGTSTVIRPSKRIIYDTTEAVVSFLSENVDTCVDEFLEEWARVSKMVVIARQGESVTLYYQLVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1000 ### # start gene g1001 3 AUGUSTUS gene 3964766 3965911 0.92 - . g1001 3 AUGUSTUS transcript 3964766 3965911 0.92 - . g1001.t1 3 AUGUSTUS stop_codon 3964766 3964768 . - 0 transcript_id "g1001.t1"; gene_id "g1001"; 3 AUGUSTUS CDS 3964766 3965911 0.92 - 0 transcript_id "g1001.t1"; gene_id "g1001"; 3 AUGUSTUS start_codon 3965909 3965911 . - 0 transcript_id "g1001.t1"; gene_id "g1001"; # protein sequence = [MFQNTEIINRVLTLQFIQDPLTHALCPHNSCNGTAHLLCLSQHFISQSLSGNYNPSDAPMVPRGGNCPSCFNFVLWGD # VVKGCYRRSAGGAVSVEEDEEALEKMYKSDSLAEDTSSHDHDSGRANNGNAQGKKRKAKRVVSPRKKREREGCIESSTSSLGEEFDFDEVEEERYSDD # PEVVGTSRRRMATSSPTKFKIGNAHLTIPTPVTPSASTRARKPQTTLFSSSPTPRKQVRAIRSPKDYQESSEGELFDFDDVERLSSTDDDEAPKRKVG # RPKKVLNVDGAVSGPSSRPTGATKRRGRPRKDSLNVALSSTSSKTPTKKLSNSSKRMLMSRPLGKLAAAPLEPPRSNVLPLYLSDSDDDVLVHTMSSL # SVSSPSSSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1001 ### # start gene g1002 3 AUGUSTUS gene 3973199 3974082 0.41 - . g1002 3 AUGUSTUS transcript 3973199 3974082 0.41 - . g1002.t1 3 AUGUSTUS stop_codon 3973199 3973201 . - 0 transcript_id "g1002.t1"; gene_id "g1002"; 3 AUGUSTUS CDS 3973199 3973514 0.46 - 1 transcript_id "g1002.t1"; gene_id "g1002"; 3 AUGUSTUS CDS 3973634 3974082 0.79 - 0 transcript_id "g1002.t1"; gene_id "g1002"; 3 AUGUSTUS start_codon 3974080 3974082 . - 0 transcript_id "g1002.t1"; gene_id "g1002"; # protein sequence = [MQNDTSIPALKRKRIDSGNLLEPDGFAISKPPSKPGKAAPPTFRSAFDTSKKHRATDNHDPRKAESSSNSRSTATRPL # VSVPDFTLDPQLALIQVAEGSRRIASTPKKPTSKVVASSGTKLSTKFHSPSLRIAPVSKEVQPVFHENQTIPTSSSSNTKACPRSENSATPPPPPISV # STPSKPLRTIATTRMARAIDLSTENGAAELASIVLQTSSDSETVDTTDFKSGLELSPQKSNSFGRSPKFARYMSFIVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1002 ### # start gene g1003 3 AUGUSTUS gene 3976301 3977306 0.99 + . g1003 3 AUGUSTUS transcript 3976301 3977306 0.99 + . g1003.t1 3 AUGUSTUS start_codon 3976301 3976303 . + 0 transcript_id "g1003.t1"; gene_id "g1003"; 3 AUGUSTUS CDS 3976301 3976990 1 + 0 transcript_id "g1003.t1"; gene_id "g1003"; 3 AUGUSTUS CDS 3977058 3977306 0.99 + 0 transcript_id "g1003.t1"; gene_id "g1003"; 3 AUGUSTUS stop_codon 3977304 3977306 . + 0 transcript_id "g1003.t1"; gene_id "g1003"; # protein sequence = [MAGPEIKRKTNLQIEADEDLDDLDGQLSFISRFAELVYIFRFLDVLSEFTTASPARPTSTAVPISPLTSPPPPPPTAT # FAKARPRTNTRVDSAPISIPGTGALQKEVGITERSEDTDDADYIPEGPEDEAALSDAFTKELVKNMQDLMRELADEKTPKSNENEETEEGEAERLMKA # AWEAMLIEGMNGMTEPPPLPSTSKSTAASTSASGAGSDFQSKIKQTMEKLKESENSSSSTSTGKPESLQGLLNSLKDLGLDDLGADGDGVEDEAELAS # FLESMMGQLMSKDVLYEPVKELNEKAGICYLLLLIHIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1003 ### # start gene g1004 3 AUGUSTUS gene 3979690 3980088 0.55 + . g1004 3 AUGUSTUS transcript 3979690 3980088 0.55 + . g1004.t1 3 AUGUSTUS start_codon 3979690 3979692 . + 0 transcript_id "g1004.t1"; gene_id "g1004"; 3 AUGUSTUS CDS 3979690 3980088 0.55 + 0 transcript_id "g1004.t1"; gene_id "g1004"; 3 AUGUSTUS stop_codon 3980086 3980088 . + 0 transcript_id "g1004.t1"; gene_id "g1004"; # protein sequence = [MPSPPMLSFTPTVSISISSKIRFPDKSLFIVIGRELEFFSQAGFDMDKIYLKRNAPVAQLYEDAIRNEGAILSSSGAL # INFSGKKTGRSPKDKRIVYEDTSKDDIWWGSVNIKLDERMSCDPIGLSSLCANF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1004 ### # start gene g1005 3 AUGUSTUS gene 3981304 3981678 0.5 + . g1005 3 AUGUSTUS transcript 3981304 3981678 0.5 + . g1005.t1 3 AUGUSTUS start_codon 3981304 3981306 . + 0 transcript_id "g1005.t1"; gene_id "g1005"; 3 AUGUSTUS CDS 3981304 3981678 0.5 + 0 transcript_id "g1005.t1"; gene_id "g1005"; 3 AUGUSTUS stop_codon 3981676 3981678 . + 0 transcript_id "g1005.t1"; gene_id "g1005"; # protein sequence = [MLAERMSKNNVDCWLINTGWTGGKYGVGKRCPLKYTRKIIDTIHDGSLAKTLADGKHENFGTFNLTIPTEIEGVPREL # LNPEVAWTDKDAYNREVKKLAGMFVKAFKLYETDVDRKVLKAGPAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1005 ### # start gene g1006 3 AUGUSTUS gene 3983678 3983986 0.92 + . g1006 3 AUGUSTUS transcript 3983678 3983986 0.92 + . g1006.t1 3 AUGUSTUS start_codon 3983678 3983680 . + 0 transcript_id "g1006.t1"; gene_id "g1006"; 3 AUGUSTUS CDS 3983678 3983986 0.92 + 0 transcript_id "g1006.t1"; gene_id "g1006"; 3 AUGUSTUS stop_codon 3983984 3983986 . + 0 transcript_id "g1006.t1"; gene_id "g1006"; # protein sequence = [MDSDSSDSSSDSSSESETEGSSTKSKRRSFRKRFKRGSKHEKVDKDATLKGDSPSDAGKPEQMEMRKVDSAPGAFGIS # KLEANMPADAVLTEHGAAEVSFKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1006 ### # start gene g1007 3 AUGUSTUS gene 3984403 3984813 1 + . g1007 3 AUGUSTUS transcript 3984403 3984813 1 + . g1007.t1 3 AUGUSTUS start_codon 3984403 3984405 . + 0 transcript_id "g1007.t1"; gene_id "g1007"; 3 AUGUSTUS CDS 3984403 3984813 1 + 0 transcript_id "g1007.t1"; gene_id "g1007"; 3 AUGUSTUS stop_codon 3984811 3984813 . + 0 transcript_id "g1007.t1"; gene_id "g1007"; # protein sequence = [MEPVKNGVTPVHADGILKGKSEGLAAPLTSEPAPPAAIEARLLDRKRRKASSTTQTGGEATPTSVGAPRPRQGPKSRF # KSGPLQKNSVVSAPQDSSSGIPIPEIREPVKEGPLSTAMETEEASVPGEQQDMDGETS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1007 ### # start gene g1008 3 AUGUSTUS gene 4010523 4010840 0.76 + . g1008 3 AUGUSTUS transcript 4010523 4010840 0.76 + . g1008.t1 3 AUGUSTUS start_codon 4010523 4010525 . + 0 transcript_id "g1008.t1"; gene_id "g1008"; 3 AUGUSTUS CDS 4010523 4010840 0.76 + 0 transcript_id "g1008.t1"; gene_id "g1008"; 3 AUGUSTUS stop_codon 4010838 4010840 . + 0 transcript_id "g1008.t1"; gene_id "g1008"; # protein sequence = [MSTQYEHILTSRPNPSVALITLNRPKALNALSTPLFLELNKALFEADADQAIGAIVLTGSEKAFAGESAGNSDHPYVH # TRELAGADIKEMKDKECKPMVASSLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1008 ### # start gene g1009 3 AUGUSTUS gene 4019095 4020102 0.97 + . g1009 3 AUGUSTUS transcript 4019095 4020102 0.97 + . g1009.t1 3 AUGUSTUS start_codon 4019095 4019097 . + 0 transcript_id "g1009.t1"; gene_id "g1009"; 3 AUGUSTUS CDS 4019095 4020102 0.97 + 0 transcript_id "g1009.t1"; gene_id "g1009"; 3 AUGUSTUS stop_codon 4020100 4020102 . + 0 transcript_id "g1009.t1"; gene_id "g1009"; # protein sequence = [MHHSVLDNSANKAGRGVRPPSLNLPGTPIASQFESPAVENDAPGAKVKGPQTEQTQEVVVKPSEETSWASMVATPQDL # MFKKGGDVPPNSAAAAAPSDPAAPTSVPTAPSGLVGPAAGMAAGLAAGMMNPFNMAMLNNIGFSTEAQILAVQLVMSGLVQPSGIQKPIQPKPHSRAA # NASNNWRSPASARYPGSALRSSGLRSSALRSALKAQTPKSAVSTNTLGSATTPKIEDIDPELLKDVPVWLKSLRLHKYTDCFTGMTWEDMIDLNEDQL # EKRGVVALGARRRMIKTFENVKRKMGIEFTPTIPVTAGVEPSSSLPNMGEVSVPRSAAPNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1009 ### # start gene g1010 3 AUGUSTUS gene 4025404 4026279 0.75 - . g1010 3 AUGUSTUS transcript 4025404 4026279 0.75 - . g1010.t1 3 AUGUSTUS stop_codon 4025404 4025406 . - 0 transcript_id "g1010.t1"; gene_id "g1010"; 3 AUGUSTUS CDS 4025404 4026279 0.75 - 0 transcript_id "g1010.t1"; gene_id "g1010"; 3 AUGUSTUS start_codon 4026277 4026279 . - 0 transcript_id "g1010.t1"; gene_id "g1010"; # protein sequence = [MSATELSAFDDMFTMIFDAVSEQKSSEMRSSGTQGKTSDPGGLNDLFGKLRKHSKRMRWTTEEEELLDRKKEAMDLCD # TDQELLEWAIREVFDESQKFEAASREALQKVTSSPNKTSAAENLPILQSPIYPHIIAHLMRTFRDKYHDPHLALSIFDHARNLSIPSYVFGCTTPAYN # ELIETKWTHFHDLKGVHDALQEMVINGVDVNDNTRKIVDGVRRQVGERNLWIEDDYFGEGELWDVLKSIESLVRKPEADSDRSKRWNDWKTSTKADKD # WAFNQWDTASDSTSKRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1010 ### # start gene g1011 3 AUGUSTUS gene 4043846 4044514 0.36 + . g1011 3 AUGUSTUS transcript 4043846 4044514 0.36 + . g1011.t1 3 AUGUSTUS start_codon 4043846 4043848 . + 0 transcript_id "g1011.t1"; gene_id "g1011"; 3 AUGUSTUS CDS 4043846 4043894 0.39 + 0 transcript_id "g1011.t1"; gene_id "g1011"; 3 AUGUSTUS CDS 4044000 4044514 0.63 + 2 transcript_id "g1011.t1"; gene_id "g1011"; 3 AUGUSTUS stop_codon 4044512 4044514 . + 0 transcript_id "g1011.t1"; gene_id "g1011"; # protein sequence = [MTQMAGSLQSQTLVSFHSESLASLQPLHALIFLFKWVSTSSDSMSGNYDPEFPGFFAHQVVNNACATLAVLNALGNIP # ALKSGSQLTQLLEFTNGMDPQTRGLVITSSDWLREAHNSLSPPSAISLDGLGLPKQTEDAYHFVVYLPFMEFLYELDGLKPHAVSHGSYNETGEGWLS # RARSVVSRFPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1011 ### # start gene g1012 3 AUGUSTUS gene 4046574 4046804 0.84 - . g1012 3 AUGUSTUS transcript 4046574 4046804 0.84 - . g1012.t1 3 AUGUSTUS stop_codon 4046574 4046576 . - 0 transcript_id "g1012.t1"; gene_id "g1012"; 3 AUGUSTUS CDS 4046574 4046804 0.84 - 0 transcript_id "g1012.t1"; gene_id "g1012"; 3 AUGUSTUS start_codon 4046802 4046804 . - 0 transcript_id "g1012.t1"; gene_id "g1012"; # protein sequence = [MLILPIFKVNFAPYFVAPEGLATVKTVANHVEHIANIAGKEHVGIGSDFDGIEIVPAGLEDVSKYPALVRDYPISV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1012 ### # start gene g1013 3 AUGUSTUS gene 4051210 4052669 0.62 + . g1013 3 AUGUSTUS transcript 4051210 4052669 0.62 + . g1013.t1 3 AUGUSTUS start_codon 4051210 4051212 . + 0 transcript_id "g1013.t1"; gene_id "g1013"; 3 AUGUSTUS CDS 4051210 4051710 0.71 + 0 transcript_id "g1013.t1"; gene_id "g1013"; 3 AUGUSTUS CDS 4052022 4052669 0.63 + 0 transcript_id "g1013.t1"; gene_id "g1013"; 3 AUGUSTUS stop_codon 4052667 4052669 . + 0 transcript_id "g1013.t1"; gene_id "g1013"; # protein sequence = [MERLEDLAVSQPERVKIIKKARVTKLIKDENGQVIGVEYTFNGKTETAYGPVILATGGYAADFTSDSLLKKHRPEYYN # LPTTNGDHCTGDGHKMAMTAGAKGIDMEKVQVHPTGLVDPNDPEAKVKFLAAEALRGVGGLLLDNTGARFVDELQHRDYVTGKMWENGKFFSGEWTYD # DTFHVSMMTPVLHYTMGGLEIDDASRVIDTNGKPIPGLFACGEVAGGVHGANRLGGSSLLGCVVFGRVAGDSAAAYTLQATSAAIAKAGGRLGAIAGQ # VSGAPSASSSSSSAPAPEAKGEQSSTGGKVYTMDEVAKHKDKKDVWVVVNGEVLDVTEVRLVILFDRFPANINVGSSFLTIPEVRKRSCFMLGEMLRK # SSTCYTIPRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1013 ### # start gene g1014 3 AUGUSTUS gene 4053021 4053742 0.75 + . g1014 3 AUGUSTUS transcript 4053021 4053742 0.75 + . g1014.t1 3 AUGUSTUS start_codon 4053021 4053023 . + 0 transcript_id "g1014.t1"; gene_id "g1014"; 3 AUGUSTUS CDS 4053021 4053044 0.75 + 0 transcript_id "g1014.t1"; gene_id "g1014"; 3 AUGUSTUS CDS 4053137 4053742 1 + 0 transcript_id "g1014.t1"; gene_id "g1014"; 3 AUGUSTUS stop_codon 4053740 4053742 . + 0 transcript_id "g1014.t1"; gene_id "g1014"; # protein sequence = [MFRSQAIRAKQIRTYTTEVPKSKSNNGLLIATVVAAVGAGGYWYYSNNPDEAARLEAKAKKDEEVAVQKAREAGAAGK # ARVDDAYKLGQLKIGEAKASADKTVGQAETRAKQAANDAQAKFDEYKSSASRSLSNAKDSTENLYNEARASVDQKYGDAKGSVEEKKEQAKAGWFSWL # GWGKSTAEDIKKAGAEKVSDAAGDVQAKASKRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1014 ### # start gene g1015 3 AUGUSTUS gene 4057333 4058143 0.36 + . g1015 3 AUGUSTUS transcript 4057333 4058143 0.36 + . g1015.t1 3 AUGUSTUS start_codon 4057333 4057335 . + 0 transcript_id "g1015.t1"; gene_id "g1015"; 3 AUGUSTUS CDS 4057333 4057505 0.46 + 0 transcript_id "g1015.t1"; gene_id "g1015"; 3 AUGUSTUS CDS 4057563 4057720 0.41 + 1 transcript_id "g1015.t1"; gene_id "g1015"; 3 AUGUSTUS CDS 4057830 4058143 0.7 + 2 transcript_id "g1015.t1"; gene_id "g1015"; 3 AUGUSTUS stop_codon 4058141 4058143 . + 0 transcript_id "g1015.t1"; gene_id "g1015"; # protein sequence = [MASEDQVPSSQKTLNNHTNPQVEPFVPLASTSEAQPSDDWGMDPSAADLNHSPPISSRRSSMLNDEAESFLSSVMPMT # KYVSSKIYLSFHEHDEFSGLLVWNMSCQNPSHDEIDEAQTMSMESLLLASDPSAGQISLTQGVIPLKVSMSYNDSKLVMKSRSFYRFEDLNAILAACS # PVKEWGWLCAAKEEEARKFRQIADLLSHKKWVMILLLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1015 ### # start gene g1016 3 AUGUSTUS gene 4058575 4059783 0.39 + . g1016 3 AUGUSTUS transcript 4058575 4059783 0.39 + . g1016.t1 3 AUGUSTUS start_codon 4058575 4058577 . + 0 transcript_id "g1016.t1"; gene_id "g1016"; 3 AUGUSTUS CDS 4058575 4058836 0.39 + 0 transcript_id "g1016.t1"; gene_id "g1016"; 3 AUGUSTUS CDS 4058909 4059783 0.99 + 2 transcript_id "g1016.t1"; gene_id "g1016"; 3 AUGUSTUS stop_codon 4059781 4059783 . + 0 transcript_id "g1016.t1"; gene_id "g1016"; # protein sequence = [MAPVDSEVFGLSPVSEIEREMLSTLLNEYPATVNQGTVGTEWDSSLRVIFAHVNSLVPSSGWRDIRDIPGLSEYRMMN # DVRFFVYGSMSIATINAEGLGGLVTFTPNALLSDPLGVHERILQIEEHDFWACYILPAVIGMAVSIAYRDREHVIQKRIACKANKHVPHCTGSQSIDV # DIDIGIDEPISCTCDGLGYEWLLDAIDEELISIVGAPPLQTHLGGQGAVTRRGASRDNRLRNTEDWNLLSENHSTSSSFLTYLDTPSSSLPLSFIAQD # QLGCPPSSIPVQYDDSFVPWIFQLFDSDVRDHSETLAFCIREFIQLCGNLPQEEWEDAIKREIMEDLGRLQISRGFREELRRFVIVTGSEDKGLQTDQ # SGVSTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1016 ### # start gene g1017 3 AUGUSTUS gene 4061914 4062812 0.57 + . g1017 3 AUGUSTUS transcript 4061914 4062812 0.57 + . g1017.t1 3 AUGUSTUS start_codon 4061914 4061916 . + 0 transcript_id "g1017.t1"; gene_id "g1017"; 3 AUGUSTUS CDS 4061914 4061932 0.57 + 0 transcript_id "g1017.t1"; gene_id "g1017"; 3 AUGUSTUS CDS 4062436 4062812 0.96 + 2 transcript_id "g1017.t1"; gene_id "g1017"; 3 AUGUSTUS stop_codon 4062810 4062812 . + 0 transcript_id "g1017.t1"; gene_id "g1017"; # protein sequence = [MFVRDTSLAYYDTLLFAYADERAVLKAIQLAVILPHASALTLFFLLTNTMTHRSVTSEDEDPLTLAIAPPPNETPTQR # DQRLAEEKKAKEISDSIDEEINVQRLAEKKENPVKVLLLGMLSDVISYLSGLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1017 ### # start gene g1018 3 AUGUSTUS gene 4063075 4063563 0.99 + . g1018 3 AUGUSTUS transcript 4063075 4063563 0.99 + . g1018.t1 3 AUGUSTUS start_codon 4063075 4063077 . + 0 transcript_id "g1018.t1"; gene_id "g1018"; 3 AUGUSTUS CDS 4063075 4063563 0.99 + 0 transcript_id "g1018.t1"; gene_id "g1018"; 3 AUGUSTUS stop_codon 4063561 4063563 . + 0 transcript_id "g1018.t1"; gene_id "g1018"; # protein sequence = [MTRAQQASSPNSPLAPDSLDDISILDSENELPTLTAEHLKLKMRLSPLLQVEESLWRRLSPSSAFESETSHLASITNV # PHSTRPKEVYVQSSMAWKSTFSRLLSTSTRSSVDSDPGIDFDDPKDPGVILNNCAEDMIKLWHDPTIRNLLNVLRIRLEDTPGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1018 ### # start gene g1019 3 AUGUSTUS gene 4069651 4070679 0.59 + . g1019 3 AUGUSTUS transcript 4069651 4070679 0.59 + . g1019.t1 3 AUGUSTUS start_codon 4069651 4069653 . + 0 transcript_id "g1019.t1"; gene_id "g1019"; 3 AUGUSTUS CDS 4069651 4070679 0.59 + 0 transcript_id "g1019.t1"; gene_id "g1019"; 3 AUGUSTUS stop_codon 4070677 4070679 . + 0 transcript_id "g1019.t1"; gene_id "g1019"; # protein sequence = [MTPAVPSSPQMRAKSPFLSPAIPNSIPTLSAPVHHPSPLGDNAISNSSYFSAARDIPGFYVVIPAGGAGTRLWPLSRE # GHPKFLLDLTLKGRSLIQATWDRLLPLTSASRTTIVAGPSHVSSIREQLPDLLSENLFCEPTAKDSMAAIGLAAAILAHRDPDAVIGSFAADHMISGD # DAFLAAVAEAVEVARNDYLVTIGIAPSHPSTGFGYIRLGEPVNIKNAPNARLVSSFKEKPDARTAASYIATGKYRWNAGMFVMKATTLLKFLEEYKPE # MSEGLRKIGAVWDDEKERNIILEKIWPELEKIPIDNAVAEPAAEVGRVAVVPATFGKFYEMRIFPRLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1019 ### # start gene g1020 3 AUGUSTUS gene 4076563 4077636 0.53 - . g1020 3 AUGUSTUS transcript 4076563 4077636 0.53 - . g1020.t1 3 AUGUSTUS stop_codon 4076563 4076565 . - 0 transcript_id "g1020.t1"; gene_id "g1020"; 3 AUGUSTUS CDS 4076563 4077636 0.53 - 0 transcript_id "g1020.t1"; gene_id "g1020"; 3 AUGUSTUS start_codon 4077634 4077636 . - 0 transcript_id "g1020.t1"; gene_id "g1020"; # protein sequence = [MQSEFNIEISHRLQIKMFEGLLTATTHDTRQSYWAGLLRFNQFCDAESIPEGARMPASAILLGAFVAEFMGTCTGSCI # QNWLSGLRLWHLYNNAVWHGQEGWLPSLKKAAERKGAVFKRAQRGPIERHHLLTLHSHLDLSTPHGASTWAIATTAYWGCRRLGEIIPKSATKVTPEH # DIFRSTRVTRSVVGGRRTISFHLPWTKTTREKGGECFLTEIPGDPLCPVAAVENHLKVNHSPPPNTPFFAFREGPSWTIWVKSAFIGWFTSIFRLHNL # EEVFGHSFRIGGSLAYLLLGVPPEVIMKIGGWTSLCFLIYWRRLEKVIPLAVAQAMQSESRMRAFASSYNLPFTTEDLEFDLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1020 ### # start gene g1021 3 AUGUSTUS gene 4079307 4080167 0.39 - . g1021 3 AUGUSTUS transcript 4079307 4080167 0.39 - . g1021.t1 3 AUGUSTUS stop_codon 4079307 4079309 . - 0 transcript_id "g1021.t1"; gene_id "g1021"; 3 AUGUSTUS CDS 4079307 4080167 0.39 - 0 transcript_id "g1021.t1"; gene_id "g1021"; 3 AUGUSTUS start_codon 4080165 4080167 . - 0 transcript_id "g1021.t1"; gene_id "g1021"; # protein sequence = [MANSGLSSLRAAQKNQNVSVLPTTSPMAVSTSMRMGGSIPVVSVDENMLLSPVAPDVSALSTVSSARDSAISDPRFLL # YKDFSSTILHCTPFSDATPLEIEIYNRIITPYNAEAFAKLLAECGLSEKYPLLVNNLISGFPIGDMPPLTETVIIPNHPSIIEHLESVYDYINTELEA # KRMSGPFTQAEAEHILGGPFYCSPFVVVKQDQGPDLPPKVRICRHLSKDARNMGSVNSFVDKEDFPTRFDMPSRVADAVSLSFIFNPYHPLYPISHII # HHNINIPISIWL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1021 ### # start gene g1022 3 AUGUSTUS gene 4083204 4085532 0.33 - . g1022 3 AUGUSTUS transcript 4083204 4085532 0.33 - . g1022.t1 3 AUGUSTUS stop_codon 4083204 4083206 . - 0 transcript_id "g1022.t1"; gene_id "g1022"; 3 AUGUSTUS CDS 4083204 4084946 0.99 - 0 transcript_id "g1022.t1"; gene_id "g1022"; 3 AUGUSTUS CDS 4085019 4085047 0.36 - 2 transcript_id "g1022.t1"; gene_id "g1022"; 3 AUGUSTUS CDS 4085100 4085532 0.43 - 0 transcript_id "g1022.t1"; gene_id "g1022"; 3 AUGUSTUS start_codon 4085530 4085532 . - 0 transcript_id "g1022.t1"; gene_id "g1022"; # protein sequence = [MFPTSAPPGLDVSSNSILGCQITLSPDRMVLGHRRNPSTGSLYSDDSDDTDDTIDISDLDDDVGVGLIGFPLQRMAQY # STLPSGNSRREDEENESEYEDDDELTALYNACMAARLETNQNADDGRSDSSGTSSIGWDDVYVVNPYSLSERYTRDVQLHPSSYPALSAPITLHTLRL # SANPNPLETSPFEDRDDSLILLLLLALNTPELRSDPWNPVPRILRAVERVCGDVSSKEGAGSTVYLFHPPLVSLTQQSQLNLDKQENGTLAQWLDFFR # QVLEGLAFLHENGVVWGGFDAIEPRPCSTAAPSRPPGLDSGGVNEPEMFMMDISSDPGVFTSSPGTEWNFDRSRYPVKYYFTNFRRARQISPPVISTP # APSPSSPFTKDVQSCGKWLEAVVNDIHPVYESLLPLTQAMVSGTFTADGARKLFEARARSLSLSRDKSLWDDEVPSVRWEPMVQPGKEFGEKSYVKRS # KTIHVAQSRPGMGVSHTRVTEASSTTKPTTLSTMDPPPPAHISRSKSNPIPIPQENSRKDVFGDLSFVKSVDPGVTTPVSLLNTFFPDEPVALRSAKS # KESDSDIGSTTTTTKVNSPAPSRPLSFLNPNPHTHAKVPPSPVFTIPSLVTFPSWSPLPSLPELSSQQQPDQHYQHHQHQPPTSLLRRKTLALGTGLF # SRKALQYAPSLGGPGSSSSVAAVVDEESDVGLSSMSTLTPTLPTPLMKIGRSISMPVSGSGTWTNSQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1022 ### # start gene g1023 3 AUGUSTUS gene 4086166 4086917 0.94 - . g1023 3 AUGUSTUS transcript 4086166 4086917 0.94 - . g1023.t1 3 AUGUSTUS stop_codon 4086166 4086168 . - 0 transcript_id "g1023.t1"; gene_id "g1023"; 3 AUGUSTUS CDS 4086166 4086595 0.98 - 1 transcript_id "g1023.t1"; gene_id "g1023"; 3 AUGUSTUS CDS 4086681 4086841 0.94 - 0 transcript_id "g1023.t1"; gene_id "g1023"; 3 AUGUSTUS CDS 4086912 4086917 0.98 - 0 transcript_id "g1023.t1"; gene_id "g1023"; 3 AUGUSTUS start_codon 4086915 4086917 . - 0 transcript_id "g1023.t1"; gene_id "g1023"; # protein sequence = [MEVNNCKLAGCNQAKIWHAVELFNAQVGLKYLRGMHLNDSKTECGSKKDRHDNIGVGHLSIRTFAHILADPRVQDIPL # ILETPSHEESSKNWDVWAKEIEVLNLLSTSSIPNTNAASDALPSRHDTTNSIENAENPRGGTNGAHKLKLDSLAQSIKDAITTAETTGRRKKATNASA # SRGGKKSRRGKRKEEEEEGESE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1023 ### # start gene g1024 3 AUGUSTUS gene 4088811 4089671 0.64 + . g1024 3 AUGUSTUS transcript 4088811 4089671 0.64 + . g1024.t1 3 AUGUSTUS start_codon 4088811 4088813 . + 0 transcript_id "g1024.t1"; gene_id "g1024"; 3 AUGUSTUS CDS 4088811 4088846 0.65 + 0 transcript_id "g1024.t1"; gene_id "g1024"; 3 AUGUSTUS CDS 4089339 4089671 0.94 + 0 transcript_id "g1024.t1"; gene_id "g1024"; 3 AUGUSTUS stop_codon 4089669 4089671 . + 0 transcript_id "g1024.t1"; gene_id "g1024"; # protein sequence = [MTQFNFFKFIHFSIDANCDNLFIGEQLCIPGTTPPPPCAENYTVKAGDVCINIANQFNITVAQLEAANTEIDPLCDNL # QIGEVDQSRYSTNRDFANDSHLGSMHSLGLSIDVTWNFPECTPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1024 ### # start gene g1025 3 AUGUSTUS gene 4091097 4092437 1 - . g1025 3 AUGUSTUS transcript 4091097 4092437 1 - . g1025.t1 3 AUGUSTUS stop_codon 4091097 4091099 . - 0 transcript_id "g1025.t1"; gene_id "g1025"; 3 AUGUSTUS CDS 4091097 4092437 1 - 0 transcript_id "g1025.t1"; gene_id "g1025"; 3 AUGUSTUS start_codon 4092435 4092437 . - 0 transcript_id "g1025.t1"; gene_id "g1025"; # protein sequence = [MSAQKVSFTIRRPSPTSRAASSGPESDSGSSFKVPALPRHLTNDSSVPGSPLARSGTSSPYYDDSDSDQDDEVQDELV # TGFDKFGVQRCVFRQASCIQSSQLTKVLRQNHRRLHERKKPQGPLVIPALKNRDWREAARRRRTLNQYVPESARAQTVGSDGSVGGLGTRDSINSGPV # VSGLQYTKKEMDSEKREQDVVMVEVAGEDIPKAEEEEDSEDKAALRALLAGADGEDSGPRIDIIPTPISEKDAYKQDVEELPESASLADYERVPVSQF # GAAMLRGMGWKEGTAASRKGNGIVQPYIPESRPALLGIGAKEMEVFDDGSKKRGGNRRPEKRYIPVVKKDKDGNIVSEGEARRRDSERERRRDRSRSP # QRESRVSSRRSSSERRSYDDRRREYSRKDEDERNNRRDKFRDRDTDKESSRRERIDRDRDRHQDRSRDTERQRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1025 ### # start gene g1026 3 AUGUSTUS gene 4099256 4100092 0.63 + . g1026 3 AUGUSTUS transcript 4099256 4100092 0.63 + . g1026.t1 3 AUGUSTUS start_codon 4099256 4099258 . + 0 transcript_id "g1026.t1"; gene_id "g1026"; 3 AUGUSTUS CDS 4099256 4100092 0.63 + 0 transcript_id "g1026.t1"; gene_id "g1026"; 3 AUGUSTUS stop_codon 4100090 4100092 . + 0 transcript_id "g1026.t1"; gene_id "g1026"; # protein sequence = [MPLWLPKSYQDLNDLPSENIVYQPKLGGSKVVRTAPGVVIKYRGDLAEEVNCLNFARDHLSIRVPRVLHHPGDVRQST # LWDPRTEELPQVWYICMEEIQGVQLKEVIDSFTPLQLEHVASQIKAILADMHSVPAPHIGSVSGGPFQNSYFFPYAVKPQNAWTKVADFIDHYHQLLM # TFGTEEYAKELLANFPQDCPVNFTHGDLVPRNILVEGSTITGIVDWSMAGFYPEFWEYSRMYDDSEQSKGWSQVLSMIFPGPRLDNQIATFHRLMGTL # LYNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1026 ### # start gene g1027 3 AUGUSTUS gene 4110197 4113160 0.9 + . g1027 3 AUGUSTUS transcript 4110197 4113160 0.9 + . g1027.t1 3 AUGUSTUS start_codon 4110197 4110199 . + 0 transcript_id "g1027.t1"; gene_id "g1027"; 3 AUGUSTUS CDS 4110197 4113160 0.9 + 0 transcript_id "g1027.t1"; gene_id "g1027"; 3 AUGUSTUS stop_codon 4113158 4113160 . + 0 transcript_id "g1027.t1"; gene_id "g1027"; # protein sequence = [MLAEQYGWLECADVLNNWVKDKDRDLRERVQPDEGISMALSVAQAPSGSEDDIKPNTRKHIQVKRSIDTALNILKAGS # TSTPSSKLALSSTSSFTNNARTTSPISPTIARRDFSPSPSEDGRFSPSPSPINQESRRPSLPHIFQTPSSSSQRSQKPATLTKPRNSRRPRSAGTDAE # QDPDPDGSGTGFGRGSTGKKLGTKYSLLNLFKKGNESGGVPLERTASYQSSASIPSPSPNSSKFTAILSSSPQLNASPLNENGPLPAVGFRFGGSSSS # HTRTSPSTSSLFHQQTYTPPRPSVPLAADLHHGITAQHHRYSNRDRSGSSGSAARYEPPTGLGISFDEADGETAASFNKLSTRRFRPSDIEQHRDRSG # SNASNRNGTIFDDEIIISTGPNNGSSGNISTTESIIGGTSKNNSRPSILRGHNRTSSSSQPRALRFDSSTSGSGVVPRRESDAQPPRTVNIPLRGCIS # AGSLNRFQNERNGSPRLQPMALEKEKEQPWKARVPDSAPANIGDFDFTVTEENEYGHPIQPSIAARLGIQTRNRGSSFTSSESSLSPALSAGDEPTST # VALHADFPFSLDAPPPIDEVDGVAPPQVQLSPPPVDSRMRGDSVSSTSTADSGLNPSLSASATTSGSGRSGTIPTPMVSPEGGSYLNLSSADSRPRSN # NEKINVPEVSYDDYLEAGPAQGVAVIGINERRGNTALENIDVNIVSSHAQAEALVQRTQQDILSAHADGHSSSTDSMPLSARLAALGESLELERRLRE # KKQAEEVKAQVTAELLEDSTSSTARTEILRQCSLDQLSGSVSSSQQIRRPHANSEASRIATVNGRLCFLPMGKAKMMLNFLLLDIDSARIDRTKLTHH # PSLSASVVEASVSSPTFDSDVDSPSIQSKFFDRRANHSRTPDLENDLSRISSLEGFDVDTELGPSLFRVSTAPNSSFSTRDKRERELASNTKLTRMGF # SPSENARAPSKRFGGLKSLMQSLKGSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1027 ### # start gene g1028 3 AUGUSTUS gene 4114560 4116523 0.21 + . g1028 3 AUGUSTUS transcript 4114560 4116523 0.21 + . g1028.t1 3 AUGUSTUS start_codon 4114560 4114562 . + 0 transcript_id "g1028.t1"; gene_id "g1028"; 3 AUGUSTUS CDS 4114560 4115177 0.49 + 0 transcript_id "g1028.t1"; gene_id "g1028"; 3 AUGUSTUS CDS 4115466 4115657 0.77 + 0 transcript_id "g1028.t1"; gene_id "g1028"; 3 AUGUSTUS CDS 4115732 4116523 0.82 + 0 transcript_id "g1028.t1"; gene_id "g1028"; 3 AUGUSTUS stop_codon 4116521 4116523 . + 0 transcript_id "g1028.t1"; gene_id "g1028"; # protein sequence = [MSANSDSTATAAQSTMATSGMIIPNTSTMEEEYIEVPYGRDARESGSSTNDERDRSRDRGQTPGFSPGFTDDEPDSAS # NYASPLSPNSPAVGLSGLSARLKTDDEEDGPSTRSGDDFYDKPLSYGRNSANSDRSINAYSNRMGGRASVVEENEKMRRDYEFRIATMQTQISNLQRD # LGDSQQTQFKLSESEMRVRQLEEELASVLRADAEVVEQLRSDMQGLLVEVSDLSRRNDELMTAKDSDLVVIRDLDNQLKEYKRKYEQAKTELRSLFLQ # APKIDKLEDQLPVSADGGILDIHVTAFLSAVDGLLTAGRSNAPTRVLSPMKYVVNAVTNIIDDVRAYERRPSRADVDVDTLHMLRERADATLSNLVTA # SKTHATSSGMSPVSLLDAAASHVAATITDIGKLIYIRKATKAEQEQFASSTYSPGPSATNGFTPSLRSVNEKDHQRKGSSASSAFGSSSRYDNPSMYP # SGRSSDEHARRTPSDNSSSEKTNSPPPIFDHPPNTASTASDGDGTEDNWAEVKVNIPSIDRFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1028 ### # start gene g1029 3 AUGUSTUS gene 4119664 4119945 0.69 - . g1029 3 AUGUSTUS transcript 4119664 4119945 0.69 - . g1029.t1 3 AUGUSTUS stop_codon 4119664 4119666 . - 0 transcript_id "g1029.t1"; gene_id "g1029"; 3 AUGUSTUS CDS 4119664 4119945 0.69 - 0 transcript_id "g1029.t1"; gene_id "g1029"; 3 AUGUSTUS start_codon 4119943 4119945 . - 0 transcript_id "g1029.t1"; gene_id "g1029"; # protein sequence = [MGLTATDDCHQRVDKVEILEATNIETRIADATCVKITQNSFKAKALSNKLNSVSRNIEERSTSQQENKPGRMGVASGC # ILLVLRMVDQHAVDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1029 ### # start gene g1030 3 AUGUSTUS gene 4124142 4125092 0.68 - . g1030 3 AUGUSTUS transcript 4124142 4125092 0.68 - . g1030.t1 3 AUGUSTUS stop_codon 4124142 4124144 . - 0 transcript_id "g1030.t1"; gene_id "g1030"; 3 AUGUSTUS CDS 4124142 4125092 0.68 - 0 transcript_id "g1030.t1"; gene_id "g1030"; 3 AUGUSTUS start_codon 4125090 4125092 . - 0 transcript_id "g1030.t1"; gene_id "g1030"; # protein sequence = [MAFAKSVATEPLTSDDWEIIVCRSMISVEFRLICCPGNPCISRRIYSSLSSPRSESRPGDQCVGAGQDTRPTQDRHVY # RALFVPTLNLITVVVSLAPQAKNDALLLSTNTEVSISPKLHANRRVHAKEPTVNGTADAVVPKSIPQPFQILRVLPNHVLSKPLTAYSGSEVIGYVSS # STLAQLLPASRNVAKQHTCYKVSLKRLEPPINPVSTLQTPETVPETKVLNPSEKIHNVENSDNAERSYVCGRVELIGGHIVFPSLPAGIEHWDLIKFV # PRIVEYPLFQTQELLRIVADSSAGTLTISGDNNTETLTPHPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1030 ### # start gene g1031 3 AUGUSTUS gene 4126343 4128764 0.36 - . g1031 3 AUGUSTUS transcript 4126343 4128764 0.36 - . g1031.t1 3 AUGUSTUS stop_codon 4126343 4126345 . - 0 transcript_id "g1031.t1"; gene_id "g1031"; 3 AUGUSTUS CDS 4126343 4127259 0.36 - 2 transcript_id "g1031.t1"; gene_id "g1031"; 3 AUGUSTUS CDS 4127312 4128764 0.36 - 0 transcript_id "g1031.t1"; gene_id "g1031"; 3 AUGUSTUS start_codon 4128762 4128764 . - 0 transcript_id "g1031.t1"; gene_id "g1031"; # protein sequence = [MGQLKDYEADQAFQFFTRVSASPRFDSSGVSSFTSDASVVAPSRPQSPTWSIALHWEDRLQDAGEWDGHIHAMHPVSL # LTSSSVLPPSIIESRNANQDVSDRELDFRTEDCFPFELAESDEEEEEHAEQPSLSDPPSDPDPSTGANVEEEHEDTESDESDESEDPSSVHGENEMEL # NLPVYMPTPSSLAEALTPLDPSESPQNFTTGVFALPVPLPPKKPETPQDLPPFITRSPSFEEKTPFAPPPLSIPPPPLATIVPAQSRLYEADQLSETF # QQEILPDYQADKVRELSQNDDPPAFSSSASTAVLRAEIQRQADIRLRTPYSRLLNYASRKLGSIGHGTPIDPNRRRNLIAWLEDRKVVNNAHAISEKV # FVQHGPERLPPVGSSAWYAMRFPSTLSSQPVLKSTAVKPDAFITSTGPTASSPQALLAGTQQQQLEAQPSFETNWPPLTVQPGDLETFRNHNWMDAKA # YFVHEGVSSSDIMQNVDFQQGSSRGCGTDQAQYQYSPANHGATPNTNGNLNQGAAPNVAPSRFSPKIAMDENLSDEDAEGDIDPDVVQSVSEFTSSPS # NDPASSGGNLMTTGVHENRSYSPSTAGMDSFSGLPPDGHSNGGIGFDSSGPSSGFHNSRMGIYSCTVALNANDVVGHGMPNSETPLPGTVPNRSFADT # NPAGFPDSGIQGIGMNLNVGVSVGFGMGMGINRFDMMGVGVGLGMIGFPVVETDSWFLPASSPPSTSLPTSSANGEHHDHGVGGMGSFGNNSIYNDPL # PDHARERFGSPGSPENAYPLGFAMG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1031 ### # start gene g1032 3 AUGUSTUS gene 4128812 4130358 0.54 - . g1032 3 AUGUSTUS transcript 4128812 4130358 0.54 - . g1032.t1 3 AUGUSTUS stop_codon 4128812 4128814 . - 0 transcript_id "g1032.t1"; gene_id "g1032"; 3 AUGUSTUS CDS 4128812 4129789 0.97 - 0 transcript_id "g1032.t1"; gene_id "g1032"; 3 AUGUSTUS CDS 4129918 4130358 0.54 - 0 transcript_id "g1032.t1"; gene_id "g1032"; 3 AUGUSTUS start_codon 4130356 4130358 . - 0 transcript_id "g1032.t1"; gene_id "g1032"; # protein sequence = [MAAPDIDKSLRRSNRRPSTSTTLLAKDTEGGSLRRSARVGRLPSRYSHSATAGTTPSHFPLSASNKRKRTSSTSKERS # TGRASKRSHIIQADTPTANNSPPADRNNTSSASARSQRYQRRHPSVFNGGVSETENSHAIASTSYLPPLGSRGPTWDSVKRSADISPPVHTPRTPTLK # GKERDPSPSSVAYDNASPSSCPSFSMGKSNQVANDDLPEPMRSKLTSPLQKTAELPVFVSADDEATQSVMKSQSRSPLRRLRSLAQTTAKASLTKRKR # ASSTGVPTGKKKPKIVEIEGDILDEEESDASTPSEDVEAVTTVPSEPTIPIAATLPYPMSLPNPIPTLSVTPPTPPNSPPPVSTSDPIPYDHCSVPSI # EGPKKASQDIGWNWPTGTQPVVPVESSAWEDALSSAQSEASSSPDDAQRGRKAIRSPRARRPRQKPRQVARVTERPSETLFTLACRERVDYLWVTSCS # AC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1032 ### # start gene g1033 3 AUGUSTUS gene 4133859 4135193 0.53 + . g1033 3 AUGUSTUS transcript 4133859 4135193 0.53 + . g1033.t1 3 AUGUSTUS start_codon 4133859 4133861 . + 0 transcript_id "g1033.t1"; gene_id "g1033"; 3 AUGUSTUS CDS 4133859 4135193 0.53 + 0 transcript_id "g1033.t1"; gene_id "g1033"; 3 AUGUSTUS stop_codon 4135191 4135193 . + 0 transcript_id "g1033.t1"; gene_id "g1033"; # protein sequence = [MFQKSTHQFKTPQVKLKNFPKPGVTEVDAKIVCDASGFSRKLTSKFGNKELLDGWNCDAYWAYFKEKEGGKAENRLDH # WDYPATKHMCFPEGWGWFIKLISWHHAPLANLMDLVAYIINKAKSGVPAHAIPPTKILSEMFNCPFEFITSIGWAVRNDHEFPDNLEEYGDGEGERKF # NYFKVRYPTLNKLMNGVYELLPKYYGKQTYFVRKSMTYRSPVVAGEGWFAIGNSAGFTNPLISPGINAGIGTSVLAANMSKEILDQPPEHSRAVMKKC # AASYQTYSHEFMIPRLHLMNRYWYNSFRDHRLFEVMVPCFWTLGVDDIDSQYVNEFTEEDVYWVVGVGHDDFVDLSRKILDILEPSTNRMTVNEDKVE # QARALAKQCMDYRKERFPGNEWGKYLRRHDCKLQLVPEKHERMPGGRCFGIRCISCKVWRHNNMNACPVCGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1033 ### # start gene g1034 3 AUGUSTUS gene 4136994 4137520 0.55 + . g1034 3 AUGUSTUS transcript 4136994 4137520 0.55 + . g1034.t1 3 AUGUSTUS start_codon 4136994 4136996 . + 0 transcript_id "g1034.t1"; gene_id "g1034"; 3 AUGUSTUS CDS 4136994 4137172 0.55 + 0 transcript_id "g1034.t1"; gene_id "g1034"; 3 AUGUSTUS CDS 4137256 4137520 0.55 + 1 transcript_id "g1034.t1"; gene_id "g1034"; 3 AUGUSTUS stop_codon 4137518 4137520 . + 0 transcript_id "g1034.t1"; gene_id "g1034"; # protein sequence = [MTDQASKETADPDTQKSTPVCKIAVSHVSPSIPTQAEAHCSPLPPVDLGVGTVKVPVTDFNQHGASPIRAEFRMRRVT # NSSGYLRAGDDVHGFALAGTSDITTTASSAGGQAVFARREGKSSGGQKGLYEESSREHHVEGVENRTRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1034 ### # start gene g1035 3 AUGUSTUS gene 4139013 4140386 0.54 - . g1035 3 AUGUSTUS transcript 4139013 4140386 0.54 - . g1035.t1 3 AUGUSTUS stop_codon 4139013 4139015 . - 0 transcript_id "g1035.t1"; gene_id "g1035"; 3 AUGUSTUS CDS 4139013 4140386 0.54 - 0 transcript_id "g1035.t1"; gene_id "g1035"; 3 AUGUSTUS start_codon 4140384 4140386 . - 0 transcript_id "g1035.t1"; gene_id "g1035"; # protein sequence = [MYEIDLDNYIFHVDGEPLFDIRNMPRIDDFASYIGECYSKSISLYLQLGFLGTNSYGCRSFNVNTPEEHRYKLPPSLP # VAPEIHDIYEGLHPACTSTHEVLHVPPELRGIEEIRFKFMQVLIASSMRTLYNSIGLGINAVLSDKVSDNVVTRLRVIVDTLSGPLVFSNSIASVDQK # SLDTSPFQWVVKDVLCILAVPRLDEDLLVQAAIVHLMQHIENHFQIEVHAVGTMFHAAIMSLYHVSIVRLKVIEHDGTKAFELTHTNHLRFLPTEHPT # SSFTPGLEALSRLGQLVFEKHLRQDVLDRNYVCHKLASGSIIESLPAEICISIAQYLPRTALKPLTTISPTWAQVAFEFLLHPWIERSRSVERSVNYD # WYHVVSHDLSSTIAFETVHSSSFLATDQDGRKVALVLTSNLKSDRDDIHQTFGISPEDLADSVFNIGYVSDLWRRIYVLAFPLSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1035 ### # start gene g1036 3 AUGUSTUS gene 4141275 4141727 0.93 + . g1036 3 AUGUSTUS transcript 4141275 4141727 0.93 + . g1036.t1 3 AUGUSTUS start_codon 4141275 4141277 . + 0 transcript_id "g1036.t1"; gene_id "g1036"; 3 AUGUSTUS CDS 4141275 4141548 0.94 + 0 transcript_id "g1036.t1"; gene_id "g1036"; 3 AUGUSTUS CDS 4141600 4141727 0.99 + 2 transcript_id "g1036.t1"; gene_id "g1036"; 3 AUGUSTUS stop_codon 4141725 4141727 . + 0 transcript_id "g1036.t1"; gene_id "g1036"; # protein sequence = [MKTSHLSEVFGCFEGNVVCGDDPRSGMRSKPDPDIFLVAAKETLGRDVGPLKGEDEKGVEVTDAQRIERGKGLVLEDG # LPGMQAGKRAGMAVVWVPDANLLDVNYSGNEKADQILKSLEDFVPEEWGLPPYDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1036 ### # start gene g1037 3 AUGUSTUS gene 4143564 4143971 0.88 + . g1037 3 AUGUSTUS transcript 4143564 4143971 0.88 + . g1037.t1 3 AUGUSTUS start_codon 4143564 4143566 . + 0 transcript_id "g1037.t1"; gene_id "g1037"; 3 AUGUSTUS CDS 4143564 4143971 0.88 + 0 transcript_id "g1037.t1"; gene_id "g1037"; 3 AUGUSTUS stop_codon 4143969 4143971 . + 0 transcript_id "g1037.t1"; gene_id "g1037"; # protein sequence = [MEQVGLIEKIIAIVALLNFIFFFVFPDTGYYGVPALIMPKLYANSVLMVLNARIKIIGGRATYISTFDAGHGPRNAHN # GATEFNVHESSMHFRVITSSRTGENTEDTELSMNELIFAGAGGNEVPKILDGAGNIK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1037 ### # start gene g1038 3 AUGUSTUS gene 4145185 4145637 0.75 + . g1038 3 AUGUSTUS transcript 4145185 4145637 0.75 + . g1038.t1 3 AUGUSTUS start_codon 4145185 4145187 . + 0 transcript_id "g1038.t1"; gene_id "g1038"; 3 AUGUSTUS CDS 4145185 4145637 0.75 + 0 transcript_id "g1038.t1"; gene_id "g1038"; 3 AUGUSTUS stop_codon 4145635 4145637 . + 0 transcript_id "g1038.t1"; gene_id "g1038"; # protein sequence = [MATPASTAITGQIDRFVSDSFSKHLNLMRTESTSSSSSLDSPRSSSPFSDHDSSSSASNSELELDLLDPSTYVCFPSL # ASASSIVPVEHLAHILSHLFDLHAVDGVLGLVLADDKNFTTKEEMDGVKYSVSKSNSTTHKPVTEFEVRPLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1038 ### # start gene g1039 3 AUGUSTUS gene 4146223 4147413 0.24 + . g1039 3 AUGUSTUS transcript 4146223 4147413 0.24 + . g1039.t1 3 AUGUSTUS start_codon 4146223 4146225 . + 0 transcript_id "g1039.t1"; gene_id "g1039"; 3 AUGUSTUS CDS 4146223 4147413 0.24 + 0 transcript_id "g1039.t1"; gene_id "g1039"; 3 AUGUSTUS stop_codon 4147411 4147413 . + 0 transcript_id "g1039.t1"; gene_id "g1039"; # protein sequence = [MFRSAFFLDFIDLTIPSQNHSVVPESDSDWPSLSTIIQFRDGVRSRLENLYAELDSGERVLTRRIARMLVMCIEHEGW # HVETLLYMLIQRSPGALPSNLPTTLLPPGFALPPWDSLAAQWDTTWASFDILESDSDVKSKTILLGPATVVLGHNDSEGDDPHFEGGNTEEVINHEYG # WDNESPSRSLAVGKFKAELRPVSNGEFAQYWRRGKGKVPAPKSWIITDDETTGKSEIQVRTIYGPVPLRIAHTWPVLTAYDDLEAYANSKGGRMPTEG # ELRLFLDTFEVGYEGGGNSGFRNWHPVCPTAGSASPSSKGTNGGIWEWTSTPFQGHAGFVGTNLFTGYSEDFWDGKHHVVVSTAAVSYLFIDLIAFFS # TARSVLRHNSTPFLSEDCTQLLAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1039 ### # start gene g1040 3 AUGUSTUS gene 4150279 4151277 0.92 + . g1040 3 AUGUSTUS transcript 4150279 4151277 0.92 + . g1040.t1 3 AUGUSTUS start_codon 4150279 4150281 . + 0 transcript_id "g1040.t1"; gene_id "g1040"; 3 AUGUSTUS CDS 4150279 4151277 0.92 + 0 transcript_id "g1040.t1"; gene_id "g1040"; 3 AUGUSTUS stop_codon 4151275 4151277 . + 0 transcript_id "g1040.t1"; gene_id "g1040"; # protein sequence = [MILCRLAKRSREEDNGRPQANGTTSSRDHPKFVSSNSAEFFSDTLCPDANLNSLRVDTLCPLIRRKKILFAGPDTTFY # LHANLLQAFELHENRSHSCLGTEFCTFHQICRVPRSSNSAEPFFPPGGFKKYPSNRELDASQSGILKYILSNSLYVGSDMQDPRYTDPLAQVDQDTGV # RQKERYWLGQARKADVLVLNRGPLPAPAWTYDGTLQGNWSFVQKPLRIMRGREIERDGRVGESTLESRNLYGEGILDIALRVTVAKFLPEIVETLKAL # SKEAQQHRQVVLWHGSWIMESACAGKDARGLSTLDSKMDSWTLFYNAQGKMIVYHGRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1040 ### # start gene g1041 3 AUGUSTUS gene 4155373 4156656 0.48 - . g1041 3 AUGUSTUS transcript 4155373 4156656 0.48 - . g1041.t1 3 AUGUSTUS stop_codon 4155373 4155375 . - 0 transcript_id "g1041.t1"; gene_id "g1041"; 3 AUGUSTUS CDS 4155373 4155880 0.86 - 1 transcript_id "g1041.t1"; gene_id "g1041"; 3 AUGUSTUS CDS 4156188 4156352 0.71 - 1 transcript_id "g1041.t1"; gene_id "g1041"; 3 AUGUSTUS CDS 4156448 4156656 0.51 - 0 transcript_id "g1041.t1"; gene_id "g1041"; 3 AUGUSTUS start_codon 4156654 4156656 . - 0 transcript_id "g1041.t1"; gene_id "g1041"; # protein sequence = [MLLSAVFLALFAPSVWAQSSVIDAYVASESPIAKASMLANIGPSGSKSSGAFSGIVIASPSTENPDYLYTFTLGFDTT # LRGEIDNYVGAQAIVQQIPNPSGDITTGGLGEPKFYVNETAFTGPWGYDLWEEIYSSSFFSTAVQHRALRQGITLARAIGQTSLASSYGNQADFLLCF # LQSYWNPTGYMTANTGGGRSGIDANSVLASIHTFDAAAGCDAITFQPCSDVALLNLFTYVNAFRNTYEINSGISTNEAVLTGRYPEDVYMGGNVSRFL # LLQPVPNSLDMDSPGILPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1041 ### # start gene g1042 3 AUGUSTUS gene 4162912 4165161 0.84 + . g1042 3 AUGUSTUS transcript 4162912 4165161 0.84 + . g1042.t1 3 AUGUSTUS start_codon 4162912 4162914 . + 0 transcript_id "g1042.t1"; gene_id "g1042"; 3 AUGUSTUS CDS 4162912 4165161 0.84 + 0 transcript_id "g1042.t1"; gene_id "g1042"; 3 AUGUSTUS stop_codon 4165159 4165161 . + 0 transcript_id "g1042.t1"; gene_id "g1042"; # protein sequence = [MERLNSKPAPTLKTEADRILEASGDLCLIQPAGPSLALPKPFAYRYSSSQTSHSTSASNVLPIQNTHAPLNSQSAQAS # SSSVQEISSQNLSSELLSILEAAKNNPQVNREALLRVISFIDSATKTNTELTIADALRKLAPSQASVTLPQAPQTPPRTPPAPTAPTSPDDTIVILDK # ENVNPSAFRRRAERGAEEGKSLATLSIDIPPLPQQQVLLASGVNQYLRPTTTFTNEAIPSVPSTRKRTLSEALDDTHSFKRNQERNGTFSSPPRSNRT # IMSPGFSKDQPIVIPDSPSMPKPGGQRTQSRARLKMPYVVPDWARTQTALQPRLSEEALSMMKEMEQRKQEEKLAKRMKWSQQRKSGLMHRTMSTPAV # FSSGADEPVASGSGLSSFSKKGPIVGPSLHPVPDLLPPVIAAAGTSISFPSSPQRTPSPSPMQPAPPQTPPRRRFASSSSSPEEEEFSLFTPRRMATP # QKGPSVFESLTITQSPSIRPIHRREATPPPSSEPVAAEDDTASCQGDDSDDENFLTQELNSAMEETEISAILPVKRSDKEMTDSRDDVDAHIQDEDEE # DEEGSDKPFWPGLPPSSPPPQSSPMLQPTDDLEDDFELPTVSSDFDIEDFPPKTEQIIDSENVENTFSDVDHEVNHFDDTALAAILEMLTNSNNVNSG # SPFIADNSDDIFKDLGAVVDETGQSQHVDTAHRDSLLGFPSDITLDNPGFWSAVGPLLDQIPNTDTVIEGSDPIKNLLSGCVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1042 ### # start gene g1043 3 AUGUSTUS gene 4177154 4178818 0.56 - . g1043 3 AUGUSTUS transcript 4177154 4178818 0.56 - . g1043.t1 3 AUGUSTUS stop_codon 4177154 4177156 . - 0 transcript_id "g1043.t1"; gene_id "g1043"; 3 AUGUSTUS CDS 4177154 4178818 0.56 - 0 transcript_id "g1043.t1"; gene_id "g1043"; 3 AUGUSTUS start_codon 4178816 4178818 . - 0 transcript_id "g1043.t1"; gene_id "g1043"; # protein sequence = [MDVPSVPYAVCPSCSYTYPPTYPKNSRAPVYPTHCSERITQDSEPCGAELLFDSKPIKTYHYYSFYEWFGRFIAHPGI # EQYGDKFCDDISGVNEPPEVKRDFKDGTFVHSFKGHDGKLFIAERGEEGRWLFLLYADFFNAEGASLHGKTSSTGVTGLVCLNLPPSMRNNQAWVYIP # GIIQGRQEPDAKQSEHRHYWRQLVTELEAGYSRGLRPFHTHKTHQMGLSSNNRIFRVAIAGASMDFKAARPFGGFMDVTSHHTCFLCKCWHISHIGRT # DFENWRPADIEFLKRGAQEWINAKTVAQRKQVENFYGTRSSELWRLPYWNPIMQLLIEPMHTLFSILMQRFARRALGLDNPEPDSNGAVLDDSEQDNP # KRKKGKAKKKQIYISFYHDFTPPPHPSDLTPLGTKPEIGRISDTLQALVDDSEVQDQRLSLLEWNDLTPEQKTARLSRNKQFVSTIQSDPRAFQGVYD # LYQLLSSPAPAKDAEKLKFLKKLSSYRWIVLAFVCNNLVEFPAAKRESEDKKETEANDFLSQSSIHKGDITVKMFGQALAHWVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1043 ### # start gene g1044 3 AUGUSTUS gene 4179484 4179816 0.63 - . g1044 3 AUGUSTUS transcript 4179484 4179816 0.63 - . g1044.t1 3 AUGUSTUS stop_codon 4179484 4179486 . - 0 transcript_id "g1044.t1"; gene_id "g1044"; 3 AUGUSTUS CDS 4179484 4179816 0.63 - 0 transcript_id "g1044.t1"; gene_id "g1044"; 3 AUGUSTUS start_codon 4179814 4179816 . - 0 transcript_id "g1044.t1"; gene_id "g1044"; # protein sequence = [MPRNKGYAQFLSSKFVEGRGVSAPEDLPTINEAALVTPAQSSSNPVSRMLKKEGRKQRTSTAPANRDDLRSSDHSLST # FFDEDAMVDELTVISAPEFGSCLGLIDTTGCA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1044 ### # start gene g1045 3 AUGUSTUS gene 4179951 4180376 0.5 - . g1045 3 AUGUSTUS transcript 4179951 4180376 0.5 - . g1045.t1 3 AUGUSTUS stop_codon 4179951 4179953 . - 0 transcript_id "g1045.t1"; gene_id "g1045"; 3 AUGUSTUS CDS 4179951 4180376 0.5 - 0 transcript_id "g1045.t1"; gene_id "g1045"; 3 AUGUSTUS start_codon 4180374 4180376 . - 0 transcript_id "g1045.t1"; gene_id "g1045"; # protein sequence = [MIDFAREHNNQQLENFWTYVLVVVKTFGERGMSDEEDGVEDVLIDGVPTQQDIKKVKKLWFRHETFEALFQQVDETPK # VETRIFTQQGPVSMKRVRSNIIDNRKPPPGYPKGIFRPEYLDSLLEYELENLEFAEGEFEILT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1045 ### # start gene g1046 3 AUGUSTUS gene 4183522 4184403 0.28 - . g1046 3 AUGUSTUS transcript 4183522 4184403 0.28 - . g1046.t1 3 AUGUSTUS stop_codon 4183522 4183524 . - 0 transcript_id "g1046.t1"; gene_id "g1046"; 3 AUGUSTUS CDS 4183522 4183844 0.36 - 2 transcript_id "g1046.t1"; gene_id "g1046"; 3 AUGUSTUS CDS 4184145 4184403 0.4 - 0 transcript_id "g1046.t1"; gene_id "g1046"; 3 AUGUSTUS start_codon 4184401 4184403 . - 0 transcript_id "g1046.t1"; gene_id "g1046"; # protein sequence = [MNPEVENSISPSSLEPEDVGAMQQLDRERSSETIRQGESSQAKNDKLEKEKAAVEQEVLKLQLENKELQSSLRVIEAT # NSKKLQVCYDKDTQLRRSDQRLLEIDSALQGYRSLEQEWAISSGTLEEELTAAKQEVGRLKAENGDIQLTLEDMQTSASRVLQVSASRVTDTPSLHRS # VHSSGKIAGTTERTTIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1046 ### # start gene g1047 3 AUGUSTUS gene 4190267 4190794 0.99 + . g1047 3 AUGUSTUS transcript 4190267 4190794 0.99 + . g1047.t1 3 AUGUSTUS start_codon 4190267 4190269 . + 0 transcript_id "g1047.t1"; gene_id "g1047"; 3 AUGUSTUS CDS 4190267 4190794 0.99 + 0 transcript_id "g1047.t1"; gene_id "g1047"; 3 AUGUSTUS stop_codon 4190792 4190794 . + 0 transcript_id "g1047.t1"; gene_id "g1047"; # protein sequence = [MLWFPDAFAYVDVGLGAEFTDLLLAWIALERSSQWNTNPQVRLPTSNRPALLARWVDKKRYNTKGNEPLKEECGIDFS # ENVKQWWVSLQPEWRRTACQESSASSDSNSRQQQDWSRIDKFGINGWYGIIVCLKWWGENLQYREGGSAARQEWVDTLKDVCNMMKDLTRYRVAQVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1047 ### # start gene g1048 3 AUGUSTUS gene 4214406 4214954 0.88 + . g1048 3 AUGUSTUS transcript 4214406 4214954 0.88 + . g1048.t1 3 AUGUSTUS start_codon 4214406 4214408 . + 0 transcript_id "g1048.t1"; gene_id "g1048"; 3 AUGUSTUS CDS 4214406 4214954 0.88 + 0 transcript_id "g1048.t1"; gene_id "g1048"; 3 AUGUSTUS stop_codon 4214952 4214954 . + 0 transcript_id "g1048.t1"; gene_id "g1048"; # protein sequence = [MSVSISTPRGDTPSKRSTLDTVPTPSTSFSGRASPRDVSADIERLAEELRQYDQNRAEENRDLGDALRDLREELLGLS # DSHPIPSQEPPQTPSCPRYPRQPQYPRQPQYPQQPYPHYAEERVGSSRAMNADENRSLSLAPSSLNRTPSSTSSMSFLSSHHSDDWLLYPTPQPPGSL # VSRRSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1048 ### # start gene g1049 3 AUGUSTUS gene 4228653 4228931 0.85 - . g1049 3 AUGUSTUS transcript 4228653 4228931 0.85 - . g1049.t1 3 AUGUSTUS stop_codon 4228653 4228655 . - 0 transcript_id "g1049.t1"; gene_id "g1049"; 3 AUGUSTUS CDS 4228653 4228931 0.85 - 0 transcript_id "g1049.t1"; gene_id "g1049"; 3 AUGUSTUS start_codon 4228929 4228931 . - 0 transcript_id "g1049.t1"; gene_id "g1049"; # protein sequence = [MSIDQHRPFTIIEITNPVNGEDGVIRYPDPPLAALAIHVDVDNIQPDLSEFVTQFVDGDRISVAGDERNSTVQPLVND # NSTAVTSGVTEGVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1049 ### # start gene g1050 3 AUGUSTUS gene 4232120 4233373 0.68 + . g1050 3 AUGUSTUS transcript 4232120 4233373 0.68 + . g1050.t1 3 AUGUSTUS start_codon 4232120 4232122 . + 0 transcript_id "g1050.t1"; gene_id "g1050"; 3 AUGUSTUS CDS 4232120 4232547 0.68 + 0 transcript_id "g1050.t1"; gene_id "g1050"; 3 AUGUSTUS CDS 4232602 4233373 0.92 + 1 transcript_id "g1050.t1"; gene_id "g1050"; 3 AUGUSTUS stop_codon 4233371 4233373 . + 0 transcript_id "g1050.t1"; gene_id "g1050"; # protein sequence = [MLGIGAAQSKDPNGIAWKQSKDFESLLRRLNESNAASSDSGAQVIDGNTENIREEEGINGDDDLEKDGKKENREDRKK # RKKEEKEAKKERKEQKKRKRAESVGEEVEQPKPKKKAKSDTKVKEEPPKVEKAEEPKRIIPRHRAHRARAIAAKNISSKSAVHISEILGIASSSSSSF # ATPITAAPPSGTLTPLDQDVLGLVKLTTSTKSVSEYFKERLLVKTSGNSSPLSSTVTPESNARAVDESESEDAPRAGLGSSRNLTRDTGDLDDTPRGG # LGSSRTSTTFTSAASTFQSGMSKFESMFTSASVIAKEETIVQVDVKSVDNISRDTNTREDRKRRRKEAQKKEKESSNGVAEVVGEPGAVDVEDKARKM # AKDARRREKAEKKEKKKRHKGELAETI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1050 ### # start gene g1051 3 AUGUSTUS gene 4236536 4237090 0.42 + . g1051 3 AUGUSTUS transcript 4236536 4237090 0.42 + . g1051.t1 3 AUGUSTUS start_codon 4236536 4236538 . + 0 transcript_id "g1051.t1"; gene_id "g1051"; 3 AUGUSTUS CDS 4236536 4237090 0.42 + 0 transcript_id "g1051.t1"; gene_id "g1051"; 3 AUGUSTUS stop_codon 4237088 4237090 . + 0 transcript_id "g1051.t1"; gene_id "g1051"; # protein sequence = [MWQSILYPPIFAKVIDVSLIWMFNWHNRNITPSQKIAAYAHLYSFASTKSVVHWFQIMRNGAFLMYDDEVMSPVVRTS # VSSYRPARFPTKNIATPIVLLYGDRDSLVDIDAMMSQLPEHTEARRLHSYEHIDILWGKDVDRDVIPEVLDALKRYCEDKDKLSGIVNGVKRTGDGTE # TDGLSDSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1051 ### # start gene g1052 3 AUGUSTUS gene 4241259 4242494 0.94 - . g1052 3 AUGUSTUS transcript 4241259 4242494 0.94 - . g1052.t1 3 AUGUSTUS stop_codon 4241259 4241261 . - 0 transcript_id "g1052.t1"; gene_id "g1052"; 3 AUGUSTUS CDS 4241259 4242494 0.94 - 0 transcript_id "g1052.t1"; gene_id "g1052"; 3 AUGUSTUS start_codon 4242492 4242494 . - 0 transcript_id "g1052.t1"; gene_id "g1052"; # protein sequence = [MSRPSSTMKFLQLSPRQQKNLNNTLTHSSLRHPFSDPRPNLQRSSTLRRHQTGGRWVSEDMSVASSHRTDGEADEDYE # DVPNPQGRRQTLRTGGSADSALTVGVGRSLVGEGLKAAGLKGGGAVGRRGDIFDENTPLREKVIRDRERAQRLERIERSISRTGIRSQSRLGWEHEND # EDEGHFSNIRSRGNGSDIRTLAGTVVGPRASTSMAIRDREREGVGGEPEPRTAPPHLRSYKSSYDLVLSQEALSRHEIDLGRETAQDREDRAPSSLSR # HVPSPFGSTRRSIPNLLSNDGEASYLNIPRSNHNRLLHDSLHMFETHVTRVPSTSSATTSDLLRNAQNIASAAEKLNLMTRVAMTKALDAQINAEVDG # GTSDEAADISLTVKFSEVPTERVIVDTLPSSYNVHPVYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1052 ### # start gene g1053 3 AUGUSTUS gene 4256384 4256614 0.78 + . g1053 3 AUGUSTUS transcript 4256384 4256614 0.78 + . g1053.t1 3 AUGUSTUS start_codon 4256384 4256386 . + 0 transcript_id "g1053.t1"; gene_id "g1053"; 3 AUGUSTUS CDS 4256384 4256614 0.78 + 0 transcript_id "g1053.t1"; gene_id "g1053"; 3 AUGUSTUS stop_codon 4256612 4256614 . + 0 transcript_id "g1053.t1"; gene_id "g1053"; # protein sequence = [MSDPSSSHPSSPNSSTSRKRQNEFPLEPDEDPSKVRVIQLASPEQKEIEDVGNNPSRSNPFHSNMTLPRQEQHAKY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1053 ### # start gene g1054 3 AUGUSTUS gene 4258301 4258669 0.33 + . g1054 3 AUGUSTUS transcript 4258301 4258669 0.33 + . g1054.t1 3 AUGUSTUS start_codon 4258301 4258303 . + 0 transcript_id "g1054.t1"; gene_id "g1054"; 3 AUGUSTUS CDS 4258301 4258669 0.33 + 0 transcript_id "g1054.t1"; gene_id "g1054"; 3 AUGUSTUS stop_codon 4258667 4258669 . + 0 transcript_id "g1054.t1"; gene_id "g1054"; # protein sequence = [MRNSSIGKNARTTETTDHDGDAAMEADDEDETCLPSGSSNVHSGSTAPFASGKTSTSASASSTASSNIDFAAIVSETL # RQLNQVPSAKGKKTAKEGSQAYARQMKKNGLSALPKQVEKEWRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1054 ### # start gene g1055 3 AUGUSTUS gene 4260048 4261520 0.58 - . g1055 3 AUGUSTUS transcript 4260048 4261520 0.58 - . g1055.t1 3 AUGUSTUS stop_codon 4260048 4260050 . - 0 transcript_id "g1055.t1"; gene_id "g1055"; 3 AUGUSTUS CDS 4260048 4261128 0.99 - 1 transcript_id "g1055.t1"; gene_id "g1055"; 3 AUGUSTUS CDS 4261348 4261520 0.87 - 0 transcript_id "g1055.t1"; gene_id "g1055"; 3 AUGUSTUS start_codon 4261518 4261520 . - 0 transcript_id "g1055.t1"; gene_id "g1055"; # protein sequence = [MYPSKPTDPPAVPTSSATDVPPTVPTVIQRLDKANEETWLLVGHVAEQMGNSDHALFALRIHNDNPFIDPSDAQSWYL # LGRAYLDIHNYTKASENFREAIQRDDGNPIFWCAIGALYSHIDQIHSALDAYSRALHINPYISEAWLGLGGLYEECGNQTSDAIAAYTRASSLDPGNE # MISNRLQMLTAAQTTVGPLPVAPGPHIRAAQDEHPSYSQGVATPAPPVLPFVWMSPLISSATMPQLPSGIVDEDNDRGRPQGPSESHSQGVTTPAPPV # LPFVWMSPLISSATMPQLPSGIVDEDNDRGRPQGPSESHSHLPTAHLPTSHPPASHPPTSHPPTSHPPTISSGSDIDSSDCVLSKRKAYSTLPEESNR # TERSRKSTYLFRKDTQRRVRRTSISIQPSPSPFSTTSDYSYHWQC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1055 ### # start gene g1056 3 AUGUSTUS gene 4276943 4278071 0.28 + . g1056 3 AUGUSTUS transcript 4276943 4278071 0.28 + . g1056.t1 3 AUGUSTUS start_codon 4276943 4276945 . + 0 transcript_id "g1056.t1"; gene_id "g1056"; 3 AUGUSTUS CDS 4276943 4277243 0.29 + 0 transcript_id "g1056.t1"; gene_id "g1056"; 3 AUGUSTUS CDS 4277320 4278071 0.99 + 2 transcript_id "g1056.t1"; gene_id "g1056"; 3 AUGUSTUS stop_codon 4278069 4278071 . + 0 transcript_id "g1056.t1"; gene_id "g1056"; # protein sequence = [MRRYGKLVVVKALRADISSVNYPDLVVARLLQQRQPSNSLRTIDDHFVVDGPNGSHEFLVSALAGPSVRAMLDFPERR # RLRADLARKVAAQAACALELIHYFTTSNLLFQLSDHATEWSDREVYEHFGVPVTDTVRTCNGEPVGPHAPSQLIEAIDHSMFMETHLLQEDIMAIDFG # QAYAILDPPKDYRPNAMLSYMSPEAFFELRAGPEADVWALGCAIFEIRAGFPLFDYFFPCSTEILTHIVTTLGRLPNPWWDAFKNQAQFDEDGSPKKD # TNLVVSSIRDQLCSLGTSDEILTSNERTIFEVTEMRMDRKEVDLLVDLLGKMMRYRPEDRIEIREVVNHGWFKFSW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1056 ### # start gene g1057 3 AUGUSTUS gene 4283906 4285471 0.36 + . g1057 3 AUGUSTUS transcript 4283906 4285471 0.36 + . g1057.t1 3 AUGUSTUS start_codon 4283906 4283908 . + 0 transcript_id "g1057.t1"; gene_id "g1057"; 3 AUGUSTUS CDS 4283906 4285471 0.36 + 0 transcript_id "g1057.t1"; gene_id "g1057"; 3 AUGUSTUS stop_codon 4285469 4285471 . + 0 transcript_id "g1057.t1"; gene_id "g1057"; # protein sequence = [MHRLPQQNQFQWMQVCFTFIFVVLLSETRQDHLYNTDIVGLDDLNQVLVILIVVCNTVLGLSTMQCNFLVAVAGILIK # TAMAMNSSSEGSSAFSPFQNGIISDMPTSLSDALRKFDVDGIFIPYATCPSCNATTKGIPIEDGVYHWPDTCANSIVGQEGARTCGEPLLFHRKDGTP # QPIKPYLVGSLPDYIARCLLDPTYLEQSVKGIDAALHDIQSGIGPKQTSVHDVFEAEFIKDFKGPDGKLFVNRGNKVRLAFSIHLDFFNPNGITYRGA # HNSIGVISCANLALDSSIRYLPENMFLAGIIPGPSEPKGDQMDHFVRPVIEQFVQAWSPGFKVSRTASSEVPVVVEAGILLSVNDLPAARKVAGLQGI # RSSFICSICQLRGTDQVFNTDCDHWKLRDVQELRHWANAYKNASNLAEQMKIWDDHGVRWSSLWLLDYWNPTRMLVIDSMHCLLEGLIQYHCRHVLRV # DASSTKSVLMVSDMLLTGRGFLMMMIWFQMSAPSCLQNIFLALQISITRYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1057 ### # start gene g1058 3 AUGUSTUS gene 4305468 4306766 0.84 - . g1058 3 AUGUSTUS transcript 4305468 4306766 0.84 - . g1058.t1 3 AUGUSTUS stop_codon 4305468 4305470 . - 0 transcript_id "g1058.t1"; gene_id "g1058"; 3 AUGUSTUS CDS 4305468 4306766 0.84 - 0 transcript_id "g1058.t1"; gene_id "g1058"; 3 AUGUSTUS start_codon 4306764 4306766 . - 0 transcript_id "g1058.t1"; gene_id "g1058"; # protein sequence = [MSTSGILYNELEFATSLGFASIGANNGHNGTSGYAFLNNTDALADYTYRSLHTGVVAGKELTKKFYGFPFHKSYFLGC # SSGGRQGLKEAQDFPEDFDGIVAGAPALALPNIMSWGGALYKATGDPESESFLSPELWAVVYDEVLRQCDALDGASDGLLEDPSTCQFTPETLICSKG # QTSRCLTGLQAQTVRSIYSPLYGSDGQLLYPRMQPGINTKKQVPFYFQGIPWDLTEVISRTSYLSPLTCFVQDWFRYVVYNDTTWDGRNFSLADAMNA # ASQNPFNIQTWEGDLSAFAENGGKILTYHGLQDFVCSSEISQLYYAHVSRTMSLPPHELDSFYRLFYVSGMDHCRDGDGASAIGQDIGSSAGRDPNEN # ALMAMVRWVEEGIPPDVLRGAKLSADGSQVEYWRAHCKWPKKNRYTGNGIVTDEKAWQCM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1058 ### # start gene g1059 3 AUGUSTUS gene 4310041 4311642 0.43 - . g1059 3 AUGUSTUS transcript 4310041 4311642 0.43 - . g1059.t1 3 AUGUSTUS stop_codon 4310041 4310043 . - 0 transcript_id "g1059.t1"; gene_id "g1059"; 3 AUGUSTUS CDS 4310041 4310289 1 - 0 transcript_id "g1059.t1"; gene_id "g1059"; 3 AUGUSTUS CDS 4310367 4310682 0.95 - 1 transcript_id "g1059.t1"; gene_id "g1059"; 3 AUGUSTUS CDS 4310775 4311045 0.64 - 2 transcript_id "g1059.t1"; gene_id "g1059"; 3 AUGUSTUS CDS 4311095 4311245 0.79 - 0 transcript_id "g1059.t1"; gene_id "g1059"; 3 AUGUSTUS CDS 4311298 4311642 0.8 - 0 transcript_id "g1059.t1"; gene_id "g1059"; 3 AUGUSTUS start_codon 4311640 4311642 . - 0 transcript_id "g1059.t1"; gene_id "g1059"; # protein sequence = [MVTRNYEQLGLKFKLFSAEVLFNKGLSQIYLGSVDAGLADMQEARKDKATDEHNVIDDAIADRGEGYTVFSIVGFLFV # LMLYITSLTTLQPVGVLYRPSEKKLKNAVSKNYMGKAVLIAAADSRDAFTGFTGSTNLKQGISPSGVFVETAPDLTRSATVPAPSLPKLDTEVGRAPA # LGRANTTLNVPSNARERITGSDSSPEPTASVTRSNTTISPIKPSVNATMGMGMGGPVRGLSVRKTPAGNTAPPPPPLKGPYGNDGPPPPLPLASAGAA # ANGPPDRIAAWARSNANPNNLPPIARSGSRSAPASNYAPSSFGGGSVRRRVTRRNTARTANSRIQSSYEEEEEGYASGDYDDGPFELLHYKDDVRGMA # LTPDTSFEDFMDKITSKFGKGFGGLGLKFKDEDGGKVTLQDESDYDLAIETARESSKGKPEGKLEIWCEDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1059 ### # start gene g1060 3 AUGUSTUS gene 4315284 4316132 0.87 - . g1060 3 AUGUSTUS transcript 4315284 4316132 0.87 - . g1060.t1 3 AUGUSTUS stop_codon 4315284 4315286 . - 0 transcript_id "g1060.t1"; gene_id "g1060"; 3 AUGUSTUS CDS 4315284 4316132 0.87 - 0 transcript_id "g1060.t1"; gene_id "g1060"; 3 AUGUSTUS start_codon 4316130 4316132 . - 0 transcript_id "g1060.t1"; gene_id "g1060"; # protein sequence = [MEVVKFQQAQLINSDLDMYYARTDTPALCRTSSLVEELGQIEYVFSDKTGTLTRNEMEFRMCSIAGTAYADVVDENRR # GDGEDGKGNEDVWRTFAEMKAMLEDNANANPFVDPSASGSLTSDADREKEVIREFLTLLAVCHTVIPEEKDGKLQYQASSPDEAALVAGAELLGYQFH # VRVLRQSTCYRRSYVCPKIRKPKSVFVNVLGVSQEFQILNVCEFNSTRKRMSTVIRMPDGTIKLFTKGADTVILERLSKNQPYTEKTLAHLEVTSTST # CTIYLMTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1060 ### # start gene g1061 3 AUGUSTUS gene 4316834 4317931 0.87 - . g1061 3 AUGUSTUS transcript 4316834 4317931 0.87 - . g1061.t1 3 AUGUSTUS stop_codon 4316834 4316836 . - 0 transcript_id "g1061.t1"; gene_id "g1061"; 3 AUGUSTUS CDS 4316834 4317100 0.92 - 0 transcript_id "g1061.t1"; gene_id "g1061"; 3 AUGUSTUS CDS 4317193 4317219 0.91 - 0 transcript_id "g1061.t1"; gene_id "g1061"; 3 AUGUSTUS CDS 4317380 4317931 0.93 - 0 transcript_id "g1061.t1"; gene_id "g1061"; 3 AUGUSTUS start_codon 4317929 4317931 . - 0 transcript_id "g1061.t1"; gene_id "g1061"; # protein sequence = [MSDDFLRLVSQANPASREYQPANNNNNGYPPSTSVSGPYANSSDPQLLDPFFDDDDDMPDSAFGRPMPMESQESGLPL # ARSAAPPAGVSKVMLGDGVPQGWNFDDDDLQTSNQRPFQGSHSFPGQASSALEKSSRKSKKRAWRWPWQREKVLEGERIIALNNRAANAEFISNYVST # SKYNMITFYTTIVPLAVKRHQSDSELNARKAKVLESQGTFEEKKWKDISVGDVVRLESNEFIPADMVLLSSSEPEGLCYIETSNLDGLDCTCFYKTPG # MLNSVLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1061 ### # start gene g1062 3 AUGUSTUS gene 4318818 4319801 0.79 + . g1062 3 AUGUSTUS transcript 4318818 4319801 0.79 + . g1062.t1 3 AUGUSTUS start_codon 4318818 4318820 . + 0 transcript_id "g1062.t1"; gene_id "g1062"; 3 AUGUSTUS CDS 4318818 4319801 0.79 + 0 transcript_id "g1062.t1"; gene_id "g1062"; 3 AUGUSTUS stop_codon 4319799 4319801 . + 0 transcript_id "g1062.t1"; gene_id "g1062"; # protein sequence = [MASKMYALSTITYSKRISIDKRYTCVNETCLPTAELPIVFYPTWTALQHHTRMAHPPTCTDSSCNGRVFASQKGLRAH # QKTHEQRDEEIQLNAVVAESDRDDEQPPKKRRRGGEHGRDWKCEVEGCEKDFKSVGIYNLLEKLLNFFLLQSKALNVHHKVTHLGRKDFVCSHESCGA # SFGYKHLLQRHVVRLHFKHSDNSSADKRDAYQDASSSSGSDVPTKPLMGIEDITGSAYSSRAQELLGTTQAIRCPYPHLQDISLVLCSRDDETATEQL # GGTESTLAGPNCAYVFRRAYDLRRHLRAIHKVEAEKESTDSWVSKMKLKKIGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1062 ### # start gene g1063 3 AUGUSTUS gene 4321092 4321940 0.37 + . g1063 3 AUGUSTUS transcript 4321092 4321940 0.37 + . g1063.t1 3 AUGUSTUS start_codon 4321092 4321094 . + 0 transcript_id "g1063.t1"; gene_id "g1063"; 3 AUGUSTUS CDS 4321092 4321940 0.37 + 0 transcript_id "g1063.t1"; gene_id "g1063"; 3 AUGUSTUS stop_codon 4321938 4321940 . + 0 transcript_id "g1063.t1"; gene_id "g1063"; # protein sequence = [MFWSGDFTDKPYLALLSFLYTQNIGLHDTQSSKDVCSPKLWLWINPGFMLTLKNPALSREKFEKIIQNQWAAPFLHPR # FKGIIEFKFWNTTEQLDGVSELRDVWRFAPTLFNSGGHHIPGMPKTWGLQDEGTTSVVEGHPNATSVPVSYSEPEKVAVVLSDMARFLLCHRFGGVYL # DADTLFLRDWEELWGWKGAFAYRWSWHDNYNTAALKMSKGSALGSFILRTAFKNDFDFHPMTITNYLKDAHMEDLLFRLPDAMFDSAWLNMEGYQRER # PPQPYFSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1063 ### # start gene g1064 3 AUGUSTUS gene 4327908 4332727 0.89 - . g1064 3 AUGUSTUS transcript 4327908 4332727 0.89 - . g1064.t1 3 AUGUSTUS stop_codon 4327908 4327910 . - 0 transcript_id "g1064.t1"; gene_id "g1064"; 3 AUGUSTUS CDS 4327908 4330334 1 - 0 transcript_id "g1064.t1"; gene_id "g1064"; 3 AUGUSTUS CDS 4330382 4332727 0.89 - 0 transcript_id "g1064.t1"; gene_id "g1064"; 3 AUGUSTUS start_codon 4332725 4332727 . - 0 transcript_id "g1064.t1"; gene_id "g1064"; # protein sequence = [MRDNPKRIDNPLIYHLDVAAMYPNIMLSNRLQPDSMVDESICAVCDYNRPGKTCDRRLEWAWRGEFFPSHRDEYNMIR # HALNQEIFPSKRPNGPQRRYADLSPAEQTALLHKRLGDYSRKVYKKTKDTKVENRESIVCQRENPFYVDTVRRFRDRRYEYKGLHKTWKKNLDTVINE # GRSLAEVDEAKKMIVLYDSLQLAHKCILNSFYGYVMRKGARWHSMEMAGITCLTGATIIQMARALVEQIGRPLELDTDGIWCMLPGVFPENFKFKLDN # GKSIGFSYPCTMLNHLVHAKFTNHQYHDLDLETGEYKIHSENSIFFELDGPYKAMILPSSKEEDKLLKKRYAVFNDDGSLAELKGFEVKRRGELQLIK # HFQSQIFEKFLLGSTTEECYKAVAQVADQWLDVLFSKAAALTDEELVELIAENRSMSKTLAEYGGQKSTSISTARRLAEFLGDQMVKDKGLACKFIIS # AKPIGAPVTDRAVPVAIFSAEESIKRVYLRKWLKDSSLIDFDLRSILDWNYYIERLGSVIQKLITIPAAMQKVSNPVPRIHHPDWLHRRVAGTIDKMK # QNKLTDFFRLATDVEAQEEESQLMDIEDWGGEGPSTQILLAPSEPHIVRQDIPEPGVAEEDKALPDPMISYSAWLKAMRPRWKRRRQGPDPRSVVVPS # MFSNVKVRADRRWDIVQIRPTGTLGRYMLWLSVDSELIPLPLRIARQFYVHLRTPKEEIFRTDFYSYEKVSRNLPRDLPCINLYKITVREDLYREISE # HFIDLTNDPNVDGVFELQVPLVVRALLKLGRICKSTDSSMTLNRAEAIGFDLHQLEAPSVSGNSKHKYLRSGKNQKYIFIYHACSANAPLHVFAVFFP # SGLVKLHIVDPATRRQAIPRLREGYTEIKKKRDEHFGSSSFVYPDTRDFTTTYHSTDITALKAISRELGVAEDQNYIIVLSSSKDNSYFEMNVPKLAR # FPVLSMAKAKSAHTLDVFPWQSHVVGKMLNRYLAMGGWLDRSMALSEYYDIPLGHIEGDQPLQLSDITFARRLVQQDMVLWWSSSELPDLGGMETDKR # PTDDLPKTEFTMPGAYSHVCLEIAVRNLAINSVVHSLVINELEGSGGSTAFDSVSRTLDEYAQGDGQKDISLGESNVPVQTFSILKAMVKAWLTDRLQ # GELEGVECPSVLTVDHFWRWISSSASNMYDPSLHRFVHGLMRKTFVQLLAEFKRLGSHVIYADFSKILLATSKPPGTAHAYATYINTAVTSHELFQHI # YLRNDCFYDYLLFMDQANWGGIVCENPLALEPPEELSIMMKLNIAEFLPQPAQKEITSIIQYFVVSLFKIRQKTNETARVPLRPLQNGDPPGATQHDF # QMKDEVENVRQFIAGKLTRRMLRTVGNIQEQYREAMMNEETAVEWQFPVLPGSHLHMSNPPLEFIKFACAIFQLAKEYHVEIGLVKRNALDLIGVKEF # ASEAIFRNPCEPLKLFNVPCKHCDALKDFDFCRDPELLPAQGETGPPKWVCFNCKGEYDRTLIEFSLIRVVWAMERNFAGQDLKCSKCKQIQGDYVSR # WCHCSGSYQLTIGKAEVKRKLKTVVNVAIVHNMNRLKVKIIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1064 ### # start gene g1065 3 AUGUSTUS gene 4333683 4334447 0.69 - . g1065 3 AUGUSTUS transcript 4333683 4334447 0.69 - . g1065.t1 3 AUGUSTUS stop_codon 4333683 4333685 . - 0 transcript_id "g1065.t1"; gene_id "g1065"; 3 AUGUSTUS CDS 4333683 4334447 0.69 - 0 transcript_id "g1065.t1"; gene_id "g1065"; 3 AUGUSTUS start_codon 4334445 4334447 . - 0 transcript_id "g1065.t1"; gene_id "g1065"; # protein sequence = [MENSVEEWLKKKYEGLICRIVRDRKEDLKLPNHLMGHRRLYLQLCFRNVSDLLNVRRELLPLALANGAKRDAVDAYAE # VVNATSTGLANMDIAFEEEGWGNAGFSRNATFREDAREAIIDIREYDVPYYLRVAIDNDIRVGLWYAVSFTAGQPDFRHIAERVKRADPVVMAYDIET # TKAPLKFPDQATDQVMMISYMVDGQGYLITNREIVSEDIEDFEYTPMEGYEGPFIIFNEPNEVRTHFYFLDHLCSWRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1065 ### # start gene g1066 3 AUGUSTUS gene 4335303 4335596 0.85 + . g1066 3 AUGUSTUS transcript 4335303 4335596 0.85 + . g1066.t1 3 AUGUSTUS start_codon 4335303 4335305 . + 0 transcript_id "g1066.t1"; gene_id "g1066"; 3 AUGUSTUS CDS 4335303 4335596 0.85 + 0 transcript_id "g1066.t1"; gene_id "g1066"; 3 AUGUSTUS stop_codon 4335594 4335596 . + 0 transcript_id "g1066.t1"; gene_id "g1066"; # protein sequence = [MGNSRSGSSFTATPMISDSSDDDVNEQDTHANGFDSASRLGSPSISSVHDSRAEVDDDSVTCLWDDCGLVFTDLQVFI # DHIHNGANCFIGCYDDAQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1066 ### # start gene g1067 3 AUGUSTUS gene 4339391 4340302 0.5 + . g1067 3 AUGUSTUS transcript 4339391 4340302 0.5 + . g1067.t1 3 AUGUSTUS start_codon 4339391 4339393 . + 0 transcript_id "g1067.t1"; gene_id "g1067"; 3 AUGUSTUS CDS 4339391 4339477 0.53 + 0 transcript_id "g1067.t1"; gene_id "g1067"; 3 AUGUSTUS CDS 4339619 4340302 0.55 + 0 transcript_id "g1067.t1"; gene_id "g1067"; 3 AUGUSTUS stop_codon 4340300 4340302 . + 0 transcript_id "g1067.t1"; gene_id "g1067"; # protein sequence = [MAERMDFDPAKIPAPDFASEAYAFMRAALRRQEEAEAERQEKERELTKEAEKKRLPIYDFQKGLGVDSIPLQLHPYAR # KMMMACKYVPLWYFLPDAAVEAKERSKESLDTNHLQFAVEDGDSLSGSTVSLVGSHSVRTSPNAIPDSQLSWPQVMRAKSAFLNALRLGTWPDHFIAM # FAGFYSNMDMHRELQEQDGDRVIAHYHAEMRLAWYDAMERKAPFDLSIISDRVLGESRQQIVKQKQKKSLKGKQSSPSRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1067 ### # start gene g1068 3 AUGUSTUS gene 4340548 4341561 0.99 + . g1068 3 AUGUSTUS transcript 4340548 4341561 0.99 + . g1068.t1 3 AUGUSTUS start_codon 4340548 4340550 . + 0 transcript_id "g1068.t1"; gene_id "g1068"; 3 AUGUSTUS CDS 4340548 4341561 0.99 + 0 transcript_id "g1068.t1"; gene_id "g1068"; 3 AUGUSTUS stop_codon 4341559 4341561 . + 0 transcript_id "g1068.t1"; gene_id "g1068"; # protein sequence = [MHQQTFRLPQHRWKQGSQPGYNNCLRRPQTLSRTHGNPPIERAKLPIPPHPPAKLADKLKTVNQTPLAFNVPFGTQTN # HRSHDVTDVSDGTNMTYTAAHKHQSGTENAMSPATGTSTDISKLLKEPTQVWNSVRTGRDQTDAPVVPTLKSIFAQDALTADTELAAALTENKFAVRT # PLQAKEWKLAITSLNLTHKYPTLAESIQHCFNVGIPRIKHTFSPPNKLNNPESIAAFHEIMRNEINTGRWLGPYSKETIEKTIGPFQTSPISMIPKSG # KPGKFRLLENLSYPYRPTLIPSIPAVISSINSHIDSTLYPCLWGTFATTCRLIWTLPPIHREQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1068 ### # start gene g1069 3 AUGUSTUS gene 4349976 4351429 0.5 + . g1069 3 AUGUSTUS transcript 4349976 4351429 0.5 + . g1069.t1 3 AUGUSTUS start_codon 4349976 4349978 . + 0 transcript_id "g1069.t1"; gene_id "g1069"; 3 AUGUSTUS CDS 4349976 4350143 0.68 + 0 transcript_id "g1069.t1"; gene_id "g1069"; 3 AUGUSTUS CDS 4350785 4350920 0.88 + 0 transcript_id "g1069.t1"; gene_id "g1069"; 3 AUGUSTUS CDS 4351002 4351429 1 + 2 transcript_id "g1069.t1"; gene_id "g1069"; 3 AUGUSTUS stop_codon 4351427 4351429 . + 0 transcript_id "g1069.t1"; gene_id "g1069"; # protein sequence = [MPIHQKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHELLNRRSTPYPTTGSNKGSNKEEKS # AVNDVPPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKS # RQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1069 ### # start gene g1070 3 AUGUSTUS gene 4351691 4354481 0.57 - . g1070 3 AUGUSTUS transcript 4351691 4354481 0.57 - . g1070.t1 3 AUGUSTUS stop_codon 4351691 4351693 . - 0 transcript_id "g1070.t1"; gene_id "g1070"; 3 AUGUSTUS CDS 4351691 4352105 0.63 - 1 transcript_id "g1070.t1"; gene_id "g1070"; 3 AUGUSTUS CDS 4352197 4354481 0.59 - 0 transcript_id "g1070.t1"; gene_id "g1070"; 3 AUGUSTUS start_codon 4354479 4354481 . - 0 transcript_id "g1070.t1"; gene_id "g1070"; # protein sequence = [MGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKY # AGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELK # DGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKG # MLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYL # YETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGRYLSNPSDESLGEMSKDE # RIKFIRLFKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAPPT # LMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISA # YNSQANGKIERAHLDIRQALIKATGGDISKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALHT # IKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVED # EDEYWMSPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1070 ### # start gene g1071 3 AUGUSTUS gene 4354537 4356844 0.5 - . g1071 3 AUGUSTUS transcript 4354537 4356844 0.5 - . g1071.t1 3 AUGUSTUS stop_codon 4354537 4354539 . - 0 transcript_id "g1071.t1"; gene_id "g1071"; 3 AUGUSTUS CDS 4354537 4355969 0.94 - 2 transcript_id "g1071.t1"; gene_id "g1071"; 3 AUGUSTUS CDS 4356044 4356307 0.62 - 2 transcript_id "g1071.t1"; gene_id "g1071"; 3 AUGUSTUS CDS 4356403 4356844 0.64 - 0 transcript_id "g1071.t1"; gene_id "g1071"; 3 AUGUSTUS start_codon 4356842 4356844 . - 0 transcript_id "g1071.t1"; gene_id "g1071"; # protein sequence = [MGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSV # AYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDATPFQVLLGRPFDVLVESEIKTFGNGDSEI # TISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEII # DCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPIRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSE # TIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPINKLEERIKLNQQDRSPINLIDET # NKQVDNEAIGVEKPIKLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFAPTGRYTEERKEIIDKNHPEGFLWEQERDL # MHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEP # LNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1071 ### # start gene g1072 3 AUGUSTUS gene 4484428 4487416 0.22 + . g1072 3 AUGUSTUS transcript 4484428 4487416 0.22 + . g1072.t1 3 AUGUSTUS start_codon 4484428 4484430 . + 0 transcript_id "g1072.t1"; gene_id "g1072"; 3 AUGUSTUS CDS 4484428 4484443 0.24 + 0 transcript_id "g1072.t1"; gene_id "g1072"; 3 AUGUSTUS CDS 4485447 4487416 0.62 + 2 transcript_id "g1072.t1"; gene_id "g1072"; 3 AUGUSTUS stop_codon 4487414 4487416 . + 0 transcript_id "g1072.t1"; gene_id "g1072"; # protein sequence = [MTNNRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQASNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRTVKSLQ # SHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPKSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLR # DNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1072 ### # start gene g1073 3 AUGUSTUS gene 4487446 4489763 0.83 + . g1073 3 AUGUSTUS transcript 4487446 4489763 0.83 + . g1073.t1 3 AUGUSTUS start_codon 4487446 4487448 . + 0 transcript_id "g1073.t1"; gene_id "g1073"; 3 AUGUSTUS CDS 4487446 4488877 0.84 + 0 transcript_id "g1073.t1"; gene_id "g1073"; 3 AUGUSTUS CDS 4488952 4489763 0.97 + 2 transcript_id "g1073.t1"; gene_id "g1073"; 3 AUGUSTUS stop_codon 4489761 4489763 . + 0 transcript_id "g1073.t1"; gene_id "g1073"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSVDRPLKKPSVTIE # DVDESDDKDTIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDSEKSTGEHDSK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDDQAEEIIDCYLNQKKIGDKQVFCVWRDGVLGEFDDQLNNEQFNLNPIKSFFLQNGRIKP # KPVRKKVQKRRFVEPILQNFSLGENCDKSESTETAQNQCNNANTSETIRDDNWNKPKNSQRTRKRIVRYEILKRGTESFQRSQPSFEKVRYESRQRKK # GKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEECLRSTNQLIKRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1073 ### # start gene g1074 3 AUGUSTUS gene 4489958 4490728 0.73 + . g1074 3 AUGUSTUS transcript 4489958 4490728 0.73 + . g1074.t1 3 AUGUSTUS start_codon 4489958 4489960 . + 0 transcript_id "g1074.t1"; gene_id "g1074"; 3 AUGUSTUS CDS 4489958 4490728 0.73 + 0 transcript_id "g1074.t1"; gene_id "g1074"; 3 AUGUSTUS stop_codon 4490726 4490728 . + 0 transcript_id "g1074.t1"; gene_id "g1074"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY # ILRDEIPHVTIPYIDDVPVKDHQLDMNYQKEVRNYSRNPGIRRFVWEHFQNMNRVIQRMKYAGEPSVEPKRFFVVRKQLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1074 ### # start gene g1075 3 AUGUSTUS gene 4490755 4491114 0.76 + . g1075 3 AUGUSTUS transcript 4490755 4491114 0.76 + . g1075.t1 3 AUGUSTUS start_codon 4490755 4490757 . + 0 transcript_id "g1075.t1"; gene_id "g1075"; 3 AUGUSTUS CDS 4490755 4491114 0.76 + 0 transcript_id "g1075.t1"; gene_id "g1075"; 3 AUGUSTUS stop_codon 4491112 4491114 . + 0 transcript_id "g1075.t1"; gene_id "g1075"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDRLKRRSFSITLDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1075 ### # start gene g1076 3 AUGUSTUS gene 4491255 4493221 0.48 + . g1076 3 AUGUSTUS transcript 4491255 4493221 0.48 + . g1076.t1 3 AUGUSTUS start_codon 4491255 4491257 . + 0 transcript_id "g1076.t1"; gene_id "g1076"; 3 AUGUSTUS CDS 4491255 4491795 0.51 + 0 transcript_id "g1076.t1"; gene_id "g1076"; 3 AUGUSTUS CDS 4491939 4493221 0.58 + 2 transcript_id "g1076.t1"; gene_id "g1076"; 3 AUGUSTUS stop_codon 4493219 4493221 . + 0 transcript_id "g1076.t1"; gene_id "g1076"; # protein sequence = [MLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPELNPEDYVDEDGGEPINFIMGDGET # EEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPL # IGSTLVEKEKRMHMLNSAHDCLGHKGVFAINDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYI # IHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGNIERTHLDIRQALIKATGGDV # SKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYR # HTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTREEPIELPNNIHELIDLTAEQLDLMV # EDEDEYWMTPENDYIFDAIPHLRLSDTNSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1076 ### # start gene g1077 3 AUGUSTUS gene 4493482 4494259 0.27 - . g1077 3 AUGUSTUS transcript 4493482 4494259 0.27 - . g1077.t1 3 AUGUSTUS stop_codon 4493482 4493484 . - 0 transcript_id "g1077.t1"; gene_id "g1077"; 3 AUGUSTUS CDS 4493482 4493909 1 - 2 transcript_id "g1077.t1"; gene_id "g1077"; 3 AUGUSTUS CDS 4493991 4494126 0.76 - 0 transcript_id "g1077.t1"; gene_id "g1077"; 3 AUGUSTUS CDS 4494233 4494259 0.27 - 0 transcript_id "g1077.t1"; gene_id "g1077"; 3 AUGUSTUS start_codon 4494257 4494259 . - 0 transcript_id "g1077.t1"; gene_id "g1077"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERA # TTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1077 ### # start gene g1078 3 AUGUSTUS gene 4498862 4501198 0.84 - . g1078 3 AUGUSTUS transcript 4498862 4501198 0.84 - . g1078.t1 3 AUGUSTUS stop_codon 4498862 4498864 . - 0 transcript_id "g1078.t1"; gene_id "g1078"; 3 AUGUSTUS CDS 4498862 4501198 0.84 - 0 transcript_id "g1078.t1"; gene_id "g1078"; 3 AUGUSTUS start_codon 4501196 4501198 . - 0 transcript_id "g1078.t1"; gene_id "g1078"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDGKE # LCLTFQDRNVRISAALASEIVQPGAEGGIEELGRGVNGDEIHAGTLQSPPEAPQQPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLVPSDKDLGPDDPILMGINEWLSFADESTEEEVEEILETGRSTMEKVTPNPAKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIKSLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASDSST # TEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDMFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKE # YIDEMLGKGFIQSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGS # FEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEASHVGHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEK # VKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVTSLPRFCVKEKGRNLMGTPTNQSNTQ # YASSLLSNLFNSKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1078 ### # start gene g1079 3 AUGUSTUS gene 4503544 4505712 0.87 - . g1079 3 AUGUSTUS transcript 4503544 4505712 0.87 - . g1079.t1 3 AUGUSTUS stop_codon 4503544 4503546 . - 0 transcript_id "g1079.t1"; gene_id "g1079"; 3 AUGUSTUS CDS 4503544 4505712 0.87 - 0 transcript_id "g1079.t1"; gene_id "g1079"; 3 AUGUSTUS start_codon 4505710 4505712 . - 0 transcript_id "g1079.t1"; gene_id "g1079"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQLEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAI # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEI # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMR # HMYQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKH # SSPRNIEVPELLNPGNTATRSPQLRSGTSPTVHALAQNSTPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSWISGQDLTARLAPNPVHVPPRLSN # PSVIPYQGSVSMQSQAVGMESQRGPNQRRTLAVHEEAVPPQGAPFGTPFVTGAQMN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1079 ### # start gene g1080 3 AUGUSTUS gene 4511627 4512154 0.69 - . g1080 3 AUGUSTUS transcript 4511627 4512154 0.69 - . g1080.t1 3 AUGUSTUS stop_codon 4511627 4511629 . - 0 transcript_id "g1080.t1"; gene_id "g1080"; 3 AUGUSTUS CDS 4511627 4512154 0.69 - 0 transcript_id "g1080.t1"; gene_id "g1080"; 3 AUGUSTUS start_codon 4512152 4512154 . - 0 transcript_id "g1080.t1"; gene_id "g1080"; # protein sequence = [MHGLLAEQQSVIDDTLAVIGTFRQEMDEVVHQVDAARIKACDPSRDLSSNFINHSSLENEMKTLLKDLQAVRPSDMPP # LVLLNQNDILAELKALKEKEKSLDDQEERFGSLIPIMLNSLLAYLCALGHVALTVLILILQHGPAWSRLGCYVCALSRELFSTLPTFSLGGNASAQC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1080 ### # start gene g1081 3 AUGUSTUS gene 4515836 4516927 0.55 + . g1081 3 AUGUSTUS transcript 4515836 4516927 0.55 + . g1081.t1 3 AUGUSTUS start_codon 4515836 4515838 . + 0 transcript_id "g1081.t1"; gene_id "g1081"; 3 AUGUSTUS CDS 4515836 4516927 0.55 + 0 transcript_id "g1081.t1"; gene_id "g1081"; 3 AUGUSTUS stop_codon 4516925 4516927 . + 0 transcript_id "g1081.t1"; gene_id "g1081"; # protein sequence = [MLRRFSIRKNAKSSNNVWFSRFRMVQTNNTLTVKLKYGSDEEEDNSETDSEEDESEDEDGEELTPAVDAAILRTLARI # KRKDPEIYNNKTGIFEGAHTYSSLTEITKKYLKRSRKSWVQPNLSPSGPRTRYVFYSGKFQAYSEPPQARPITMRQVAMEAQLQGDSRSPSPEPLTHS # EEQRRLRDETIAVFHQLGDDNSEGDDLFVPREKTKDEQEQEEEEYRSFLEREVGGDLKTLVSVEENTWKEETPPSIESKQKKKKNKKGKDVKKVEDDD # QEFLIKYVFRVFHHPRRLNLGIQVTSLTVGGLIVQRTVCQHTKRSLPPRKVRARLQRKRGAWRMQIPLISKKTYTQQLTLTLMRRNSKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1081 ### # start gene g1082 3 AUGUSTUS gene 4517365 4518188 0.89 + . g1082 3 AUGUSTUS transcript 4517365 4518188 0.89 + . g1082.t1 3 AUGUSTUS start_codon 4517365 4517367 . + 0 transcript_id "g1082.t1"; gene_id "g1082"; 3 AUGUSTUS CDS 4517365 4517661 0.89 + 0 transcript_id "g1082.t1"; gene_id "g1082"; 3 AUGUSTUS CDS 4517715 4518188 0.89 + 0 transcript_id "g1082.t1"; gene_id "g1082"; 3 AUGUSTUS stop_codon 4518186 4518188 . + 0 transcript_id "g1082.t1"; gene_id "g1082"; # protein sequence = [MAALYGDDADYDEDGKPSWDDDINIGDIAMANNSESTRQKKKKKKKGEKAVEEDGVSVDAMDADIDKVDDDEWDGTEE # MRKKKIEEYMDEVYGLDFNDMVGGIPTRFQYTHVEPENFHLSPTEILMATDAELNEYMGIKKFAPYRKAGKWDSNRGDRLKELRQKIGERGYGGDITQ # DDKAVKKRKGKKERMRMKTLLDPDVGEDVEKEVEVTGKSAMPENLKRKQPSGDVLDESEEAAQKKKRRRHKKKNHSEDSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1082 ### # start gene g1083 3 AUGUSTUS gene 4519657 4520562 0.84 - . g1083 3 AUGUSTUS transcript 4519657 4520562 0.84 - . g1083.t1 3 AUGUSTUS stop_codon 4519657 4519659 . - 0 transcript_id "g1083.t1"; gene_id "g1083"; 3 AUGUSTUS CDS 4519657 4520562 0.84 - 0 transcript_id "g1083.t1"; gene_id "g1083"; 3 AUGUSTUS start_codon 4520560 4520562 . - 0 transcript_id "g1083.t1"; gene_id "g1083"; # protein sequence = [MQMSARDKSNLLNSALRPQRKPKVPKGALGARAKASLKQQSSRKSSPLPPSSPFATSSQIPDFLPIATSEASEHLETP # FYEEVSVEEEHDFESDVYGMLEEPADVQHSTYSARNSDPFGFFALEAKLKAQRKEQSITTTSNAPYPQSWEPPHSPHKPRIRKRASGKNADSPSLPSS # PSPAKPRRVTKQGLAKATNSDETKIQKAISDDEKDCLDVASQDYQPRKRMKTKAVRRQEQRNGDKSIDPERLARDLKVLLPKRSSRRNGKRRSDSNSH # EADAKRLRGTTRDKQNKSDTGDQVGIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1083 ### # start gene g1084 3 AUGUSTUS gene 4521954 4522589 0.84 + . g1084 3 AUGUSTUS transcript 4521954 4522589 0.84 + . g1084.t1 3 AUGUSTUS start_codon 4521954 4521956 . + 0 transcript_id "g1084.t1"; gene_id "g1084"; 3 AUGUSTUS CDS 4521954 4522589 0.84 + 0 transcript_id "g1084.t1"; gene_id "g1084"; 3 AUGUSTUS stop_codon 4522587 4522589 . + 0 transcript_id "g1084.t1"; gene_id "g1084"; # protein sequence = [MRDRVDIIQIISWNGKRPTYEPFPSNLKSDALDYGESHYIGPIKGIQPKSQGWVDGYPHDAFLKLTAYFGRAFKEGRY # PDINEDRIFAWARPHPKSAIASNDRVPRPENWDLVRNFNSRRPDADLSSQTDDKVWVVVLAKLPATVLIYGPKNLKVDVREGLTKISQTLEPGDGMEI # VMQRNEVVVTECSPLEFTFNPKPLLYNFNVFTACS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1084 ### # start gene g1085 3 AUGUSTUS gene 4531706 4532629 0.93 - . g1085 3 AUGUSTUS transcript 4531706 4532629 0.93 - . g1085.t1 3 AUGUSTUS stop_codon 4531706 4531708 . - 0 transcript_id "g1085.t1"; gene_id "g1085"; 3 AUGUSTUS CDS 4531706 4532629 0.93 - 0 transcript_id "g1085.t1"; gene_id "g1085"; 3 AUGUSTUS start_codon 4532627 4532629 . - 0 transcript_id "g1085.t1"; gene_id "g1085"; # protein sequence = [MEGVSFPLESLVFELFILVSKLLRMVLDNNKRVQEAGCSAFATLEEDAGIELAPYLEPVLRNLVFAFDKYQHKNMLIL # YDAVGTLADAVGRELSNPTYVEILMPPLTNRWAKLKDDDIDLIPLLEVYIMHPLNLSSLNCFQCLASVTIAMGQAFLPYAPPVFERCCSIIHTSLLQY # QQFQQNPELDEPDKSFLVVALDLLSGLTQGLGMALEVLINQSQPNLLTLLTVCLKHPQAPVRQSAYALVGDMAMGCFSILRPFMPGIMSELILQLDPE # PKVEFVSASNNAAWSVGEVALRYGRGKPTLFFC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1085 ### # start gene g1086 3 AUGUSTUS gene 4532898 4533488 0.72 - . g1086 3 AUGUSTUS transcript 4532898 4533488 0.72 - . g1086.t1 3 AUGUSTUS stop_codon 4532898 4532900 . - 0 transcript_id "g1086.t1"; gene_id "g1086"; 3 AUGUSTUS CDS 4532898 4533488 0.72 - 0 transcript_id "g1086.t1"; gene_id "g1086"; 3 AUGUSTUS start_codon 4533486 4533488 . - 0 transcript_id "g1086.t1"; gene_id "g1086"; # protein sequence = [MDHVAEYMLYSTKDKNENVALEACEFWLTFAEDVELAPFLQPLLGKVAPVLLDCMIYGEDDLLWLEGDAEDAEIPDKE # TDIKPRHYGSKSHGYERDANGEPTEAPKARIGAYGEETIDSDEDDDYLDDDEFVDEMSTEWNLRKCAAAALDVLAVRFSGDLLNVLLAPLKDKLWSND # WLQRESGILALGAMAEGKSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1086 ### # start gene g1087 3 AUGUSTUS gene 4539375 4540097 0.74 + . g1087 3 AUGUSTUS transcript 4539375 4540097 0.74 + . g1087.t1 3 AUGUSTUS start_codon 4539375 4539377 . + 0 transcript_id "g1087.t1"; gene_id "g1087"; 3 AUGUSTUS CDS 4539375 4540097 0.74 + 0 transcript_id "g1087.t1"; gene_id "g1087"; 3 AUGUSTUS stop_codon 4540095 4540097 . + 0 transcript_id "g1087.t1"; gene_id "g1087"; # protein sequence = [MNATVVNSTASPVDIHKLTIKIPGPKPDSDPVAEPSSAMTIDTPQSGSGTVKHKRRSGKARLTNYPSIKLSAVPQLAV # LADTTRKPSMRLIETWASLLKASPDDVERWVKDHKAQGANQVESTAPTVPSGPSEPARTSVQPDESESDEEPLIIGIHSPQLQSENTLIGQPPQMPPR # DQLLLAIHTRLSSATNDSSSPETVSEFNTLFKPYGAMMERFVQDIETGKLERMGWGFNRKLVQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1087 ### # start gene g1088 3 AUGUSTUS gene 4540186 4541279 0.51 - . g1088 3 AUGUSTUS transcript 4540186 4541279 0.51 - . g1088.t1 3 AUGUSTUS stop_codon 4540186 4540188 . - 0 transcript_id "g1088.t1"; gene_id "g1088"; 3 AUGUSTUS CDS 4540186 4540820 0.99 - 2 transcript_id "g1088.t1"; gene_id "g1088"; 3 AUGUSTUS CDS 4540964 4541279 0.51 - 0 transcript_id "g1088.t1"; gene_id "g1088"; 3 AUGUSTUS start_codon 4541277 4541279 . - 0 transcript_id "g1088.t1"; gene_id "g1088"; # protein sequence = [MSDVIDRFAFITSNVVARDVARFALPGLLPSVLKSVPLTFDDVLHKSAVKLSIAFPPPSLLQYDCGKLQRLTALLREK # KSGGHRVLLFTQMTKILDILEIYLNFHALFVQFLASETLLYSLTGADTVIFYDSDFNPQMDRQCEDRAHRIGQIRDVHIYRFISEHTVEEAMLLKANQ # KRFLDDMVIQKGEFDWRSIFKFDSEDEANNIEVARVQRGIDSGLLTKALGEFEDSEDSLAARIAEREEVDMEGADKADFGLGVVGGDDQEDALKGRSG # TMTVGEGHEGDHEDGEEDGGTTVDYMLAFISRDSEFFAEWRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1088 ### # start gene g1089 3 AUGUSTUS gene 4542757 4545584 0.19 - . g1089 3 AUGUSTUS transcript 4542757 4545584 0.19 - . g1089.t1 3 AUGUSTUS stop_codon 4542757 4542759 . - 0 transcript_id "g1089.t1"; gene_id "g1089"; 3 AUGUSTUS CDS 4542757 4543773 1 - 0 transcript_id "g1089.t1"; gene_id "g1089"; 3 AUGUSTUS CDS 4543911 4544376 0.45 - 1 transcript_id "g1089.t1"; gene_id "g1089"; 3 AUGUSTUS CDS 4544499 4544637 0.31 - 2 transcript_id "g1089.t1"; gene_id "g1089"; 3 AUGUSTUS CDS 4544777 4545301 0.44 - 2 transcript_id "g1089.t1"; gene_id "g1089"; 3 AUGUSTUS CDS 4545560 4545584 0.86 - 0 transcript_id "g1089.t1"; gene_id "g1089"; 3 AUGUSTUS start_codon 4545582 4545584 . - 0 transcript_id "g1089.t1"; gene_id "g1089"; # protein sequence = [MILLCVLLSSASAPGPSRRTRRAHTERKNLLLPESSSFSPAASISAFNRKGNAFGNNDASELRPANNSSSLNGKTLDS # PSSLSSSSKVKGKRKAIDAIQGATSSSLTRSSRGKRRNKDDAESDNSNACMDLASTINRVHTNHPDISTPKPKRPSGILLRVPPRSSMIAPPSESTSV # NEFDPIRRSRHHRAELNQSPSKFSNVLSTKRKVDLTDHGSHPESTVSTLISCFSPLQRPLPPKYNYSLSDFLSSYTTDGSEEVPPDTLVKRARTRTKF # LERIQKLREEGRLLDDLSVLELTPAEAANKQQKSSDIWCHCIVDAAAYLESKSEEPSGVEIAGQIAKAIQNYWDVKTVKQEKMKAQEEKRIRALAKAT # IKLVVAEWKKAVFSGHILETQHGDLTRLDRSRSHSRGSSISDWTENDSEDEAEDGKEEKDENKETGDDTVIGVDEEEGNNQQGASVVSHAQYDFSIEV # DQSTLPDIVIDMDSVGGREASSTSDYHGTSDDLSHSSLPLLGTSEPVTIFTKPLNQPWDSTSLDTHEVLPPINGSTSFPPLHLDQPLDGDTSSPSTAD # VVTPPNEFEASIPIVDLASLQGGEFMSETLAIKANSGGLGLKESFTSVAVDSLATVDPNNSTSEPLNGDGESMEYSFLQTQYQEDSDDQSQEAQFPAY # LTPYIVTHVDWNPDNKIAPPVLLRGVLRPYQFAGLEWLASLHSNNLNGILADEMGLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1089 ### # start gene g1090 3 AUGUSTUS gene 4549807 4550808 0.46 - . g1090 3 AUGUSTUS transcript 4549807 4550808 0.46 - . g1090.t1 3 AUGUSTUS stop_codon 4549807 4549809 . - 0 transcript_id "g1090.t1"; gene_id "g1090"; 3 AUGUSTUS CDS 4549807 4550808 0.46 - 0 transcript_id "g1090.t1"; gene_id "g1090"; 3 AUGUSTUS start_codon 4550806 4550808 . - 0 transcript_id "g1090.t1"; gene_id "g1090"; # protein sequence = [MPSTHEISILSYTHARQLPDFVFSTLEANRIDANVILPLLRKSSDSERSNLPISFNQLWLCCISYDSSITGTVDMVLS # CTENELGKYPIFIVPTRPRSLWTRNSLEVRLRKLAEALFKSVPRERVYSVFAPDIIVSLFSQQWSELAGVGINNEPYYAARLLSCTAVIPQPSTLPPF # GTCRLADTADTKTVAKLCRRFSEESEPFVLEREGAFKEARLLISKEQVWVHCVSGKITCIAAFTRNTADTATITKVYTHRSWRRQGCAKRLVREVTEH # LLGTGRSEVVLYVAHNNGSAAKVYESVGFVETDGAVAIGHSVKWTEVGFDRNFVELGHW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1090 ### # start gene g1091 3 AUGUSTUS gene 4551924 4553804 0.32 - . g1091 3 AUGUSTUS transcript 4551924 4553804 0.32 - . g1091.t1 3 AUGUSTUS stop_codon 4551924 4551926 . - 0 transcript_id "g1091.t1"; gene_id "g1091"; 3 AUGUSTUS CDS 4551924 4553071 0.59 - 2 transcript_id "g1091.t1"; gene_id "g1091"; 3 AUGUSTUS CDS 4553166 4553483 0.84 - 2 transcript_id "g1091.t1"; gene_id "g1091"; 3 AUGUSTUS CDS 4553642 4553804 0.57 - 0 transcript_id "g1091.t1"; gene_id "g1091"; 3 AUGUSTUS start_codon 4553802 4553804 . - 0 transcript_id "g1091.t1"; gene_id "g1091"; # protein sequence = [MLYKRSLYGLALNLAKTQNLDDSHVADIHRQYGDHLYSSKNDYDGAMTQYVKTLDHTTLLLNTYTKLKDVSRLDSFIK # TESKYSREESIASDELPFDLDTAIRVCRQAGYFEHAGYLAKKYERHEDYLRIQIEDAGKYSEALLYLRKLGMDAVCRTTTSIETTELLIDLCTTTLDT # TVEVIDNTGEETPISAVSKSTAGGASYLSYLTLHRNSIAGQASETATVAAPSVKTVRVGDIDGSTIRRSGSLNSDGASGTPRGISPPPTALSTIGIAP # MSARPPNVNLSKRLSPRLYFAHFVDHMEQFVVFLETVALRRWGQSVDENSQKDTSDPSRLSTTPDIDDEEDRHDQVAVWNTLLELYLTLPGISSSLGS # SAPQDEIALKEKALRVLRSETIPYDTTHALILCSSRGYTKGLVLLWEKMGMYEDVLRFWMERDKEGATPEASTQVLKHLQLYGPKHPHLYTLVLRFLT # SSPVLFSRHMDDVKEVIQHIDQENIMPPLGIIQVLSRNDVASVGLVKEWLIERITQERGEIQAVSSLFLLCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1091 ### # start gene g1092 3 AUGUSTUS gene 4559333 4560517 0.27 - . g1092 3 AUGUSTUS transcript 4559333 4560517 0.27 - . g1092.t1 3 AUGUSTUS stop_codon 4559333 4559335 . - 0 transcript_id "g1092.t1"; gene_id "g1092"; 3 AUGUSTUS CDS 4559333 4559484 0.63 - 2 transcript_id "g1092.t1"; gene_id "g1092"; 3 AUGUSTUS CDS 4559538 4560024 0.54 - 0 transcript_id "g1092.t1"; gene_id "g1092"; 3 AUGUSTUS CDS 4560143 4560517 0.53 - 0 transcript_id "g1092.t1"; gene_id "g1092"; 3 AUGUSTUS start_codon 4560515 4560517 . - 0 transcript_id "g1092.t1"; gene_id "g1092"; # protein sequence = [MSFITSSLLALSLAASAYSSPLSTNYHNAPAQRSSFIPAPLIEENHLHGTINNSYIVKFRDGLSNALVANHLNFLQTK # HTESPLVGEDSGLRHVYEFGYSGYFHDDVVEQLRALPEVEYIERDQVGLARVSHRKKLTLGSFTKYDYVTYAGEGVDVYIIDTGIYVDHPEFNGRAHW # GVTIPQNDVDEDANGHGTHCAGTVASEAYGVAKKAEVYAVKVLGSNGSGTMSDVIKGVEWATAAAKQKAQSGSSKHKGSVANMSLGGGKSPTLDAVVN # KATDSGLHFAVAAGNENRDACSSSPAAAEKAITVGASTIYDERAYFSNFGKCVDVFAPGVFMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1092 ### # start gene g1093 3 AUGUSTUS gene 4562561 4564392 0.66 + . g1093 3 AUGUSTUS transcript 4562561 4564392 0.66 + . g1093.t1 3 AUGUSTUS start_codon 4562561 4562563 . + 0 transcript_id "g1093.t1"; gene_id "g1093"; 3 AUGUSTUS CDS 4562561 4562600 0.82 + 0 transcript_id "g1093.t1"; gene_id "g1093"; 3 AUGUSTUS CDS 4562716 4562742 0.74 + 2 transcript_id "g1093.t1"; gene_id "g1093"; 3 AUGUSTUS CDS 4563860 4564392 0.86 + 2 transcript_id "g1093.t1"; gene_id "g1093"; 3 AUGUSTUS stop_codon 4564390 4564392 . + 0 transcript_id "g1093.t1"; gene_id "g1093"; # protein sequence = [MYKVKRLSPNRSTVSKGIDRDLFSNTPGAVDDASATTALYLLISTLRNYAISERSLRELKWKPNGLAKRSHDLTGHTL # AILGLGGIGMRLAELAHAFPMRIIYYSRHKVTDAPEWCEYFENVEEMLAQADVLSVHVPLNPNTVGLVGEKWIRALKKGAIIINTARGKVIDEDAMIR # ALEDGHVSNRFIQCCPCGNHEIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1093 ### # start gene g1094 3 AUGUSTUS gene 4570141 4571313 0.48 + . g1094 3 AUGUSTUS transcript 4570141 4571313 0.48 + . g1094.t1 3 AUGUSTUS start_codon 4570141 4570143 . + 0 transcript_id "g1094.t1"; gene_id "g1094"; 3 AUGUSTUS CDS 4570141 4571313 0.48 + 0 transcript_id "g1094.t1"; gene_id "g1094"; 3 AUGUSTUS stop_codon 4571311 4571313 . + 0 transcript_id "g1094.t1"; gene_id "g1094"; # protein sequence = [MANFQLLDFSSPVSSSASMLSPSSSSDYSVPESYSPTNSPQGNFPATMTCSPADIMPSTFSINDEYQEGPSAQNPLEL # NTFDTFYNNQSLRSSTSEIDTAEGWVETSSWSVRPPASFADFSNPRAAIDKEELLVHPAVPISPQQVDDFSSCATTTQKKTAKAHRRRNKKVQSQSIA # PRLVSSSPADSYVARSPVSSISHNYHPLHSESSIDIVQPQASTSAVVSNVPITRKRKRSYQDEDFSYYNVASHHRAAKERISYSEDGVESNDDDDPEY # ISCHVEDSEDDDYGGSQKQSARTKRSRASTSNISGSDPRFPCPAPGCRRIFNRSADQRRHSESAHEHRRFPCIYCHAVLSRHDALIRHQVKARRCGRK # ARQAQGRVPNASFEADDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1094 ### # start gene g1095 3 AUGUSTUS gene 4571923 4572746 0.88 - . g1095 3 AUGUSTUS transcript 4571923 4572746 0.88 - . g1095.t1 3 AUGUSTUS stop_codon 4571923 4571925 . - 0 transcript_id "g1095.t1"; gene_id "g1095"; 3 AUGUSTUS CDS 4571923 4572633 0.97 - 0 transcript_id "g1095.t1"; gene_id "g1095"; 3 AUGUSTUS CDS 4572717 4572746 0.88 - 0 transcript_id "g1095.t1"; gene_id "g1095"; 3 AUGUSTUS start_codon 4572744 4572746 . - 0 transcript_id "g1095.t1"; gene_id "g1095"; # protein sequence = [MKYSLHEDFRSILSSLHYIYCGHIGIMGYSFDDLEPLVRQILSAPGTDLTTISAKRVRRELLSLDPSLTPEFVKANKL # DVDAVITRVFGEVSAAQNGEVIDAPEEPVTASRRYNSSDQEEAEQEEEEEDADDDDDEAEHMPKKSRKGPKKGLSDAELARQLSSEINGRSSTRRSTG # KGRAANGTPKKSRSKKKSATTIDSDDENTGEEGGKKTKKKRAGGGAAKGGFAKEYTLRYQIHISMRLDYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1095 ### # start gene g1096 3 AUGUSTUS gene 4572792 4573295 0.62 - . g1096 3 AUGUSTUS transcript 4572792 4573295 0.62 - . g1096.t1 3 AUGUSTUS stop_codon 4572792 4572794 . - 0 transcript_id "g1096.t1"; gene_id "g1096"; 3 AUGUSTUS CDS 4572792 4573295 0.62 - 0 transcript_id "g1096.t1"; gene_id "g1096"; 3 AUGUSTUS start_codon 4573293 4573295 . - 0 transcript_id "g1096.t1"; gene_id "g1096"; # protein sequence = [MELEYIDRVPERELESVSDQPSSTEEQIFYDDEGPWYLGKARDEFHRRRNSQSRVEEEDDPIQWARDRRNAEAREAEY # GGEDYLDAGLRPDEDDDDEYSETMLLVMLCVTVSVLIYVRTRIVRRMRHDQQQRQQQQQQEEAVPEAPAGNGMFPAPGDPARDEWAMLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1096 ### # start gene g1097 3 AUGUSTUS gene 4573322 4573819 0.52 - . g1097 3 AUGUSTUS transcript 4573322 4573819 0.52 - . g1097.t1 3 AUGUSTUS stop_codon 4573322 4573324 . - 0 transcript_id "g1097.t1"; gene_id "g1097"; 3 AUGUSTUS CDS 4573322 4573819 0.52 - 0 transcript_id "g1097.t1"; gene_id "g1097"; 3 AUGUSTUS start_codon 4573817 4573819 . - 0 transcript_id "g1097.t1"; gene_id "g1097"; # protein sequence = [MTPSNDTALLALTQWTRAAAQRNIDALVKVGDYYYHGLGVPDEKESFRYEKAAKYYQSAADTQMSALAMWNLGWMYEN # GVGVPQVIDVNISLALSNFDQDFHLAKRHYDLAAQTNSEAYLPVFFSLAKLYVRSIWHTILGGKGGLNIWFDEEDSEIQSGALFGSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1097 ### # start gene g1098 3 AUGUSTUS gene 4581131 4581421 0.92 - . g1098 3 AUGUSTUS transcript 4581131 4581421 0.92 - . g1098.t1 3 AUGUSTUS stop_codon 4581131 4581133 . - 0 transcript_id "g1098.t1"; gene_id "g1098"; 3 AUGUSTUS CDS 4581131 4581421 0.92 - 0 transcript_id "g1098.t1"; gene_id "g1098"; 3 AUGUSTUS start_codon 4581419 4581421 . - 0 transcript_id "g1098.t1"; gene_id "g1098"; # protein sequence = [MSSTVRTVDDAEKGTLEHVSSMATLDTMTSTASIKDVAHKELKRLPSDTSTLQARSPDSVSKSKGAEISKPDPPKPSP # RPKVSKWLKFQLWFNTYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1098 ### # start gene g1099 3 AUGUSTUS gene 4583361 4585193 0.21 + . g1099 3 AUGUSTUS transcript 4583361 4585193 0.21 + . g1099.t1 3 AUGUSTUS start_codon 4583361 4583363 . + 0 transcript_id "g1099.t1"; gene_id "g1099"; 3 AUGUSTUS CDS 4583361 4583973 0.74 + 0 transcript_id "g1099.t1"; gene_id "g1099"; 3 AUGUSTUS CDS 4584041 4584342 0.68 + 2 transcript_id "g1099.t1"; gene_id "g1099"; 3 AUGUSTUS CDS 4584645 4585193 0.41 + 0 transcript_id "g1099.t1"; gene_id "g1099"; 3 AUGUSTUS stop_codon 4585191 4585193 . + 0 transcript_id "g1099.t1"; gene_id "g1099"; # protein sequence = [MSLLRPQLTRNWVRHCSQPSARCFHKSRVSPGAIAPTNPLRAVAAPAVGSYAPKDGEHVLNSPSELARRISAKVLPKL # PRPDVQKVVVVGSGGLSIGQAGEFDYSGSQALKALSEEGVQAVLINPNIATWQTSHQLASEVYFLPITADYVAYVLEKERPDGILLTFGGQSALNVGI # ALDKMGVLERLGVQVLGTPIKTLEVSEDLYPTEIDIPVAQSTAVSSVNAALAAAETIGYPVILRSAFTLGGLGSGFANTPDELRDLSAKSLSLSPQVL # IERSMKGWKELEYEVVRDGADVRRSPFEILTPKSIKVLSSLSDPSSSPLNIILSALASKATGYPLAYTAAKIALGYTLPELPNAVTKTTTACFEPSLD # YIVTKIPKWDLAKFSSQVNRQVGSAMKSVGEVMAIGRTFEESLQKAIRQVDPRWKGFEVYIEPEDLDNALTQPTDMRLFAIAYAMYRKNYTIDQLHDL # TKIDKVKTFGHRTLNDF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1099 ### # start gene g1100 3 AUGUSTUS gene 4585310 4586011 0.28 + . g1100 3 AUGUSTUS transcript 4585310 4586011 0.28 + . g1100.t1 3 AUGUSTUS start_codon 4585310 4585312 . + 0 transcript_id "g1100.t1"; gene_id "g1100"; 3 AUGUSTUS CDS 4585310 4585754 0.36 + 0 transcript_id "g1100.t1"; gene_id "g1100"; 3 AUGUSTUS CDS 4585812 4586011 0.7 + 2 transcript_id "g1100.t1"; gene_id "g1100"; 3 AUGUSTUS stop_codon 4586009 4586011 . + 0 transcript_id "g1100.t1"; gene_id "g1100"; # protein sequence = [MGFADTQIADLVSSTEDQVRAHRKSFGITPFVKRIDTLAAEFPAHTNYLYTTYNASEHDVEFDEHGTMVLGSGVYRIG # SSVEFDWCAVTCARKLRDMGKRTIMINYNPETVSTDFDEADRLYFEELGYERVMDIYELEQAQGVIVSVGGQLPQNIALRLKKTGVNVLGTDPEQIDN # AEDRHKFSSVLDSIEVDQPEWTEVTTVAAAKQFADKVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1100 ### # start gene g1101 3 AUGUSTUS gene 4586104 4587118 0.58 + . g1101 3 AUGUSTUS transcript 4586104 4587118 0.58 + . g1101.t1 3 AUGUSTUS start_codon 4586104 4586106 . + 0 transcript_id "g1101.t1"; gene_id "g1101"; 3 AUGUSTUS CDS 4586104 4586653 0.58 + 0 transcript_id "g1101.t1"; gene_id "g1101"; 3 AUGUSTUS CDS 4586736 4587118 0.96 + 2 transcript_id "g1101.t1"; gene_id "g1101"; 3 AUGUSTUS stop_codon 4587116 4587118 . + 0 transcript_id "g1101.t1"; gene_id "g1101"; # protein sequence = [MNVVHQESDLDYRLSAAASVSPLHPVVITKFIDDAQEIDVDAVAHQGKLLVHAVSEHVENAGVHSGDATLVLPPFSLS # ESDMSRLKVIAEKVASAFKISGPFNMQIIKKSSAANEQAELKVIECNLRASRSFPFVSKVLGRNFVDTATAAIVGQDVPEPVDLMAQKRDYTAIKVSQ # FSWTRLPEMASTGEVASFGKDIHEAYWASSLSTTGFKVPSAGSGMLLGGDINKPEMISVAKKLFELGFKLYCSSPVVEEFLNDIPYISAKRIFFPTKD # KRKLREVFDEYDIQCVINLANSRATSFTDEDYVARR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1101 ### # start gene g1102 3 AUGUSTUS gene 4593987 4595653 0.44 - . g1102 3 AUGUSTUS transcript 4593987 4595653 0.44 - . g1102.t1 3 AUGUSTUS stop_codon 4593987 4593989 . - 0 transcript_id "g1102.t1"; gene_id "g1102"; 3 AUGUSTUS CDS 4593987 4595156 0.81 - 0 transcript_id "g1102.t1"; gene_id "g1102"; 3 AUGUSTUS CDS 4595200 4595558 0.57 - 2 transcript_id "g1102.t1"; gene_id "g1102"; 3 AUGUSTUS CDS 4595647 4595653 0.53 - 0 transcript_id "g1102.t1"; gene_id "g1102"; 3 AUGUSTUS start_codon 4595651 4595653 . - 0 transcript_id "g1102.t1"; gene_id "g1102"; # protein sequence = [MQKYYSSIESDDIGVPSSLLTMMNISALRHNAEHNEPASSESEEGEECVVLSLSEFFVVNESRRLTPWPEHVHETALS # YSPYASSAQNQWASYEWSNRNGKSISRDLPKDQQYPINIFGHTAPFFEQEQAFADFPEPRNDLSSGEDDDFAAHFPDTRPRRPHSALSHYAVSNERHS # QNESPISPKSSNSNFRPIFHEPFQSHSYENAFGGASSSRGDAAPFLESTGPGLSRMSIGSYPDDETGRRRKQLFDNEETVSQYLDSPVVSYPLSDRSP # GGISAKVKGKQRSYEDAEDSAIPNVQMSGLHLGIEMSTGTRTSPRLELKDDDRRNARFRSSPTGSVYLDEDDVEEEFDCQRTETRSRKYTSQSSATGG # RLGSSRAAVSRSGKRPVTSDEEDESALDQSADALPTTIVSPTKPSGKKRKVNRYPCPVPLCKETFTRRNDVRRHIKNAAVHRDSPEALALLGEVVGAG # TRCKYCNADLSRSDARMRHERASACGKRTTQKMKDQMLLKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1102 ### # start gene g1103 3 AUGUSTUS gene 4608767 4610076 0.4 - . g1103 3 AUGUSTUS transcript 4608767 4610076 0.4 - . g1103.t1 3 AUGUSTUS stop_codon 4608767 4608769 . - 0 transcript_id "g1103.t1"; gene_id "g1103"; 3 AUGUSTUS CDS 4608767 4609397 0.94 - 1 transcript_id "g1103.t1"; gene_id "g1103"; 3 AUGUSTUS CDS 4609454 4610076 0.42 - 0 transcript_id "g1103.t1"; gene_id "g1103"; 3 AUGUSTUS start_codon 4610074 4610076 . - 0 transcript_id "g1103.t1"; gene_id "g1103"; # protein sequence = [MPKVPTNKNSFVNPASLSLPSTSDDMFSSPSPEPQPGPSRKRPRTEQSSEDRKEARAHRNRIAAQNSRDRRKAQFSYL # ERRVAELEEENRQLRAGMGISPAAATSAPVLVSSAPIKSSSDEARDRENEELKERIRTLEKGWDAVVKALAERGLPTGVAPSSNIEVVPSAVSPPALS # TSVMPPSPSSSTTFSSSSVSTSPIPSTVTLSPTGGDRKNPPSFPAAGELALYDPYCDNISAAADFEVPTGSQDAPPVDDATMESLFREIISDSESSPV # TQTHSELVSLPTESHSTYGLAQPKEFHSQATSAKEEMTIGLLDRDRRMRVDGLSAVHLNEENGSTEVDGLDLGLNHGRIENDMMDLSDYIGESASSPE # SSAAWSDIGLTLEAFLDILPGTQDVNDNIPTTGLWESFEGRIGLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1103 ### # start gene g1104 3 AUGUSTUS gene 4616127 4617682 0.88 + . g1104 3 AUGUSTUS transcript 4616127 4617682 0.88 + . g1104.t1 3 AUGUSTUS start_codon 4616127 4616129 . + 0 transcript_id "g1104.t1"; gene_id "g1104"; 3 AUGUSTUS CDS 4616127 4616701 0.88 + 0 transcript_id "g1104.t1"; gene_id "g1104"; 3 AUGUSTUS CDS 4616803 4617682 0.98 + 1 transcript_id "g1104.t1"; gene_id "g1104"; 3 AUGUSTUS stop_codon 4617680 4617682 . + 0 transcript_id "g1104.t1"; gene_id "g1104"; # protein sequence = [MVQDTSASPELYLSQLREGKYGGWGAHESMDEHIDYSNLRECTRYWVVSVPGETEWAGQTRTDAVLASTSKNSNRSAD # HKFPLPSTAHVGVHTNIYSVQSDPDLKSTDIATFVGLFEAERDTLHVLFHLHENTAHKLYRVYPLTMTDTHESTSLEKGNRALQRELVKWIADESLAG # DMDAAEWVLLSIISRVQSRHPPIIPASLTLARFPPPPAKVVPTASTSATPDVRLATSTGIPGLYHVLSLLLPIITHVPLSLPLLNDGVFFPESKPRLR # SEDADEEPEDELYSGLLQLAPSTVCLITDSSVTEGQINDRGVRNLRALQEVIRNQTLEYVFPYSVFRFETDIGCIVCTEGKKSALVETHTTIPLRPAD # SLSISELQKRLYKLPDELNLPPIEKLEAWRKLIGGAIAKQTVHIVNQSSSSPPPPPVPVGGIGVSNAAAELIQEEFVQERQNEAQRSKSSVERKAQTT # ITPDDLIHRMLMTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1104 ### # start gene g1105 3 AUGUSTUS gene 4618812 4621962 0.28 - . g1105 3 AUGUSTUS transcript 4618812 4621962 0.28 - . g1105.t1 3 AUGUSTUS stop_codon 4618812 4618814 . - 0 transcript_id "g1105.t1"; gene_id "g1105"; 3 AUGUSTUS CDS 4618812 4620957 0.86 - 1 transcript_id "g1105.t1"; gene_id "g1105"; 3 AUGUSTUS CDS 4621631 4621962 0.28 - 0 transcript_id "g1105.t1"; gene_id "g1105"; 3 AUGUSTUS start_codon 4621960 4621962 . - 0 transcript_id "g1105.t1"; gene_id "g1105"; # protein sequence = [MFLITVPGSASNEDPPDHMEDIQVPEPSTPKKHHLTLPLSPSFLSLSSTPPSPTSNRTLATNAYPDHPISRSKECTSL # DSPSAQVYSIQLNTETETHVVSNKKMLSARPATLDEDVEKCLRTLNGNTNLEALDLAFPSTQTAYSVLEQTALPLRPTRTSVHDRRELCQSLSVSVHS # GTDVRCTKVASSTVFMNDFNSLSHPLGALGFGSPPQSVSFAMAEAEASETADKLKSAVIFPTRQSQLSIPFDDKKILNDPASLTYRPVSGQLQSSPSR # SKKDSFGSKSSRSLKHGRLPSILSLSSLSSSLTKSRLRSFSLTGKNKWANSPATASMMDLDSENQHDLSTVSLSRSSSFCSPRPKRRAFLSGEMEMQH # PADDTQVQLYDLGEKRNQDKSQGPNVDVFSSEHHRDESRMRRPDALFPDNRTLSPLPFASYISENTSHIDESIRPASRCSEDKRPPLRPTRSSTFHIF # PNFDALVGLGSLGAKLGRGLSGGRSPSPMPTRMLSTGAGEGMIGMRSPTPWRMAGIMEMTKAAVSGAAGVMRPPSGLGMDLLRTKDSLGANGEVMAVE # RIESHGDEDIVKSKQIRNGGRGWICVESEDEEQYASDADVNLCEIRTPKKLSRPAEEDRWTSPSRIPRLKTTVLHSPESLKSNSSSEISTSFGLQTPR # TPFTPNTPISSFRKLIHSESPQSLPETVSISLNPYDAFRSSPLSTKNKPAFSPPPSSFSSSRFGSKKAPHFGGPVEVFSNDPDPFAGPELGAIVRDSQ # VNLLREDADKDGFGVQTATRMSAGGNLTLSVPKEKRNPGVGLRRPVGDIRSVSFGFPTCNC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1105 ### # start gene g1106 3 AUGUSTUS gene 4624817 4625353 0.54 - . g1106 3 AUGUSTUS transcript 4624817 4625353 0.54 - . g1106.t1 3 AUGUSTUS stop_codon 4624817 4624819 . - 0 transcript_id "g1106.t1"; gene_id "g1106"; 3 AUGUSTUS CDS 4624817 4625353 0.54 - 0 transcript_id "g1106.t1"; gene_id "g1106"; 3 AUGUSTUS start_codon 4625351 4625353 . - 0 transcript_id "g1106.t1"; gene_id "g1106"; # protein sequence = [MITDMARVGEILPLTNNKRPRSSEDLRDQVQQSSDENREDRQIVGSYRVFHTPRDPLHGPHNFGPESEFGNEATQSFD # LSSFLNTTPSQSSSPEGSVLDIPRHLFEDPLSTPRPSEFTIPNPYSTENASADSSPQTDFDFDTFLASLPSSMDNAASSMWSATPAGYESVSAACGRH # LF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1106 ### # start gene g1107 3 AUGUSTUS gene 4628237 4628857 0.97 - . g1107 3 AUGUSTUS transcript 4628237 4628857 0.97 - . g1107.t1 3 AUGUSTUS stop_codon 4628237 4628239 . - 0 transcript_id "g1107.t1"; gene_id "g1107"; 3 AUGUSTUS CDS 4628237 4628857 0.97 - 0 transcript_id "g1107.t1"; gene_id "g1107"; 3 AUGUSTUS start_codon 4628855 4628857 . - 0 transcript_id "g1107.t1"; gene_id "g1107"; # protein sequence = [MSLLKEVYSRVHVPSNLHLYVSDLFSATRHHHQLEGRLVSITAIKDASELSRAARVLGGDPTGMELISETLRSDARTD # DNSTTGGETGDERFSKVLNDVESAFVVIDPQVNIETHLSTEFAHEDSDSVRVPALPVLDLTQADIARIVPRVLTHRLRVKDGPEDEVLASAVFGAAFS # ATSKKEERGRKRDRNRVTVKELLVEILQEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1107 ### # start gene g1108 3 AUGUSTUS gene 4629098 4629622 0.86 - . g1108 3 AUGUSTUS transcript 4629098 4629622 0.86 - . g1108.t1 3 AUGUSTUS stop_codon 4629098 4629100 . - 0 transcript_id "g1108.t1"; gene_id "g1108"; 3 AUGUSTUS CDS 4629098 4629622 0.86 - 0 transcript_id "g1108.t1"; gene_id "g1108"; 3 AUGUSTUS start_codon 4629620 4629622 . - 0 transcript_id "g1108.t1"; gene_id "g1108"; # protein sequence = [MTSQYTKSLSYPNDLLSAKSLNTAPSLSLSASEPFGDYNSPSITEVVSPTHINTASRNSSLSALPQPTFPHSYSDPTP # LRVVRDPTQIQLPDALVLSGLEHASLASQRALTEVLIERRVVIDDTDLSGVWPFPKDFILVYICPLDERERPPIHKPLVSPLYISNVHRLTSSLAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1108 ### # start gene g1109 3 AUGUSTUS gene 4632189 4634015 0.56 + . g1109 3 AUGUSTUS transcript 4632189 4634015 0.56 + . g1109.t1 3 AUGUSTUS start_codon 4632189 4632191 . + 0 transcript_id "g1109.t1"; gene_id "g1109"; 3 AUGUSTUS CDS 4632189 4634015 0.56 + 0 transcript_id "g1109.t1"; gene_id "g1109"; 3 AUGUSTUS stop_codon 4634013 4634015 . + 0 transcript_id "g1109.t1"; gene_id "g1109"; # protein sequence = [MESTDGGNVLGALGLIFRHSYSPKDKAPSHLDDDNLYEDGSGSRKSSNISFTSPTQSPGRKGKSRWTGKSKQDVPSFT # IDLPPLNLSQEHFEIPTLLPPPTAHTPLSDFTSLTYMSTPDTRNFRELSFNAPFSHLSNTSHPQPPAASPDYGKTVSHGAPLIRDGFHRSNESESEVD # FRSSLVSTRQEPDLQVHVQEFEVQSTNATFSTRRSVSRTAASMYAREMDRGSVRTNDDGLSMLGPATARAAIRSLSPRTSELAFTALGLHQPVPSASH # SENDPRFPRERLVSDETLRPQSQDPSADVDLARHDRRKTVESASRKSRLSVRFEDDTDRLTSSSKNQSAELADDSLLVPPGRLEVPKAAFRLTPQRPV # TSPISEADSKVATSFLDLSGSNSQSNSDSSQKEPSLASQGQGLKSRWSATTATDLGSHNLRQESSDSQNSGGSTSSPSSNFPFPVSLPASPHHPEGFK # PSPPVTPSSGTYQTLAPGRLNIHPHPFGIAMNPASPSDSVPISISDLHFRHSDSENDDLITDSTADPGSHLPPHPPLPSIPPTPTSPPPLNAPSHVAP # PTSPTLSSPSYIVSRVFPHSRSNSAIDPQSPSAHRTAGSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1109 ### # start gene g1110 3 AUGUSTUS gene 4639821 4640300 0.88 - . g1110 3 AUGUSTUS transcript 4639821 4640300 0.88 - . g1110.t1 3 AUGUSTUS stop_codon 4639821 4639823 . - 0 transcript_id "g1110.t1"; gene_id "g1110"; 3 AUGUSTUS CDS 4639821 4640300 0.88 - 0 transcript_id "g1110.t1"; gene_id "g1110"; 3 AUGUSTUS start_codon 4640298 4640300 . - 0 transcript_id "g1110.t1"; gene_id "g1110"; # protein sequence = [MVSFCTENDRLSGLRPFGVSLLYAGYDQHYQFQLYHSDPSGNYSGWKATCIGANNGTAQSLLKQEYKDDIEVKAAISL # VLKTMSKTMDSTTLGSEKCESLSLCILFSLAQIRFLVEFAVITLDTETQLPKAKIYKPDEIDELLQAEGLAKKEDDNAMKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1110 ### # start gene g1111 3 AUGUSTUS gene 4641216 4641686 0.88 - . g1111 3 AUGUSTUS transcript 4641216 4641686 0.88 - . g1111.t1 3 AUGUSTUS stop_codon 4641216 4641218 . - 0 transcript_id "g1111.t1"; gene_id "g1111"; 3 AUGUSTUS CDS 4641216 4641686 0.88 - 0 transcript_id "g1111.t1"; gene_id "g1111"; 3 AUGUSTUS start_codon 4641684 4641686 . - 0 transcript_id "g1111.t1"; gene_id "g1111"; # protein sequence = [MASGQPLTDADREPWLELIRTTAEHKSVELQAEKGCEKIHGLVVGCSSLKKYYRDILRGKRKEAADTNSAVLPEHLEP # PHPDLLPTYFVFIKGSRELLLGRMQKREGHFMKASMLDSQLQTLESPEGEEGVFVVDAEDSTEQQIAKVKEGLEKLDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1111 ### # start gene g1112 3 AUGUSTUS gene 4643150 4644451 0.84 - . g1112 3 AUGUSTUS transcript 4643150 4644451 0.84 - . g1112.t1 3 AUGUSTUS stop_codon 4643150 4643152 . - 0 transcript_id "g1112.t1"; gene_id "g1112"; 3 AUGUSTUS CDS 4643150 4644451 0.84 - 0 transcript_id "g1112.t1"; gene_id "g1112"; 3 AUGUSTUS start_codon 4644449 4644451 . - 0 transcript_id "g1112.t1"; gene_id "g1112"; # protein sequence = [MPPIIKVFETLHDKYDTRPMLVHQGVSILLLDYVMVTALLLTTDIQEWMVVQKHDGEVNHELPPEVSGSDDFGPRSAP # PASTSALQWRKVLYGVPLYPKRQSSASTASHVRFPGNLNQIAKIVNGEPMYPSLYRESSSIDFSSSESESDQETESEDILDTRVQPSSTPSRAPSPSA # ESVLYPLTTASAPSHTYLDPSFYNEYGIPPVPPLPAEYVASRNLVSPVSASASRRPRELPRPPSQHSATHRSRSSPPRPHTSPSSPAEPYSADFTPDR # RRPSVDSTFLSRNNSQFQRTLPELPPISLQASTSHSPLRHSQSSTRPMNSRTREKRSSQCPRRTLPPTPTAVSHPDWMTGLRIRKRSHNELAQWFHNG # HDSMPTRYDDHRQSMVFDALDCPPPAYNSLEFAAGTSLNIAPSSSLPPPPPPMHDMQGVLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1112 ### # start gene g1113 3 AUGUSTUS gene 4645559 4646109 0.4 + . g1113 3 AUGUSTUS transcript 4645559 4646109 0.4 + . g1113.t1 3 AUGUSTUS start_codon 4645559 4645561 . + 0 transcript_id "g1113.t1"; gene_id "g1113"; 3 AUGUSTUS CDS 4645559 4645593 0.4 + 0 transcript_id "g1113.t1"; gene_id "g1113"; 3 AUGUSTUS CDS 4645658 4645811 0.54 + 1 transcript_id "g1113.t1"; gene_id "g1113"; 3 AUGUSTUS CDS 4645939 4646109 0.96 + 0 transcript_id "g1113.t1"; gene_id "g1113"; 3 AUGUSTUS stop_codon 4646107 4646109 . + 0 transcript_id "g1113.t1"; gene_id "g1113"; # protein sequence = [MSTDATDPTAATKVATEATQPIDASPNAKGKGKAPKEDQSMDEDEDDDDDEDDEDEEEGSEEEEDEDDSMEEIDPSVI # MAGRRTRGKKVDYTSAEALAKAGLKSSEKEEDDDDDEMKEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1113 ### # start gene g1114 3 AUGUSTUS gene 4649637 4650393 0.44 - . g1114 3 AUGUSTUS transcript 4649637 4650393 0.44 - . g1114.t1 3 AUGUSTUS stop_codon 4649637 4649639 . - 0 transcript_id "g1114.t1"; gene_id "g1114"; 3 AUGUSTUS CDS 4649637 4650068 0.56 - 0 transcript_id "g1114.t1"; gene_id "g1114"; 3 AUGUSTUS CDS 4650181 4650393 0.44 - 0 transcript_id "g1114.t1"; gene_id "g1114"; 3 AUGUSTUS start_codon 4650391 4650393 . - 0 transcript_id "g1114.t1"; gene_id "g1114"; # protein sequence = [MNSQSGSKERRHTDEDDSVGDTTDEEAPSEAAMKLEEEEEEKKALAILLKRENVRCNDENNLDYLLTVHTYRLHCEVD # VSREFMSNVFGGNTQYTFPAIGQDKFRKHGLNDFMYLSKSYNPVAPTIPGQSGLFFSHDNFWLSNINPTAKELEDAEQPGWAKVSQRVLTRLKPSHWL # YVGQYTVSFSRALTPSEWENLSEKVSNCSDVLRTHHIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1114 ### # start gene g1115 3 AUGUSTUS gene 4650886 4651158 0.56 - . g1115 3 AUGUSTUS transcript 4650886 4651158 0.56 - . g1115.t1 3 AUGUSTUS stop_codon 4650886 4650888 . - 0 transcript_id "g1115.t1"; gene_id "g1115"; 3 AUGUSTUS CDS 4650886 4651158 0.56 - 0 transcript_id "g1115.t1"; gene_id "g1115"; 3 AUGUSTUS start_codon 4651156 4651158 . - 0 transcript_id "g1115.t1"; gene_id "g1115"; # protein sequence = [MEVEEDNSINELKRENEVLKASMAKFEQEWNAALATLGIKFPNGKQPPSTSAPDESKDEGASESTSSNAESSQPSHSL # ATLIAAASQLPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1115 ### # start gene g1116 3 AUGUSTUS gene 4657924 4659841 0.82 + . g1116 3 AUGUSTUS transcript 4657924 4659841 0.82 + . g1116.t1 3 AUGUSTUS start_codon 4657924 4657926 . + 0 transcript_id "g1116.t1"; gene_id "g1116"; 3 AUGUSTUS CDS 4657924 4658505 0.82 + 0 transcript_id "g1116.t1"; gene_id "g1116"; 3 AUGUSTUS CDS 4658561 4659841 1 + 0 transcript_id "g1116.t1"; gene_id "g1116"; 3 AUGUSTUS stop_codon 4659839 4659841 . + 0 transcript_id "g1116.t1"; gene_id "g1116"; # protein sequence = [MSSSTHQFTRFSSDTLEGMFDGDPDSEWSLRIYKELFKKEEGSQDSEFNKHTRRIYKVWPRDPKGGGKPCLMSDLREL # SAGYRTNNSYHLWGATILDFYMFRSFNDECADAMLGFSSGSKLYAWMKAHGELYAKDELEWAEMEEKPRLRPAADILEIIEAKNLAILMGSCGISMRD # DDDGEAEEESDESENETISAIPRPFDYENYPDPWPLVPFSSKAPTLQSPIPFHLLPETLIVHDPFRLLNGGDPPDELDVDWTSVDDITHRYSLNLTVP # SIKDSIAAERAKMTEAAREGGPVFIGFSLEILNRTETGIGSSSTAQSGTAFKLTVPSPPASPSSIPEAHLFISPTEFVGKGHHSVVYRAEWDLPRSVF # SKYVICHRCVIEAAKKILSKDTISNAAGDTRSPSDEVGPADEIVGGNFILRKKHLPAIEMNFVREGQREDENTPCYSVRGETLDYLEYTGESIPTIHV # DTVPWYDSSSTDPAPCSHLAVTSSISGPLPGPVPPTASVSVIAKLSVYDDNHLEKEAKCYQSFGEDFSQHWSGYTVALPLRDPTPTGAITPNFYGFYS # KEEDKTKDNEEKVIDRDSFLSPILLIEDCGNPIEVKKLSLDDRCVQLHLRLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1116 ### # start gene g1117 3 AUGUSTUS gene 4661145 4663214 0.93 + . g1117 3 AUGUSTUS transcript 4661145 4663214 0.93 + . g1117.t1 3 AUGUSTUS start_codon 4661145 4661147 . + 0 transcript_id "g1117.t1"; gene_id "g1117"; 3 AUGUSTUS CDS 4661145 4663214 0.93 + 0 transcript_id "g1117.t1"; gene_id "g1117"; 3 AUGUSTUS stop_codon 4663212 4663214 . + 0 transcript_id "g1117.t1"; gene_id "g1117"; # protein sequence = [MASRTVAKSAIPITNPNPNPKPPPEEPLLSDSPPLANGNASHPSSTVAPIAEPPRPRSEATWTSLDMGGVGIKNLPSN # SGLFSFNFLTNLYLNHNGLIAIPPEIAQLRNLELLDLSGNALTTLPPELGMLVSMKEFYLFDNQIMTIPPEFGTLHQLQTLGVEGNPLDTNLKNLITK # DGTPALIAFLRDSCPVSAPPQNRAWIPLITPVEQEALPPSTETISVVCYNILCQRAATVRLYGYTPSWALAWDYRRELILSEILAHGADFICLQEVDV # TSYEDFFLKHLSEAGYESVYWPKSRAKTMSNENERRFVDGLATFFRADKYQLIEKHLIEFSAVAMQREDFKKTEDMFNRVLGKDHIATACAFENRDTG # SRVLVANVHILWDPKFCDVKLVHVALMVEEVEKMAERFVKLPPRLWPEPETANGNVDSVDGIADSSFSSSSELSSPFPTTSSLPSSSLPPSSSSSSPP # DSPSSKPSTRRQRPKPPTYTSASQIPLIFCGDFNSIPGSGVYEFLSTGTLRKDHPDFMGHVYGKYTGGAGSGPGSAGGNADGLKSWLGLKSAYAAPAH # GVHGAHSRAPQSLHQQQQQPLPVSGTRTPGSTPAPGASNNLLSIPASTSLTHTSSSLLRSSTSSPSPELLPTTNYVSSFSGVLDYIWYSGSSLGVNAV # LGQVDPVYMSKCVGFPNVHFPSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1117 ### # start gene g1118 3 AUGUSTUS gene 4666715 4668926 0.17 + . g1118 3 AUGUSTUS transcript 4666715 4668926 0.17 + . g1118.t1 3 AUGUSTUS start_codon 4666715 4666717 . + 0 transcript_id "g1118.t1"; gene_id "g1118"; 3 AUGUSTUS CDS 4666715 4666864 0.53 + 0 transcript_id "g1118.t1"; gene_id "g1118"; 3 AUGUSTUS CDS 4666932 4667458 0.32 + 0 transcript_id "g1118.t1"; gene_id "g1118"; 3 AUGUSTUS CDS 4667862 4668197 0.36 + 1 transcript_id "g1118.t1"; gene_id "g1118"; 3 AUGUSTUS CDS 4668377 4668926 0.96 + 1 transcript_id "g1118.t1"; gene_id "g1118"; 3 AUGUSTUS stop_codon 4668924 4668926 . + 0 transcript_id "g1118.t1"; gene_id "g1118"; # protein sequence = [MSAAGLFDQCLKSSNPRAVWREIHDTDANGDIPSVRGGHAMCIDTQRRYIYLFGGWDGQTSLADFWRYDIKEQRWVVL # SANTSLESNGPGPRSCHKMVYDSKTNSIYVLGRLDDQDRPTSRAQTRNSESAGSPGFNRSSGAADETPTLSSRPMPSSEFYRYRCEDNTWEHLDIDVN # GPRTIFDHQMVMDSEAQILYVFGGRAAEKDYDYSGLHSFNVRMKKWSLLQFGGLIHDRATLSESSNWLYRYPSRPGKWQKIQPLKGLHKSPTPSSSSP # QITANPPSRFAHQVVYDLPSKTVYLHGGTMMDSDSAKLREGNDGQTEEAPMKRLSDFWEMSLWRFKEMCETQAPVQSLIYLQNQVSEVVNHDDPSETQ # LFRSLLTHLLMNSSPISTVPSAIETESPRNNYAGNAKPQTDSSLLNISTGNSSDQLGHPGLLQSGLDSVHISSEPLPDLSSQNRTNTKIQTSEDPYER # KLHPTKDPTSQECFVQRTKTFEAILEFVDDDAKQPAGSLLELVDVDADLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1118 ### # start gene g1119 3 AUGUSTUS gene 4669274 4670935 0.56 - . g1119 3 AUGUSTUS transcript 4669274 4670935 0.56 - . g1119.t1 3 AUGUSTUS stop_codon 4669274 4669276 . - 0 transcript_id "g1119.t1"; gene_id "g1119"; 3 AUGUSTUS CDS 4669274 4670935 0.56 - 0 transcript_id "g1119.t1"; gene_id "g1119"; 3 AUGUSTUS start_codon 4670933 4670935 . - 0 transcript_id "g1119.t1"; gene_id "g1119"; # protein sequence = [MIPHKAWACGDTVTALVKFSPLLKGVGVLNINTSIHETVKVYTRTGHQEHNRAVASMKHEIVGGKAVEVHEHEHRHRT # AQTPCGSPSPGTPSLSSSYRSTGSAGGYFAYSPNGSQTSQPGPSSLPASLSASPSSQLLRDPVEGLEMSQDDVVTYLLLPIPLNITPTHVLDPIHVTH # RIRWSILILNPDGHTSELRCSLPLHVLDPRLLNEARMNTAATRRLLIGGPEVPAEETEDDMELPSYHAHVRDRIANMYLPESATMRVTNPWVRDGVNS # LGGNSDVVSPWPRSRSGYSSPLDAHALSHLPHAPGSGDSTPLDWVNSELLLLHPDSDTHTQTIGHFSQTSSEVSPDHSNPSSSPVTRPNSRPTSSYPS # RRSSRASSPERGGHVNPQSLHVAGPNETYIHTGKDSRNIQGVFKATMKPFTSLTHPTWLGSRSHSHNNLSSLTSSSSLTANLSHDRPGQSITPGNRTL # QLSDYNNSQEAMQRVPDYQIASRGFIGGVPPLTSLRDLPSYEDSQLGTRTRSDSDLASRFAGVSLSPMATVAGRTALPTTPLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1119 ### # start gene g1120 3 AUGUSTUS gene 4679249 4680340 0.95 - . g1120 3 AUGUSTUS transcript 4679249 4680340 0.95 - . g1120.t1 3 AUGUSTUS stop_codon 4679249 4679251 . - 0 transcript_id "g1120.t1"; gene_id "g1120"; 3 AUGUSTUS CDS 4679249 4680340 0.95 - 0 transcript_id "g1120.t1"; gene_id "g1120"; 3 AUGUSTUS start_codon 4680338 4680340 . - 0 transcript_id "g1120.t1"; gene_id "g1120"; # protein sequence = [MQSFSSVKVEFCDLDGLQWTGSALRKRTVSRPDSNSGILSQCKNLNQNSPRRARAQTLFCPSSPSLSSSSLSPSSSYF # PSLDTPLSSPKCRKPEALTTLNNVDFAPNFDEKTVRACVSPVKAALDSQKHTASNRDLDSRPPAKQRRRSRSPVKGAFIGETKSSAKHESRSDILPTV # VYDSKPAMSTPPPPAYTGGAPMERLESSSSRRSLTRTYTQAEITFGVSPTVATEVMRGRERSRGFRVPSKLALEDTMVFDESEEVIESDLVGLGPIRL # SPPKADRERGQRLRGLAPQHPSSSARLFQSIVEEEDPLVTPTPERFSSVLEYPISPETPIQPRCSCADLTLLKRKRQSSETQNEIDQEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1120 ### # start gene g1121 3 AUGUSTUS gene 4683712 4686250 0.15 + . g1121 3 AUGUSTUS transcript 4683712 4686250 0.15 + . g1121.t1 3 AUGUSTUS start_codon 4683712 4683714 . + 0 transcript_id "g1121.t1"; gene_id "g1121"; 3 AUGUSTUS CDS 4683712 4684368 0.3 + 0 transcript_id "g1121.t1"; gene_id "g1121"; 3 AUGUSTUS CDS 4684984 4685313 0.91 + 0 transcript_id "g1121.t1"; gene_id "g1121"; 3 AUGUSTUS CDS 4685366 4686250 0.43 + 0 transcript_id "g1121.t1"; gene_id "g1121"; 3 AUGUSTUS stop_codon 4686248 4686250 . + 0 transcript_id "g1121.t1"; gene_id "g1121"; # protein sequence = [MNPYAYPAPGYYPPAQQYHPHPAPFYAPGYPTQLPPPSTTKLISSVKTLTHILFSSATNRSAKYPSLHHILAVDSTTL # KIDIKQKPRAGINASTFYAYADMYAMAIPTYHIRLISKAFPWSIEIKSTTPITCAAVWDALHSALQENIADSEWGMLAGEKKLRETIEKAAKKRGQSD # ADKALKRIDWLGDATIFRGLEKVEDFQKIRLLPGSDPVAETWVKGQNNYPPQPAVEQDFSSPLNGSFRGNGRGRGRGGGRGGWSRQSYNSATGANDTP # LGTPRYSPEESAQISPAIVAVVADAAPEPIIEAEVERKEKKEQKKRKSIGGEGAQNRLSKKSKIAEAVPAEDSKKKSSEEKEEKKKRKEAKKLAKDVT # ATAEISSAEGKQDKEIIEDVEMANVTSTKEEKKRRKSRSGGEGEHSLVTGTETKEKQKKQKKEVNEVEGQKKEEEQSSTEEQKKRKKRKEDDVVEVKE # REQENLEQKTQKTGRKERKEREAEVNGDAKKSEMKEEKKKRKSKKVETEETQEREQPEDSEHPEAKTEKKRRKKVEKQAAEVIEQAKEKSKEDKHKRK # DKEQQKNVIEESTATKKSKTEQVSVVEEAKLDVQTEKKKEKKSKKSRKSVSEAES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1121 ### # start gene g1122 3 AUGUSTUS gene 4686774 4687270 0.59 + . g1122 3 AUGUSTUS transcript 4686774 4687270 0.59 + . g1122.t1 3 AUGUSTUS start_codon 4686774 4686776 . + 0 transcript_id "g1122.t1"; gene_id "g1122"; 3 AUGUSTUS CDS 4686774 4686780 0.6 + 0 transcript_id "g1122.t1"; gene_id "g1122"; 3 AUGUSTUS CDS 4686852 4687270 0.9 + 2 transcript_id "g1122.t1"; gene_id "g1122"; 3 AUGUSTUS stop_codon 4687268 4687270 . + 0 transcript_id "g1122.t1"; gene_id "g1122"; # protein sequence = [MSFTRGVPCLRRATSLAYTDADEDAERLLNFGDSSAGGDGDEWVETHAGRKPNLDSAANPGEIADIPDDNAQDDDLAS # GVGNMSLGNVPAMSEIPDIDEIPDMEEEDLEEGDAATAPVKATPNVIDPRCVIALYSLSQFST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1122 ### # start gene g1123 3 AUGUSTUS gene 4687595 4687861 0.92 + . g1123 3 AUGUSTUS transcript 4687595 4687861 0.92 + . g1123.t1 3 AUGUSTUS start_codon 4687595 4687597 . + 0 transcript_id "g1123.t1"; gene_id "g1123"; 3 AUGUSTUS CDS 4687595 4687861 0.92 + 0 transcript_id "g1123.t1"; gene_id "g1123"; 3 AUGUSTUS stop_codon 4687859 4687861 . + 0 transcript_id "g1123.t1"; gene_id "g1123"; # protein sequence = [MKKVIERMNNSVVAEQLAQQKIPKEKKKWPFGRKTSGTGKDDKNAAAAAAAGDDEEVEGMRVDFYLVVFLKFIASIVP # TIEVDSTTSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1123 ### # start gene g1124 3 AUGUSTUS gene 4692972 4693518 0.41 + . g1124 3 AUGUSTUS transcript 4692972 4693518 0.41 + . g1124.t1 3 AUGUSTUS start_codon 4692972 4692974 . + 0 transcript_id "g1124.t1"; gene_id "g1124"; 3 AUGUSTUS CDS 4692972 4693016 0.42 + 0 transcript_id "g1124.t1"; gene_id "g1124"; 3 AUGUSTUS CDS 4693096 4693518 0.67 + 0 transcript_id "g1124.t1"; gene_id "g1124"; 3 AUGUSTUS stop_codon 4693516 4693518 . + 0 transcript_id "g1124.t1"; gene_id "g1124"; # protein sequence = [MIAQCVEEYKEMYVIAMRRAIDGNNLAAGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGNADGDRGRGGGGGGNS # RGGRGGARGNRGARADNGSRKQSSSSTDARRDIIDINSDDGKYQVPPSRVIFILYPNRLATASPQTTKYRTNETCFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1124 ### # start gene g1125 3 AUGUSTUS gene 4700722 4701096 0.75 - . g1125 3 AUGUSTUS transcript 4700722 4701096 0.75 - . g1125.t1 3 AUGUSTUS stop_codon 4700722 4700724 . - 0 transcript_id "g1125.t1"; gene_id "g1125"; 3 AUGUSTUS CDS 4700722 4701096 0.75 - 0 transcript_id "g1125.t1"; gene_id "g1125"; 3 AUGUSTUS start_codon 4701094 4701096 . - 0 transcript_id "g1125.t1"; gene_id "g1125"; # protein sequence = [MTETITNPPFIGINNFRDVGRVINACTSRHDCVEVCELNKFPRMKEGMLLRSGRLDEATAEDTQLMVDEYGLKTVIDL # RTKAEHLRSRDFEVQCERRWDTVKINFIGRKFELNLLKQLRWWQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1125 ### # start gene g1126 3 AUGUSTUS gene 4703662 4706169 0.42 - . g1126 3 AUGUSTUS transcript 4703662 4706169 0.42 - . g1126.t1 3 AUGUSTUS stop_codon 4703662 4703664 . - 0 transcript_id "g1126.t1"; gene_id "g1126"; 3 AUGUSTUS CDS 4703662 4705968 0.45 - 0 transcript_id "g1126.t1"; gene_id "g1126"; 3 AUGUSTUS CDS 4706020 4706169 0.8 - 0 transcript_id "g1126.t1"; gene_id "g1126"; 3 AUGUSTUS start_codon 4706167 4706169 . - 0 transcript_id "g1126.t1"; gene_id "g1126"; # protein sequence = [MFLSCLDSITKRLEHIKARNALITAMLPESNIDEIQACETEFSDAIERFQTLRGLHAAEDITKLQDKLEVVYSEIKAI # SQQVTQLQTSFDDLKARLGPLDDSQLVVPTMPNPPTIFHGRNEIVNEIANTLARRSIDGKLSRFCILGPGGLGKTSAALAVMQHPLIRSSFEEGQFWI # PCNTANSPNALLDALAEGTGVNPQTKNLLRSILSRLSSLPGQSILLLDNFETPWLLDEGSQSRVQAILEQLNSLPNVAILLTMRSNSPPLRDWKHTDL # PPVDLDNSRKIYLDVDGAAHDSPDLDVLLDTLGHMPGAVYLMANLGANSLSTPTELLQQWRAGGINVMDHCIGLSMKSSFVTDCEGAIELLQVLSMLP # AGVVRSHLKLWLPSYRPEAIQCLRKAALLHVSSGSDPKLFVLPVIQSCVKKIIPDNVRQRVYNSCCQILLSYNGAIDGPNNPLFKAHSRFIRSEQSNV # ESLLTEMLTNIFHSHTDTTAETVAHQLDAFRVFIWFRYWSQPHVELAVKVAQAAEMTNNTTSQADTLLCLGKMYRITGKSDDALKTLARARELFSTLD # YTQRRNRRNAMRCEVTYTEMSALVRSLRQEDVIPLVESLRPQCEGEDTYLEALRLESLSAYQFKAHQFEAALVSISESRNLFRENDCPFDAATCLLDL # ARILGCLERYEEALQIADEAVSSFHDLGFEGYNTCFSYILKARIMKSLQAPGDAILEVLNDALKHSYREPLPLAFTLLEYGEVYLKRRDWRAATLAYE # EARNAISRLDKEGHRGIPDECNNKIQVIRRYETQEVDPPEEELASLIPAPRLFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1126 ### # start gene g1127 3 AUGUSTUS gene 4708345 4709058 0.89 - . g1127 3 AUGUSTUS transcript 4708345 4709058 0.89 - . g1127.t1 3 AUGUSTUS stop_codon 4708345 4708347 . - 0 transcript_id "g1127.t1"; gene_id "g1127"; 3 AUGUSTUS CDS 4708345 4709058 0.89 - 0 transcript_id "g1127.t1"; gene_id "g1127"; 3 AUGUSTUS start_codon 4709056 4709058 . - 0 transcript_id "g1127.t1"; gene_id "g1127"; # protein sequence = [MVQTFASPIITLNTQGSRIIVGEMQESVSFVAYKAPENRLLVFADDSQSRWVSAVAMVDYNTVAIGDRFGNIIVNRLD # TKESDQVDEDPTGAGILHEKGILMGAPHKTKMVAHFHVGDLITSIHKVAMVAGGREILLYTGLHGTVGILVPFVSKEDVDFISTLEQHLRTEQSSLVG # RDQLSWRGYYTPVKAVVDGDLCETFARLPGSKQSAIAGELDRTVGEVLKKLEQLRVTTSGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1127 ### # start gene g1128 3 AUGUSTUS gene 4710410 4712139 0.73 - . g1128 3 AUGUSTUS transcript 4710410 4712139 0.73 - . g1128.t1 3 AUGUSTUS stop_codon 4710410 4710412 . - 0 transcript_id "g1128.t1"; gene_id "g1128"; 3 AUGUSTUS CDS 4710410 4711337 1 - 1 transcript_id "g1128.t1"; gene_id "g1128"; 3 AUGUSTUS CDS 4711454 4711572 0.85 - 0 transcript_id "g1128.t1"; gene_id "g1128"; 3 AUGUSTUS CDS 4711624 4712139 0.87 - 0 transcript_id "g1128.t1"; gene_id "g1128"; 3 AUGUSTUS start_codon 4712137 4712139 . - 0 transcript_id "g1128.t1"; gene_id "g1128"; # protein sequence = [MISAMEKSKLVYILNRDAAANLTISSPLEAHKNGAIIHHIVGLDVGFENPTFAALEVDYTESDQDPTGEAFKNAEKML # TYYELDLGLNHVVRKWSEPTDRRANLLLQVPGGQLASSDRFDGPSGVLVCCEDHIIYRHMDAPQHRVPIPRRKHPLDNRDRGMLIVSAVMHKMKGAFF # FLVQNEDGDLFKVTIEHEDEEVKSLKIKYFDTVPVAYFYQFQKLGDDDEEPEFSSTSYRSFGMADPTAPLPNEYFRPRPLENLALADELESLDPILDS # KVLNILPNSDTPQIFAACGRGSRSSLRTLRHGLEVEESVSSDLPGIPNAVWTTKKREDGKSLYLFEIQTYILTTLYSDAYDSYIILSFVNGTLVLSIG # ETIEEVQDTGFLSSARTLAVQQIGTDALLQVHPEGIRHVLANGHVTEWKSPSGKTIVNATTNKRQVVVALSSAELVYFELDLEGQLNEYQDRKAMGST # VLALSIAEVPEGRQRTPFLVRASPHSVNYEFLIDRRRLLAAKTKLFESSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1128 ### # start gene g1129 3 AUGUSTUS gene 4712852 4715110 0.94 + . g1129 3 AUGUSTUS transcript 4712852 4715110 0.94 + . g1129.t1 3 AUGUSTUS start_codon 4712852 4712854 . + 0 transcript_id "g1129.t1"; gene_id "g1129"; 3 AUGUSTUS CDS 4712852 4715110 0.94 + 0 transcript_id "g1129.t1"; gene_id "g1129"; 3 AUGUSTUS stop_codon 4715108 4715110 . + 0 transcript_id "g1129.t1"; gene_id "g1129"; # protein sequence = [MKFFLLRRFSHLIHRRTRSDSALPELSLPSQRDFPHSLSLGDLVQQLGDYSRYPNALPPTESRTTTSNRPLLAESSEN # PSVAIFYVEQCISQLQKENAQLQVTREHIKTQLELKSTELYSYKTRIASLNHSLSKLNLVIEAFEQELVSLGTSIDSIDQSFVLLLDIAVCGPVFHRT # RSAISSGFVFMDAIVDAIREAAEVPHSPWSALIPPVIGARSQDHYASALSITLRTRSDVRRIKNLARYWKSSAQEDEKHKDVITPSGSTLSEVQEVFT # TERQKAVDALWIKLKSGELPIRSTVVSQAREEDTALIHAFTVKPSAPSVNASSLFMPPDPQSIKPQMSASVAASIVTLNVSKCLLTMLFHFFYFLQAS # LTHSSSGESFPSTQSSGDSSIVGSAPSTSTRLCSEEAISPLPRLSSFSSDFWAAASNAGVSSDNIAAGHDSESAGSDFTTKDAIQSLELIYNRFNNMK # LDTINEASPVCPADTILPEAHTTCVPAENAFLSETDILSSDSDESGSDFEADFVIVSIPTSAESSSAKKRNSILKSLNISSRIPRRISISLSPTSFKS # RSPTKSAKTGLNVPLKKGNLLSTPDRPGDISKVLPMSVGSTTVRKLVGKTPKDRSTPSASRCQEARTSSPIANRPPSRPTISSSLKKTHSTSPSRSTK # AANARNNIHFTSPRTGVAAASGSSQNVYASGRVDTMQGQSVASLSSMKKNRKNYPSRLPVQHHRPPPPVPAKGEIGRRDIVAAKKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1129 ### # start gene g1130 3 AUGUSTUS gene 4716551 4718038 0.53 - . g1130 3 AUGUSTUS transcript 4716551 4718038 0.53 - . g1130.t1 3 AUGUSTUS stop_codon 4716551 4716553 . - 0 transcript_id "g1130.t1"; gene_id "g1130"; 3 AUGUSTUS CDS 4716551 4717444 0.77 - 0 transcript_id "g1130.t1"; gene_id "g1130"; 3 AUGUSTUS CDS 4717502 4717888 0.55 - 0 transcript_id "g1130.t1"; gene_id "g1130"; 3 AUGUSTUS CDS 4717979 4718038 0.91 - 0 transcript_id "g1130.t1"; gene_id "g1130"; 3 AUGUSTUS start_codon 4718036 4718038 . - 0 transcript_id "g1130.t1"; gene_id "g1130"; # protein sequence = [MVITLAPGTFTYQLLTSRVTCLTTEGDLNESDSNNSNNSPNQGNDSAGPRGGAGTEVNSASGSSDQDRSSGGGSSNAR # TKRSLGPTYSQRDNKRPRQHSDFQVILNASPISGGNICFLTLGFQELHLAFNCPRENLLSHGFSEYSVIPMPVSVPSGTDKPPRRGSFTTSIGSSSGA # SSSGTTANSIENQPLFSPHSGPVVPEGIAATRSTDNSLTQPASQSIVESSNATSVIESSSQKALPIVDHAGVILDTKVHQSTKGIVWGGKMYLEGLKP # APKPVHVVVKLADWERDSEAPEGSQTPYGKSLCYEAKIYHHLVGSNIGPHFYGVFNNSGSIALVLEYKGKRLPDFGTLTDDRYFHSCMMGSGIFSDIA # VFSFSRKQMLFNQACNLHSLGVKHKYLAPRNVLVNKEGDLTIVDFHRSKLGHKCKGSRRCSELRDFAEHLQIVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1130 ### # start gene g1131 3 AUGUSTUS gene 4720963 4722423 0.9 - . g1131 3 AUGUSTUS transcript 4720963 4722423 0.9 - . g1131.t1 3 AUGUSTUS stop_codon 4720963 4720965 . - 0 transcript_id "g1131.t1"; gene_id "g1131"; 3 AUGUSTUS CDS 4720963 4722423 0.9 - 0 transcript_id "g1131.t1"; gene_id "g1131"; 3 AUGUSTUS start_codon 4722421 4722423 . - 0 transcript_id "g1131.t1"; gene_id "g1131"; # protein sequence = [MVRHNLTLSTVTHFAKSFGVRRDREDGCATISSPDSADSPGYLLRRVARNLDAWMDALARSQIEQVPWADIYRKSKKT # TFVYHSASEESDDSEDDSYQPNQGDTTTDEGDTEEDDNDEDDTEEDDTDNGDSDNSSDSPDQGNDSAGPRGGAGAGGNSGSGSSGQGRSSGGGSSNAR # TKRSLEPTYSQGDNKRPRQHSDFQVVLSVSPISLGNMFLILGFQQLHLAFNCPGEQLLSDGFSNYFFIPMAESSAGVSGGVTTNITAALPVSVPSGTV # TPPRRGSLTSSISSGSGTSSSDTDAFWSPTSTVSSIHSLPLSSPQSSPVRPKGITTTRSTDNSLTQTTSQSVVESLSATSLIESRPQNPLSIIDHAGV # ILDTKVHQSTIGIVWAGKMYLEGLASVPKPLRIVVKLADWERDSEAPEGSETLHGKALRSEAKIYHHLVGSNIGPHFYGVFNNSGSIALVLEYMGKRH # SNFSTLTDDRYFSMHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1131 ### # start gene g1132 3 AUGUSTUS gene 4722463 4723620 0.98 - . g1132 3 AUGUSTUS transcript 4722463 4723620 0.98 - . g1132.t1 3 AUGUSTUS stop_codon 4722463 4722465 . - 0 transcript_id "g1132.t1"; gene_id "g1132"; 3 AUGUSTUS CDS 4722463 4723620 0.98 - 0 transcript_id "g1132.t1"; gene_id "g1132"; 3 AUGUSTUS start_codon 4723618 4723620 . - 0 transcript_id "g1132.t1"; gene_id "g1132"; # protein sequence = [MSSDLSADEQLIQAILSATDIVMMEHGSIEDASQSTRSPSLYDLHLPKQLQLRMLKLGTPSSRVYVPEGDSLPRVQLV # GSEEDRFLKRLLQRPAVLELLRGTRGVNLRQQWSAQLNLLIALDCIDEESVVFAENTVSMVIADLLALVVVDLSEVQFAHMGRWKLFSPYSSREKETK # ADLLFGLHLENTIKQFDVKLSSLQGYQAIWPLVKDFNPTYMRCITSMECKNIALGDPKSYLMLLLLTRLMTDRKVREFWPGLDCKGCQEFAESHDALA # RDAAPVRIPDDDPARVLGIKPTTESVVFRAEFERLLALIPFNNVTVSASDSKKTVGPPRNKSPWYDTVYKEMEMLLVELGHPDPRELNAIMHWVTPIR # NIMIQVGKCSSVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1132 ### # start gene g1133 3 AUGUSTUS gene 4730684 4732513 0.91 - . g1133 3 AUGUSTUS transcript 4730684 4732513 0.91 - . g1133.t1 3 AUGUSTUS stop_codon 4730684 4730686 . - 0 transcript_id "g1133.t1"; gene_id "g1133"; 3 AUGUSTUS CDS 4730684 4732513 0.91 - 0 transcript_id "g1133.t1"; gene_id "g1133"; 3 AUGUSTUS start_codon 4732511 4732513 . - 0 transcript_id "g1133.t1"; gene_id "g1133"; # protein sequence = [MVLKACGKFNEGDLRANSGYLYVSIIYNVSICLSLYCLAMFWICVNDDLKPFRPMPKFLCVKGILFFSFWQSIGVSII # VAAGAIKHLGPYTDPESISLGLTDTLICVEMPFFAIAHIFAFSHTDFIDRDKTFIGRMPISYAFRDAFGVKDVVEDTKTTLRGEGMDYREFEPSEGFM # HQGLGRERRIRAGLRYSKGGKRKYWLPTFSAAEPPGRIERGVDRVVQKVAGRDQAEDVYAPLLQGQAEDVVHLAPDMIDDSDELVDLWSSSRVGVEEG # FDLPFGDLDDDDEALFAHCKRYLFGDYNYPCIDASTEFARAAIWDEEERILRDEHGAWFSPIRGSKGFMNIQQQRHVPGGYGAMGTSNRQYVDDAREE # RVIDMELEREERKVTGAVKMQWARNKNQTRPSGSGSRSPQTGNGSRPTSHSPNVRVRVESAGSSSTPSASTPSRTPAGSPGASRLRSLPNPLSRSNSS # NNESRTPPLPPDAVDLVVEASEDDDPKKRLRKVYRRGFVARDEQGHPEERGEIEVKGHGRDRVEAGEEIAEAIEDEGEHVESAVERVEGDDVDLEIDR # ETTTGVAEQDSHGQDVVIARSTTPPAYARPRYDLDDDNPWA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1133 ### # start gene g1134 3 AUGUSTUS gene 4737605 4738207 0.58 + . g1134 3 AUGUSTUS transcript 4737605 4738207 0.58 + . g1134.t1 3 AUGUSTUS start_codon 4737605 4737607 . + 0 transcript_id "g1134.t1"; gene_id "g1134"; 3 AUGUSTUS CDS 4737605 4737758 0.58 + 0 transcript_id "g1134.t1"; gene_id "g1134"; 3 AUGUSTUS CDS 4737813 4738207 0.63 + 2 transcript_id "g1134.t1"; gene_id "g1134"; 3 AUGUSTUS stop_codon 4738205 4738207 . + 0 transcript_id "g1134.t1"; gene_id "g1134"; # protein sequence = [MAQYWIDILLKKSSELKRKDPRRPVDDISIELLLWLATQTTQPYNPLLDVKYLDIPQDTPVENLHTYLLGHEKYAWHD # MHTSWSTATQALFTIRLQSTDITGLTVPPIRSAYMMQYRNGLIGKHFKTLMQTAVFHVQDIVSDNQFTLIKALGELGAHLWIAEIDNLEEYLVAISIV # IVESHY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1134 ### # start gene g1135 3 AUGUSTUS gene 4744093 4744557 1 + . g1135 3 AUGUSTUS transcript 4744093 4744557 1 + . g1135.t1 3 AUGUSTUS start_codon 4744093 4744095 . + 0 transcript_id "g1135.t1"; gene_id "g1135"; 3 AUGUSTUS CDS 4744093 4744557 1 + 0 transcript_id "g1135.t1"; gene_id "g1135"; 3 AUGUSTUS stop_codon 4744555 4744557 . + 0 transcript_id "g1135.t1"; gene_id "g1135"; # protein sequence = [MYSGNESPHRQGKGPRIPPKQSKDIDVWFVPGITFGHRDAAVHGDPMTARHMQGQVEGFLWHKFGKVVSWQNAYSTEL # KLDHVRFRMKHDAGYLTGYAIGIVDMGSGPSGPGTATTDPFHGVYESVPTETGGDFEKLLETFRKEYPAATPANGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1135 ### # start gene g1136 3 AUGUSTUS gene 4746743 4747612 0.95 - . g1136 3 AUGUSTUS transcript 4746743 4747612 0.95 - . g1136.t1 3 AUGUSTUS stop_codon 4746743 4746745 . - 0 transcript_id "g1136.t1"; gene_id "g1136"; 3 AUGUSTUS CDS 4746743 4747612 0.95 - 0 transcript_id "g1136.t1"; gene_id "g1136"; 3 AUGUSTUS start_codon 4747610 4747612 . - 0 transcript_id "g1136.t1"; gene_id "g1136"; # protein sequence = [MTANPAPVSTAPVLPALPPAKETPYKSRTTDLLIFREGQLGDKRDAVIEDLGNMVPEVDLDWFFENLLPPMPKGIDTA # TVVEQLRKSGVVTENGWAGFSQNPQDERRHEDVVFAQLQPIFKAISDTVQELDPSLQQTFTLLLQPTKYPTSERACTSKPDNCWVAIEDVESIKNDPG # RFYTWYNIAGPAEDKKLPESSREQRNKVRFLITVFTSPFTQLVSVECRSDCLQHATNYVSRSLSSVYLWYDDAGSRTEGLVCVSGICSYYKGVRFPQG # MFLLSGLYYAHGDVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1136 ### # start gene g1137 3 AUGUSTUS gene 4750767 4752341 1 + . g1137 3 AUGUSTUS transcript 4750767 4752341 1 + . g1137.t1 3 AUGUSTUS start_codon 4750767 4750769 . + 0 transcript_id "g1137.t1"; gene_id "g1137"; 3 AUGUSTUS CDS 4750767 4752341 1 + 0 transcript_id "g1137.t1"; gene_id "g1137"; 3 AUGUSTUS stop_codon 4752339 4752341 . + 0 transcript_id "g1137.t1"; gene_id "g1137"; # protein sequence = [MPSPSLQAQGGQADFSYFDVPLKGPRSPRKATFPQPSHSSAKDKEQDIFSPVFEEIENSEWTAVDKPPSPALSLSQNS # NSQAQGALNSAHRGAPSHLYETYTALGMLPASSQQIHPFPRPYSLPHSSSSGSGGSVISSGTETDNEKTSLPRLGRSQTEEGLNIYNSEQLGIGKPSW # DSFKSVDRSSSASLPLPSQIPFYTLPKVGELHNSDVGRLRGFVSEVARSQVPESSAEDMDGPQLESRNSSGSSTDTLPSTSHSLSPSPPKAADPPSFR # SPPPSSSGAQHNPNNPNAHAFRNNLLDCAHPASARTSSVLSSDEARQRLNTLLETTAHATALRRRPTSSDSNSSSSVFSQPPEPPIILPPPSPPPNMG # FMSRYAVSQRSMESNGSADTQTPPPPVPKIVDPSELPPVLPPSRTRSVTGNFLAGPSTSSASTSSASTSSASSTLSYPGAANLGNSSLSAPGALGQSS # MASRTVSPHSSATPPYAPFLSHMPPPADSWIEVETTPLEYRLNIRLPGFKRDGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1137 ### # start gene g1138 3 AUGUSTUS gene 4757137 4757589 0.94 + . g1138 3 AUGUSTUS transcript 4757137 4757589 0.94 + . g1138.t1 3 AUGUSTUS start_codon 4757137 4757139 . + 0 transcript_id "g1138.t1"; gene_id "g1138"; 3 AUGUSTUS CDS 4757137 4757589 0.94 + 0 transcript_id "g1138.t1"; gene_id "g1138"; 3 AUGUSTUS stop_codon 4757587 4757589 . + 0 transcript_id "g1138.t1"; gene_id "g1138"; # protein sequence = [MVSGSGPTLEATVNFNGRTPAVPDRYIQESAKFAAITVLNAAPKYLQGVSTIRILKWDGYPVADQDDYFHFDVRFQSK # VLNPTTGTGKHELEVVNGIYNGRCKEEEGEVTGRLTDPARREVVSIIRGRIGQASVSCLFLRVLHDLMALWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1138 ### # start gene g1139 3 AUGUSTUS gene 4761466 4762184 0.61 + . g1139 3 AUGUSTUS transcript 4761466 4762184 0.61 + . g1139.t1 3 AUGUSTUS start_codon 4761466 4761468 . + 0 transcript_id "g1139.t1"; gene_id "g1139"; 3 AUGUSTUS CDS 4761466 4761654 0.61 + 0 transcript_id "g1139.t1"; gene_id "g1139"; 3 AUGUSTUS CDS 4761714 4762184 1 + 0 transcript_id "g1139.t1"; gene_id "g1139"; 3 AUGUSTUS stop_codon 4762182 4762184 . + 0 transcript_id "g1139.t1"; gene_id "g1139"; # protein sequence = [MGGMAAQIPIKNDPAANDAVMEKVRLDKLREVLAGHDGTWIAHPLINKIALAVFNEHMLGPNQYHVRREDVKVAAVDL # LNPRVPGTITDEGVRSNISTSLAYTSAWIGGNGCIPLNYLMEDAATAEITRVQLWQWVKYNSRLESGQYITAEYVEKLIDELAPDVKKIYPGVKEDNL # KIAVDYLKGQIKKEWPSEFLTSDLMPYLAIADGAEPKWQKSAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1139 ### # start gene g1140 3 AUGUSTUS gene 4764237 4764974 0.29 + . g1140 3 AUGUSTUS transcript 4764237 4764974 0.29 + . g1140.t1 3 AUGUSTUS start_codon 4764237 4764239 . + 0 transcript_id "g1140.t1"; gene_id "g1140"; 3 AUGUSTUS CDS 4764237 4764239 0.62 + 0 transcript_id "g1140.t1"; gene_id "g1140"; 3 AUGUSTUS CDS 4764287 4764316 0.57 + 0 transcript_id "g1140.t1"; gene_id "g1140"; 3 AUGUSTUS CDS 4764473 4764630 0.97 + 0 transcript_id "g1140.t1"; gene_id "g1140"; 3 AUGUSTUS CDS 4764683 4764974 0.8 + 1 transcript_id "g1140.t1"; gene_id "g1140"; 3 AUGUSTUS stop_codon 4764972 4764974 . + 0 transcript_id "g1140.t1"; gene_id "g1140"; # protein sequence = [MDAIKLPPCHLPLEVAEGHEEVNEIWASAFPDESTVKEDAIYDAGFGNIQYMFSNPKLSPLVTAMTRVTYPVAMVRWN # YHHLDQFRIMNLDFYLNRKSHPKSVLARIIGSVKLVHGSEDVAYPKSYAEEFLRQLEEAGVEASLLEVPGAPHYLSPDFAAW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1140 ### # start gene g1141 3 AUGUSTUS gene 4765635 4766468 0.49 - . g1141 3 AUGUSTUS transcript 4765635 4766468 0.49 - . g1141.t1 3 AUGUSTUS stop_codon 4765635 4765637 . - 0 transcript_id "g1141.t1"; gene_id "g1141"; 3 AUGUSTUS CDS 4765635 4766468 0.49 - 0 transcript_id "g1141.t1"; gene_id "g1141"; 3 AUGUSTUS start_codon 4766466 4766468 . - 0 transcript_id "g1141.t1"; gene_id "g1141"; # protein sequence = [MPSAVHDAVEEYSECWYPANSFPADDPGAAVTGSEGYCSLKSLLKVQQIQQSIRELSLIEGNTVDCNRYKKLDFGMCL # SELATNIQFPNLNALAVSFNGPGSREYCLGVTAVGELMRIHSKLEHLGISSLYLDTHCLQNLLSSMRVCAQLSSITLECITCAAGTESLISRDSSLAL # EENTAALPQWSRAPIQRLSLSDVGLSLVEVLFSPTKPTIFQIELKSLAIDCSNLDSNHGTMEGSVGFRLIDRHASSLQHLLLKHPKAINHGLYLVQFH # RPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1141 ### # start gene g1142 3 AUGUSTUS gene 4771386 4772289 0.21 - . g1142 3 AUGUSTUS transcript 4771386 4772289 0.21 - . g1142.t1 3 AUGUSTUS stop_codon 4771386 4771388 . - 0 transcript_id "g1142.t1"; gene_id "g1142"; 3 AUGUSTUS CDS 4771386 4771564 0.51 - 2 transcript_id "g1142.t1"; gene_id "g1142"; 3 AUGUSTUS CDS 4771632 4772289 0.43 - 0 transcript_id "g1142.t1"; gene_id "g1142"; 3 AUGUSTUS start_codon 4772287 4772289 . - 0 transcript_id "g1142.t1"; gene_id "g1142"; # protein sequence = [MPPGPGYNWICVLSSAAEIVGHAARYRASQVSRLSREKASANKARGVTLENDWNDLKAKTQTVEERLEVQERDGQREE # EGRIVVPLQPDFAPTTSNSASVSILEPMETTEDRVAISKEAHTPSETALNTVSNVESSVNSTSAMPFDEKPLEEGLSKSQSSATTESPIPVDLLEAEL # ERNKSAITEPAAAASTLAHRNTLQSSKVPSSKLGRLFHYGGTRRYGAASEFLRPSTSSANASDTPNRSVLLTDANIGRLVSKLSQMRGAALKLGQFLS # IQGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1142 ### # start gene g1143 3 AUGUSTUS gene 4780049 4781807 0.34 + . g1143 3 AUGUSTUS transcript 4780049 4781807 0.34 + . g1143.t1 3 AUGUSTUS start_codon 4780049 4780051 . + 0 transcript_id "g1143.t1"; gene_id "g1143"; 3 AUGUSTUS CDS 4780049 4780213 0.34 + 0 transcript_id "g1143.t1"; gene_id "g1143"; 3 AUGUSTUS CDS 4780419 4781807 0.98 + 0 transcript_id "g1143.t1"; gene_id "g1143"; 3 AUGUSTUS stop_codon 4781805 4781807 . + 0 transcript_id "g1143.t1"; gene_id "g1143"; # protein sequence = [MLWQEHIGTQASKRRHSPSSNGSASGSDNDVATIRAIARRKKKARLAKKPNVTFGTLITSGTTSQPSEDVVPTEQLAS # AANTRLETTQTLVGEPVQASLSSSRPQRNRRLPARYQDVLPEGTAVIVNAEPLVEEQVPLRRRVILHVREQLKTQLNSFGLWREYLEKPSHDPDGEVG # IQDMANIPSAQDPDDDGHTSDDSHCDATLNPTQTLLTGWQNNGNSTKSNGEMDKLANLIRRPEFQVSELQGYSAHTANAKITQADENWDYNKLKDSFL # ETSVDIEVPSGDKNIPSKVFSIPGLLYRSPLSVIRAAFASRLANQFHYTPFRLFQTSESPDGSDNDVQRVHTDIYNSDAFIQEHYRVLRAPTDDPDCK # REKVVAALMCWSDATQLANFGTAKLWPIYMLFGNLSKYIRASPNSGAVNHLAYIPSIPDSIKHEISMFHTKWKTQSKEIITHCSRELYHAIWRYLLDD # EFIHAYRYGIVIKCFDGVERRIYPRFFTYSADYPEKYVFICMCNQTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1143 ### # start gene g1144 3 AUGUSTUS gene 4783964 4784272 0.85 + . g1144 3 AUGUSTUS transcript 4783964 4784272 0.85 + . g1144.t1 3 AUGUSTUS start_codon 4783964 4783966 . + 0 transcript_id "g1144.t1"; gene_id "g1144"; 3 AUGUSTUS CDS 4783964 4784272 0.85 + 0 transcript_id "g1144.t1"; gene_id "g1144"; 3 AUGUSTUS stop_codon 4784270 4784272 . + 0 transcript_id "g1144.t1"; gene_id "g1144"; # protein sequence = [MYMRYFPGGGVGHTANRKFFKDVAEDAEELDGEPTGNQSPDEDDELYFPLDSELPLSDKEEMLGSSSDEENEDESDEE # DQVEDGSDGTDIDDWQWDDGYGSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1144 ### # start gene g1145 3 AUGUSTUS gene 4786949 4788327 0.48 + . g1145 3 AUGUSTUS transcript 4786949 4788327 0.48 + . g1145.t1 3 AUGUSTUS start_codon 4786949 4786951 . + 0 transcript_id "g1145.t1"; gene_id "g1145"; 3 AUGUSTUS CDS 4786949 4788250 0.69 + 0 transcript_id "g1145.t1"; gene_id "g1145"; 3 AUGUSTUS CDS 4788307 4788327 0.48 + 0 transcript_id "g1145.t1"; gene_id "g1145"; 3 AUGUSTUS stop_codon 4788325 4788327 . + 0 transcript_id "g1145.t1"; gene_id "g1145"; # protein sequence = [MPSSPSKAPTAAGPSRLPLPRSSSGREVASDGEVEQDQLAFTIESPSLPQLQLFENIFNTGKSLAVYCRDDPLWPILA # AVALPCSNCTKHPETCKVPEGSPRCSFCTGKKTCSLGKLLRYRYFARRCNQDLAYSRRFLELHGTPAQRVSWTIPEDVWHRYDELLHSSTSATKVLVE # LNMLDDQDSQAVDRSELRRFQEAQEQEALLAARRKRVNASPPPKVRSKKRRLTKVVEEPVIEEVPRLVRLVIPPSRPAPSAPGSAPSTFARSSAALPL # TSVQATGQLGSVQGPSPLARLADLVDQQTDSQAEASTRSLGPGSSPIKASLGDSNLPKMSPVVRPPLVPRILSQHPYRVENERLAARIRLLESQLASS # RQENATLTSALRDTSVSLEARQGELDQLRESVSSAAQQQELYDRLLDQVQTLKRALPGPPNEWIGFGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1145 ### # start gene g1146 3 AUGUSTUS gene 4803326 4804882 0.19 - . g1146 3 AUGUSTUS transcript 4803326 4804882 0.19 - . g1146.t1 3 AUGUSTUS stop_codon 4803326 4803328 . - 0 transcript_id "g1146.t1"; gene_id "g1146"; 3 AUGUSTUS CDS 4803326 4804584 0.84 - 2 transcript_id "g1146.t1"; gene_id "g1146"; 3 AUGUSTUS CDS 4804642 4804749 0.2 - 2 transcript_id "g1146.t1"; gene_id "g1146"; 3 AUGUSTUS CDS 4804837 4804882 0.53 - 0 transcript_id "g1146.t1"; gene_id "g1146"; 3 AUGUSTUS start_codon 4804880 4804882 . - 0 transcript_id "g1146.t1"; gene_id "g1146"; # protein sequence = [MLHRQNCRYATPRKFDQFCGWNNSQGGVPSNSITPHGSNCAGIAVATHAQPTALASEIVQPGVEGGTEELGRGVNSEE # IHAGTLQSPPEAPQRPPEAPQPPPEASQQPPEAPLRAPRTRVKLEEVKDEEYEASQPGPHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEIL # EAGRSAMERVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDLPTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTH # VVERKSDPTVQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELK # RSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKMVPCDSALTIEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1146 ### # start gene g1147 3 AUGUSTUS gene 4805732 4809369 0.23 - . g1147 3 AUGUSTUS transcript 4805732 4809369 0.23 - . g1147.t1 3 AUGUSTUS stop_codon 4805732 4805734 . - 0 transcript_id "g1147.t1"; gene_id "g1147"; 3 AUGUSTUS CDS 4805732 4808145 0.3 - 2 transcript_id "g1147.t1"; gene_id "g1147"; 3 AUGUSTUS CDS 4808198 4808233 0.74 - 2 transcript_id "g1147.t1"; gene_id "g1147"; 3 AUGUSTUS CDS 4808358 4809369 0.9 - 0 transcript_id "g1147.t1"; gene_id "g1147"; 3 AUGUSTUS start_codon 4809367 4809369 . - 0 transcript_id "g1147.t1"; gene_id "g1147"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRASSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEV # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEAHQELYGLNLPFEAEAAAKIDEESNEDANAIAAKNR # RCRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMRHMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNR # GTSYMVQCELESVGEFPPEQFDQKGELHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPNVHALAQNATPPPRVNLQTKPLTPVSTQR # YQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESHRGPNQRRTLAVHEEAVPPQGAPFGTPFVTGTQMNRPG # MAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTAGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQAMEPISFNRNTPTGA # RDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGG # APPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITI # ESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEA # RRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLHGEKCYKDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1147 ### # start gene g1148 3 AUGUSTUS gene 4827112 4827591 0.71 - . g1148 3 AUGUSTUS transcript 4827112 4827591 0.71 - . g1148.t1 3 AUGUSTUS stop_codon 4827112 4827114 . - 0 transcript_id "g1148.t1"; gene_id "g1148"; 3 AUGUSTUS CDS 4827112 4827591 0.71 - 0 transcript_id "g1148.t1"; gene_id "g1148"; 3 AUGUSTUS start_codon 4827589 4827591 . - 0 transcript_id "g1148.t1"; gene_id "g1148"; # protein sequence = [MLPPALPVSERVPQTSINRDVGSDDDDDTVGPQPAVRPNIKRIDERSYGGALLRGEGSAMAAFLQDGTESRIPRRGEI # GLTSDEIAQYEDVGYVMSGSRHRRMNAVRIRKENQVISAEEKRGILKLQKEERERRETILREEFSELVQESLKGAERPKAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1148 ### # start gene g1149 3 AUGUSTUS gene 4828900 4829949 1 - . g1149 3 AUGUSTUS transcript 4828900 4829949 1 - . g1149.t1 3 AUGUSTUS stop_codon 4828900 4828902 . - 0 transcript_id "g1149.t1"; gene_id "g1149"; 3 AUGUSTUS CDS 4828900 4829949 1 - 0 transcript_id "g1149.t1"; gene_id "g1149"; 3 AUGUSTUS start_codon 4829947 4829949 . - 0 transcript_id "g1149.t1"; gene_id "g1149"; # protein sequence = [MDEENESKQPASSADTVVDPFHYNDYIKHEIQGEHTRTPPTPTPTMPPMNYKIPRHPNAIFSFPTPTPYSAPSGNPTL # TLAPCANGSASELFKCIVKKPDVVQMEINDEMQSNASDVTVQFLAELRVYTTVQTHRNICAFLGSLENVGMVLEYIDGRTLFDVISVRPELTVSKKID # YHNQLLDGLTHLHSYGLSHGDLSLLNIQVTNSSDTIKLLDFGRSVSADSVYANPEAEPIDPFTALAKRTSIFSPLPPSKTEQIHPGTRPFCAPEILRG # ECQDARLADAYSFGLIIVCLDRCETVDIRPWDQRKDLLPRDLFEGCSVFEDRARAYLQKWMTRRRLMKEDKMALP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1149 ### # start gene g1150 3 AUGUSTUS gene 4834210 4836317 0.68 - . g1150 3 AUGUSTUS transcript 4834210 4836317 0.68 - . g1150.t1 3 AUGUSTUS stop_codon 4834210 4834212 . - 0 transcript_id "g1150.t1"; gene_id "g1150"; 3 AUGUSTUS CDS 4834210 4834800 0.76 - 0 transcript_id "g1150.t1"; gene_id "g1150"; 3 AUGUSTUS CDS 4835082 4836317 0.8 - 0 transcript_id "g1150.t1"; gene_id "g1150"; 3 AUGUSTUS start_codon 4836315 4836317 . - 0 transcript_id "g1150.t1"; gene_id "g1150"; # protein sequence = [MPIHIPPDVEDPTPRSIHSQRLSPRSPVVDSDPWLRLSAAQKHAGELAAQSSQLKASLEALKIESNSAEGAARKAKND # LDRVRSLANRQKRASADLELRVKARRDELIQCEAFAKALSEPDLLALARARSGLATSPETTSGQDFEESAVEAIREASSNDGSIWSKIVSLVIGPRAP # DNYINSINMTLQARQELRYWKKVSNFWKKTARENNTNTGAPTPSTSIVSEIREILSDERKRAVQELTEKRKTLGLNTTCNESTSSGSLSSSSNESFKL # SYRLPDSQPSFTSVMSTMSKSVSSRESTVPQSADRLAPLASDLFKQDLLSSHSAQRMFSSSSHKSLWSSFAAEKQVQVISRPSEKSFGKRKAVSARDS # SASTVKSCVILADVDLISRRSQLPTSFSFESNVGQIGSSASISEESAFSNPTTNGPQIVVHISEELSSESLSSAGSMGDLDAQFATLHPELCLPVSKA # PTFEGDMTLVESGSEESNQGLTHHENDMTLVEVDREEGLKAIIKEDASLEDGPLTKKSRLPFFKIPDRLSQMSKMTGSSSKKSLSSFRSRNSSSTIST # VASKENNGPRSVKNFLVGIPGFKPILPLRIIKKDKLGTNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1150 ### # start gene g1151 3 AUGUSTUS gene 4840734 4841240 0.4 - . g1151 3 AUGUSTUS transcript 4840734 4841240 0.4 - . g1151.t1 3 AUGUSTUS stop_codon 4840734 4840736 . - 0 transcript_id "g1151.t1"; gene_id "g1151"; 3 AUGUSTUS CDS 4840734 4841240 0.4 - 0 transcript_id "g1151.t1"; gene_id "g1151"; 3 AUGUSTUS start_codon 4841238 4841240 . - 0 transcript_id "g1151.t1"; gene_id "g1151"; # protein sequence = [MAQRLCKVGCIPMDAATKIAETVGTSELGAKNVTQILLEARRLDLDLIEKHVDRAFHKFCSIAGTTKDFDDEKKKKKG # KSSQSDVMAPAIALFAQEIHGLTNTLPNIDQVKASYAYSKGKTVNFGKTVAFRTLCEIQVAASSEGGAPCLRLLDQVKSISGGARRLFQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1151 ### # start gene g1152 3 AUGUSTUS gene 4842597 4844744 0.13 - . g1152 3 AUGUSTUS transcript 4842597 4844744 0.13 - . g1152.t1 3 AUGUSTUS stop_codon 4842597 4842599 . - 0 transcript_id "g1152.t1"; gene_id "g1152"; 3 AUGUSTUS CDS 4842597 4843342 0.46 - 2 transcript_id "g1152.t1"; gene_id "g1152"; 3 AUGUSTUS CDS 4843445 4844016 0.36 - 1 transcript_id "g1152.t1"; gene_id "g1152"; 3 AUGUSTUS CDS 4844086 4844744 0.21 - 0 transcript_id "g1152.t1"; gene_id "g1152"; 3 AUGUSTUS start_codon 4844742 4844744 . - 0 transcript_id "g1152.t1"; gene_id "g1152"; # protein sequence = [MRKVSVTNSAISLFRLDVFSDAGDTATDSSSSSIFDQYSGLSRQNTTSSISSFTPESFTKPNSVRPSDTGSLSLRAHA # VPQPIIFDNPNSAISPSDDDSLASSPTLFSHSAPFPSALSPPPTPSDSLSGSFPPILQNIRKPFIIAHDKETQKLFDNPDGLVPWGAQYELARGVILR # EWTWEDVREKIHNFTGKSDADTMHSVCYIMKDVTLPKLLKTDIGQESDREQLAILENRERGLGLMGHFQGADHWFGGQIQQIATLRKTARCTLRLQLE # PLEMRRSTRLARQFGSRRVLQVRIPEDLLRGEARRETIKFLSNKFILNGRVFAPTPPKEGAVYFIEINEDYERTPVDKFGDQYRKSLREVLDWHNPMT # LNSQQVILVTRMIFVHQLTFSIAVVKICSKSSVSLIELIASDCTERKPPAHKVLTDGCGFMNEAALKAIATALNYSSRPTAVQGRIAGSKGLWTISPD # QVANASDIPQIWIRDSQRKIVYPHFNSFSRHYVMLDRVHRTFDLCHAALPSLSTVGPMVSLKKQSVLNLWANGVPIEIFRELMEKGLQDMIQPLIQWE # GQFAMPALWDAINKAGKVSHVRTTRLGAGMARALGLAGREYKKEGSTQGEADASIFSSTVSGRNEISGGVCGIFMQIYTSSLLHSSCHIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1152 ### # start gene g1153 3 AUGUSTUS gene 4849315 4850607 0.82 + . g1153 3 AUGUSTUS transcript 4849315 4850607 0.82 + . g1153.t1 3 AUGUSTUS start_codon 4849315 4849317 . + 0 transcript_id "g1153.t1"; gene_id "g1153"; 3 AUGUSTUS CDS 4849315 4850607 0.82 + 0 transcript_id "g1153.t1"; gene_id "g1153"; 3 AUGUSTUS stop_codon 4850605 4850607 . + 0 transcript_id "g1153.t1"; gene_id "g1153"; # protein sequence = [MSITSYFFPISKAKSKRVSATGSVNRTTSEGQAKLRPTPYPETAERKPSQPVTLNVSQTPSSSFILTSSTSNPDTTSF # SNGNHPRYMNLKRIAEETIEAVESGSFQLGGTIYDLKVAVNEMRSSTEFWSPDSKRLASWAATRVVRPDIRRNLDISLQEISSLEGSRFLAAQISAQY # SATTASSYFSSSAATPTATPTATPKIGLLNFASATKPGGGFLSGASAQEESIARSSTLYYSLTTRNADEFYKLHKRMKHNGKWNGLGKGKKQDLSDAG # EQMEGHTRDAGFYTHAMIYSPSVLLFRDDTGSWLKPLPVDVLTSAAVNAGDIRTKHHIKNATKSEKRALEARIEKEMKERMARILHIFALKGVRNLVL # GSFGTGVFKNNVEVVARLWKELLIETGAPFEKSFDRVVFAVLGKETYETFEDVLQLDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1153 ### # start gene g1154 3 AUGUSTUS gene 4853201 4853854 1 - . g1154 3 AUGUSTUS transcript 4853201 4853854 1 - . g1154.t1 3 AUGUSTUS stop_codon 4853201 4853203 . - 0 transcript_id "g1154.t1"; gene_id "g1154"; 3 AUGUSTUS CDS 4853201 4853854 1 - 0 transcript_id "g1154.t1"; gene_id "g1154"; 3 AUGUSTUS start_codon 4853852 4853854 . - 0 transcript_id "g1154.t1"; gene_id "g1154"; # protein sequence = [MSTSTSATDLKAIVKEGYDAIAPKYHSWAAPRLTQKRTEYIERLGKSLPKGSKVLELGCGAGLPATQQLVDQGFEVLG # VDISSSQLTLAKEHVPRAQFMEGDMTAIEFEKGSFDAVMAFYSLFHLPRDEHGPMLKKMVDWLKPGGWLLFNLHTDEKDHMRDDWMGVKMFSTGLGIE # GNRQMLVEYGAGLIDVEDVIDKEFVGRFEEDFHWICAKKSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1154 ### # start gene g1155 3 AUGUSTUS gene 4856576 4860289 0.65 - . g1155 3 AUGUSTUS transcript 4856576 4860289 0.65 - . g1155.t1 3 AUGUSTUS stop_codon 4856576 4856578 . - 0 transcript_id "g1155.t1"; gene_id "g1155"; 3 AUGUSTUS CDS 4856576 4860289 0.65 - 0 transcript_id "g1155.t1"; gene_id "g1155"; 3 AUGUSTUS start_codon 4860287 4860289 . - 0 transcript_id "g1155.t1"; gene_id "g1155"; # protein sequence = [MELAHRWGFHEVMKLATREIEKLEMPDIDRIVAYHKFELDRSLLLHRYAALTAREEPLNLEEGMALGMDTTLKIFRAR # EVARATPAADGSRSPTSATLPDDEMQSLIVDLFEIPEYSEPLPDDEPPRPQPTKKSPVKAAPVKKTQETPSAVPIAPEEPPAPPAPPAKPNRTSNATT # NATPTTATATTKSTNSSAWGATGSTANKPASPWGSNATTNSKSNNASSSAPATTTSTPLADVPLASTDVSPSLITTVDESGKDAKVIDKNADKSGDKD # VKKASPGGLVNSVTSLVPDFANPSSPSQQVRPTLQADSVVSRTPSILCSISSLPMQLTTTHLGPLPAMELQKPRPLPPTSRTQTCLEALPLLAETKTG # KSPQNDDRSVTDSGLDIDGGSDSGSMKTVEELSDDDETRVDSGEHDNFHDDDFGTSEKDEKHESKKGDDVVNDDNKRQAETVTVNDEEEVASIAIDGE # AMASFTATTWGSHNPGDIIVEDAKTALVAAHGDAAGANIGLGAIAGSSEIVTTAQVDDSEDIPLSKLVPSNTLYPGAADDTDQTALEFATTTTSEAPE # PSIEVPLDTAAAHNDLKEESPAANTTNTLIHTSEGKGIISTSTANEATLEPGAAEHTPSLLPEDNTQSVSDQSKSIQAQALEQTENKVTIKPEDEMQA # VSNGPVLTKTPLPEILDKGMSTVPAPQVDSESLVQVEAPLPEKSEDTNASILPAGDVSNSLTQDNAISSTNPRDTNSLTVDSGDQVTSDHLSTELVPE # ISSQQHKDTEAIEPTSTSEGDKDDSVQIKAATPIQDDKVATGEGNTEPSSAIVPQAEALVAETPGKGDDSKPLVTLLRDTEAGTQEPLTTTQQETLSV # LSPLKDEIRAASNSNGVQPETPNDPKILDGTDHVSSSDSPKVTKTSLENTTSTQVVVTVEGSTPDVQPLEADTPNKGEDALPSNVNPTGNNPVTIGDD # YPSGGNHDEGKSLDSKEEEPNLGAAPPVPDKDANVEPAQSLDPSTLDTPPPVPEKDANVEPAQSLSPSTAQAPPDVSASLLPSEEMKTVVPESSKESK # TEGPLQFPDGDTYAKNEEEVIPGISTTKNDSDTSNPAKLSIEALLPVLTPDSATNTVVSTVTKPGSTPEVSSLNPPDPGISRTEPDFFQSLSFNFGGG # DGTDNAFQFGRETPEHTTTDPHDSTWSKDYSHIWDAAQSSDATGAAARNAVNNLDLSAFSDDDEFFDLPEGPQGEGGFMAH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1155 ### # start gene g1156 3 AUGUSTUS gene 4864843 4865127 0.46 - . g1156 3 AUGUSTUS transcript 4864843 4865127 0.46 - . g1156.t1 3 AUGUSTUS stop_codon 4864843 4864845 . - 0 transcript_id "g1156.t1"; gene_id "g1156"; 3 AUGUSTUS CDS 4864843 4865127 0.46 - 0 transcript_id "g1156.t1"; gene_id "g1156"; 3 AUGUSTUS start_codon 4865125 4865127 . - 0 transcript_id "g1156.t1"; gene_id "g1156"; # protein sequence = [MPKISSDVVDGTKHENTVPEQPVSFAIMSLSPEYPNQQAHDSSNHADSSKHGKNEDREASATIRSKRSLRGDNPHSTT # KVKVNYQLSQTPYMDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1156 ### # start gene g1157 3 AUGUSTUS gene 4870531 4871720 0.99 - . g1157 3 AUGUSTUS transcript 4870531 4871720 0.99 - . g1157.t1 3 AUGUSTUS stop_codon 4870531 4870533 . - 0 transcript_id "g1157.t1"; gene_id "g1157"; 3 AUGUSTUS CDS 4870531 4871412 1 - 0 transcript_id "g1157.t1"; gene_id "g1157"; 3 AUGUSTUS CDS 4871568 4871720 0.99 - 0 transcript_id "g1157.t1"; gene_id "g1157"; 3 AUGUSTUS start_codon 4871718 4871720 . - 0 transcript_id "g1157.t1"; gene_id "g1157"; # protein sequence = [MDVDPEAAPPNPNSDSKTTTSKDDDLSQYNLDDYDDDTPGDSKHSYISGSLDDEDDIEAERSELEVLPSDNLLVVAKT # EDEISQLEIYVYEESEANLYVHHDLMLPNFPLCLEWLDFPPASSSSSTMNNDPSNLGFGNYIAVGTLDPEIEIWSLDVVEAMYPNSVLGRPDKTKAHI # PVPLGTGKKKKKKTKSRQTEKAYHVDAVLGLSWNKKQRNLLASASADKTVKLWDLSRDPTITGGEGGALRSFDVHKDKVQAVQWNEKDPAVLLTGSYD # RTVRTFDSRAPEGGVGAFLGSDVEALRWDPWNESGFYVSIILFPSCEMPVSITNSYYFAVLGFPRKRPCA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1157 ### # start gene g1158 3 AUGUSTUS gene 4873017 4874064 0.6 + . g1158 3 AUGUSTUS transcript 4873017 4874064 0.6 + . g1158.t1 3 AUGUSTUS start_codon 4873017 4873019 . + 0 transcript_id "g1158.t1"; gene_id "g1158"; 3 AUGUSTUS CDS 4873017 4873471 0.6 + 0 transcript_id "g1158.t1"; gene_id "g1158"; 3 AUGUSTUS CDS 4873557 4874064 0.99 + 1 transcript_id "g1158.t1"; gene_id "g1158"; 3 AUGUSTUS stop_codon 4874062 4874064 . + 0 transcript_id "g1158.t1"; gene_id "g1158"; # protein sequence = [MTKPKAKDDVEREQLSLASFLLITLLLPSLLTAPTERDIRIINVVNRFYAAASASSFSSAFYDSLTSDKTPPLNSTFL # AEGTRSLRTIILTRHLQRILDALPAAQIPKTDSNSSAIPIVNSDSQKSNIVAITVSPGISRADTVARILNADWTYLLALPLLHVCTKSSVAAVQSVLH # VLFLPTPFKFLSQTIQNQPKAKNDSLIDKSVTESPEEVLKPGALYAECAVVRLKVPSPPLEGVADGNRNDKGNGNGKAAEKEPQTLDLPDDGEFGGEL # AGRRVWEAFEAALKAWEKANPTLEELEREAKAAAEQEVIDAEEISS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1158 ### # start gene g1159 3 AUGUSTUS gene 4874915 4876419 0.24 - . g1159 3 AUGUSTUS transcript 4874915 4876419 0.24 - . g1159.t1 3 AUGUSTUS stop_codon 4874915 4874917 . - 0 transcript_id "g1159.t1"; gene_id "g1159"; 3 AUGUSTUS CDS 4874915 4875475 0.51 - 0 transcript_id "g1159.t1"; gene_id "g1159"; 3 AUGUSTUS CDS 4875538 4876419 0.24 - 0 transcript_id "g1159.t1"; gene_id "g1159"; 3 AUGUSTUS start_codon 4876417 4876419 . - 0 transcript_id "g1159.t1"; gene_id "g1159"; # protein sequence = [MSSVTTTTFPTTLAYYGAGIIGFFTLASFGMKKISGCFRWIPFSRNDLSTNVIQDLRQTLSQRDAEIVELREFLSTAE # NRSTKTARELEASRKEIEHVNRIRTNLEKRAREALVGKEALEHELGTRAEELATSREDANRIQEALNQTKTLLDMRTAELEVAQAFLPRSDRYAGADI # MKMVESLNSEIHQTASIMADVFSPDLQGPGTVFGDGEVGLHEAAVHTEEILGEGMTKILQTFNHQEENILLQIAFQASMCAFTEWIMDSWCYHDRDSE # VEAVLQETYEQLRETGKLWGPVSARWRILTRKYVRKLYPRVEQPNLAYHILAACANILITSGLHESEQGLLERLAARFADRVALIVERAVHLNNAIGD # DITSCEFVPIYCTPDVAFDPSTMENATENGSATAGHEAIFVHNENKILCTTDLGLLKAEKVHGEEGTWDNTVLLKPKIVMPSALTASPTSSESPDWRA # QSLHGEQEEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1159 ### # start gene g1160 3 AUGUSTUS gene 4888396 4888917 0.66 + . g1160 3 AUGUSTUS transcript 4888396 4888917 0.66 + . g1160.t1 3 AUGUSTUS start_codon 4888396 4888398 . + 0 transcript_id "g1160.t1"; gene_id "g1160"; 3 AUGUSTUS CDS 4888396 4888917 0.66 + 0 transcript_id "g1160.t1"; gene_id "g1160"; 3 AUGUSTUS stop_codon 4888915 4888917 . + 0 transcript_id "g1160.t1"; gene_id "g1160"; # protein sequence = [MLIQGLSPGELPKSDDILHFFLTPGHKSVYDLVYAAERLTLLTTKDNKAKLVSLRVLGYLVLLAPGPDHKALAEIATA # VRTTDLSDLYVLGEIYSDCFVRSCELYRNIQGTLTDILLVYKVKGSQTPFTPSHPSRPSFDARVQEIKATILQAPKNHSEAKDKVGYTMLLVSVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1160 ### # start gene g1161 3 AUGUSTUS gene 4892318 4895801 0.3 + . g1161 3 AUGUSTUS transcript 4892318 4895801 0.3 + . g1161.t1 3 AUGUSTUS start_codon 4892318 4892320 . + 0 transcript_id "g1161.t1"; gene_id "g1161"; 3 AUGUSTUS CDS 4892318 4895420 0.49 + 0 transcript_id "g1161.t1"; gene_id "g1161"; 3 AUGUSTUS CDS 4895467 4895801 0.56 + 2 transcript_id "g1161.t1"; gene_id "g1161"; 3 AUGUSTUS stop_codon 4895799 4895801 . + 0 transcript_id "g1161.t1"; gene_id "g1161"; # protein sequence = [MTSIVGSTISSTIFSANSTSLGLNDRTAFFMDNIFAIGFGLSLRFLITLISRDSPSSLKVTGTLVGLWEGIVLLHFTQ # KWPRSYDPYVAYGVRMFVDLLVTESVPRMVLVAIWTGLGMVLADVGPGVWKDSGGRRIWSRFKRDMKVMGRRMPRMPMIAIPFLDRPRTVRFVPSSRS # RTTSVVSPTSSAVSGPTYSVVSTATAPTAPTATTRTVPRFAGTPAASVYSTTTTSSTTASSVTPPEPTEPPVSTGPAVSVHPPTPGTTPTPRKTRVPG # HFMRDSETETEITTLPRNRLSRRKFPYTGPSTNSSGSASGLTTDNELLGTSRGSRYSLFPVSTKKPDLRLTESDSDDDEGDDDTSSTTTETPTPDAGT # LRDISLEVVEAAEAEQSEQLDQITPTQSPVTTEHPILPTLPDTTNDLNGNNNELLITGIDLPTVPKTPLPPADQVPDIPDVDVDYDSWEKVEKETPFE # FPLKKWNTKGKAKVKDDELDAKSEVSVKGKGKAKDDELDAKSEFSVKGKAKDEGLDAKSEFSVKGKAKDEGLDAKSEVSVKGKGKAKDDELDAKSEFS # VKSKAKEEGLDSKSEFSIRGKGTVKDDEFDAKSEFSVKGKGKIKTVTPALKLAPGVQAAQPRSQHPTPGPPESKTPEPITPIPPRLPPKENSKPVNTS # NSSSFNFSTNQDPKPLIDPKKSTLISSAKPEKAMSEPGWLDSFGDLVGKNKNKTGKPTKTKSVVSAVSSVAGITDAFVKPGATGAGAGTGWGLGSAGR # SPLSGNATTTAADETKSNSWSNPWGSVKANTKAPSEINASVDKHKSERSQPSPPPTWSQTFPDGAPNLFPDDSASGYQDITTDKDKKEKEGGSFVGGS # TTGNITPSAKAASTKAPSAKAPSIVSVSPKGTPELPQPIPPSVKAPSAKAPSTVSVSPKEGSASPRPAPKLDDGAAGDSSSPPENETNDNEGEKSEEK # AKTEADAEKEEEVDSGTELLPSDASFSAKLELSLDFLKQIDGLRKVQKKGDGYDEQIAKQIQRLERKVNRISATEHSPFVRMCYLAILQSSLPSVHTK # VFVLVRLCSNNSPYLDWTPKDVKEPNKIDVPANISPKIVTNQIEERLWKLLTNKAARDIGYDYLEVTVPKGMKGKPIKNAVNEVMKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1161 ### # start gene g1162 3 AUGUSTUS gene 4897992 4898507 0.51 + . g1162 3 AUGUSTUS transcript 4897992 4898507 0.51 + . g1162.t1 3 AUGUSTUS start_codon 4897992 4897994 . + 0 transcript_id "g1162.t1"; gene_id "g1162"; 3 AUGUSTUS CDS 4897992 4898507 0.51 + 0 transcript_id "g1162.t1"; gene_id "g1162"; 3 AUGUSTUS stop_codon 4898505 4898507 . + 0 transcript_id "g1162.t1"; gene_id "g1162"; # protein sequence = [MDKDDSDYVRINERSLTAKLWLTLFVGAHRGYEVVRGSNPLKITSNIASPRKSSSGSNSRKPKIDRSRLLTLGKDSAS # SLEGTLNDDHLLREIVWRTIGDAQELMQAIKKLKPESTVLEITDDLSHIAATFEYLTLVKNNGVDPVLDADDLKKGQAILRKMRALRSGEKSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1162 ### # start gene g1163 3 AUGUSTUS gene 4908899 4909231 0.9 - . g1163 3 AUGUSTUS transcript 4908899 4909231 0.9 - . g1163.t1 3 AUGUSTUS stop_codon 4908899 4908901 . - 0 transcript_id "g1163.t1"; gene_id "g1163"; 3 AUGUSTUS CDS 4908899 4909231 0.9 - 0 transcript_id "g1163.t1"; gene_id "g1163"; 3 AUGUSTUS start_codon 4909229 4909231 . - 0 transcript_id "g1163.t1"; gene_id "g1163"; # protein sequence = [MEATSTRRAGLERFTFPEGSKPYFVLGELPASAWNPPDGRHNIDLSNDLPDSFVGGIMDIDPQQGRITIGGKWGSRYV # SKNNLNDILILVLSAASGPEVSVIKLSRVMTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1163 ### # start gene g1164 3 AUGUSTUS gene 4914244 4915320 0.97 + . g1164 3 AUGUSTUS transcript 4914244 4915320 0.97 + . g1164.t1 3 AUGUSTUS start_codon 4914244 4914246 . + 0 transcript_id "g1164.t1"; gene_id "g1164"; 3 AUGUSTUS CDS 4914244 4915320 0.97 + 0 transcript_id "g1164.t1"; gene_id "g1164"; 3 AUGUSTUS stop_codon 4915318 4915320 . + 0 transcript_id "g1164.t1"; gene_id "g1164"; # protein sequence = [MHPRLSFLLLCVLTVTHIAAAYRPYRPHDSSDLAQPHRVPRSFKSDNKREVSPPQTPSHVNASIRAVSESTVSSSHPT # QIPPCASDCSPVALSADASPSARQAIDEPGSSEVAMDTLKSQPVPRYANTTITPPVPSLAARQIHNADYGSSNAPSSSSDSNSTEQAHPSSSASHPSA # TDSADSNNRREEITEHVRTGPPAARAAAMRGLEISDLTPVYNKNSTTTIPSVNPTETNFSRRFPRASALRRTYLFDMLPGTDNDTSSSNSTGSKSDNS # SERRVPRAAAMRRINVPGLPEVKNSTTPPSTMKSDDSAPRDNSTSVGTNGSNGNSTKSDNDFANSSPNQPERRLAFRFRRGRQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1164 ### # start gene g1165 3 AUGUSTUS gene 4919360 4920910 0.39 + . g1165 3 AUGUSTUS transcript 4919360 4920910 0.39 + . g1165.t1 3 AUGUSTUS start_codon 4919360 4919362 . + 0 transcript_id "g1165.t1"; gene_id "g1165"; 3 AUGUSTUS CDS 4919360 4920910 0.39 + 0 transcript_id "g1165.t1"; gene_id "g1165"; 3 AUGUSTUS stop_codon 4920908 4920910 . + 0 transcript_id "g1165.t1"; gene_id "g1165"; # protein sequence = [MYNQSATYANNVNSHIDTLQSSINDGLFGWVNGTTTTLNDTLATFYSDIQDAISDAFNGTLLEEPLQEFLACFIGSKV # EAIEDALTFLNNNLQIDMPRMNDSILVLSPESINEVSQPIAAAAVGDGSDDNGGFVGKLVNAYVASLKKERIMFGIFMGLWGVVVLMAICIILWSTYC # KRYLERRRHRKWEREQRCGVDGLVVPFRLGQPVSEKPGTDFLSFTPPPTQSFSDNAAGSSGAPRSSDPKTGKSWENFFGAGDSRKKPFPAISKPFKLV # PAVGNQPERAGLGQDDQFGKTWFTRLTGTFTRKISDPQSVSPTPPSDRTRPDLRISIDRASSTRTLAQDPDGAKDGEPHSRWSTSPEVTKIAPWMGML # SPTRRSYDHGPPPNRTMRQDVRSIPADVNSVYESSAVHVGHAPLAPPLHHGFTGILRSNIQAPSTLAPPQDRHRRSSSVPAWKMSPPAVSSVTPITRF # LTSNSARRSSNVDPFATPFDDEHQVIVERAPPRQSYQTNPFTVVAM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1165 ### # start gene g1166 3 AUGUSTUS gene 4932831 4934369 0.68 + . g1166 3 AUGUSTUS transcript 4932831 4934369 0.68 + . g1166.t1 3 AUGUSTUS start_codon 4932831 4932833 . + 0 transcript_id "g1166.t1"; gene_id "g1166"; 3 AUGUSTUS CDS 4932831 4933760 0.7 + 0 transcript_id "g1166.t1"; gene_id "g1166"; 3 AUGUSTUS CDS 4933821 4934369 0.97 + 0 transcript_id "g1166.t1"; gene_id "g1166"; 3 AUGUSTUS stop_codon 4934367 4934369 . + 0 transcript_id "g1166.t1"; gene_id "g1166"; # protein sequence = [MRSSLLVEYLLKTLPSSTTFLSVIFAIVNSLRLQRELFILPSRSKHFKPRASSTDFVARGISDYLTSETGITIIFESA # IVPKWKDSRISFKNVYVSRRPMTTPRQKLINAHMAAAGIGIQEYQDFGEYEEDEAHVVSEQDTNYSMFDLNIDSVDVTLSLWRWLDGRGLVEDAVVKG # VRGVLGAVSGYLSLDVSYPDPITVDRRSVLYDPEHPLDPASFRHESHVGDFELDSLQLEDVLITVYQPGGFRPYTASIFRADIRTFRKRWMFYDFLSA # ENIVGQFDNCLFSLHKPQSIGRTTGSELHDGDWARMSRIRIDGVSIDHLQASTSMEGPVSWITSGKLDAVLDIKFPKDPDDALALNVILEEIADAISN # TLSTSPALDPLRQRIPGQRELAKPPLSAPDTEEFTASVNLEQSKEPKVVIELDLRFRDVKAAVPIFTSDLSYVNNALIRPIVAFMKYVYCYTICVIAH # DPQPQCQSDLGPHTLSSRESSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1166 ### # start gene g1167 3 AUGUSTUS gene 4938388 4939813 0.6 + . g1167 3 AUGUSTUS transcript 4938388 4939813 0.6 + . g1167.t1 3 AUGUSTUS start_codon 4938388 4938390 . + 0 transcript_id "g1167.t1"; gene_id "g1167"; 3 AUGUSTUS CDS 4938388 4938968 0.6 + 0 transcript_id "g1167.t1"; gene_id "g1167"; 3 AUGUSTUS CDS 4939057 4939252 0.99 + 1 transcript_id "g1167.t1"; gene_id "g1167"; 3 AUGUSTUS CDS 4939316 4939813 1 + 0 transcript_id "g1167.t1"; gene_id "g1167"; 3 AUGUSTUS stop_codon 4939811 4939813 . + 0 transcript_id "g1167.t1"; gene_id "g1167"; # protein sequence = [MIWKVDDSAFEGWGADHWVPKDFDPVWRIDASPRKVGQVLFHPTASNVVAGATGDYTVKLWDLARTEDPRNVLSGHND # AIQSLAFNSTGTLLVTTCRDRKLRLFDPRAGSDAVRVTDGHGGIKGARVVWMGDHDRIATTGFSKMSDRQVAIWETGSLSNLKTTTIDQSSGVMMPFW # SENNILFLGEYHYIYAFLDGNIRYYEYENDNLFALDEHKSVDPQRGMCFLPRRALNVADCEIARAYKIAGSNIEPIAFIVPRRADGFQSDIFPPAPSS # EPSMSANDFFSGKNAPRKVVDLASGASFVSSAPPSAVPVPVSASMPSPAPLTPSYSTPAPASQTPSAPVITKSYSIPTPSSTTTAEPPSPAPAPTIQK # SNSRDDSTLGQENAQLRKELREARELIRNLELQVEAQRANARKAAQALLDAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1167 ### # start gene g1168 3 AUGUSTUS gene 4946642 4946986 0.52 + . g1168 3 AUGUSTUS transcript 4946642 4946986 0.52 + . g1168.t1 3 AUGUSTUS start_codon 4946642 4946644 . + 0 transcript_id "g1168.t1"; gene_id "g1168"; 3 AUGUSTUS CDS 4946642 4946986 0.52 + 0 transcript_id "g1168.t1"; gene_id "g1168"; 3 AUGUSTUS stop_codon 4946984 4946986 . + 0 transcript_id "g1168.t1"; gene_id "g1168"; # protein sequence = [MADITLPKSTSTVSVKALNIASPRTSIPAALFVTPVKPGRERLASPDYAFLIEHPSGRKVLFDLGPMKDFSKLPPAMQ # GLLAQGGFEMSVDADITEQLKAGGVSVDDIDSVIWR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1168 ### # start gene g1169 3 AUGUSTUS gene 4949394 4950506 1 + . g1169 3 AUGUSTUS transcript 4949394 4950506 1 + . g1169.t1 3 AUGUSTUS start_codon 4949394 4949396 . + 0 transcript_id "g1169.t1"; gene_id "g1169"; 3 AUGUSTUS CDS 4949394 4950506 1 + 0 transcript_id "g1169.t1"; gene_id "g1169"; 3 AUGUSTUS stop_codon 4950504 4950506 . + 0 transcript_id "g1169.t1"; gene_id "g1169"; # protein sequence = [MERHFHKSTTKGLALAVASVASASTSKLVRGVKDVATKSIHAGSSPVSSDIESSPHGLPPPSASLATDVIDEEEEGIR # EHWPGTQEVTEEESAEGKEERERREIEEETRSLMEIIHSEYVSPASPRVLRRWGHIVDLYDGSRLGDRSSKADASSGEPSNKTRVWLTPNIAYDQFDW # EGNAHSNGANLSNDTPNNNTSDLPSSKDKISFAVPEIKQTDFASTSQSESQNPNRPPVLRNQDTYTPRNPAHSYPSRYPQFHTLFAQFPKTLILIGDA # ERLTTEVGNLARAMGKDCDCGGETANTKDAGNKEEEDLPREGLVSLGGGCVQVRWIPDAVHDVFMIPPGWWDEKIKSEVWEDVKTWMTGFHEASIM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1169 ### # start gene g1170 3 AUGUSTUS gene 4952295 4952885 0.63 - . g1170 3 AUGUSTUS transcript 4952295 4952885 0.63 - . g1170.t1 3 AUGUSTUS stop_codon 4952295 4952297 . - 0 transcript_id "g1170.t1"; gene_id "g1170"; 3 AUGUSTUS CDS 4952295 4952885 0.63 - 0 transcript_id "g1170.t1"; gene_id "g1170"; 3 AUGUSTUS start_codon 4952883 4952885 . - 0 transcript_id "g1170.t1"; gene_id "g1170"; # protein sequence = [MAITIAWQFPGPLTDTTRFSLFFDEIGFEPVVVYHKNEHGKTVTHVQEVKEVSWRPSPTNTILLGSVFKTSSLVCRFG # DSADFRKHIFDTIKDVQELQSQTIALLEGRQKEFGIVQTGPYFDPRLRQHPTIEDDLDWINTVFLFLSLTDLPMSSGGPAHVSPMATPLVTATSLETW # NKKFNLLCLARYPSLPLNRC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1170 ### # start gene g1171 3 AUGUSTUS gene 4956818 4961224 0.62 - . g1171 3 AUGUSTUS transcript 4956818 4961224 0.62 - . g1171.t1 3 AUGUSTUS stop_codon 4956818 4956820 . - 0 transcript_id "g1171.t1"; gene_id "g1171"; 3 AUGUSTUS CDS 4956818 4956844 0.62 - 0 transcript_id "g1171.t1"; gene_id "g1171"; 3 AUGUSTUS CDS 4956998 4961224 0.63 - 0 transcript_id "g1171.t1"; gene_id "g1171"; 3 AUGUSTUS start_codon 4961222 4961224 . - 0 transcript_id "g1171.t1"; gene_id "g1171"; # protein sequence = [MGNTASPNFSGFQFQSIGKSQSDNQISLLKRLSSVKTSGSNEHDDQDHSTQTHDIDVSQGSTSVPTAAEVDTSSFAIS # SVPSRRTLFQTLGNNEQVTSVPVQYGPKVDIFGQRFPFVLPSSRPVDSMNSTTVSQSVVGTSTGNNAVDEVVSLPSSSIPISKPPSDLPSIPFQSTIS # RASSCASNSSHIDLTYPTSTPQSPQQPPSPFVVKSELARAAVHIPSKDHLNFSSLTQGDSSSSSAPTPTSFGPSFAALNEIHSRLLSTFHDLSSESSE # TIAQASAKLASAFECASRAQNLAQESLKLTQTASSTLVDSLEVGKDSHETADKAISLVETSMKILAAYETKHAKGIAEMKEATERIGGWIDEEQQRLR # LTKEAKAKAEKELQAREKKAGEVREAKERRGEAQEKIEDQKKEKSANEAQERGNKKKRGPVARFFNLTNDVNHVIMSGPSCITAHDPPTSYAPAALVD # ATDSLSVNSSFNFSIDASTSTLDSLDSLEKADAWIEKLKTIENTARRAREEKEMQMERVMKDKNRQREEYKQAEETRQRQAAEQERQRLEAEQEDRRR # KEENERRQSDMAAAEGARCDTLEEEKQRCEAANLAAEKELVEAQLRKKAIEEREQKLRLKLEQEQEQAQAWKQAAIDEQQRRREALQQSQAGRKLGSQ # RATPVGNIGLPSVPIIPSIPSVVSPTFTSTSTRPFNPSALPKSSVPSRPQLFSSIPTTPNVIANQTVPKLTKKQRQKARKAEALAQQQPVSGNVPLGP # TESPSLIASKVTLPTAASGVRQNPTTQSMPLNPDHRTSVSNYPHSPRNNISLGLIDGSVSRSSNSPILHTNSTDAGNILLQSSAPKSPEVRAANMRFV # VKGAGAGMDNSTSSDSNANWRERKLAIRKSKPEYDIPMFKNEDDDRDSMKCLRSPAKMTIPVVSHPTPDLSTPLLEATSNPQVLPPAAEGHSRVGNQS # RNSSEYIPGDASGAGLGYTPIAPNVAKARSTSAKGVISVPSLLKQPANNPTLTSTSAPAPLQEPTSQARPVTGASRRPPSAPAPSNSQTHPTSQGNLT # APNTSVCPPPATALSESQNRPVSRAGPNAVASPVSQMSAPIRSLSPIAPNDGGWANVRIPDSASEYIARSGRRGHNHNSPSPNSIGSGQHMSLEGSPF # VPRSPPSATGSPFSHREQTQRDRRLSSDPDQRERSPSRPNRRGNSTSLGYGLDSGRPSNSNGQDIRRGGGRGRTSTPPNRATFKSRSRSPPVTRTGRK # RSRVDDDMRDTPPFRQDHYSHQAESISRNGYKNSRRTSYPDSEHSVEAYNESLSPPNSSPTYNDIPTSLESRLSNGYDASGGTSEGFYSSSYDRNDWV # LDNRRLSPPFHHQSQPPELPNKRQKLLDPGSADKAPLLSRMAGSSYEGTFKGHGGQARKAHPFWL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1171 ### # start gene g1172 3 AUGUSTUS gene 4964911 4966484 0.56 + . g1172 3 AUGUSTUS transcript 4964911 4966484 0.56 + . g1172.t1 3 AUGUSTUS start_codon 4964911 4964913 . + 0 transcript_id "g1172.t1"; gene_id "g1172"; 3 AUGUSTUS CDS 4964911 4964938 0.58 + 0 transcript_id "g1172.t1"; gene_id "g1172"; 3 AUGUSTUS CDS 4965007 4966484 0.81 + 2 transcript_id "g1172.t1"; gene_id "g1172"; 3 AUGUSTUS stop_codon 4966482 4966484 . + 0 transcript_id "g1172.t1"; gene_id "g1172"; # protein sequence = [MTTPPTRSIREPDDEAGEELEGEVSPTVTTVDVTPRPSVAPTHPDALVYPYRRPRSRPSSSAEAGSGSNSPTSVLAKS # ASVSSSSARGAHISRALPGRYSSNGREDVEFSSDDDSYEFDNIDYSEGDDGEENIEISSARFSMTSGGTGNYFGGHASYGPPEGYRDREGSVATLRIK # RPDSGGDRDRPPPIFTSPFASTSAVASPSSSVPPSFDTGMARPPSVSATPTSPSADTTPSGMDADFDFAYITSFGADLSADPSSSVPDFVRPRRVSAM # SLSGTSSNRETSGRKDSLGKSLFFSWLSGRRPSTATVASSNSSNMFIHDDTFAQTLLKWGGEGYKEQRKDWTIRREVHPVSSSSSSAPTSSGNKEEKL # KRITTTSTAPRMSTATNITAVTSTAVGTSHGFLSPEPPSSLNKDREASHSHTKSQSHDTSKDSRSQEKDHSHKEREKERLRRSTMHWRGMPVGSEEVW # GNDLLGKFAVYREEVGRGAKGELLYFECQLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1172 ### # start gene g1173 3 AUGUSTUS gene 4966646 4969216 0.69 + . g1173 3 AUGUSTUS transcript 4966646 4969216 0.69 + . g1173.t1 3 AUGUSTUS start_codon 4966646 4966648 . + 0 transcript_id "g1173.t1"; gene_id "g1173"; 3 AUGUSTUS CDS 4966646 4969216 0.69 + 0 transcript_id "g1173.t1"; gene_id "g1173"; 3 AUGUSTUS stop_codon 4969214 4969216 . + 0 transcript_id "g1173.t1"; gene_id "g1173"; # protein sequence = [MAFSLTRYHKPSHVTSSSAAMRARSATPSEGFVNSQHARLPPHLKAAGVVGSSGSSALPVPRATANRIILLAPRRVQE # AFTSTTTTKMLADHGLLSPPSGSLSRNEKDRIRDIDGDKRKKSLPGDGKSARSSPSPEKMRRKKSISASQPQLPSRSSSATPPPVPALPTTPNTPASL # SPSAQITPLNSSSLSPPAIYPNSFSDDAPSTNIEGPPSSSSTSTTSTSLASSSTSVSQRMSSCTTDTDNTDHTEHTDRSSTLVDSELSEISSTSASEA # SASESSVGSSRPHRHRIPRRKLHEYDHDHNEDEADESSYNDDDHDDDLYGYRPHRDGGPSRVARTPHNETYGTVDFSSANDRQRILQIVSDSSSSSSS # SPFSILRFINRNVRTGVIDSLDPSASALRATAGPAFDPPWLTFPSRGKQEQQRRVVDNLNMSFKDVGLLPSTPRENHGRPGSSSVGRSTRSTITGSGR # RKSVSGGGKSKKDKGSSSKASSDPSRDVFASVPPESLCMLLPLWPGDTDPPSQAHSQHVYPPSQSSFKKPVLPLEKRTFLLVWYKALEPQLPSLKGGK # DGDRKAGADKEKEEVALAVIDSLIGFSPDTEKETKDKDKKDKKSKSNSNKSAGSGKDSGKDSGKDSGKSSHASPTSSSDSTGFLRSSRSLGGIGIGGG # SGRGSGTGSATASGTHHSNLTWAQLHANDERNILLPGFLITVRRVSYRDLQGTGVRVPDEGVTVNGPLEEAWRECFNIPDSMSGIMADSGSPLTPSFM # PDPTILAVCHSRESGVEFDPEALISLGLCKVLNPLPMGMVAEDFVENGAEMSGQDGWGFGGMELKLKLTPVGRSVMEMCWVGGLALMSFGPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1173 ### # start gene g1174 3 AUGUSTUS gene 4985512 4986303 0.38 - . g1174 3 AUGUSTUS transcript 4985512 4986303 0.38 - . g1174.t1 3 AUGUSTUS stop_codon 4985512 4985514 . - 0 transcript_id "g1174.t1"; gene_id "g1174"; 3 AUGUSTUS CDS 4985512 4986303 0.38 - 0 transcript_id "g1174.t1"; gene_id "g1174"; 3 AUGUSTUS start_codon 4986301 4986303 . - 0 transcript_id "g1174.t1"; gene_id "g1174"; # protein sequence = [MFFGLTNSPATFQAFMNHILRELIDQGHVIVYMDDILIFTDNIEEHRIIVRKVLDILKANKLYLKPEKCTFEAREVEY # LGIIVGNGQIRMDPKKVEAVRTWQPPQKKRELQSFLGFCNFFRRFIRDFSKIAKPLTRLTGNATWEWTSLEQDAFNQLKDRIIEDVTLIIPRETGKFR # IEADSSDYANGAVLSQNVDGKWRPVAFRSRSLNEVERNYEIYDKEMMAIMDSLSDWRQYLLGAKEPVEVFADHQNLQYFWKPQKLNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1174 ### # start gene g1175 3 AUGUSTUS gene 4986964 4990682 0.71 - . g1175 3 AUGUSTUS transcript 4986964 4990682 0.71 - . g1175.t1 3 AUGUSTUS stop_codon 4986964 4986966 . - 0 transcript_id "g1175.t1"; gene_id "g1175"; 3 AUGUSTUS CDS 4986964 4990010 0.82 - 2 transcript_id "g1175.t1"; gene_id "g1175"; 3 AUGUSTUS CDS 4990073 4990682 0.78 - 0 transcript_id "g1175.t1"; gene_id "g1175"; 3 AUGUSTUS start_codon 4990680 4990682 . - 0 transcript_id "g1175.t1"; gene_id "g1175"; # protein sequence = [MTTRAEKKPVRYEPNTPEWVAQRLQMDKLPMAIGILRAWMPESRVREASEETVLAIRNLSHATTTEAVSNLKSRKRFV # RGTRGRELKLRTTIENIDNGVQIETEALLDSGATGSCINKDFVEQHQLTVKELPVKMPVYNADGTLNKNGSIEGYVQVRMVIGDHAKRIDMAVTNLGK # TDIFLGIDWLRYHNPSIDWKESTLTFERILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLV # PGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVR # WGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKC # EFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPIL # ALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTR # RQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQIVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLAN # GIAEWEEDNGLVYYRGRVYIPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLW # EEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSN # GQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQK # EGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDE # DEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1175 ### # start gene g1176 3 AUGUSTUS gene 4990808 4991911 1 - . g1176 3 AUGUSTUS transcript 4990808 4991911 1 - . g1176.t1 3 AUGUSTUS stop_codon 4990808 4990810 . - 0 transcript_id "g1176.t1"; gene_id "g1176"; 3 AUGUSTUS CDS 4990808 4991911 1 - 0 transcript_id "g1176.t1"; gene_id "g1176"; 3 AUGUSTUS start_codon 4991909 4991911 . - 0 transcript_id "g1176.t1"; gene_id "g1176"; # protein sequence = [MDFTSRLGRPRLSVQTDRYRTPDSSAPSTSSSIERNITSFIPAYIPSNYSMSNPTPAPTTTTSNIHGKSLLREPSIFD # GDKAQFKEWRRTLFAYIRDPRNRIVTDSERIDIAVSYMRGPKVSSWVQNYTDDNFNDDEEEWKVTWKGFKDALNASFLDKGLTENAQEKLEHLRQGPN # ERAEDFFKEFEVIMRDAGYAKDAPYVIRLIEMNVKPKLIDQVYGTSNERIEKFDELKQKIISIDDMWWRREEMRRNWSNRYQQNAGQGPSSQRWQPQM # TQTPITKAPTPAVPTQDRKDGTGTTFKGAGRPMDIDAARRNKECFHCGKQGHIAKFCPEKTPKPQFVRGMWSRMTQEDQETMAKELGFVLPQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1176 ### # start gene g1177 3 AUGUSTUS gene 4994993 4995739 0.42 - . g1177 3 AUGUSTUS transcript 4994993 4995739 0.42 - . g1177.t1 3 AUGUSTUS stop_codon 4994993 4994995 . - 0 transcript_id "g1177.t1"; gene_id "g1177"; 3 AUGUSTUS CDS 4994993 4995739 0.42 - 0 transcript_id "g1177.t1"; gene_id "g1177"; 3 AUGUSTUS start_codon 4995737 4995739 . - 0 transcript_id "g1177.t1"; gene_id "g1177"; # protein sequence = [MYPLRQVNEPPMFVAGEKLGQKVFPGQGGMGGGMPSGGAGMGMGMGAGIPSGMPGMQSGIGGGVGGGMPGGITGNMGG # NMGMPGGAGAFNQQQAQALIAQQNSNMEMLEARRTHSLGGRAGPLPPGAPVPGAPGMHGPPVPGPHGRGIPPPGVGVPGVPPGRRPVGAPGGQGSPDD # DDSGDEIDSISTRTHALMRYKRNHDLMNEVFVKASFGEYFERLNHYFRDPCASPSSRSSGFREIARIMLIVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1177 ### # start gene g1178 3 AUGUSTUS gene 5000978 5001757 0.38 + . g1178 3 AUGUSTUS transcript 5000978 5001757 0.38 + . g1178.t1 3 AUGUSTUS start_codon 5000978 5000980 . + 0 transcript_id "g1178.t1"; gene_id "g1178"; 3 AUGUSTUS CDS 5000978 5001497 0.38 + 0 transcript_id "g1178.t1"; gene_id "g1178"; 3 AUGUSTUS CDS 5001573 5001757 0.63 + 2 transcript_id "g1178.t1"; gene_id "g1178"; 3 AUGUSTUS stop_codon 5001755 5001757 . + 0 transcript_id "g1178.t1"; gene_id "g1178"; # protein sequence = [MSLADAQTLAIRKLLSKSFYDSNIAPGPPLPKSHPAPGLIAKLHLECASLYSSARTLAKTPSASSKSAEDVSPELRHY # LGDEALLHSALAKKWFGIDAGENGGEDRGGDAVGLLIWAQKELQELKDGGKGVGLSRGEKEKRDRNLRKEKVTKELEITGVWLKHYKKINDTVRIHLQ # SRLSSGVSAVFATPYSLPEPMFGPGSGARVQKEQDTLDREGSMGGSASSTYAGAGEYY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1178 ### # start gene g1179 3 AUGUSTUS gene 5004744 5005697 0.99 - . g1179 3 AUGUSTUS transcript 5004744 5005697 0.99 - . g1179.t1 3 AUGUSTUS stop_codon 5004744 5004746 . - 0 transcript_id "g1179.t1"; gene_id "g1179"; 3 AUGUSTUS CDS 5004744 5005697 0.99 - 0 transcript_id "g1179.t1"; gene_id "g1179"; 3 AUGUSTUS start_codon 5005695 5005697 . - 0 transcript_id "g1179.t1"; gene_id "g1179"; # protein sequence = [MHPSGFRFVVNVKGAVSCLVKTHTFSSKHSLETSHTDVLIPRSPVMLNSHIHGLNVIEPGHLDSGSQNLLSGPFPDLS # LWTHLLFESEDGPVSALTNDSGLGQLTEEDEDGGNHAGIEVADGHINVVAGMAVNNEYLSQGQLPPLSLDIDSLPSSFGINPLVLAGQSQPAEQVAPV # LLAINVAKPLPPIVPQPMDVRLPDPQPTESIMPSAKRQRSRKLSVGESSQSMYMSTPLTTAEDKRRRNTAASARFRLKKKEREIALDKQTKELEARVN # ELEKQCEGLRRENGWLKGLVVGVTGGAQKSSTGLQPRREEILC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1179 ### # start gene g1180 3 AUGUSTUS gene 5014894 5015187 0.89 + . g1180 3 AUGUSTUS transcript 5014894 5015187 0.89 + . g1180.t1 3 AUGUSTUS start_codon 5014894 5014896 . + 0 transcript_id "g1180.t1"; gene_id "g1180"; 3 AUGUSTUS CDS 5014894 5015187 0.89 + 0 transcript_id "g1180.t1"; gene_id "g1180"; 3 AUGUSTUS stop_codon 5015185 5015187 . + 0 transcript_id "g1180.t1"; gene_id "g1180"; # protein sequence = [MGSRILSRSFGVERVGIDGDDDGEEMNPEADKSIGSAMDVDEHDETTGVEDTSIQDDSPSEVGDEGEEDAIDISMVPI # ADLLNVRLPSTYYVCFTPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1180 ### # start gene g1181 3 AUGUSTUS gene 5018470 5019033 1 - . g1181 3 AUGUSTUS transcript 5018470 5019033 1 - . g1181.t1 3 AUGUSTUS stop_codon 5018470 5018472 . - 0 transcript_id "g1181.t1"; gene_id "g1181"; 3 AUGUSTUS CDS 5018470 5019033 1 - 0 transcript_id "g1181.t1"; gene_id "g1181"; 3 AUGUSTUS start_codon 5019031 5019033 . - 0 transcript_id "g1181.t1"; gene_id "g1181"; # protein sequence = [MFAEFDSTFFPVSSLKTRSGSSSSTLSSRPNTCERAEAAERSDRYKLAVEVLRTVYHEFYDEHVRLAQEEIDKLKFSN # EPLLEESPWITFFNSTDGEEQVIQLGEVHTIILENAFDDSEELYHYCCAPASQNMEELEFFTNFVPHADAPEFDLDEFLAWDEDARDSFSFPWQNLED # PDRSSSVIFLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1181 ### # start gene g1182 3 AUGUSTUS gene 5020458 5020709 0.66 + . g1182 3 AUGUSTUS transcript 5020458 5020709 0.66 + . g1182.t1 3 AUGUSTUS start_codon 5020458 5020460 . + 0 transcript_id "g1182.t1"; gene_id "g1182"; 3 AUGUSTUS CDS 5020458 5020709 0.66 + 0 transcript_id "g1182.t1"; gene_id "g1182"; 3 AUGUSTUS stop_codon 5020707 5020709 . + 0 transcript_id "g1182.t1"; gene_id "g1182"; # protein sequence = [MTETAPPVSPPPRTEQGSGDSAVSLDAPADLYPASEPVHSGTEAPQTDAAAVTPQQPEERERVRDPKLSTLQGMFPDF # DESLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1182 ### # start gene g1183 3 AUGUSTUS gene 5020825 5022103 0.52 + . g1183 3 AUGUSTUS transcript 5020825 5022103 0.52 + . g1183.t1 3 AUGUSTUS start_codon 5020825 5020827 . + 0 transcript_id "g1183.t1"; gene_id "g1183"; 3 AUGUSTUS CDS 5020825 5021146 0.6 + 0 transcript_id "g1183.t1"; gene_id "g1183"; 3 AUGUSTUS CDS 5021253 5021621 0.58 + 2 transcript_id "g1183.t1"; gene_id "g1183"; 3 AUGUSTUS CDS 5021763 5022103 0.95 + 2 transcript_id "g1183.t1"; gene_id "g1183"; 3 AUGUSTUS stop_codon 5022101 5022103 . + 0 transcript_id "g1183.t1"; gene_id "g1183"; # protein sequence = [MSDPEYHSEHRPQEEPVAVRRHPLPTSLNWLLTNIFNSNPQSQEELDAHFARQLYMEDQEQQAAWQAQQQQQRPRPTF # SGRRDSYPQPAQEKDTMTEISDQFNKIAEKFDQSRYTNVPFNPLSSRLIIIFYRQEGSSWSTGVGGDTYPYEPGQAPYPNPKPNSNPQQQQSRHQRMQ # QMQQQQLLQQQQQQEEQLARQDQQQPAYYDPNPTSESPPSSAGGYDAAPSPRSSPSCRRYYQSTSYSPQTLSGKLGLLPKRPVSLFRAQSPTSPPVGG # APSQSTRFSTEQTAPAPAAISRLDSDAEELYADADEDPFEDEHEVGRRESEIATASGAPATANAVPNLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1183 ### # start gene g1184 3 AUGUSTUS gene 5031204 5031923 0.87 + . g1184 3 AUGUSTUS transcript 5031204 5031923 0.87 + . g1184.t1 3 AUGUSTUS start_codon 5031204 5031206 . + 0 transcript_id "g1184.t1"; gene_id "g1184"; 3 AUGUSTUS CDS 5031204 5031923 0.87 + 0 transcript_id "g1184.t1"; gene_id "g1184"; 3 AUGUSTUS stop_codon 5031921 5031923 . + 0 transcript_id "g1184.t1"; gene_id "g1184"; # protein sequence = [MDEVRGYAISAIEKLPNVDPVDKIVLARTYDIPTWLVPSFNEILQRSQSLTESDIEKLGIPTTVRLVKLRDRLRPSTT # QMGVWMLDKERLGVPIDFTSSIPDEFPECKGHHNNHFSDSEKPNLEYVPSIGIPTAPSYAPSIIESPRPLSSDMILLRSPLSCHPSRAPSRAPSCVPS # CAPSCTPRQVSDMFIPPFLSGASATTPSSSTPRPANVPLATKPINEKKKKGKKLKSRKSFLDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1184 ### # start gene g1185 3 AUGUSTUS gene 5033157 5033543 0.66 + . g1185 3 AUGUSTUS transcript 5033157 5033543 0.66 + . g1185.t1 3 AUGUSTUS start_codon 5033157 5033159 . + 0 transcript_id "g1185.t1"; gene_id "g1185"; 3 AUGUSTUS CDS 5033157 5033543 0.66 + 0 transcript_id "g1185.t1"; gene_id "g1185"; 3 AUGUSTUS stop_codon 5033541 5033543 . + 0 transcript_id "g1185.t1"; gene_id "g1185"; # protein sequence = [MQKNVPYTAHDQFCVFFGKHYGLQYSGPQEKAARINVPTVREHIDYHVLTSLGQVQYDDLVDPDFEEALKTLTVLQLK # SPQAITDDFTYVAGVAAELELDHEDGEWHKIYTEVMNLRAREPKRHSPTY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1185 ### # start gene g1186 3 AUGUSTUS gene 5042565 5043041 0.94 - . g1186 3 AUGUSTUS transcript 5042565 5043041 0.94 - . g1186.t1 3 AUGUSTUS stop_codon 5042565 5042567 . - 0 transcript_id "g1186.t1"; gene_id "g1186"; 3 AUGUSTUS CDS 5042565 5043041 0.94 - 0 transcript_id "g1186.t1"; gene_id "g1186"; 3 AUGUSTUS start_codon 5043039 5043041 . - 0 transcript_id "g1186.t1"; gene_id "g1186"; # protein sequence = [MTNEDSGNYILAADVGSDGQVNLREAYATGGMGLHGINGGNTGPDGLFGQGSVAVSNVTNMLVAVNVRILVFLSIIIR # SDSDSFLCMYLQPGSGTVSLFSINPSDPSNLTHIGDPAGSGGQWPTSVTFNKAGDIVCALNGGEVNGVRYGAPSSNQYSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1186 ### # start gene g1187 3 AUGUSTUS gene 5045761 5046093 0.5 + . g1187 3 AUGUSTUS transcript 5045761 5046093 0.5 + . g1187.t1 3 AUGUSTUS start_codon 5045761 5045763 . + 0 transcript_id "g1187.t1"; gene_id "g1187"; 3 AUGUSTUS CDS 5045761 5046093 0.5 + 0 transcript_id "g1187.t1"; gene_id "g1187"; 3 AUGUSTUS stop_codon 5046091 5046093 . + 0 transcript_id "g1187.t1"; gene_id "g1187"; # protein sequence = [MSEYQAAWIVDSDVEEDDEEDDDKENRVDFKIDTPEGDDVAMEEDEEEAEGDDGISGGGGKRKVRFGDEADFEDLSQD # EEDAQLASWRLAREKNKEREKEGMLLYPIMNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1187 ### # start gene g1188 3 AUGUSTUS gene 5058233 5063170 0.44 + . g1188 3 AUGUSTUS transcript 5058233 5063170 0.44 + . g1188.t1 3 AUGUSTUS start_codon 5058233 5058235 . + 0 transcript_id "g1188.t1"; gene_id "g1188"; 3 AUGUSTUS CDS 5058233 5063170 0.44 + 0 transcript_id "g1188.t1"; gene_id "g1188"; 3 AUGUSTUS stop_codon 5063168 5063170 . + 0 transcript_id "g1188.t1"; gene_id "g1188"; # protein sequence = [MSSALFTAVTTTLKGDNYDTWASEMEAFLQATGLESAITTDQPSEPSPLVAANAASVEAWKNYEVVFKAWKEIDTKAI # GNIRLRISPSIRILAKEYSDTAKKLWNYLAKTYNVKSLGTVFNDFAAAMAIKIPYKQNPLSSMMEIGMYFTRMDEAGIGLADHLEALILLSKLPSRYS # VVIQTMSQLETAELKKLTFAKVRIAVMNAFSGDTIGNSQPQNANKFSNVHRKGNDPKFSQQQHGNGSNQQQKGQNGNDDNKKKRKRGSGKNKKAKKNA # NAAQADADSMDFSPIGSTVDFGPVRTDLTPSVQDVRKHSIHPPYNPPNATSLHLHKKTRMAIKRARDIGVRATAEVIRTLEPAGHISELDSDDELDPP # TKRTRAMSPVDDVENGSKAPTPPPPSPPMDFEVPGTASFDPDELMNFDLDREILAITGFMDTMGSVPSSDLDHTKCTNTPSSVAVAKTCKSAFEPDLL # SRLYNYRIDAKYISNEHFCVHDVSYSVCKKCKGKQRNQPKWCMNDSGCSEHTTFDLSDFIVYEDLEEKVLIATATTTAYITGVGTVLINFKDVRGRMH # SARIAPVFYMKELSHRLIAQGRFLQDGKTARGNADKVDFWDKDGLFLSFEPRTHSDTIYILKDYSPQPMAVNLVIHSVDYTTMHRRMGHPSREALTQL # RKHAEGVPTFSIPHEEDLCEGCAKGKMTLRPFPPTNRRASRPFEIIHSDLKEWPTISYHKYKYTIFFIDDYTSHGFYCHLKKKSGALPVIKQFIATVK # NLYETNVKEWMSDGGGEFRSNALDEFFKNEGIKAQWSSPHIHQQNGRAERFIWTIIEKSEPQRFQACIPDSWWEFSVAHAVHVYNRTPMRRHKWKTPY # EILYNKVPRIDHLRVFGCGAYVYLHEEIWTNKQSPRSELMTYLGVSDGGHGNIYMRSNNAIFTATHAVFDEKLFPRCKSSERHRSTRLPDRNPDPKDP # IPPPGDDDVPIFHQPTTPQMRQDPEQDVAPPVPAEQPARDPSPLPQPRNEQPPAQEQLRRSGRVRRPLTHLTGDPRSSTKLPTEQQVERPKRDIQRRA # PQPGSSSAEQEQVPGPSTEHPTPENGEQPSVTPGDEANTLIRLCREGGAELIYFLMAKAVPFEGELKSSENVHEWTYKDITRLPKAEREEWLKACQEE # LEALKRRGTFELMDRPADRKVIKNRWVFDIKSDGRKKARLVVKGFSQIEGLDYDQVFSPVVRFETVRLLLALTALNNWYLTGLDVRNAYLYGVLHETI # YMEQPEGFRIKGKEDKVLLLRKALYGLKQAGLVWWRTLDSYMKTLGFKRLSSDAGIFIRRGKDGSLVIAIIYVDDALFAGPDKKLVDSLKGKFMSHWE # CRDLGEAKEFLRMRINRHGKKIYIDQCAYLDKVLKRCGMENAKMADTPLPAGFQPEPTIGQSNSALRSKFQMVIGSLLYLMLGTRPDISFAVTKLAQH # AANPSQEHLNKALYICRYLLGTRSYALCYDGESGIGLSAWTDSDWASDPYTRRSQTGFFMKLANGIFSWTSHVQKTIAHSSTEAEYMALSDCSRQVVW # IRNLLEELGYKLDAIPIAGDNQGSIFMASNPVTSKHLKHIDIRYHYIREVVERGLVQVFFVDGSNNPADLFTKNLGRIKFELFRSMLGLEFYLSTNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1188 ### # start gene g1189 3 AUGUSTUS gene 5063664 5067380 0.42 - . g1189 3 AUGUSTUS transcript 5063664 5067380 0.42 - . g1189.t1 3 AUGUSTUS stop_codon 5063664 5063666 . - 0 transcript_id "g1189.t1"; gene_id "g1189"; 3 AUGUSTUS CDS 5063664 5065918 0.52 - 2 transcript_id "g1189.t1"; gene_id "g1189"; 3 AUGUSTUS CDS 5066000 5067380 0.46 - 0 transcript_id "g1189.t1"; gene_id "g1189"; 3 AUGUSTUS start_codon 5067378 5067380 . - 0 transcript_id "g1189.t1"; gene_id "g1189"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPSIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNQYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFKKCEFEQQQI # EYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDISFTWTDTRQKAFDTLREAFISAPILALWTPDR # PTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWAL # YLSRFDFHMIHCPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEE # DNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDL # ITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERAN # QEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGK # RKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEV # EEILDSRVRWKKLEYLVKWKGYDTGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1189 ### # start gene g1190 3 AUGUSTUS gene 5067431 5068597 0.97 - . g1190 3 AUGUSTUS transcript 5067431 5068597 0.97 - . g1190.t1 3 AUGUSTUS stop_codon 5067431 5067433 . - 0 transcript_id "g1190.t1"; gene_id "g1190"; 3 AUGUSTUS CDS 5067431 5068597 0.97 - 0 transcript_id "g1190.t1"; gene_id "g1190"; 3 AUGUSTUS start_codon 5068595 5068597 . - 0 transcript_id "g1190.t1"; gene_id "g1190"; # protein sequence = [MSTPIPPAPNTSADDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPMHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSASAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1190 ### # start gene g1191 3 AUGUSTUS gene 5074428 5075495 0.85 + . g1191 3 AUGUSTUS transcript 5074428 5075495 0.85 + . g1191.t1 3 AUGUSTUS start_codon 5074428 5074430 . + 0 transcript_id "g1191.t1"; gene_id "g1191"; 3 AUGUSTUS CDS 5074428 5075495 0.85 + 0 transcript_id "g1191.t1"; gene_id "g1191"; 3 AUGUSTUS stop_codon 5075493 5075495 . + 0 transcript_id "g1191.t1"; gene_id "g1191"; # protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFSAENPP # FGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLWERFFTALLPEIRQHLIIVNIAQGIAPTLKEAIKRAI # SVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVKQNCPHKETTCRYCGRQGHLESVCQDKFMGL # SRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRANAMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1191 ### # start gene g1192 3 AUGUSTUS gene 5075546 5079253 0.99 + . g1192 3 AUGUSTUS transcript 5075546 5079253 0.99 + . g1192.t1 3 AUGUSTUS start_codon 5075546 5075548 . + 0 transcript_id "g1192.t1"; gene_id "g1192"; 3 AUGUSTUS CDS 5075546 5079253 0.99 + 0 transcript_id "g1192.t1"; gene_id "g1192"; 3 AUGUSTUS stop_codon 5079251 5079253 . + 0 transcript_id "g1192.t1"; gene_id "g1192"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLQKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTTFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQV # LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ # RHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLA # RLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE # ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNP # INGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1192 ### # start gene g1193 3 AUGUSTUS gene 5080449 5081419 0.68 - . g1193 3 AUGUSTUS transcript 5080449 5081419 0.68 - . g1193.t1 3 AUGUSTUS stop_codon 5080449 5080451 . - 0 transcript_id "g1193.t1"; gene_id "g1193"; 3 AUGUSTUS CDS 5080449 5081082 0.72 - 1 transcript_id "g1193.t1"; gene_id "g1193"; 3 AUGUSTUS CDS 5081406 5081419 0.83 - 0 transcript_id "g1193.t1"; gene_id "g1193"; 3 AUGUSTUS start_codon 5081417 5081419 . - 0 transcript_id "g1193.t1"; gene_id "g1193"; # protein sequence = [MFHRCSKLPTEQQVERPKRDIQRRAKAPQPGSSSAEQERPEPEQVPGPSTEHPTPENREQPSVTPVDKANTLIRLCRE # GGAELIYFLMAKAVPFEGELKSSENIHEWTYKNITRLPKAEREEWLKACQEELEALKRCGTFELMDYPADRKVIKNCWVFNVKSDGRKKARLVVKGFS # QIEGLDYDQVFSPVVWFETVRLLLALTALNNWYLTGLNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1193 ### # start gene g1194 3 AUGUSTUS gene 5086109 5087824 0.7 - . g1194 3 AUGUSTUS transcript 5086109 5087824 0.7 - . g1194.t1 3 AUGUSTUS stop_codon 5086109 5086111 . - 0 transcript_id "g1194.t1"; gene_id "g1194"; 3 AUGUSTUS CDS 5086109 5087824 0.7 - 0 transcript_id "g1194.t1"; gene_id "g1194"; 3 AUGUSTUS start_codon 5087822 5087824 . - 0 transcript_id "g1194.t1"; gene_id "g1194"; # protein sequence = [MSSALFTAVTTTLTGDNYDTWTPEMEAFLQATGLGSAITSDLPIELSPLDTEDLDSVKAWKEYDDAFKSWKEIDTKAV # GNIRLRLSPSICILAKDQGNTAKELWEFLQKTYKVKGLGAVFNDFAAAMAVKVPYKGNPLTAMTDIGMFFSHMDDADIGIPAHLEALVLLSKLPSHYS # VVVQTMSQLGTEELKKLMLTKVRIAVMNAFSGDTIGNSQLQNANKFLNVHRKGNDPKFSQQQHNGSNQQQKGQNGNDDSNKKKRKHGSGKNKKAKKNA # NAAQADADSMIFSPIGSTVDFGPVRTDLTPSVQDVRKHSIHSPYNPPPNAMSLRLHKKTRMAINHARNIGVRATAKVIRTLEPTGHISELDSDDELDP # PTKRTRAMSPVDDVKNGSKAPTPPPPSPPMDFEVPGTASFDSDELMNFDLDCEILAITGFMDTMGSVPSSDLDHTKCTNTPSSVAVAKTCKLAFEPDL # LSRLYNYCIDAKYISNEHFCVHDVSYSVCKKCKGKQRNQPKWWMNDSGCSEHTTFDLSDFIEYEDLEEKVLIATATTTAYITGVGTILIHFKDVRGHM # HSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1194 ### # start gene g1195 3 AUGUSTUS gene 5088797 5089575 0.19 - . g1195 3 AUGUSTUS transcript 5088797 5089575 0.19 - . g1195.t1 3 AUGUSTUS stop_codon 5088797 5088799 . - 0 transcript_id "g1195.t1"; gene_id "g1195"; 3 AUGUSTUS CDS 5088797 5089166 0.32 - 1 transcript_id "g1195.t1"; gene_id "g1195"; 3 AUGUSTUS CDS 5089292 5089575 0.32 - 0 transcript_id "g1195.t1"; gene_id "g1195"; 3 AUGUSTUS start_codon 5089573 5089575 . - 0 transcript_id "g1195.t1"; gene_id "g1195"; # protein sequence = [MEMQYLWPTTTRRSEGLNCSTQEVGGERKAGVEDMRQGEVSHRGRSKVAKIQEDNLKKLQNCKTIAQFWSLYINWMDG # KPKEMEVTIEQLLREFRRAIQKEEIEEAKAHIAMKNLDSSVGVDQVDYKLIMKIPNENCVKLLNYCIENRTAPSAWLVALVVGILKWRKEADDPSSYR # LVMLECCFLKMLTLIIDRRLREYAEDQDLLPSTQNGFRPGY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1195 ### # start gene g1196 3 AUGUSTUS gene 5090454 5090981 0.16 - . g1196 3 AUGUSTUS transcript 5090454 5090981 0.16 - . g1196.t1 3 AUGUSTUS stop_codon 5090454 5090456 . - 0 transcript_id "g1196.t1"; gene_id "g1196"; 3 AUGUSTUS CDS 5090454 5090981 0.16 - 0 transcript_id "g1196.t1"; gene_id "g1196"; 3 AUGUSTUS start_codon 5090979 5090981 . - 0 transcript_id "g1196.t1"; gene_id "g1196"; # protein sequence = [MSVINGTVLEVNELGAYTSHQHNGKAVVDYCVVSNNMVNAVKHMRVHGNPKQEEDRWSNHSILSMSVELSLQTRASAV # KEQEKMTVKIQPLHESTNVLYNKILASALSEEEALKQYYGNFYYANDPVTVYTDGSCLGGGTDSAQAGAGICYGLNSKRNQSVRVPEPGKQMNNRAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1196 ### # start gene g1197 3 AUGUSTUS gene 5092759 5093055 0.35 - . g1197 3 AUGUSTUS transcript 5092759 5093055 0.35 - . g1197.t1 3 AUGUSTUS stop_codon 5092759 5092761 . - 0 transcript_id "g1197.t1"; gene_id "g1197"; 3 AUGUSTUS CDS 5092759 5093055 0.35 - 0 transcript_id "g1197.t1"; gene_id "g1197"; 3 AUGUSTUS start_codon 5093053 5093055 . - 0 transcript_id "g1197.t1"; gene_id "g1197"; # protein sequence = [MIDHEDSGDEPLTTSLLLSPMSEGLEVTVDSLGNMTMEACMEKEFGIDLNMTSVAKVVQVASKLKKMAIAVGGQQMEM # RNAFRDETSMLRQDLGKLEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1197 ### # start gene g1198 3 AUGUSTUS gene 5098826 5099008 0.76 - . g1198 3 AUGUSTUS transcript 5098826 5099008 0.76 - . g1198.t1 3 AUGUSTUS stop_codon 5098826 5098828 . - 0 transcript_id "g1198.t1"; gene_id "g1198"; 3 AUGUSTUS CDS 5098826 5099008 0.76 - 0 transcript_id "g1198.t1"; gene_id "g1198"; 3 AUGUSTUS start_codon 5099006 5099008 . - 0 transcript_id "g1198.t1"; gene_id "g1198"; # protein sequence = [MEFLKEAQDIGDDLEEGDDDDDFKDFVDEDMVEDAASLSTLRPALYACQVANSAREPHYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1198 ### # start gene g1199 3 AUGUSTUS gene 5102951 5103334 0.38 - . g1199 3 AUGUSTUS transcript 5102951 5103334 0.38 - . g1199.t1 3 AUGUSTUS stop_codon 5102951 5102953 . - 0 transcript_id "g1199.t1"; gene_id "g1199"; 3 AUGUSTUS CDS 5102951 5103334 0.38 - 0 transcript_id "g1199.t1"; gene_id "g1199"; 3 AUGUSTUS start_codon 5103332 5103334 . - 0 transcript_id "g1199.t1"; gene_id "g1199"; # protein sequence = [MFLDPTDTNDKDEKFFAYMTRSGDQKNAMLKKNDVVAFFGNKDPESVFKVLRDVNQLRSSSHGGRPWEIKSVDNDADY # VIAVLDYLAALPSTANGHPTVLNSQNETVKKMKGLAEKLKQLRAAARHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1199 ### # start gene g1200 3 AUGUSTUS gene 5106164 5107656 0.35 + . g1200 3 AUGUSTUS transcript 5106164 5107656 0.35 + . g1200.t1 3 AUGUSTUS start_codon 5106164 5106166 . + 0 transcript_id "g1200.t1"; gene_id "g1200"; 3 AUGUSTUS CDS 5106164 5106592 0.45 + 0 transcript_id "g1200.t1"; gene_id "g1200"; 3 AUGUSTUS CDS 5106658 5107656 0.65 + 0 transcript_id "g1200.t1"; gene_id "g1200"; 3 AUGUSTUS stop_codon 5107654 5107656 . + 0 transcript_id "g1200.t1"; gene_id "g1200"; # protein sequence = [MQDDVDQLHYNPFAAPVDSRPRSLSTSSLQNNSFFPTSPSTLSVTANIYNDDRGSCAGGDNQHIEIRKAQAEDASILD # HHPLRSAGLSNSFEDAGVTRPHLTRILDGDRLVDVPSFPNDEENDEEDTGQDEATSNEKVVIVHEVSSKDSLAGVALKYRINLTELRRANHLWSSDSI # HLRNILYIPLEKTSLPPPTVTPSFATSSDEPASFYSHKFTVPEASQSPTATTISSSAIRRIPASELSFFPPPSRTSVLSNSSSPSPLSQPRPSNSRII # HNRHATTPAPSLNTILTALPIAASTRDTIIARLSFDSPSSSYNDQEREPYLNGHEGHELADVQARREPSRRSLEEDWQGYLDGVTTKLLKNSQSTFTN # DPVFKQPDISAINPDWKARSERVGPNFNGHGRSFSEEYTGPALSLPSISSTRIRNVQLEPSPVMQLPIKNNENSSQLCSMLCSTGTKKTDLALIELDP # KVEQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1200 ### # start gene g1201 3 AUGUSTUS gene 5108928 5109305 0.77 - . g1201 3 AUGUSTUS transcript 5108928 5109305 0.77 - . g1201.t1 3 AUGUSTUS stop_codon 5108928 5108930 . - 0 transcript_id "g1201.t1"; gene_id "g1201"; 3 AUGUSTUS CDS 5108928 5109305 0.77 - 0 transcript_id "g1201.t1"; gene_id "g1201"; 3 AUGUSTUS start_codon 5109303 5109305 . - 0 transcript_id "g1201.t1"; gene_id "g1201"; # protein sequence = [MLGCLGAEAGGELKLLKGSRLMIIVLLDAVVQNAIQNRVSQGEVHGLSVTGYVSYEGSTVKDEAGSWDIGAKNVISDT # GVPLTTISVVTGDLPSSVTEDLCSRTVRGQEENKSLRAARCGGRMGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1201 ### # start gene g1202 3 AUGUSTUS gene 5125951 5126310 0.99 + . g1202 3 AUGUSTUS transcript 5125951 5126310 0.99 + . g1202.t1 3 AUGUSTUS start_codon 5125951 5125953 . + 0 transcript_id "g1202.t1"; gene_id "g1202"; 3 AUGUSTUS CDS 5125951 5126310 0.99 + 0 transcript_id "g1202.t1"; gene_id "g1202"; 3 AUGUSTUS stop_codon 5126308 5126310 . + 0 transcript_id "g1202.t1"; gene_id "g1202"; # protein sequence = [MSTPIPPATPAPPASAEDLMTQPIKQVANLATAMEERSSSKSSINKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS # QAKLIKSALGFFTESAGDWATPHLLHFNAEHPPLEEIGKSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1202 ### # start gene g1203 3 AUGUSTUS gene 5128422 5129534 0.89 + . g1203 3 AUGUSTUS transcript 5128422 5129534 0.89 + . g1203.t1 3 AUGUSTUS start_codon 5128422 5128424 . + 0 transcript_id "g1203.t1"; gene_id "g1203"; 3 AUGUSTUS CDS 5128422 5128826 0.9 + 0 transcript_id "g1203.t1"; gene_id "g1203"; 3 AUGUSTUS CDS 5128911 5129534 0.97 + 0 transcript_id "g1203.t1"; gene_id "g1203"; 3 AUGUSTUS stop_codon 5129532 5129534 . + 0 transcript_id "g1203.t1"; gene_id "g1203"; # protein sequence = [MSSSCTTTRTTTTVGSILVTGAHPTSPPAPTRPSTPDLSDEERELELQLERTREKNRRRKEKKKKAEEEARWKAEEEK # ERQEAAARAADARRLEEEAAEKRRRIVAAAAARHRQGPSHGEASTSARRVEVEIPRVASGGDPDDGGDDDDDDDDEERVPCKRCQMKKIPCLEQVGKR # STVICKACHDAKVKCLYSGRPMQVKREGGPSGERMAVMESQLAQLLADNRALREATSRSHQYLRQLLRRQDEDHVWLIAIDTRDAMREPATLGPLRLV # SDRPRNLKRRRVIENSEEEEEEEREGEKDGEGEEEVEEEEKEGEAPAPKKVKTAASEKGKEKEVAEVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1203 ### # start gene g1204 3 AUGUSTUS gene 5129899 5131875 0.32 - . g1204 3 AUGUSTUS transcript 5129899 5131875 0.32 - . g1204.t1 3 AUGUSTUS stop_codon 5129899 5129901 . - 0 transcript_id "g1204.t1"; gene_id "g1204"; 3 AUGUSTUS CDS 5129899 5130585 0.32 - 0 transcript_id "g1204.t1"; gene_id "g1204"; 3 AUGUSTUS CDS 5130670 5131875 0.52 - 0 transcript_id "g1204.t1"; gene_id "g1204"; 3 AUGUSTUS start_codon 5131873 5131875 . - 0 transcript_id "g1204.t1"; gene_id "g1204"; # protein sequence = [METDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWCHYLEGSGDPVDIVTDHKNLE # YFSTTKVLTCRQVRWSEFLHQFNMVIRFRPGKLGEKPDPITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPALRASIIMDIEALH # QAIILALPADPSSIVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHSDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTI # CGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTYDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVL # AFFRALGKALSMELHYTSGYHPEANGQTERFAYNNAPNASTGITPFFANKGYHPNITIRPEVDMKSDLARDFVVNLDELHTFLREEILLAQSRYKEQA # DRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEY # NVAEILDSKLDRRYKRCPLRYYIWWAGYEGTDDEFSWVAADELHADELVPAFHAQYPHKPRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1204 ### # start gene g1205 3 AUGUSTUS gene 5132906 5134447 0.7 - . g1205 3 AUGUSTUS transcript 5132906 5134447 0.7 - . g1205.t1 3 AUGUSTUS stop_codon 5132906 5132908 . - 0 transcript_id "g1205.t1"; gene_id "g1205"; 3 AUGUSTUS CDS 5132906 5134447 0.7 - 0 transcript_id "g1205.t1"; gene_id "g1205"; 3 AUGUSTUS start_codon 5134445 5134447 . - 0 transcript_id "g1205.t1"; gene_id "g1205"; # protein sequence = [MTKISPVNLRLFDGSLSSNPITDMANIAVWFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNT # SHLDSPQTSVPSATNTVDAKVAVPLPEPLPSVSPTILETPPGDSPRSHSRSRTLRAKPLSSKFPFEPIYSYPMVSQFAAQLETPEVDIALVSAAVFNR # ACKDAGMEPILHHAIHSEVAARAADRSSTAPTVPPLHYSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVTLKDFID # KQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEW # KVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVCLDDILIYSDTPEEHQEHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLSYILSPDGLTMSKEKVQT # VLEWPVPRKVKDIQSSLGFANFYRRFIYNYSDIVVPMTRLTRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1205 ### # start gene g1206 3 AUGUSTUS gene 5134711 5135229 0.99 - . g1206 3 AUGUSTUS transcript 5134711 5135229 0.99 - . g1206.t1 3 AUGUSTUS stop_codon 5134711 5134713 . - 0 transcript_id "g1206.t1"; gene_id "g1206"; 3 AUGUSTUS CDS 5134711 5135229 0.99 - 0 transcript_id "g1206.t1"; gene_id "g1206"; 3 AUGUSTUS start_codon 5135227 5135229 . - 0 transcript_id "g1206.t1"; gene_id "g1206"; # protein sequence = [MAHLPEPATLADYRQEVLRIDNHYWKREETRKHEAGKPFVAWNPKKGSSDFKTGSTNQQNNSQPSGSSALFTPKPKPF # SGSKPNNNGKPQNSSNSGQSGSQRPGFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIAVCNKQKAQESKGRAAEVEETPEATIEVVEEELEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1206 ### # start gene g1207 3 AUGUSTUS gene 5136465 5137448 1 - . g1207 3 AUGUSTUS transcript 5136465 5137448 1 - . g1207.t1 3 AUGUSTUS stop_codon 5136465 5136467 . - 0 transcript_id "g1207.t1"; gene_id "g1207"; 3 AUGUSTUS CDS 5136465 5137448 1 - 0 transcript_id "g1207.t1"; gene_id "g1207"; 3 AUGUSTUS start_codon 5137446 5137448 . - 0 transcript_id "g1207.t1"; gene_id "g1207"; # protein sequence = [MPPKTRAQSRTNSEENTFFTTAQSFAPFSESISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIESPILQAISCRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPIDPDDPGADNNHDNLDDDSGGLPRGEPG # GPGGPGGPDGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALSRPSDSSESKSKVKEPEVFDSSDPRKLKTFFVNLALVFNDRPKYFTDQ # RKVNYTLSYLSGSAKEWFVPDILDPDLSCPDHNQTNPSTIPHASLHLSKTSPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1207 ### # start gene g1208 3 AUGUSTUS gene 5140425 5141103 0.38 - . g1208 3 AUGUSTUS transcript 5140425 5141103 0.38 - . g1208.t1 3 AUGUSTUS stop_codon 5140425 5140427 . - 0 transcript_id "g1208.t1"; gene_id "g1208"; 3 AUGUSTUS CDS 5140425 5140825 0.83 - 2 transcript_id "g1208.t1"; gene_id "g1208"; 3 AUGUSTUS CDS 5140896 5141103 0.4 - 0 transcript_id "g1208.t1"; gene_id "g1208"; 3 AUGUSTUS start_codon 5141101 5141103 . - 0 transcript_id "g1208.t1"; gene_id "g1208"; # protein sequence = [MRLVPLRDLDPFAALRSNGSLAVALKIITPSPPLEIKSSSCAFKAPVAPPQLVRRNQELESLKADASAFLTPPRPTHS # RDSDNELLSRFPSADITSRASLPTKAPVFRRESKSKTTVKVVEDSKVSNPPSLATAAYKRVQLPPCLRKITLTASKGKAQQIVATDDDSASNEVRSED # EDEDEEIVPPSKRLKTTSSISGKVYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1208 ### # start gene g1209 3 AUGUSTUS gene 5144600 5145600 0.58 - . g1209 3 AUGUSTUS transcript 5144600 5145600 0.58 - . g1209.t1 3 AUGUSTUS stop_codon 5144600 5144602 . - 0 transcript_id "g1209.t1"; gene_id "g1209"; 3 AUGUSTUS CDS 5144600 5144936 0.63 - 1 transcript_id "g1209.t1"; gene_id "g1209"; 3 AUGUSTUS CDS 5145593 5145600 0.62 - 0 transcript_id "g1209.t1"; gene_id "g1209"; 3 AUGUSTUS start_codon 5145598 5145600 . - 0 transcript_id "g1209.t1"; gene_id "g1209"; # protein sequence = [MKGRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVNGEEEYNVAKILDSKLDRRYKHCPLHY # YIWWAGYEGTDDEFSWVAADELHADELVPAFHAQYP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1209 ### # start gene g1210 3 AUGUSTUS gene 5151233 5151673 0.58 - . g1210 3 AUGUSTUS transcript 5151233 5151673 0.58 - . g1210.t1 3 AUGUSTUS stop_codon 5151233 5151235 . - 0 transcript_id "g1210.t1"; gene_id "g1210"; 3 AUGUSTUS CDS 5151233 5151673 0.58 - 0 transcript_id "g1210.t1"; gene_id "g1210"; 3 AUGUSTUS start_codon 5151671 5151673 . - 0 transcript_id "g1210.t1"; gene_id "g1210"; # protein sequence = [MTPTASTSSCPANPPSPGALIDEDEDSIMQDALARVERVKARKAAEARKRAEEEAAAKRAVEEERRKKEAAAQASAGR # KKAAQEARGRAIRAQQQEAEVVEQQQLLAEAATARSQRGTLPSEMSVSPRRPVVEIGERDGPGAGKCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1210 ### # start gene g1211 3 AUGUSTUS gene 5158809 5161328 0.61 - . g1211 3 AUGUSTUS transcript 5158809 5161328 0.61 - . g1211.t1 3 AUGUSTUS stop_codon 5158809 5158811 . - 0 transcript_id "g1211.t1"; gene_id "g1211"; 3 AUGUSTUS CDS 5158809 5161328 0.61 - 0 transcript_id "g1211.t1"; gene_id "g1211"; 3 AUGUSTUS start_codon 5161326 5161328 . - 0 transcript_id "g1211.t1"; gene_id "g1211"; # protein sequence = [MPFGLTNAPSAFQFFMNEIFHDMVDVCMVIYLDDILIYSDDEASHVGHVRKVLERLRANHLHAKPEKCAFHVDTVEYL # GVIISPLGVSMDPEKVKAVMDWPKPRTVKELQVFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVI # LECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSQHQIQVYSDHNNLQYFTTTKQLTARQARWAELL # SGYDFVINYRPGRLGAKPDALTRRSDVYPKRGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALKRIARNEEESFVWEDGLI # KRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQL # PATAGPEKYDTILVVVCRLTKQAIYVPCHTTDKAEDFANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQ # SVEAYLRIYCSYDQDDWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKAYAKYANQKRQE # APDWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTILSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEDILD # SKPKKGRLEEVEYLVKWEGYNDEFNSWVGWEGMVGSIELLRSWHKHHPRKRQPSHLQWASLEREAWEDEEEGPGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1211 ### # start gene g1212 3 AUGUSTUS gene 5161539 5163047 0.84 - . g1212 3 AUGUSTUS transcript 5161539 5163047 0.84 - . g1212.t1 3 AUGUSTUS stop_codon 5161539 5161541 . - 0 transcript_id "g1212.t1"; gene_id "g1212"; 3 AUGUSTUS CDS 5161539 5163047 0.84 - 0 transcript_id "g1212.t1"; gene_id "g1212"; 3 AUGUSTUS start_codon 5163045 5163047 . - 0 transcript_id "g1212.t1"; gene_id "g1212"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGDEIHAGTLQSPPEAPQQPPEAPQPHPEVPQQTPEAPLRAPRTRVKLEEVKDEEYKASQPG # PHKLVPSDKDLGPDDPILMGINEWLSFADESTEEEVEEILETGRSTMEKVTPNPAKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRCNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASDSSA # TEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDVIPPIGKLYNMSEKELKSLKE # YIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1212 ### # start gene g1213 3 AUGUSTUS gene 5163260 5164417 0.68 - . g1213 3 AUGUSTUS transcript 5163260 5164417 0.68 - . g1213.t1 3 AUGUSTUS stop_codon 5163260 5163262 . - 0 transcript_id "g1213.t1"; gene_id "g1213"; 3 AUGUSTUS CDS 5163260 5164417 0.68 - 0 transcript_id "g1213.t1"; gene_id "g1213"; 3 AUGUSTUS start_codon 5164415 5164417 . - 0 transcript_id "g1213.t1"; gene_id "g1213"; # protein sequence = [MFGVRPTIYAREKDKCASAASHLTGAALSHFDMLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQ # MPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRFYDEWTRVFTKLDGAVRAQAESLRNLHGEKVLQGWLSRFPGLELAPE # APYKSPLRRERDPADVWTSNPKPVVTGRFQSRPNWKEGRQRASAAWGEGESYDSESREEDEDCCHCKDGGEWTEAVLRAGVTDTGRKWNPEERAEKWR # RRRQELCMRCGRKEHWAKDCPNPESLERPAEDQGSSERASKADSTRGRGTANQGGGRKDDSTRPLERIRAGIVVEEREGMDDLWNVHILDSPKEGEQQ # LLDEVGNGQGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1213 ### # start gene g1214 3 AUGUSTUS gene 5165072 5166931 0.84 - . g1214 3 AUGUSTUS transcript 5165072 5166931 0.84 - . g1214.t1 3 AUGUSTUS stop_codon 5165072 5165074 . - 0 transcript_id "g1214.t1"; gene_id "g1214"; 3 AUGUSTUS CDS 5165072 5166931 0.84 - 0 transcript_id "g1214.t1"; gene_id "g1214"; 3 AUGUSTUS start_codon 5166929 5166931 . - 0 transcript_id "g1214.t1"; gene_id "g1214"; # protein sequence = [MSATSTERPSSSKTESKKQQSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGCQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECLPEDVAMVLREVLESMGIEI # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDVNAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMR # HMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKH # SSPRNIEVPELLNPGNMATRSPQLRSGTSPTVHALAQNSTPPPELTCKRNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1214 ### # start gene g1215 3 AUGUSTUS gene 5170283 5170663 0.45 - . g1215 3 AUGUSTUS transcript 5170283 5170663 0.45 - . g1215.t1 3 AUGUSTUS stop_codon 5170283 5170285 . - 0 transcript_id "g1215.t1"; gene_id "g1215"; 3 AUGUSTUS CDS 5170283 5170663 0.45 - 0 transcript_id "g1215.t1"; gene_id "g1215"; 3 AUGUSTUS start_codon 5170661 5170663 . - 0 transcript_id "g1215.t1"; gene_id "g1215"; # protein sequence = [MPQLTKSIIIPNHMLVAKFPQVVKDYLAEEKSKGQMLGPFLLREIESIMHGHIMSSPLIVAEQVQAPGIPKKFRVCRH # LSKKGKDEDGNRFLSVNSFITKDLFPTSFDAASKVAELVSLTFPSTFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1215 ### # start gene g1216 3 AUGUSTUS gene 5173972 5174556 1 + . g1216 3 AUGUSTUS transcript 5173972 5174556 1 + . g1216.t1 3 AUGUSTUS start_codon 5173972 5173974 . + 0 transcript_id "g1216.t1"; gene_id "g1216"; 3 AUGUSTUS CDS 5173972 5174556 1 + 0 transcript_id "g1216.t1"; gene_id "g1216"; 3 AUGUSTUS stop_codon 5174554 5174556 . + 0 transcript_id "g1216.t1"; gene_id "g1216"; # protein sequence = [MSNNSYTCSGCGQNYNRSSDLIQHLEKTCQPACQEAYEASKQAIHHSRFMSPVDPLIYHHSQFSSSSIQAHLASQDEE # DDPIHPFQGDFFGNDYSNEDFPGFDDNDDCEDDENGNEETEADFDPELEPTWEPAREPASVLQEYDEQNTSIETGVDDEDEDVSMQDGKFLLGHLPAH # REEIHIEQFGGSGWGNSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1216 ### # start gene g1217 3 AUGUSTUS gene 5175764 5177293 1 + . g1217 3 AUGUSTUS transcript 5175764 5177293 1 + . g1217.t1 3 AUGUSTUS start_codon 5175764 5175766 . + 0 transcript_id "g1217.t1"; gene_id "g1217"; 3 AUGUSTUS CDS 5175764 5177293 1 + 0 transcript_id "g1217.t1"; gene_id "g1217"; 3 AUGUSTUS stop_codon 5177291 5177293 . + 0 transcript_id "g1217.t1"; gene_id "g1217"; # protein sequence = [MGDLLAPLKEAGVNGVVLSSGDGIRQRCHPILAVYIGDYPEQMLVTCSYYGTSPVCTVSKNQLGDYPCSAELRDPVKA # VQAAKLINTAEWTKHCSDADMKPIQHPFWEDLPYTDIFHSITPDILHQMYQGVMKHLIVWITTIVGADEVDARVRRLPARHGIRHFHKGITTLSQVSG # TEHKQMCTFLLALVTDIPRKTTSQSNRLLIATCALLDFLYLSCYPIHSDESLTMVETSLSTFHANKDIFIELGAREHFNFPKIHYLCHFVPGFKLFGT # SDNYNTETTECLHIDFTKDAYRASNRKDEYSQMTKWLERREKVVQYTNYLSWCKSQRGLNPQSIPFIVPGVRYDFPGSQRSLQDMQCSLTHVLTKFPT # RKMVSFSKLMQIKPDQQGYGAFNFEYALKMFIVQHSDPQSTTIGQIEDMTTFLSLPFQSVPVWHRIKFRNEDLYGTKTLDVVAAHPRRYNSHGQITQI # FQFDAALIRVQPKVDASNLDFLQGRHNFYTVTKRQRRSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1217 ### # start gene g1218 3 AUGUSTUS gene 5178460 5179377 0.85 + . g1218 3 AUGUSTUS transcript 5178460 5179377 0.85 + . g1218.t1 3 AUGUSTUS start_codon 5178460 5178462 . + 0 transcript_id "g1218.t1"; gene_id "g1218"; 3 AUGUSTUS CDS 5178460 5179377 0.85 + 0 transcript_id "g1218.t1"; gene_id "g1218"; 3 AUGUSTUS stop_codon 5179375 5179377 . + 0 transcript_id "g1218.t1"; gene_id "g1218"; # protein sequence = [MSTPIPPAPNTSADDLMAQLIRQVANLATAMEECSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPMHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1218 ### # start gene g1219 3 AUGUSTUS gene 5179677 5183363 0.9 + . g1219 3 AUGUSTUS transcript 5179677 5183363 0.9 + . g1219.t1 3 AUGUSTUS start_codon 5179677 5179679 . + 0 transcript_id "g1219.t1"; gene_id "g1219"; 3 AUGUSTUS CDS 5179677 5183363 0.9 + 0 transcript_id "g1219.t1"; gene_id "g1219"; 3 AUGUSTUS stop_codon 5183361 5183363 . + 0 transcript_id "g1219.t1"; gene_id "g1219"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPSRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPSIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASKRLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDISFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDTGHNSWEPAANLSRDAPPRRSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1219 ### # start gene g1220 3 AUGUSTUS gene 5183503 5185287 0.55 - . g1220 3 AUGUSTUS transcript 5183503 5185287 0.55 - . g1220.t1 3 AUGUSTUS stop_codon 5183503 5183505 . - 0 transcript_id "g1220.t1"; gene_id "g1220"; 3 AUGUSTUS CDS 5183503 5185287 0.55 - 0 transcript_id "g1220.t1"; gene_id "g1220"; 3 AUGUSTUS start_codon 5185285 5185287 . - 0 transcript_id "g1220.t1"; gene_id "g1220"; # protein sequence = [MLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRINTQADALSRMAAH # QVLDNEDNRQQTVLKPNHFTKIAASILRNPLEDRIRKASQQEAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNDLRTEVLRQCHD # HPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCETCARKKIQRHPRAVTQPLDVPLGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHALPC # TSSITAEGVADIYYKEIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVI # NSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDFVWLSAEDINLQLSSEKLG # DRQLGPYRILEKIGPLDYRLDLPISLDRIHPVFHVDKLYPWKGNTINGEIPPPPEPVYLEDEDKPEYEVEEILDSRVRWKRLEYLVKWKGYDAGHNSW # EPAPNLSRAPKIVRAFHKKHPTAAKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1220 ### # start gene g1221 3 AUGUSTUS gene 5185483 5187084 0.28 - . g1221 3 AUGUSTUS transcript 5185483 5187084 0.28 - . g1221.t1 3 AUGUSTUS stop_codon 5185483 5185485 . - 0 transcript_id "g1221.t1"; gene_id "g1221"; 3 AUGUSTUS CDS 5185483 5187084 0.28 - 0 transcript_id "g1221.t1"; gene_id "g1221"; 3 AUGUSTUS start_codon 5187082 5187084 . - 0 transcript_id "g1221.t1"; gene_id "g1221"; # protein sequence = [MVDCGATALFLNQDFATRNHVRCAPLHKPIDVFNIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDVILGL # PWLRKVNPEIDWEKGRLSVKPPRVAIEEVPDEEISYSHRAAANTESPIPELPNLEPPAEPPHIEVPLEATLEESESAVVEEPPIHRIRANHKTRRAWV # KAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLIPGALATMRTKIYPMSLNEQEELDRF # LEENLRKGYIVPSKSPISSPVFFVKKKDGKLCFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLF # EPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSSDLQEHRRVVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVK # VAAVRDWPAPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTRKDISFTWMDTQQQAFDTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1221 ### # start gene g1222 3 AUGUSTUS gene 5187270 5188445 0.99 - . g1222 3 AUGUSTUS transcript 5187270 5188445 0.99 - . g1222.t1 3 AUGUSTUS stop_codon 5187270 5187272 . - 0 transcript_id "g1222.t1"; gene_id "g1222"; 3 AUGUSTUS CDS 5187270 5188445 0.99 - 0 transcript_id "g1222.t1"; gene_id "g1222"; 3 AUGUSTUS start_codon 5188443 5188445 . - 0 transcript_id "g1222.t1"; gene_id "g1222"; # protein sequence = [MSTPIPSATPAPPASAEDLMTQLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS # QAKLIKSALGFFTESAGDWATPHLLHFNAEHPPFGGDWEEFLKEFVQRFESVDPGMEARSEIKNLKQSKGQTVAEFAQKFKDIGDRTGMSDIDLRERF # FTALLPEIRQNLIIVNIAQGLAPTLKEAIKRAISVDVYMHDPTMTGRNSGHTPTHAAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQG # HVKQNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPTPFSLFPNESVQIASSTPTSAPATVPATPSPPNQDFSNQIGQIRE # LLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1222 ### # start gene g1223 3 AUGUSTUS gene 5195075 5196784 1 + . g1223 3 AUGUSTUS transcript 5195075 5196784 1 + . g1223.t1 3 AUGUSTUS start_codon 5195075 5195077 . + 0 transcript_id "g1223.t1"; gene_id "g1223"; 3 AUGUSTUS CDS 5195075 5196784 1 + 0 transcript_id "g1223.t1"; gene_id "g1223"; 3 AUGUSTUS stop_codon 5196782 5196784 . + 0 transcript_id "g1223.t1"; gene_id "g1223"; # protein sequence = [MFKSTRVNKSRTSNNKALDESSVSSSSVRGNDTASGSGSGSTSTPAQLVTRTYAPFPAPYPYAVVTSNPVPMYEPYPA # YPQQLSQIPQPLQNQQHPQQLVLLPRPQVPEHILEHQPPHSHYTLAAVTPGNSTRHLPLPTRTPYQNGNRVEYTHDPSVRYISSSAPSSSPRIIAGAP # PGSAYVPNYPMTTSYGAPGPPDHTMYSSVQSLSPPLPHGPHSHLQQQSPSSPWYDEQHQHHPQSSPGPYSSVESISPRPGPEYGEQSPPSNTFESPSP # VVPTLVPLNLSSVRTPAETEYTLVDNNNSHSSTASMSPMSPVSPTSPTSPMTPLHPMPPTSRIPPMPSMTPMPVLPPPVSSISSPHPNTPPNPVHSPV # YQSMYTIPRGMPSTYLYSSTYTMTPAFQYSPGGAAAVTNPATIASIAYMGERAATPASPSTESSASGSVRSGGSGGSVRSMRSTGSAGSGGSVYVPSS # SSLYGPGVPGVSSSRASVGDLRTNELVRSAELVRLSEPGHAVGSAGGGDAAGGSLSGSPQRAVPLPPLHSLKRSHPYRRHPEDDKTLRLLDPRPVSSV # P] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1223 ### # start gene g1224 3 AUGUSTUS gene 5197388 5198545 0.81 - . g1224 3 AUGUSTUS transcript 5197388 5198545 0.81 - . g1224.t1 3 AUGUSTUS stop_codon 5197388 5197390 . - 0 transcript_id "g1224.t1"; gene_id "g1224"; 3 AUGUSTUS CDS 5197388 5198545 0.81 - 0 transcript_id "g1224.t1"; gene_id "g1224"; 3 AUGUSTUS start_codon 5198543 5198545 . - 0 transcript_id "g1224.t1"; gene_id "g1224"; # protein sequence = [MALSIPFHTVDVFTQTRFLGNPLAIVLLHHPSSSSDSSDPKPRPPVLTQHQKQLIAREFNLSETVFIHITQSNYDDPS # VPFAIDIFTTTEELPFAGHPTIGAGWFLAGHERWRDRKEFRLDTRAGVILVSRVTKIPGPLTSADDRARASAELVKLRIPIDFKTHPPYGSTLLSTLK # SSLCQPQLEPGDYVNGVDGSEPVASIVKGMSFVLMQLRDEGSLSRIQPLVGTNDAVPGSLIPDEHLGDWKGFSSLYVFVVSRSTESNSIFDNIYDDDP # VNLIHPIIRLRTRMFQSGGFEDPATGSAASTLCGWVASQQQNAVGRWRFEVIQGVEMGRESRIGVVVDVEREANVDGDVVVRKIELVGGAVKIMEGMV # DIPSTQGQSNLSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1224 ### # start gene g1225 3 AUGUSTUS gene 5201240 5203197 0.25 - . g1225 3 AUGUSTUS transcript 5201240 5203197 0.25 - . g1225.t1 3 AUGUSTUS stop_codon 5201240 5201242 . - 0 transcript_id "g1225.t1"; gene_id "g1225"; 3 AUGUSTUS CDS 5201240 5202079 1 - 0 transcript_id "g1225.t1"; gene_id "g1225"; 3 AUGUSTUS CDS 5202136 5203197 0.25 - 0 transcript_id "g1225.t1"; gene_id "g1225"; 3 AUGUSTUS start_codon 5203195 5203197 . - 0 transcript_id "g1225.t1"; gene_id "g1225"; # protein sequence = [MQTALQTYLAAQNGVSNFHAISDGWKPIDFAGTGTSLNGDEAANSIFYIADQIQGATTTISYSGMVISFIQDVNVAMS # LNTSGASNPEVTKAMQASSKACYAGMGATTTTVSKEYAEQHSGQAPNITSPEFLQFAAQDPEYTQASAICQSATNTYQSALSRAVGDDFYIFSGALNN # IEQLTASVTLIDGLNMEVSSETAVAGKGAGKYKPYYAIPTLNGTMSAWQSNSNGFSSSPAFTWSSSSTTGSSTNTTTSGGGGIGFIWEDFSGSGAGSS # SSSKTTSNVSSVGMSVSFGQISMFGVEYGLWNTPEVAEALQNPPDAITKKGTPVFQKYYGSASKPGPLASWKDQALVVYQPSFSVEFSSADEASSFHQ # SAASAGVCILFICIGGSGSKTTSTMNYSTGSKFVTYNDTTNQAYLVGFTQTNFFPNQGPQDDSNWPSLLGNNTDATSATSDTDSSSNSSGNSTTSDGN # SIGDSSSDTDSSSTSTGDSTSDTDSSSSTDSSSSSTDASSVDNASTTKNNGTSLDSSSSADSSSSSDTSSSTAASPTTSTSNSPSDSPPSSSKDPGST # GSKGDSTSFTSSTSDTASANPKSSSGSGDDNESTTSGAKPSAKTTSVTQSSGTQATPVVKASKAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1225 ### # start gene g1226 3 AUGUSTUS gene 5204761 5205891 0.99 - . g1226 3 AUGUSTUS transcript 5204761 5205891 0.99 - . g1226.t1 3 AUGUSTUS stop_codon 5204761 5204763 . - 0 transcript_id "g1226.t1"; gene_id "g1226"; 3 AUGUSTUS CDS 5204761 5205891 0.99 - 0 transcript_id "g1226.t1"; gene_id "g1226"; 3 AUGUSTUS start_codon 5205889 5205891 . - 0 transcript_id "g1226.t1"; gene_id "g1226"; # protein sequence = [MADQAEFAFIKTFVNTISTQPITYDDEYQQPPENSLKKVPVLTGVAVPEPPARKVEETAAGSSSSKRFKGNIAVSCAN # SAHTATLNLLIKSTKPPITYTLSGIHPTDTISAIKQHLSTTNPTAPAPDAQRLLLKGKALADNKLLKEYPVKDGDTINLMVKPGVEWNPAASAADPPV # VTLNTPAPKPAFGTSLSSSLLSGGSPAAPSGHTGKRHQRIPSVVLSPSPSNEDELGAQPRKDVLLTLDTTDLALGTGSTPKETLGAYHLTISSPGFWD # KLIQFLRYAHIFGTVSIVIDGPLSKNGVHERIRRTHCIRRFSCCEQRIFECERHSKDTGSCRGYGDGWYMTERRKERLLFTALRSHRALYIIKSKSVI # ALSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1226 ### # start gene g1227 3 AUGUSTUS gene 5209048 5209539 0.94 - . g1227 3 AUGUSTUS transcript 5209048 5209539 0.94 - . g1227.t1 3 AUGUSTUS stop_codon 5209048 5209050 . - 0 transcript_id "g1227.t1"; gene_id "g1227"; 3 AUGUSTUS CDS 5209048 5209539 0.94 - 0 transcript_id "g1227.t1"; gene_id "g1227"; 3 AUGUSTUS start_codon 5209537 5209539 . - 0 transcript_id "g1227.t1"; gene_id "g1227"; # protein sequence = [MPLFKQNSPEPSPPPQAEPTRKGTLFGRRQRSASPDRSNKSNRTRNSSDSDSVGRAGSTRSGGLFGGRIGGRGFPHNG # AYLTSISASPVFLTLCPPCNVDPTIMSAREKVSDAEESEKAADRALQQARASVKAAKDHVKFLEKEAEDEYAMTCFQNPILILSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1227 ### # start gene g1228 3 AUGUSTUS gene 5210269 5211102 0.77 + . g1228 3 AUGUSTUS transcript 5210269 5211102 0.77 + . g1228.t1 3 AUGUSTUS start_codon 5210269 5210271 . + 0 transcript_id "g1228.t1"; gene_id "g1228"; 3 AUGUSTUS CDS 5210269 5211102 0.77 + 0 transcript_id "g1228.t1"; gene_id "g1228"; 3 AUGUSTUS stop_codon 5211100 5211102 . + 0 transcript_id "g1228.t1"; gene_id "g1228"; # protein sequence = [MQSHPAYTAAAAPHSYVAAAPPQPGVKAEPIDTRYMLHNAPQMAYALPHLPGPAINGARQPAVPQYGSQTSILSFPPG # PPPVQSIPTNGAGVPLGRAYVPPTNGTPIATMSAPPPPSNSGGGGSSGRIPQLDGPSEDESDEDSQTPPPYAPRSTHPSLPQPQASTSASADSEAINS # DLDDSDTGDEEEADDGAVGETDIVFCTYDKVSYNLCFLLPDFHFVLGRTSQEQVEMYPEGWNDSCKWKGLSLLQMYWVRCLPNYAESLPRSLLSPVRE # FEW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1228 ### # start gene g1229 3 AUGUSTUS gene 5212577 5213612 0.89 + . g1229 3 AUGUSTUS transcript 5212577 5213612 0.89 + . g1229.t1 3 AUGUSTUS start_codon 5212577 5212579 . + 0 transcript_id "g1229.t1"; gene_id "g1229"; 3 AUGUSTUS CDS 5212577 5212732 0.91 + 0 transcript_id "g1229.t1"; gene_id "g1229"; 3 AUGUSTUS CDS 5213142 5213192 0.97 + 0 transcript_id "g1229.t1"; gene_id "g1229"; 3 AUGUSTUS CDS 5213271 5213612 0.97 + 0 transcript_id "g1229.t1"; gene_id "g1229"; 3 AUGUSTUS stop_codon 5213610 5213612 . + 0 transcript_id "g1229.t1"; gene_id "g1229"; # protein sequence = [MFSGLAEETGNKEYTQYARAEYSGTLAYRGPVPTEKLKEKYPQHIVLNRPKAAHAMLPHQGVGGGQAIEDAHLLGRLL # AHPKAALSSPSRPTTLPIILKLYETFRLPVAQKAAKASYDNGLMYEFNYPGLVFGGSQPDANSRGPTPDDLQVLGERIGESFTWLKEGDVEGDWQKTE # AELEKM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1229 ### # start gene g1230 3 AUGUSTUS gene 5220768 5221073 0.79 + . g1230 3 AUGUSTUS transcript 5220768 5221073 0.79 + . g1230.t1 3 AUGUSTUS start_codon 5220768 5220770 . + 0 transcript_id "g1230.t1"; gene_id "g1230"; 3 AUGUSTUS CDS 5220768 5221073 0.79 + 0 transcript_id "g1230.t1"; gene_id "g1230"; 3 AUGUSTUS stop_codon 5221071 5221073 . + 0 transcript_id "g1230.t1"; gene_id "g1230"; # protein sequence = [MDTHGLVHIDVPSFVSDSGSTLSLGSGNGLSCPTSDTRSSGIDVGSEILRVMFWYQIVGEWHIQNIKSNTPEMSTPFK # IMTIDDILDHGEPQENDLELKVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1230 ### # start gene g1231 3 AUGUSTUS gene 5222387 5223907 0.99 - . g1231 3 AUGUSTUS transcript 5222387 5223907 0.99 - . g1231.t1 3 AUGUSTUS stop_codon 5222387 5222389 . - 0 transcript_id "g1231.t1"; gene_id "g1231"; 3 AUGUSTUS CDS 5222387 5223907 0.99 - 0 transcript_id "g1231.t1"; gene_id "g1231"; 3 AUGUSTUS start_codon 5223905 5223907 . - 0 transcript_id "g1231.t1"; gene_id "g1231"; # protein sequence = [MGNKQSKAAKADVDEINERTIRRNPIVQAMDKKHQEELQNLQKAAEKRAEADENARSRQEKEHQKNLIALQSQLDQEA # EARRVAEEQHREAEQKRIKAEQEAADHAKQAEKAQKARDDAVHAAEKARKAMEEAEYRAQNERRARDEAEVERKNAVLSAEEFRDRERSARDAALKAE # EARAKFEKLEEKARLTGEETEGQLRTFKAEREKTEKELAKARRREAQLAELQPVHEPTRAEHEQTKRDRQYVEGRLHFAIAGVAGSGKSSLINAFRGV # SKGTASAAATGVVETTRTIGRYEDPHPDRSKFVWFDIPGAGTTNVSNSDYFVKQGLYIFDAIIVLFDSRFVDTDITILENCKRFNIPSFIVRSKSDEH # IKAIADEMREALDEDESEDEEDVRSKEREARRTRIDADAKDEYISVTRRNVKENLRKAGLDEEQRIYLISRRTLLRIVRGKQVAPTKLIDEFELIKDV # MAAIKERRIDPPVFKADPAKSGAYLNPFSWGSWGRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1231 ### # start gene g1232 3 AUGUSTUS gene 5226886 5228639 0.11 + . g1232 3 AUGUSTUS transcript 5226886 5228639 0.11 + . g1232.t1 3 AUGUSTUS start_codon 5226886 5226888 . + 0 transcript_id "g1232.t1"; gene_id "g1232"; 3 AUGUSTUS CDS 5226886 5227430 0.22 + 0 transcript_id "g1232.t1"; gene_id "g1232"; 3 AUGUSTUS CDS 5227638 5227729 0.53 + 1 transcript_id "g1232.t1"; gene_id "g1232"; 3 AUGUSTUS CDS 5228188 5228320 0.38 + 2 transcript_id "g1232.t1"; gene_id "g1232"; 3 AUGUSTUS CDS 5228393 5228639 0.77 + 1 transcript_id "g1232.t1"; gene_id "g1232"; 3 AUGUSTUS stop_codon 5228637 5228639 . + 0 transcript_id "g1232.t1"; gene_id "g1232"; # protein sequence = [MDTRIRPGIFAQARHSGSENAQTVLRPHADYRYIGFGGTRTIIIGRHRAAIEIMEKHGADISDRPNSVAAGDTLSGGM # RILLIKSGDKFKKLRKALQSHLQPKSIASYHPILTQSARQHMFDIIEEHNATSKGTSSFVSTRHQDHARRYAAAVVMALAYGKVPHSYEDPEVQAVNR # CLTRLGEEIPASFGKYLIETQPMLGLSDDETAYLAGSNVWSIGRDPDLFPDPEKFDHTRWIATNEKGQVKLRDDLKSYPFGVCPGQHMATASTFVNLA # LVLWAFNLTSDVKKPIDTYAFTESANAHPMPFNIVFTPRVSVKQGDREEKGWEILKEAFETYGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1232 ### # start gene g1233 3 AUGUSTUS gene 5233406 5233876 0.84 + . g1233 3 AUGUSTUS transcript 5233406 5233876 0.84 + . g1233.t1 3 AUGUSTUS start_codon 5233406 5233408 . + 0 transcript_id "g1233.t1"; gene_id "g1233"; 3 AUGUSTUS CDS 5233406 5233876 0.84 + 0 transcript_id "g1233.t1"; gene_id "g1233"; 3 AUGUSTUS stop_codon 5233874 5233876 . + 0 transcript_id "g1233.t1"; gene_id "g1233"; # protein sequence = [MIVGRATDYTSDDPTLNPPIAANQTNPVRRDTVLIPAGGSATLRVVADNPGVWFLHCMSLFYVQSMYEINSKFEPGHI # EWHLEVGLAIQLVEAPLQAQQYADTVPQALSDHCEALGKPASGNAAGIASATDLTGLPLGPFPQNNGWHPKGILAMFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1233 ### # start gene g1234 3 AUGUSTUS gene 5234212 5234592 0.79 - . g1234 3 AUGUSTUS transcript 5234212 5234592 0.79 - . g1234.t1 3 AUGUSTUS stop_codon 5234212 5234214 . - 0 transcript_id "g1234.t1"; gene_id "g1234"; 3 AUGUSTUS CDS 5234212 5234592 0.79 - 0 transcript_id "g1234.t1"; gene_id "g1234"; 3 AUGUSTUS start_codon 5234590 5234592 . - 0 transcript_id "g1234.t1"; gene_id "g1234"; # protein sequence = [MAIYSLINGSKTIPPDSVPIFCDVVSTARVHVKALDSEATYGKRVLFAKGPATMYQILQIIVKARPELADRFPPIPEV # DPVAGKPISRIDSTIAMEALGIKGLELEETVLQTVDNLLELEKKLGPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1234 ### # start gene g1235 3 AUGUSTUS gene 5236284 5236766 0.99 - . g1235 3 AUGUSTUS transcript 5236284 5236766 0.99 - . g1235.t1 3 AUGUSTUS stop_codon 5236284 5236286 . - 0 transcript_id "g1235.t1"; gene_id "g1235"; 3 AUGUSTUS CDS 5236284 5236766 0.99 - 0 transcript_id "g1235.t1"; gene_id "g1235"; 3 AUGUSTUS start_codon 5236764 5236766 . - 0 transcript_id "g1235.t1"; gene_id "g1235"; # protein sequence = [MFNEFCVTVFILATVIYGPVIHPISSLKSLNASNTIIYSLINGSKAIPPDTVPVFCDVVSTAQIHVKALESKATYGKR # VIFTKGPGTVYQMLQIIAKARPELADRLSPIPEADPLAGKPFSKFDTSIAVDVLGVKGLDLEETVLQTVDSLLELEKKLGTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1235 ### # start gene g1236 3 AUGUSTUS gene 5239960 5241029 0.3 - . g1236 3 AUGUSTUS transcript 5239960 5241029 0.3 - . g1236.t1 3 AUGUSTUS stop_codon 5239960 5239962 . - 0 transcript_id "g1236.t1"; gene_id "g1236"; 3 AUGUSTUS CDS 5239960 5240620 0.85 - 1 transcript_id "g1236.t1"; gene_id "g1236"; 3 AUGUSTUS CDS 5240673 5240916 0.4 - 2 transcript_id "g1236.t1"; gene_id "g1236"; 3 AUGUSTUS CDS 5241020 5241029 0.46 - 0 transcript_id "g1236.t1"; gene_id "g1236"; 3 AUGUSTUS start_codon 5241027 5241029 . - 0 transcript_id "g1236.t1"; gene_id "g1236"; # protein sequence = [MLSHSELLPQFVQMAHQNVRVMIYIRDIFANWGAVQNVTASISIGGWGGSQYFSTNVGSAANRTAFVKTVAGLATQYD # LDGLDFDWEYPNRQGIGCNTINNNDTSNFLSFLQELRQDSTGSKLVLSAATSLLPWNDTSGAPSKNVSEFSKVLDFIAIMNYDVYNILSAHAGPNSPL # DDTCAPTNDQTGSAVSSVKAWTDAGMPADQILLGVAAYGHSFVVPDSTALQSSSSINVTNVYPSFNKSAEHLGDKWDSPGGVDVCGNFSGPSGVYSYW # GLVEAGYVNEDGTPTSGFAYLFDNCSQTVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1236 ### # start gene g1237 3 AUGUSTUS gene 5246610 5246948 1 - . g1237 3 AUGUSTUS transcript 5246610 5246948 1 - . g1237.t1 3 AUGUSTUS stop_codon 5246610 5246612 . - 0 transcript_id "g1237.t1"; gene_id "g1237"; 3 AUGUSTUS CDS 5246610 5246948 1 - 0 transcript_id "g1237.t1"; gene_id "g1237"; 3 AUGUSTUS start_codon 5246946 5246948 . - 0 transcript_id "g1237.t1"; gene_id "g1237"; # protein sequence = [MSLPPPSYDSFDYPIPDYSSEPRANEERLVYQQIRQSQGSDTRPTGVFVSQEEGITVVINYQEDKTPTPVFGRKSNIE # GTLLVDAPESVSEVTVKVLYSKSALELGSSVIDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1237 ### # start gene g1238 3 AUGUSTUS gene 5253746 5255405 0.4 + . g1238 3 AUGUSTUS transcript 5253746 5255405 0.4 + . g1238.t1 3 AUGUSTUS start_codon 5253746 5253748 . + 0 transcript_id "g1238.t1"; gene_id "g1238"; 3 AUGUSTUS CDS 5253746 5253969 0.4 + 0 transcript_id "g1238.t1"; gene_id "g1238"; 3 AUGUSTUS CDS 5254307 5255405 0.98 + 1 transcript_id "g1238.t1"; gene_id "g1238"; 3 AUGUSTUS stop_codon 5255403 5255405 . + 0 transcript_id "g1238.t1"; gene_id "g1238"; # protein sequence = [MGNKLSRVSEEIKQLEDNNSELTSEASNMQTKLREAETEKNALEEDNQQLLNDFGVLKEDHDTLKVWFNILSPLKLAS # LNEEKEKEAEKAHRGAQTLVDEKAKLVDEAEAASQRIQELELGDATKIQELRDNMAAANQTIRELVDEKATLERVSADAAKAASGRIRELELGDARTI # QELRDDISAANQRIQELVDEKATLERDSVVAATAASCKIQDLDKEKARLVDEKAKLVDEAVAARQRNQELEQSNATTILELQGDMAIANQRIQELDNE # KAMLERESAVALSAASQKIQDLDKEKATLLDDTTAANRKIQELVGQKAALERKSADTAAAVTKKIKDLDKEKAKLVDETVTANRRIQGLVDEKTTRDR # ESAAAAAAASQKIRDLETEKKQLVDEAAVAVRKAQNVDDEKTKLIQHLEHQLRSSKVSVITILMLSKY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1238 ### # start gene g1239 3 AUGUSTUS gene 5259632 5262525 0.43 - . g1239 3 AUGUSTUS transcript 5259632 5262525 0.43 - . g1239.t1 3 AUGUSTUS stop_codon 5259632 5259634 . - 0 transcript_id "g1239.t1"; gene_id "g1239"; 3 AUGUSTUS CDS 5259632 5261886 0.97 - 2 transcript_id "g1239.t1"; gene_id "g1239"; 3 AUGUSTUS CDS 5261994 5262375 0.95 - 0 transcript_id "g1239.t1"; gene_id "g1239"; 3 AUGUSTUS CDS 5262421 5262525 0.43 - 0 transcript_id "g1239.t1"; gene_id "g1239"; 3 AUGUSTUS start_codon 5262523 5262525 . - 0 transcript_id "g1239.t1"; gene_id "g1239"; # protein sequence = [MAAGISSNLSRVDPSRSKSIDAMFEEFQAEVTKEADTLQKVNSMLSNKVSSGSSVVSNDSLEPLLVPDAQGRLQFGDP # KKRNKRTTRALVTVSGLTQAIRKLEEKIQHMSPSHNMTEIHETLCVVEDGSEVLRHQISFVTRSAISEEVTKARGMLDALDQTTRKYFFDPGEGKNTP # TIIAYCLALVSRVFERTAQRGASLILKLVKMFGFSIAILGGQGLNSDQEATLAGIPETIETLEGKFNLDVDCVPYAVCPKCSYTHAPSYPNDPSHPVY # PSVCSERKAPSEEPCGASLLLHGKPLKIFEYYPFFDWFGKFLALPGIEEYGDKFCDTVCSHQTIPNDKTDQTDGRFFHEFRAHDGQLFIANREEEGRW # FFVFNADFFNVEGNRIRGKTSSTGMMAMSCLNLPLEIRNDHAYLYMPGIIRGPHEPNAGDAEHCHYLRPLIDDLVKGFTRGVRPYATFRTRNNDIPYG # RVSRVALALALMDFKAARPFCGFLDVTSHHFCFMCDCWHISHLGRTDYENWKPLDDGLLRRAAEQWRNALLKDRKAIEELFGTRFSELWRLPYWRLCQ # MGIDPMHAMFLILLQRYFRDILGLDNPDNSKQTRKKPRFKLAFYHQFTPPPSLSSLVREMEVPPRRWSSVVGYVPQPIDENRLSLLDWTHLSPEHRAF # RQTRLESLKLEITADSRAFQAVMEILNDLSEKAPETLSKKKVLYRKIHKQKWNVILYICDNLAIFPDDRCPQHRASSKITKANVTKEQLTNILIEWVR # VSLSLSHLLVLSNIQRINGIQETDDFVWPFFTPKNVPPPVTPWARAPSDPIVTTRKLSLQECSELLTELSKSMNFTSALAIGNIHRVLQQPLARGEPE # DELRKVLKKFPGDSLAFVCIDIERLPAGKFSKDDMVRQLMIWVCISVLASC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1239 ### # start gene g1240 3 AUGUSTUS gene 5264601 5265239 0.95 - . g1240 3 AUGUSTUS transcript 5264601 5265239 0.95 - . g1240.t1 3 AUGUSTUS stop_codon 5264601 5264603 . - 0 transcript_id "g1240.t1"; gene_id "g1240"; 3 AUGUSTUS CDS 5264601 5265239 0.95 - 0 transcript_id "g1240.t1"; gene_id "g1240"; 3 AUGUSTUS start_codon 5265237 5265239 . - 0 transcript_id "g1240.t1"; gene_id "g1240"; # protein sequence = [MNPYSNFDHRPLCADHKEIHTPSKASNPTDHVVISPSSGPTRTQKTSRRASPYSSPSPDPEPLPVRHNSPSPPSTLSL # FSSIESLSSELEHDSDRERLARSRSTRRVSFVSDNGSSTFSRSRDHSASTTEHTSTSNSTLNDSAPKNDGRKARTSSAEKKHDPPPLVFEDDSNDDFL # IPKPPGEVGRPGRGGYSLFEVLSWPRKKYDKVKVRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1240 ### # start gene g1241 3 AUGUSTUS gene 5274934 5276331 0.59 - . g1241 3 AUGUSTUS transcript 5274934 5276331 0.59 - . g1241.t1 3 AUGUSTUS stop_codon 5274934 5274936 . - 0 transcript_id "g1241.t1"; gene_id "g1241"; 3 AUGUSTUS CDS 5274934 5276096 0.92 - 2 transcript_id "g1241.t1"; gene_id "g1241"; 3 AUGUSTUS CDS 5276202 5276331 0.59 - 0 transcript_id "g1241.t1"; gene_id "g1241"; 3 AUGUSTUS start_codon 5276329 5276331 . - 0 transcript_id "g1241.t1"; gene_id "g1241"; # protein sequence = [MVRAVKRHENGFISDPVVLSPSHTVADVLDIKARLGFCGIPVTDTGMLGGKLVGIVTSRDIQFREPSTSLSDVMVTDL # VTAPQGITLLEANDILRDSKKGKLPIIDSKGHLITLLARSDLLKNQSYPLASKNPETKQLYAAASVGTRPSDRERLALLVEAGLDIVVVDSSQGNSIY # QIDMIRFIKEKYSKLEIIAGNVVTREQAASLIAAGADGLRVGMGSGSICITQEIMAVGRPQATAVYAVSEFANKFGVPVIADGGISNIGHIVKAVTLG # ASAVMMGGLLAGTEEAPGEYFYHEGKRVKAYRGMGSLEAMEQGKPGVQPKVNGVQSGSSKYPSPKKDNDLENAATSRYFSESSAVKVAQGVSGDVQDK # GSVKAFIPYLYVGLQHSFQDIGVRSVSELREGVSSGKVRFELRTASAQVEGGVHGLNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1241 ### # start gene g1242 3 AUGUSTUS gene 5281359 5282519 0.53 + . g1242 3 AUGUSTUS transcript 5281359 5282519 0.53 + . g1242.t1 3 AUGUSTUS start_codon 5281359 5281361 . + 0 transcript_id "g1242.t1"; gene_id "g1242"; 3 AUGUSTUS CDS 5281359 5282519 0.53 + 0 transcript_id "g1242.t1"; gene_id "g1242"; 3 AUGUSTUS stop_codon 5282517 5282519 . + 0 transcript_id "g1242.t1"; gene_id "g1242"; # protein sequence = [MSLAGNNRTRSNKHSQSMLTSNLLEFGEHWFQPLLTLASFHTRDTVNSVGIIPKRLPFTSSNTIVRTFRHAVSLDERR # AKFKANLWNRPNAHEETLGITSAKVHHPKKKVSHKVSHKHSLREMEAEYDKDHSKPTDVDEVNLLIPYRIFRLLTYVPSGVVCWLSLRYVKPISGSTN # TFILCLADVGGGSVSNDTTINLARIPLRWMIRECFKTKTGIMFDRDGLRGLGLDPDALYPDVLPRPPPLPVGNARIQDIPTKGSVSQIEKDSALKNFS # GGSSEVSGALVQTEEELELKDALSPIYDQLSLAWFWWILEIFPIKQRFQRGDNSWASYFGWNLGRGRIVPKQKKQGVRVHRSVKMRLESQHTDGSKYK # PKANIDFQYATWVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1242 ### # start gene g1243 3 AUGUSTUS gene 5285283 5286313 0.09 + . g1243 3 AUGUSTUS transcript 5285283 5286313 0.09 + . g1243.t1 3 AUGUSTUS start_codon 5285283 5285285 . + 0 transcript_id "g1243.t1"; gene_id "g1243"; 3 AUGUSTUS CDS 5285283 5285741 0.22 + 0 transcript_id "g1243.t1"; gene_id "g1243"; 3 AUGUSTUS CDS 5285804 5286313 0.38 + 0 transcript_id "g1243.t1"; gene_id "g1243"; 3 AUGUSTUS stop_codon 5286311 5286313 . + 0 transcript_id "g1243.t1"; gene_id "g1243"; # protein sequence = [MRDKLEVVVKGGRMGPQPRSLRNDGRVATIVVTLPVRFRGGSFIVRDSEGYEERYFGRGGKNGDMEWLAFSADCEYEV # ETVTKGCRITILYGVYLKTFGPTGVTEPLINPSDNFLDLMSPVLNMSLGRRVGIYVSNDYGVNPSEVLAESLVPMLKGGDSVLYHAIKLYKLSPELHW # TAGGYIWPVDRTVEIAEQGQNSSPSAKLAGLLETPRGRVTSTPAVRGAFALPPHAGSASGRAGSVAGRAGSVNGGFSGSSAGSTYPDSDEDLLDNLRY # RVQQSGAIPLGEADITILNDWNNPTPMIGKERVRLLSVGSWISWWSMR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1243 ### # start gene g1244 3 AUGUSTUS gene 5287584 5289677 0.68 + . g1244 3 AUGUSTUS transcript 5287584 5289677 0.68 + . g1244.t1 3 AUGUSTUS start_codon 5287584 5287586 . + 0 transcript_id "g1244.t1"; gene_id "g1244"; 3 AUGUSTUS CDS 5287584 5289677 0.68 + 0 transcript_id "g1244.t1"; gene_id "g1244"; 3 AUGUSTUS stop_codon 5289675 5289677 . + 0 transcript_id "g1244.t1"; gene_id "g1244"; # protein sequence = [MHFTHRTIGLAWTALHILFWIQLSNGVPLLHRPRTISGHPNTNHEGYKSTLSTRDNANSSASSNGTTSVSPSIRDDVE # SMLQLIGPDAESRFVSINLPTAFGANDPVQSNKDLSQLVDRAFLLGQAKSGNSGWVDTYIQCLIDVANTLPSLDNQTVLIDDYYNSMRTLAPVQAKLV # QAYKAAKNESTTNIGVQLSSGQLIDALTMRTVDEWAASAFNGSDSGEGSSHSGFDSKDYTNYLSLNASYTKILPKYNKLETANKVLLFLKNFENDALI # CPQIASEGWLLREMINQSPAIFNLSMITSGDPSSLSAHYSPAWSAIIINSTSVAVTSSNSDVSGNLDHSLHDGTDNSTTYATSINNEAPVSTSISFNS # TTESSDSGSSSATPTSTNSLSSKQNTQSPTSTSAVSLAHTATATGSARRSRIRRAIVSTGSRIQRRALAASNALLLAASADSTSARTTSSGKNAGKPA # GKYASLPGMKEVASAANFAAEPDVADAVSFAPLLSTATLTQTSSSSSATSVNGVLKPNAPNASDPLSGIPDVPLQTTSSLFAMTLQEGAWSNNRLEFL # KFIAQNHPEIYRKYFFGNASGNGTTGDGPLGKHWTHIFLLVTVKANSTEIETSQVVGMVYDVLPGLVVPSTSEDVDADKRKANSENNSTDTSSGTDTG # TSGQNQTKEDKDLGGGIGQPNSNTSDTESSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1244 ### # start gene g1245 3 AUGUSTUS gene 5291826 5292137 0.63 - . g1245 3 AUGUSTUS transcript 5291826 5292137 0.63 - . g1245.t1 3 AUGUSTUS stop_codon 5291826 5291828 . - 0 transcript_id "g1245.t1"; gene_id "g1245"; 3 AUGUSTUS CDS 5291826 5292137 0.63 - 0 transcript_id "g1245.t1"; gene_id "g1245"; 3 AUGUSTUS start_codon 5292135 5292137 . - 0 transcript_id "g1245.t1"; gene_id "g1245"; # protein sequence = [MHHVQIGTHSIQDVELDTNVVALSTVTSVPFRFVIGWERLQDIVRRRRLEDNTHVKRVHVPTVALGESQKSGNVIAHD # KTHEVTATTCQGRGLSGRKQEPWDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1245 ### # start gene g1246 3 AUGUSTUS gene 5300187 5303008 0.78 - . g1246 3 AUGUSTUS transcript 5300187 5303008 0.78 - . g1246.t1 3 AUGUSTUS stop_codon 5300187 5300189 . - 0 transcript_id "g1246.t1"; gene_id "g1246"; 3 AUGUSTUS CDS 5300187 5302420 1 - 2 transcript_id "g1246.t1"; gene_id "g1246"; 3 AUGUSTUS CDS 5302489 5303008 0.78 - 0 transcript_id "g1246.t1"; gene_id "g1246"; 3 AUGUSTUS start_codon 5303006 5303008 . - 0 transcript_id "g1246.t1"; gene_id "g1246"; # protein sequence = [MRGLVEMDGAWLWETPSQPIPDGIPAWSLRGTAGSMFVRQARTSTAKPANSAASASARVASKPLSAASDSQTPPRARR # TQNTASASASATAPSPITSSSARPTGTAPTTTSTNTTSTPVTRPIYGPPRPPASPGLKKASLLPKTDHGELSSVPVITSAKSSKRSSEISKSQKQVEV # KSSANITGDSISVVLQKPKTISKKSNKNTILTSTNASSAPIPSPPASMSTSTTGHRPVISTPSSLNTVVSSASPIPTPAPTPTPSMQSIPSLFPSNDA # TEPASSSKIKSKSTPTVQVPSTSSNYNSPTLTTTAINSTNHPLCDPQVLAHETNASISVSMPKRQSPDNSSASSSRIQTPITPSQTFVIPVNPRDVKD # LTIVTNTSQSDSEGTVKFDIDTNGAKMNDDEGTRTATISPDRTLPPAPLPPQNPLLGGSSSRDLPPHPRPSLLHRVPRSYNVVSPPPVPPSVTSPVTP # VVPSIDSISSSSSESSEPPSKPSSISQTSATKSNALTVDLTSPANAIQNGDQRPARKTSKISNSVNPLSPPVYTDSLSDAAASVLTIPSTQSNSTTTT # TGTSTITTFNDVPTTSTGDTGERDLKGLKDDMRMRNIDDSAKSTKPTRPNGRENWNGTGAGIKRSGSPLEKPGPSKIQQTPRNFQHHSAPVSPPHSPS # HSSSSPHSLPLRDIPSHSSHLTPDTSETFTEIPGLGNFPIPPSPKLRIIELPPINTHGPTTTTTEVLRNTVPIIKVTRTMDAMDTSMDTSESETKQMT # SLIRPSIPVTSFHPNVEPQPSLDFLNSNGNATMNGALSSTSSSLRSSTTMSLHDSLTPSVPLEHLIRAQRKGGNKNQARSQGYTMKGESKPDSAELDA # DRFEGSGSMGNKEVGRTNGTGSTGSTTGSGSSSTPFSLSRHTLAHLLGEPSNFSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1246 ### # start gene g1247 3 AUGUSTUS gene 5304128 5305782 0.62 - . g1247 3 AUGUSTUS transcript 5304128 5305782 0.62 - . g1247.t1 3 AUGUSTUS stop_codon 5304128 5304130 . - 0 transcript_id "g1247.t1"; gene_id "g1247"; 3 AUGUSTUS CDS 5304128 5305530 0.97 - 2 transcript_id "g1247.t1"; gene_id "g1247"; 3 AUGUSTUS CDS 5305614 5305782 0.62 - 0 transcript_id "g1247.t1"; gene_id "g1247"; 3 AUGUSTUS start_codon 5305780 5305782 . - 0 transcript_id "g1247.t1"; gene_id "g1247"; # protein sequence = [MLSTRPISRNAENNTNRHAFKTPSRGLAENRLGTLKGKGKAGVGQQTPFQTKTPFQNTQLKGGVRIPARPFLDKTPFP # NRIVNLSNANNIHAQTPYLHPASASGTPDSALRPSSTRKHIRVPRNSQKFETPLNTRNHWDVDLNDDSADDIAVGLPESALPEEEDFDEIEYMAPNTL # GTSALYSSPVAVILKQWRLYVDLPYQPPFDLEMPDYKVLGKTIMEASRNGAFYEPPESPVEFEIRTEDIEICDVALDFSSICESFSFLPSVDHSSCTH # CPFYIADADPFFEFPYNKLANPQPVKPKPTRSIITCPMPLSTRTSIVTRTGASGVPSSGLRSTTATVTSKISHPGKSTSVRPLSRPVSQIATSNSRTT # LTRPVPRTASRTAVSSKGGESTRSVTAATTIARGNSTTSTTAASRSRARSNTTTNASSVVGAVAGLKRPTSSAAASSKTTVRSAVTTTSTTTAPTLKR # PTTLVRPKSSSTATFAVKPARIADVVAQAPELGGDIVTLDRVEESLDDFMFDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1247 ### # start gene g1248 3 AUGUSTUS gene 5309958 5310296 0.69 - . g1248 3 AUGUSTUS transcript 5309958 5310296 0.69 - . g1248.t1 3 AUGUSTUS stop_codon 5309958 5309960 . - 0 transcript_id "g1248.t1"; gene_id "g1248"; 3 AUGUSTUS CDS 5309958 5310296 0.69 - 0 transcript_id "g1248.t1"; gene_id "g1248"; 3 AUGUSTUS start_codon 5310294 5310296 . - 0 transcript_id "g1248.t1"; gene_id "g1248"; # protein sequence = [MEALRKEAEKLAQERRLAREQALEWTREARMNESDEEKEKRPKKAKKSKGDGTGSGDEGDAPKKKRRGKIRKANGEPT # EEGEEPAAVFSDEDEAERPTKKVCICHLGMDRIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1248 ### # start gene g1249 3 AUGUSTUS gene 5310971 5312292 0.75 - . g1249 3 AUGUSTUS transcript 5310971 5312292 0.75 - . g1249.t1 3 AUGUSTUS stop_codon 5310971 5310973 . - 0 transcript_id "g1249.t1"; gene_id "g1249"; 3 AUGUSTUS CDS 5310971 5311538 0.97 - 1 transcript_id "g1249.t1"; gene_id "g1249"; 3 AUGUSTUS CDS 5311631 5312292 0.77 - 0 transcript_id "g1249.t1"; gene_id "g1249"; 3 AUGUSTUS start_codon 5312290 5312292 . - 0 transcript_id "g1249.t1"; gene_id "g1249"; # protein sequence = [MNNGRNPQFLRFFGLIKTGLDEPGGAINTLDNLLQAPNPQKSLEATVMLASLRGSPRPGISSSEMVQERARARELFDR # ISKTLEIEDGKVNGSGLSKASRTISEDMNMHLEIARLWQDQNLDRSSKALQEALQISQLSGTTEPRLLNNLGALHHLDSNYSQALGFYEAALMESMSS # ENAEIISTSILYNLARVYEDQEEVEKATDAYEKLLSRHPEYVDGTEAHDLIKESLASQSSNLNLRAFYTYFLVQTNLTKNAKDFVFTTLKDFDKHDIY # SLCAAGWIHYNQARESRDTSSKGTEERRRGFQRSTEFYEKALQLDPFCAFAAQGLAIVTAEDALGALSGVSLSAGDDAQRRIQSTRDALDVFAKVRES # INDGSVYLNMGHCYYARDEFDRAIESVSHRSKRILTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1249 ### # start gene g1250 3 AUGUSTUS gene 5320006 5320490 0.79 + . g1250 3 AUGUSTUS transcript 5320006 5320490 0.79 + . g1250.t1 3 AUGUSTUS start_codon 5320006 5320008 . + 0 transcript_id "g1250.t1"; gene_id "g1250"; 3 AUGUSTUS CDS 5320006 5320321 0.79 + 0 transcript_id "g1250.t1"; gene_id "g1250"; 3 AUGUSTUS CDS 5320378 5320490 1 + 2 transcript_id "g1250.t1"; gene_id "g1250"; 3 AUGUSTUS stop_codon 5320488 5320490 . + 0 transcript_id "g1250.t1"; gene_id "g1250"; # protein sequence = [MKFVDVAIPTNNKAKHSIGLIWWLLAREVLRLRGTIPRTSDGWNVMVDMFFYRDPEEVEKQQQEEAAAKLAAQAGEEP # AAGLTEWDVASGPAAGAINPALVSQEGATLDWSADATAGPTDWAAEPSGAGWGADAPAGGSGWD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1250 ### # start gene g1251 3 AUGUSTUS gene 5323455 5324795 0.49 - . g1251 3 AUGUSTUS transcript 5323455 5324795 0.49 - . g1251.t1 3 AUGUSTUS stop_codon 5323455 5323457 . - 0 transcript_id "g1251.t1"; gene_id "g1251"; 3 AUGUSTUS CDS 5323455 5324041 0.85 - 2 transcript_id "g1251.t1"; gene_id "g1251"; 3 AUGUSTUS CDS 5324136 5324478 0.5 - 0 transcript_id "g1251.t1"; gene_id "g1251"; 3 AUGUSTUS CDS 5324595 5324795 0.91 - 0 transcript_id "g1251.t1"; gene_id "g1251"; 3 AUGUSTUS start_codon 5324793 5324795 . - 0 transcript_id "g1251.t1"; gene_id "g1251"; # protein sequence = [MDYGSHFPADHDDGASTSKLQQWSQGPANAKLFSGGKRRPSVVFVPSAQSDLYAQEAPLDHCLWQVQEQDDIFYATFP # QARGLHWSPQVLPANEYSGYFGGTAFSLSRNGPGHGYRSSGLTEHNPPCTPSVRYSPGSLHIEAGCTPSCIVSPGSMSTIDSCGNDKSVARLECDSSQ # LISLVKPFDVPLPKSPLQLSAEDVDTATFSGTHEPLMNFLTPPFTEPEASSPAKSPSHVEDILKMNTSKAFICKGEASRIDLQLGLVSSPTGTWPSVR # VRSIQNTPESDSPTSSNIDRRDTPEPFTSTSTLPLSTSSPRAPEPQLDTHFQPESSGLMRLSPLPMNRRPIEKKKAQTLACNFCRIRKVSKLATVWVV # VVKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1251 ### # start gene g1252 3 AUGUSTUS gene 5329546 5329932 0.93 - . g1252 3 AUGUSTUS transcript 5329546 5329932 0.93 - . g1252.t1 3 AUGUSTUS stop_codon 5329546 5329548 . - 0 transcript_id "g1252.t1"; gene_id "g1252"; 3 AUGUSTUS CDS 5329546 5329932 0.93 - 0 transcript_id "g1252.t1"; gene_id "g1252"; 3 AUGUSTUS start_codon 5329930 5329932 . - 0 transcript_id "g1252.t1"; gene_id "g1252"; # protein sequence = [MLASLFANPVIRQILLSTGNIPVDRKSNDRRVLFRGTFEALSKGYAVALFPEGTSYTEPRIMQIKDGAAWAALEYTKY # AKEHPGTQEVKVVPVAIVYTNKSKYRSSVSVLAYSEEKFDIYSTGQVIIE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1252 ### # start gene g1253 3 AUGUSTUS gene 5330639 5331451 1 - . g1253 3 AUGUSTUS transcript 5330639 5331451 1 - . g1253.t1 3 AUGUSTUS stop_codon 5330639 5330641 . - 0 transcript_id "g1253.t1"; gene_id "g1253"; 3 AUGUSTUS CDS 5330639 5331451 1 - 0 transcript_id "g1253.t1"; gene_id "g1253"; 3 AUGUSTUS start_codon 5331449 5331451 . - 0 transcript_id "g1253.t1"; gene_id "g1253"; # protein sequence = [MTLEAALDHSWLQDYVKKNNRDATADRNLGKPRDHQPDSSEFIPTGRDAIPDNTNEEKQPGSTFFSQGFQKLDINDKK # QVGPSNANDRAGVSSNSASADLPNGAADDDSQMDDATPPPPSQTRKLQPQNSRVLRRRKDVLEEANAGEMTIPRPSPELLSQFDEKRKREEDVGKPAT # GPSRTPEKRRGKRAHGDLSAVPEMADNGIGSGGEIVAVTAENGSADDSGAQPTPSKRRRNAPPTNNAARGKKVKKPTEPAVGVRRSSRNKSASA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1253 ### # start gene g1254 3 AUGUSTUS gene 5332846 5333268 0.73 - . g1254 3 AUGUSTUS transcript 5332846 5333268 0.73 - . g1254.t1 3 AUGUSTUS stop_codon 5332846 5332848 . - 0 transcript_id "g1254.t1"; gene_id "g1254"; 3 AUGUSTUS CDS 5332846 5333268 0.73 - 0 transcript_id "g1254.t1"; gene_id "g1254"; 3 AUGUSTUS start_codon 5333266 5333268 . - 0 transcript_id "g1254.t1"; gene_id "g1254"; # protein sequence = [MSSQHSQHDDESVVESQSVKQTQPSSQGLDFGREIHENVWGSFYPLVKDMKEVNLFKPKLTYRIGRSLHNDVVFPGYK # ISAYICNSRLVALQLTINFVGNKHAEITWDGRETKDSIIMLKDNSSNGTYASFISIIHSTKY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1254 ### # start gene g1255 3 AUGUSTUS gene 5335762 5336778 0.42 - . g1255 3 AUGUSTUS transcript 5335762 5336778 0.42 - . g1255.t1 3 AUGUSTUS stop_codon 5335762 5335764 . - 0 transcript_id "g1255.t1"; gene_id "g1255"; 3 AUGUSTUS CDS 5335762 5336778 0.42 - 0 transcript_id "g1255.t1"; gene_id "g1255"; 3 AUGUSTUS start_codon 5336776 5336778 . - 0 transcript_id "g1255.t1"; gene_id "g1255"; # protein sequence = [MLLASYQCSYPTFARAGYTTADARRIMFKSVQLASKAREIFRDEQVRNGTPVRNVRIALSLGPFGASLEPAQEFDGFY # PPPFGPKAYTHMDAENGNNFGDDEVAKNESIDALTLFHLERLLILFENEAMWSSLDCIAFETVPLTREIWAIRRAMGLLHDRVGAGRVSISDKAKPWW # ISMVFPNGIYPETTKDGFSRIQVADIVSAAIEHQSMNHPCPSGLGINCTQVEYLPKLISEFEGSLQNFQKTQSSLDCDSDLLDNNIIKPWLVLYPNGG # DIYDPVTQNWVEKNQANEEHWARTLTKSYTPSRIWAGVLLGGCCRTTPIHIQSLKQMVQSDINP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1255 ### # start gene g1256 3 AUGUSTUS gene 5337830 5340175 0.05 - . g1256 3 AUGUSTUS transcript 5337830 5340175 0.05 - . g1256.t1 3 AUGUSTUS stop_codon 5337830 5337832 . - 0 transcript_id "g1256.t1"; gene_id "g1256"; 3 AUGUSTUS CDS 5337830 5338347 0.22 - 2 transcript_id "g1256.t1"; gene_id "g1256"; 3 AUGUSTUS CDS 5338458 5338720 0.24 - 1 transcript_id "g1256.t1"; gene_id "g1256"; 3 AUGUSTUS CDS 5339316 5339476 0.14 - 0 transcript_id "g1256.t1"; gene_id "g1256"; 3 AUGUSTUS CDS 5339597 5340175 0.13 - 0 transcript_id "g1256.t1"; gene_id "g1256"; 3 AUGUSTUS start_codon 5340173 5340175 . - 0 transcript_id "g1256.t1"; gene_id "g1256"; # protein sequence = [MQSIAAKRPQTSSKPSPISRTASVPPVPSTSGASAKFTLPLSSSTISIPAEPYARSGVKTTSKVKTLSRKQPLDSDSC # SQPTKKVKKGGGEGGGESDSVIPSLLSRMGTSPSLPKIPPHFHPRPLRQQTLPHSRLQRSEILPSGPIGLKIKGAARKEESLLSTESEINHHAGQRQA # PTVNSSLMDRLALNGGMTPLVISSHHERRGDGRGVWVRTSWVLGTLDSPQDLSQAYSTSRAPITPDWLFPIRAFEHGEERSGMDGGVSPDNCSAVELT # KFICGSGFGTQMSNNPMVILWSNSDGSITLSQRVALSWVMPEVVDNPPRIATLSSDLSTVFPDLIFNFPNKWDNSAKTNLIWAFGTQNPGSSAVDAPF # QFHLDAGYAHFDLSKPISANSNEGLSTPSTSTPSTNPASSSKASPSSSSLTSTNSLPLNAHQRLVFAHAVFCTAGFLLFLPAGALVSRWARTFTPAWY # TAHWILQFIVCGSSCVHTEYTILIQPKKLGSASSLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1256 ### # start gene g1257 3 AUGUSTUS gene 5345278 5346015 0.67 - . g1257 3 AUGUSTUS transcript 5345278 5346015 0.67 - . g1257.t1 3 AUGUSTUS stop_codon 5345278 5345280 . - 0 transcript_id "g1257.t1"; gene_id "g1257"; 3 AUGUSTUS CDS 5345278 5346015 0.67 - 0 transcript_id "g1257.t1"; gene_id "g1257"; 3 AUGUSTUS start_codon 5346013 5346015 . - 0 transcript_id "g1257.t1"; gene_id "g1257"; # protein sequence = [MTKTLDSFSTLLGMLTDTFLLEEPLHLRSQGRIQRAVEAHQSSFTSLKKNLKEASSEWIFWGRYRTPTSGAFTKLARG # NAPIRDPDNDGGRRKAYQDAVDSLNRLAQHLNGLRSGTRLQFELTQAGAVERKARNKKTHGVPSSKSGPLVDVSLADSMVEDDDEEAAMLKAAAVMFG # DLVDDLGPPMKALSVCDLLLISRLHFLIGFSYRAPVPPVSNAFVNLSSFHNKTIVAHTTASSTFQNSMN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1257 ### # start gene g1258 3 AUGUSTUS gene 5346337 5347455 0.88 - . g1258 3 AUGUSTUS transcript 5346337 5347455 0.88 - . g1258.t1 3 AUGUSTUS stop_codon 5346337 5346339 . - 0 transcript_id "g1258.t1"; gene_id "g1258"; 3 AUGUSTUS CDS 5346337 5347455 0.88 - 0 transcript_id "g1258.t1"; gene_id "g1258"; 3 AUGUSTUS start_codon 5347453 5347455 . - 0 transcript_id "g1258.t1"; gene_id "g1258"; # protein sequence = [MNHQNISSSSSWIPYVPSSSPSNSPVHDIEAGRGVDDSSLQPEAASVLTGSSSTRPTTPKLSTSFMVAPSSGEPFSRP # SLGRSATTPHLPQVRKRNSALLRLNTGNHTPREWSVFGQLMENEGQITPQSASFRRTSRAHSTRIPSGNITPRSSMIESHPSIDIQSPVAEEEFFGGR # SPTDSDSDSESVHSLDSEESSSYASTVQDETQPKWYSLRERIPTVPVLYRNIFKCAVAYFIASLFTFNPYLSGFMSDLVSYGSGERRPLPSGHMVATV # CVIPTSLPWLYIIYFVSAVYFNPAKTMGGMIEADFFCLFGILYSAFICLSSMSMFWWLDVQPGWEWLADSLAIVWVGAGMSFLAWMKVYMVQKLFSNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1258 ### # start gene g1259 3 AUGUSTUS gene 5347857 5348521 0.4 - . g1259 3 AUGUSTUS transcript 5347857 5348521 0.4 - . g1259.t1 3 AUGUSTUS stop_codon 5347857 5347859 . - 0 transcript_id "g1259.t1"; gene_id "g1259"; 3 AUGUSTUS CDS 5347857 5348387 0.96 - 0 transcript_id "g1259.t1"; gene_id "g1259"; 3 AUGUSTUS CDS 5348501 5348521 0.4 - 0 transcript_id "g1259.t1"; gene_id "g1259"; 3 AUGUSTUS start_codon 5348519 5348521 . - 0 transcript_id "g1259.t1"; gene_id "g1259"; # protein sequence = [MSAAFETELLPAASSILSTEARQSTWIQSTVQHLNPWSGAFEVPLTPNQIFTIASNFIVTCPSSNPPIAATHAFPPIG # IPTTAAPGSSVQLSFDLNETSASDLSELFVAFLTSNGTIFEQFSSSDSYNVTFPTQEEGLLGTVFVLIVNSTTEAVTDATTIAGPTPLMFPFNATDPQ # IEALFPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1259 ### # start gene g1260 3 AUGUSTUS gene 5348618 5349031 0.34 - . g1260 3 AUGUSTUS transcript 5348618 5349031 0.34 - . g1260.t1 3 AUGUSTUS stop_codon 5348618 5348620 . - 0 transcript_id "g1260.t1"; gene_id "g1260"; 3 AUGUSTUS CDS 5348618 5349031 0.34 - 0 transcript_id "g1260.t1"; gene_id "g1260"; 3 AUGUSTUS start_codon 5349029 5349031 . - 0 transcript_id "g1260.t1"; gene_id "g1260"; # protein sequence = [MKSALFLSALAFFSSTKAYTIPQSKRTIDIVGKSRGSASHYSSSSSSSSSSYSSDYSSITDAEVLNYALTLEHLEVAF # YTQGLTNFSADAFAAAGFAAAVRANYDEILSHEETHITLLQSVLEEMGADIVQECTYDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1260 ### # start gene g1261 3 AUGUSTUS gene 5352207 5353164 0.99 + . g1261 3 AUGUSTUS transcript 5352207 5353164 0.99 + . g1261.t1 3 AUGUSTUS start_codon 5352207 5352209 . + 0 transcript_id "g1261.t1"; gene_id "g1261"; 3 AUGUSTUS CDS 5352207 5352474 1 + 0 transcript_id "g1261.t1"; gene_id "g1261"; 3 AUGUSTUS CDS 5352524 5353164 0.99 + 2 transcript_id "g1261.t1"; gene_id "g1261"; 3 AUGUSTUS stop_codon 5353162 5353164 . + 0 transcript_id "g1261.t1"; gene_id "g1261"; # protein sequence = [MDISVRLIFDCTAHTPISSWQSKHKRSATSIEADVNLRDSKRTKTSAISKLLSTNRTSKKVPEEASIRVSKNSVSNPL # VNTRANPLIPRSSTVSAGSLPSSSLRRVPVCGTSDASRPTARAQNSTNRSVSVVHRQAVYIDDSKPASHKHSSRTSAPSAFPSSESWVEDDLAHSLKT # HSSSSKTTTSETGPLNSNIINDNNPTGSSTFGFRAETSSDTAEVVSTRPPASSTSLPVSSLSSALGSVAHALVNNVILPSVLPDSESIKPKLLDDTTV # QLLSAAHKAIGALLAAHQAAVAREEGVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1261 ### # start gene g1262 3 AUGUSTUS gene 5355969 5356292 0.4 - . g1262 3 AUGUSTUS transcript 5355969 5356292 0.4 - . g1262.t1 3 AUGUSTUS stop_codon 5355969 5355971 . - 0 transcript_id "g1262.t1"; gene_id "g1262"; 3 AUGUSTUS CDS 5355969 5356292 0.4 - 0 transcript_id "g1262.t1"; gene_id "g1262"; 3 AUGUSTUS start_codon 5356290 5356292 . - 0 transcript_id "g1262.t1"; gene_id "g1262"; # protein sequence = [MANDIRQKRKRASDKVSVEIEDAGLSSDLSDIEDEFIPKTPKKKRKKKAGKESQTVSEAVKVDADEEAYDEVEVKKAR # RPRKPKPEPVYIIQDVERRETKFPGRLGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1262 ### # start gene g1263 3 AUGUSTUS gene 5368592 5370211 0.76 + . g1263 3 AUGUSTUS transcript 5368592 5370211 0.76 + . g1263.t1 3 AUGUSTUS start_codon 5368592 5368594 . + 0 transcript_id "g1263.t1"; gene_id "g1263"; 3 AUGUSTUS CDS 5368592 5370211 0.76 + 0 transcript_id "g1263.t1"; gene_id "g1263"; 3 AUGUSTUS stop_codon 5370209 5370211 . + 0 transcript_id "g1263.t1"; gene_id "g1263"; # protein sequence = [MRTEHEDHTWQLPLDRVARMLSPENRNNPLDDKVIDHLGNYACVSDSPGFMKKLKNAVMKLRPRVKDIQWPSDPDERP # FYTPLAQFLNVCVSVCKEELTDDERYTKGPFHDLEFIVYDKETQDSVNGASPTKPHLVGGKNFMAFADSDDCKVKSAQLYWNTPDKNASPILLPVEVK # DNWIELVCQAATYARCPFRQYSLVLGYNHKEGTFRFLIFHRGGLSASLPLDLRDENSHESLLHVFLSLLDCFHAGDAGMAAWCVKLPVDNSDKPDYIV # ANIKEVLHDGNSCRGRASQVTRISYSVRDTSPLPVVATTPLSPVIQLRRSARVANAEVKKGVEAPANSKKSSRNQVDSRTRSETKASNIPDPLTLAIT # PISVYGPTRDLEDVKQELMILVKSLNPRRGIISHGLMKAAWPKRDLGSGRSSVPETWMLNVCGDKFGTWQHHYDFPANHSHGIPTSNDIFLPTEMELK # KGVAEFHWDLFSLHQKYSTPLPEYRSLRFHVGKLIGTSLVSSPSPLVLFTAILHAMLGLWPFALKEDYY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1263 ### # start gene g1264 3 AUGUSTUS gene 5372424 5373672 0.45 - . g1264 3 AUGUSTUS transcript 5372424 5373672 0.45 - . g1264.t1 3 AUGUSTUS stop_codon 5372424 5372426 . - 0 transcript_id "g1264.t1"; gene_id "g1264"; 3 AUGUSTUS CDS 5372424 5373206 0.91 - 0 transcript_id "g1264.t1"; gene_id "g1264"; 3 AUGUSTUS CDS 5373271 5373672 0.47 - 0 transcript_id "g1264.t1"; gene_id "g1264"; 3 AUGUSTUS start_codon 5373670 5373672 . - 0 transcript_id "g1264.t1"; gene_id "g1264"; # protein sequence = [MIFLRSLLMKVGWNTKLSARASNYGTRIDYILATPGLLPWIKAADIEPTIKGSDHCPVWIDLHDEISLSGGGNSTLKL # RDVMSCPTPDKPDREPPRLATRFWDEYSGKQRLLASFFNTGSAGDKIKPKVVAAEATPTTNSDNSDVKMLMTSCESTLHNTTIPQPVSISSSLTSIAS # VSSFPTSSGTSTPTSTSSRSNSLKKRKTPPPSTSSSTAGTSSSSSAIQTKPKKPKGDVQNVKDLKKPGQSKLSSFFVAPPTTRDTSNSKAKNSITSKI # KPRRSESIANLADTGTQVIVDLTASDDKNDKYPVAQTIQEVEKEDIDEDLRQAIQLSLSQTSSSSMPSQSSPISSSHEAWKSLLKPREPPKCLVHNEV # AKEFRVNKPGVNKGRSFWVCSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1264 ### # start gene g1265 3 AUGUSTUS gene 5387329 5388015 0.5 - . g1265 3 AUGUSTUS transcript 5387329 5388015 0.5 - . g1265.t1 3 AUGUSTUS stop_codon 5387329 5387331 . - 0 transcript_id "g1265.t1"; gene_id "g1265"; 3 AUGUSTUS CDS 5387329 5388015 0.5 - 0 transcript_id "g1265.t1"; gene_id "g1265"; 3 AUGUSTUS start_codon 5388013 5388015 . - 0 transcript_id "g1265.t1"; gene_id "g1265"; # protein sequence = [MRAYPSNASWSLTSNTFIPTLSPSQSTDSHSTPTVSSTGSPNSDENSSSSRDQRTGRTIGGIVGGFIALILLVVILTY # YIVPYFRRKQDIGGGRIGDDEMRTSRWRRPWFEMVNFGSNAQSSIIPFALAASVSQRGSTKEAMISERTTMRHDEGAASFTAVNVAGRSHSGSGTECT # IKSNINQGQDHSTEDTPRSGRKLTLPTLIVTDASVSMATTSGERQHVVTIHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1265 ### # start gene g1266 3 AUGUSTUS gene 5393798 5394283 0.83 + . g1266 3 AUGUSTUS transcript 5393798 5394283 0.83 + . g1266.t1 3 AUGUSTUS start_codon 5393798 5393800 . + 0 transcript_id "g1266.t1"; gene_id "g1266"; 3 AUGUSTUS CDS 5393798 5394283 0.83 + 0 transcript_id "g1266.t1"; gene_id "g1266"; 3 AUGUSTUS stop_codon 5394281 5394283 . + 0 transcript_id "g1266.t1"; gene_id "g1266"; # protein sequence = [MPQGLYFEVNTTGRDPSGWSVIGWLYRDVYYNSTESFRAAWEAGELEKSTLNLEGPWIGSDYRGPTTKVGENSTMWAS # EKAPPVMVPPSGEDGIRYKVDVDNKYVEWSEFQLSVGVFSMFSLALITVDFSFYVAFRRDSGVRLFDIRYRGERIVYELGLGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1266 ### # start gene g1267 3 AUGUSTUS gene 5395049 5395795 0.9 + . g1267 3 AUGUSTUS transcript 5395049 5395795 0.9 + . g1267.t1 3 AUGUSTUS start_codon 5395049 5395051 . + 0 transcript_id "g1267.t1"; gene_id "g1267"; 3 AUGUSTUS CDS 5395049 5395795 0.9 + 0 transcript_id "g1267.t1"; gene_id "g1267"; 3 AUGUSTUS stop_codon 5395793 5395795 . + 0 transcript_id "g1267.t1"; gene_id "g1267"; # protein sequence = [MHDHVLTFKADIDILGTSNSFANHTVAPVTASYPWSHGMERSTMKLFRSYLDNEDNAKLFWPGNAHSMFMVVNKDAPN # EFGEPRGYRIMPSKGSGMHATIQNSSNLLNSMNFATHALYVTKQKDTEPRASNANNDYDTANPVVDFAAFFDGESLDQEDLVVWFNLGMHHVPHTGDL # PNTVFTTAQGSMLILPHNYLLHDPSRDSRQTVRIDYNDSGVQAVHTFGADFSNGLVNLVCSIYVGTHVASVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1267 ### # start gene g1268 3 AUGUSTUS gene 5399162 5402512 1 + . g1268 3 AUGUSTUS transcript 5399162 5402512 1 + . g1268.t1 3 AUGUSTUS start_codon 5399162 5399164 . + 0 transcript_id "g1268.t1"; gene_id "g1268"; 3 AUGUSTUS CDS 5399162 5402512 1 + 0 transcript_id "g1268.t1"; gene_id "g1268"; 3 AUGUSTUS stop_codon 5402510 5402512 . + 0 transcript_id "g1268.t1"; gene_id "g1268"; # protein sequence = [MKSVRTPGRPSGIGGGSSLPTPRSRSSSIANAERAKTPTYSIPAVPSVPLAAKSTRPPSRTSGASSSSNAAFTPTLNA # PVRIESLGFEGILRYLGEIPPKQGIWAGVELSAGFAGKGKNDGSTPDGKRYFDCAPMCGVFVSVSKLSRATAGVSRPPSVASTAGSETMSGLLSASSS # RSGLGIGTGRVTPSARTGRLSLAASTSSNASTSTSSYSYKPASYSGRVTPSNTLSTSTTSVGPETPAARAGRLRALNAGATPLVKTRSQGANVEKAVP # VPAVPSIPRASSAAGTSIPSSLPSPTTSNASPRRIPSLNQTSHLSSPFNTPKARNLATASGIGLGSPHGATPRARLPSAVSMPPPPSPNKDPTLKGLT # DLQKTTREIQERIRGLTGETVSPPSPSTSVTSNNASPPSAASTSYSYSSQNVPSPSRRPQSRIASAATISSRARSRSRAGSTSINNSMSSTSMHSRPS # SVASTASVMSATSRSHAPRSSTPGFGPRSSTPGFGVSIGPRSSTPGFGRSLSRAGAETPSASVDERLERMQSRIAALEYENTRLRDEAEETASAGGIG # ELRIKLRELEKDLENANALVASGTPAASDDVSHSSSDPESEVESSATSSTVESPSRSTSPSKDPDHKLRQEINLLTLRLDDASTKALSAHARAEQLQS # ALDALQTNSDAHLADIKRINEELQQAHHALAARESELAETKGLYASTRSDLEERTADISALQKSVSDVEKRYTDEMERDRDMWDVERKELRIQVDELR # RAGQETIALYEEKLDEMRITLKGNDLSSSVSSLSRSRSSTLADDRDLKKDDTLSASSIDHSALLEQLTYLQTKTASLTDALEDARHLHQSDLNVLQSQ # LNQSKTQFKALKGELEERVRTAEMDVGKKEREVEHERRRRGEVEEALRECGEALEEARREVEGLRMGLGGEDSEAKDKSSQDALQSELAASQTDLARV # SSELKVTKSEINSHKEEIAGLKHLVKELQRLQRDSARDEEGEMSENAVLRRENEMIKEENRMLIREMEGLKEEVKVLEEGLSVLEDEEEGKAKRREAM # VNGSSKDGNPVVNSMKSGVNVSGDEVEELKKEIEVLKKKLGEMEIKAARKTHDVSLPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1268 ### # start gene g1269 3 AUGUSTUS gene 5405437 5406066 0.72 + . g1269 3 AUGUSTUS transcript 5405437 5406066 0.72 + . g1269.t1 3 AUGUSTUS start_codon 5405437 5405439 . + 0 transcript_id "g1269.t1"; gene_id "g1269"; 3 AUGUSTUS CDS 5405437 5406066 0.72 + 0 transcript_id "g1269.t1"; gene_id "g1269"; 3 AUGUSTUS stop_codon 5406064 5406066 . + 0 transcript_id "g1269.t1"; gene_id "g1269"; # protein sequence = [MAKTPFYKQVCYFVARPATLLSHLSIVISSVNCFSVSFNAPTYALLPGAIPLKAFHRARITFSGVWTTRYDQGGLLLH # LTRTGSTDRWLKTGVEFYQDKVYLSTVSTLTYSDWSITPPTTGDNAKSTTIEVRREVDELGSSLWVYELVLGDSGEVLERQPLREVTWFLAEEDGWEV # SVSAMAARPAKEESVVGTKELVVKFEGAEVDVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1269 ### # start gene g1270 3 AUGUSTUS gene 5407813 5409270 0.61 + . g1270 3 AUGUSTUS transcript 5407813 5409270 0.61 + . g1270.t1 3 AUGUSTUS start_codon 5407813 5407815 . + 0 transcript_id "g1270.t1"; gene_id "g1270"; 3 AUGUSTUS CDS 5407813 5409270 0.61 + 0 transcript_id "g1270.t1"; gene_id "g1270"; 3 AUGUSTUS stop_codon 5409268 5409270 . + 0 transcript_id "g1270.t1"; gene_id "g1270"; # protein sequence = [MQGSRTHMAQGTRPYLYANHGLDTAISSRSDGDGHQSGRTEDPSSSLPSLTADSTTSRVGRSQTRSRAVEELELRPAT # AAVNARPSRGASTGGALISETLVPRMARPRYALHRTDSGSRQIRAHSVDAAGPSRPATERVPEPELFVPPVPGAHGRSRAHLIHVVNRILPHSAQGTG # TVPGPAPTIPHNHTHHHHHHTHSLPPPLHRQHQHHHHLPPTHIAAITSQPPQAPYIPPAPEPAQHPPARRLRHHVSFANPNKPQLLHMHPLLAASSPD # SPAPICYDVTRPPSRTSVRCKFAETTHEAASSTPRSTKNGEAVPAHVLAEPATDPPTLGKLVLKSDRFPWEVIVTAGCAEAPSVNSRPVVTNNDVLHA # LHRTLHAHVLHSEWDTLDSDRSRQRRVSRAYQRRVEIMQLRAARDRAQASLNAGRRVSGGAEGEGREEQEGVRRVDWLMGRTRFVGVVVERSAGVRGS # SDGLKGVGKLVFTKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1270 ### # start gene g1271 3 AUGUSTUS gene 5410671 5411792 0.55 - . g1271 3 AUGUSTUS transcript 5410671 5411792 0.55 - . g1271.t1 3 AUGUSTUS stop_codon 5410671 5410673 . - 0 transcript_id "g1271.t1"; gene_id "g1271"; 3 AUGUSTUS CDS 5410671 5411397 0.66 - 1 transcript_id "g1271.t1"; gene_id "g1271"; 3 AUGUSTUS CDS 5411467 5411585 1 - 0 transcript_id "g1271.t1"; gene_id "g1271"; 3 AUGUSTUS CDS 5411637 5411792 0.86 - 0 transcript_id "g1271.t1"; gene_id "g1271"; 3 AUGUSTUS start_codon 5411790 5411792 . - 0 transcript_id "g1271.t1"; gene_id "g1271"; # protein sequence = [MIENEYPIPSYMADVDNERPPGWVETPEETKLGDQDQNPRPRRKVYGIDCEMCTTEDGKELTRVCMIDYDTQLVVYDE # LVIPNKPVVDYLTRWSGITAESLATATTTFAEAQANVLKLLSPVSSHIPKANPFSTKPSVASSSAPLLTPILLGHSLESDLKALKIAHSFCVDTALIY # SHPRGRPFKPGLAWLTKKWCGREIQTRGEGGHDPEEDARATMELVRKKVENGHEFGEFKADLEGLFERMGRAVKRSSTSTVSTGTGGEKIRTAVVDHG # NPGVMHGNKASTSIGCKDDDEVVKNAVELVGSHDFVFVRLMGLAGVRGCKSNSPAHFFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1271 ### # start gene g1272 3 AUGUSTUS gene 5417394 5418578 0.87 + . g1272 3 AUGUSTUS transcript 5417394 5418578 0.87 + . g1272.t1 3 AUGUSTUS start_codon 5417394 5417396 . + 0 transcript_id "g1272.t1"; gene_id "g1272"; 3 AUGUSTUS CDS 5417394 5418578 0.87 + 0 transcript_id "g1272.t1"; gene_id "g1272"; 3 AUGUSTUS stop_codon 5418576 5418578 . + 0 transcript_id "g1272.t1"; gene_id "g1272"; # protein sequence = [MSKVDPENLTKLDRRSTILLQASREHTAGFDEKDVLAVEDPGMDTLRGSFGTVGSIIRARSARRMSQSRGGSRPGSYS # TRPAGAMAPYDPPRGQAWLSPRNSTNTEYLGGLKRHQLYDAPVPPGSPSLTGATRGDDASSISSAGRDSQMMNKRPTIKFDTQDVVHQYHPTGQTPGG # TRGDPTAIHGHRATATSPGIPGLPGHHNDMNPLSIPPSPSAASGSRDLLSESPTDTEGPSASTLSQIISLPPLPPRSPGHETIPYSAPPTSILPHLRQ # GRKDSRDLFNDTPSTTTLLSFPSVTDSARSWDGDEESSHSSTTRGRTARKYPKGDKETDREESVSLWQRDGDSVDGDGDETDMAPHGGIRLVTSKGGV # VNSELVRSFEALTEWYIMNDED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1272 ### # start gene g1273 3 AUGUSTUS gene 5421284 5421862 0.18 + . g1273 3 AUGUSTUS transcript 5421284 5421862 0.18 + . g1273.t1 3 AUGUSTUS start_codon 5421284 5421286 . + 0 transcript_id "g1273.t1"; gene_id "g1273"; 3 AUGUSTUS CDS 5421284 5421862 0.18 + 0 transcript_id "g1273.t1"; gene_id "g1273"; 3 AUGUSTUS stop_codon 5421860 5421862 . + 0 transcript_id "g1273.t1"; gene_id "g1273"; # protein sequence = [MCRPDVAASTSTGTTMDERLQLVASTALLSLFTSGVVTTPIASKSLLIKVITCKHSLVDFPRFRLTDLAKFEATLESL # AHNWPGPGDPVSLRLVREDGHLLVMDVILPSGVSTTARGLDFNPKNPRKRKRIIDEEADSAAGSEPEEEEDEEEDIGRYKQSGLAGFSKQQREVYKLV # QQPTAKGRLLAEEVSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1273 ### # start gene g1274 3 AUGUSTUS gene 5432512 5433348 0.56 + . g1274 3 AUGUSTUS transcript 5432512 5433348 0.56 + . g1274.t1 3 AUGUSTUS start_codon 5432512 5432514 . + 0 transcript_id "g1274.t1"; gene_id "g1274"; 3 AUGUSTUS CDS 5432512 5433348 0.56 + 0 transcript_id "g1274.t1"; gene_id "g1274"; 3 AUGUSTUS stop_codon 5433346 5433348 . + 0 transcript_id "g1274.t1"; gene_id "g1274"; # protein sequence = [MMYNPLSSKASLVTVTITSSTSSATAPDDSTKMTTPAKSNVEPTNGTDTAAIIGSIVGSVVLVFLIGVILLFLRYRTR # RRTIEFSQTKMVRDYVPDMVEGSTWRISDSERDLIDYSSESASFPPARRNTLRPQDSVSNIHERYVPQILPPIPAARPVSSSEPDSATSTSSIRRARD # TERKTPSISLSNLSSSNGSTGTGSLFPIPVLPPRPRTDRQMSIEEEIQQLQARMLFLQGNGNTSPIGLEKEEELKKIYRKVETLKKLHESKWALGLTN # EMSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1274 ### # start gene g1275 3 AUGUSTUS gene 5435035 5435565 0.54 + . g1275 3 AUGUSTUS transcript 5435035 5435565 0.54 + . g1275.t1 3 AUGUSTUS start_codon 5435035 5435037 . + 0 transcript_id "g1275.t1"; gene_id "g1275"; 3 AUGUSTUS CDS 5435035 5435565 0.54 + 0 transcript_id "g1275.t1"; gene_id "g1275"; 3 AUGUSTUS stop_codon 5435563 5435565 . + 0 transcript_id "g1275.t1"; gene_id "g1275"; # protein sequence = [MMVKTQETEFMTDPFGVIVRPRATVHRSRSMRSSRNSSIDNSNEKTPLETFSRPAIISGASSEYRDNVDDDDDGRSTL # VSTIEDGEKGPSRLSPPRTDRQMELEQKIHELRSQMISLSSRHKEESEGGEESIESEDSDTYLIHWHHIRARIKRLEQLEFSDWALGMTNQVPRDFIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1275 ### # start gene g1276 3 AUGUSTUS gene 5437124 5437630 0.99 + . g1276 3 AUGUSTUS transcript 5437124 5437630 0.99 + . g1276.t1 3 AUGUSTUS start_codon 5437124 5437126 . + 0 transcript_id "g1276.t1"; gene_id "g1276"; 3 AUGUSTUS CDS 5437124 5437630 0.99 + 0 transcript_id "g1276.t1"; gene_id "g1276"; 3 AUGUSTUS stop_codon 5437628 5437630 . + 0 transcript_id "g1276.t1"; gene_id "g1276"; # protein sequence = [MLEEIDYELSQPEGEDSGVESDPEYNEPGPSSAGPSSSSHRRHNKSKQPSAAPEHVFRPSANELETLSVLRTRLLPLV # ALHDSLASELSGGVSFSRGLTGVFVRAGWQGLLQSNPGPRAGKGSVVGVAGLAAKALDSSREDIQALWAHSSVKELIQERKLKLEESAPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1276 ### # start gene g1277 3 AUGUSTUS gene 5444403 5445020 0.96 + . g1277 3 AUGUSTUS transcript 5444403 5445020 0.96 + . g1277.t1 3 AUGUSTUS start_codon 5444403 5444405 . + 0 transcript_id "g1277.t1"; gene_id "g1277"; 3 AUGUSTUS CDS 5444403 5445020 0.96 + 0 transcript_id "g1277.t1"; gene_id "g1277"; 3 AUGUSTUS stop_codon 5445018 5445020 . + 0 transcript_id "g1277.t1"; gene_id "g1277"; # protein sequence = [MFDQRQTECLRVHAEVQLIQHLLQAHIPIDEIVQYMGCSKRSCFMCKNFLVILSGLRTRGCHGKLYNQWSIPEIQGIE # EDTKETLERAVRRIQDILIQEIKKPLSTRNAVSESSAGTTAVSSSRASVTSGSPGSPSESPIEDSEDSDTREEIDHQENLYEWEATPVVSHQCLPVLA # NSGGTHNLIAGTGTHWLHHMGIADNLLFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1277 ### # start gene g1278 3 AUGUSTUS gene 5448875 5449270 0.83 - . g1278 3 AUGUSTUS transcript 5448875 5449270 0.83 - . g1278.t1 3 AUGUSTUS stop_codon 5448875 5448877 . - 0 transcript_id "g1278.t1"; gene_id "g1278"; 3 AUGUSTUS CDS 5448875 5449270 0.83 - 0 transcript_id "g1278.t1"; gene_id "g1278"; 3 AUGUSTUS start_codon 5449268 5449270 . - 0 transcript_id "g1278.t1"; gene_id "g1278"; # protein sequence = [MMAETGSMEIPSESDPSEVIVQPNATVSRTTGSVGSAKNSDMDGFNEKSPTLEGLSPQAIIARALIEYRGDVDDDGRS # TLASTTRMFPSTSSSSYKEGSGEDKSINSQESDNSFMYHISKWALGMTNRVPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1278 ### # start gene g1279 3 AUGUSTUS gene 5455060 5455596 0.63 + . g1279 3 AUGUSTUS transcript 5455060 5455596 0.63 + . g1279.t1 3 AUGUSTUS start_codon 5455060 5455062 . + 0 transcript_id "g1279.t1"; gene_id "g1279"; 3 AUGUSTUS CDS 5455060 5455596 0.63 + 0 transcript_id "g1279.t1"; gene_id "g1279"; 3 AUGUSTUS stop_codon 5455594 5455596 . + 0 transcript_id "g1279.t1"; gene_id "g1279"; # protein sequence = [MLNFPLTTPVYYVNFFLKCKLFHSIKPLFNGKPTLLVINKIDVTRLEDLNADSRALVQEIIDSEDVQCVQVSCYSEEG # VMDLKNKACDALLTARVENKIKGSKINTIINRIHVAQPKARDDVVRTPFIPDAIKERKKYDKNDPDRRKLLKDVEVEEGGAGVFNINLKRECPRLYSP # FL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1279 ### # start gene g1280 3 AUGUSTUS gene 5455673 5456331 0.74 + . g1280 3 AUGUSTUS transcript 5455673 5456331 0.74 + . g1280.t1 3 AUGUSTUS start_codon 5455673 5455675 . + 0 transcript_id "g1280.t1"; gene_id "g1280"; 3 AUGUSTUS CDS 5455673 5455795 0.75 + 0 transcript_id "g1280.t1"; gene_id "g1280"; 3 AUGUSTUS CDS 5455849 5456331 0.81 + 0 transcript_id "g1280.t1"; gene_id "g1280"; 3 AUGUSTUS stop_codon 5456329 5456331 . + 0 transcript_id "g1280.t1"; gene_id "g1280"; # protein sequence = [MDGKNIADFIDPDIAEKLEALEREEEKLEAEGFYASDDDDMPDSDDELLAAKAQEDLAHKIHSQSIKKSKKNQARLPR # TAGLRTLSEMTDALTKAGLDPSRITERAQMLAKAAGVKRKRPRDAEDGDVEMDDAEGEGGDDGEEGWMDVDGEEAPQLKRTKGNSGTAVASVNKRAPR # TNRQLMGMRDEGVSIFRYFSGIASY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1280 ### # start gene g1281 3 AUGUSTUS gene 5459699 5460622 0.92 + . g1281 3 AUGUSTUS transcript 5459699 5460622 0.92 + . g1281.t1 3 AUGUSTUS start_codon 5459699 5459701 . + 0 transcript_id "g1281.t1"; gene_id "g1281"; 3 AUGUSTUS CDS 5459699 5460622 0.92 + 0 transcript_id "g1281.t1"; gene_id "g1281"; 3 AUGUSTUS stop_codon 5460620 5460622 . + 0 transcript_id "g1281.t1"; gene_id "g1281"; # protein sequence = [MAPAPPPPPPPICLPFIGNKPRRRLSFSSAQPGGSPYTSSSYSGSSSFTASQLSRHQSYSSQGTTPVKRDVAPSRDID # ALTFYSDSEKYDDIPTDTLPTLPSGKGKKDKPKLVRSNTMTGSKKSKWGYGWGIGKKNKEKEAEAEREMAEKSPSILSGTNLPMYESPRIAPVRSNTK # TTQFSKMTGMTGTTAHTAHPAQTLARSNTRDTQNTMQSHSSKNSRSTQNTQDTQNSRRPSQRSHHSSRSNGTIKPMRPRLDGPTDSSSTLVGSAMERK # LHPEESITERIDTSDRLNELRNLMEKEKEPLQM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1281 ### # start gene g1282 3 AUGUSTUS gene 5463798 5464208 0.68 - . g1282 3 AUGUSTUS transcript 5463798 5464208 0.68 - . g1282.t1 3 AUGUSTUS stop_codon 5463798 5463800 . - 0 transcript_id "g1282.t1"; gene_id "g1282"; 3 AUGUSTUS CDS 5463798 5464208 0.68 - 0 transcript_id "g1282.t1"; gene_id "g1282"; 3 AUGUSTUS start_codon 5464206 5464208 . - 0 transcript_id "g1282.t1"; gene_id "g1282"; # protein sequence = [MKRPREDDRNMPSYSSADPDFVDNGQQHNDMNAGNDMGTPYLPTIEEHPRNFELPLNSGELGSLPVHEPFLDWSVSSN # QWVPISENENALDSWAATVPNDTNQFGFYNYSTSSESITNFPFTGEQSSDQQPEDNER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1282 ### # start gene g1283 3 AUGUSTUS gene 5466007 5466528 1 - . g1283 3 AUGUSTUS transcript 5466007 5466528 1 - . g1283.t1 3 AUGUSTUS stop_codon 5466007 5466009 . - 0 transcript_id "g1283.t1"; gene_id "g1283"; 3 AUGUSTUS CDS 5466007 5466528 1 - 0 transcript_id "g1283.t1"; gene_id "g1283"; 3 AUGUSTUS start_codon 5466526 5466528 . - 0 transcript_id "g1283.t1"; gene_id "g1283"; # protein sequence = [MQPRNPQRSIQATVDAILSTRKPFEVPKDPAIVKGIFVDLANCIKDLEEDIAGLRQTLSTPLSHENPLSQTSLQPNRE # KRIAVVSQYPNHPSPPVEGYSVNDLTRDLKTFGYYEDRARHFGSSSSRKLVKDALDVKKEYTGGADFVNVKPSFKRLEFWSVQPVIRLSDKPAQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1283 ### # start gene g1284 3 AUGUSTUS gene 5469883 5471679 0.2 + . g1284 3 AUGUSTUS transcript 5469883 5471679 0.2 + . g1284.t1 3 AUGUSTUS start_codon 5469883 5469885 . + 0 transcript_id "g1284.t1"; gene_id "g1284"; 3 AUGUSTUS CDS 5469883 5470467 0.2 + 0 transcript_id "g1284.t1"; gene_id "g1284"; 3 AUGUSTUS CDS 5470555 5471679 0.71 + 0 transcript_id "g1284.t1"; gene_id "g1284"; 3 AUGUSTUS stop_codon 5471677 5471679 . + 0 transcript_id "g1284.t1"; gene_id "g1284"; # protein sequence = [MEMFSTSSRRSTGHVRLSSSSSTHIDFVKPRKPTWALPGKKLWKNSQLARKIHRTLTLFPVPWRNAPVSVQSISPPRK # FEIDASSDRTRTDSTLENFRRGGFRNSGTRTETTESALATSSRYDYYNTIQEEDEEDDHSDLGLEDSGANNEREHLISDDSDHLDLDEVMIISETGDN # FTMHSHSTNVATLRIPPSPIPPPPRTPVRERPRKFSRRTPPAPNYPAPLPPTQSPPLHSNKSLNKPSIETILQTSAPASSNVGVGQPQRSPPQRRQLP # LPTPPNVPPLVSGSSIRLPPPPTPATAAYTPLAQTQIQITPRNASTPLPRNDMDNSRPPVLPPRPPLEHVTAHTRNESASTDDSHALPVLSSPPYHSS # PLPDEFLIARSDSPPPPPSNLSSPPYTVTNFSVSRPELYHDRRDRDHGLPMILAPPSPPPLLYHNANSNHHRLMSLPSNVGSGNDRDPHPDFELPGGD # RVTNLQSGLAEHRGYPFEATLSPRSHFRNFSDDSLTASIRHAQDVTSASVDNRLLFPGAVRAVGYMSTNANNRGLQIQRSYESFQTALSDSQSSDFRR # I] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1284 ### # start gene g1285 3 AUGUSTUS gene 5473633 5473962 0.34 - . g1285 3 AUGUSTUS transcript 5473633 5473962 0.34 - . g1285.t1 3 AUGUSTUS stop_codon 5473633 5473635 . - 0 transcript_id "g1285.t1"; gene_id "g1285"; 3 AUGUSTUS CDS 5473633 5473962 0.34 - 0 transcript_id "g1285.t1"; gene_id "g1285"; 3 AUGUSTUS start_codon 5473960 5473962 . - 0 transcript_id "g1285.t1"; gene_id "g1285"; # protein sequence = [MVNLFYHANKPKFKYLYSGAQLLVENNVWTGRYLCESRALVLTQEKIGTDKPLYDTDDGFAVATGNDFGGASNTAPVG # NFTTAPYAYTLIATADVRASVVSSAGQTLAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1285 ### # start gene g1286 3 AUGUSTUS gene 5481150 5483110 0.44 - . g1286 3 AUGUSTUS transcript 5481150 5483110 0.44 - . g1286.t1 3 AUGUSTUS stop_codon 5481150 5481152 . - 0 transcript_id "g1286.t1"; gene_id "g1286"; 3 AUGUSTUS CDS 5481150 5482093 0.74 - 2 transcript_id "g1286.t1"; gene_id "g1286"; 3 AUGUSTUS CDS 5482828 5483110 0.44 - 0 transcript_id "g1286.t1"; gene_id "g1286"; 3 AUGUSTUS start_codon 5483108 5483110 . - 0 transcript_id "g1286.t1"; gene_id "g1286"; # protein sequence = [MEDMQITSDLTWIEVQFMKKAVEEVEKCRMTLKWTYAMAYYLARGNEKDLFEDNQRDLEKAVEDLSELLESPIETENI # PVLRQKVTDKTVSLWKXPQWKGEYLDNISSRNASEYRYSLYLSNSQNYELEKVNSIEIQLEDHLTNYCRMSSPPPSIDAPSLPLDYPLSQIAPSPVVP # AEETINDPPPPYPSPRTRRARGTRQNRRAPETLQRISTQHSQIPSNESDNEVQRSPRTSLRPSVVENSGADASEITPLLAGSSSSRSAILRPRSLSQS # SINSFAPSLASLAQTAWVFFSECDSDDEESRSENGHDSEGEENGGPSYVGRRPPACAVSVETREDGSIPPESGGFFSSKAWARYFHPVFRGVYWRSLT # HLVVVNFPFALLAWVYLFVFTVVRLIYLDEIMYCVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1286 ### # start gene g1287 3 AUGUSTUS gene 5483499 5484872 0.3 - . g1287 3 AUGUSTUS transcript 5483499 5484872 0.3 - . g1287.t1 3 AUGUSTUS stop_codon 5483499 5483501 . - 0 transcript_id "g1287.t1"; gene_id "g1287"; 3 AUGUSTUS CDS 5483499 5484512 0.4 - 0 transcript_id "g1287.t1"; gene_id "g1287"; 3 AUGUSTUS CDS 5484563 5484672 0.32 - 2 transcript_id "g1287.t1"; gene_id "g1287"; 3 AUGUSTUS CDS 5484770 5484872 0.9 - 0 transcript_id "g1287.t1"; gene_id "g1287"; 3 AUGUSTUS start_codon 5484870 5484872 . - 0 transcript_id "g1287.t1"; gene_id "g1287"; # protein sequence = [MSSDYEISDNEGDYYDSDEMMEDYQNDGKFTALLCPKRKSYEVDYTSLSQSSVEESLKEDVDHICGILGVDPAVAALL # LRHQGWNKESLIEKYMENPTKVLVDSGAAVPEPAREPIVRAHSVDRSAAGPSSRRAIRSNSKLLSSLTSPTRSSAQKSISSPAASASKFRKDAKSSEE # PESFVCPICFDDSPELKPVALDCGHSACSGCWNAYTISKIRDEGEHCIRCMTEGCAIVAPDDFVHNILVSDAAPPGSDTNENLVAWTRFQELLVRSFV # SSNSKLKFCPYPGCTNTVSCPSAASKSVLTTMVPIVSCGAKGIPRSANDKKPAPSSPSGITSLYDKEHVFCFGCPIESDHRPVVCGVARLWLKKCEDD # SETANWIKSNTKECSKCQSTIEKNGGCKCVIYLIPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1287 ### # start gene g1288 3 AUGUSTUS gene 5493511 5494098 0.96 + . g1288 3 AUGUSTUS transcript 5493511 5494098 0.96 + . g1288.t1 3 AUGUSTUS start_codon 5493511 5493513 . + 0 transcript_id "g1288.t1"; gene_id "g1288"; 3 AUGUSTUS CDS 5493511 5494098 0.96 + 0 transcript_id "g1288.t1"; gene_id "g1288"; 3 AUGUSTUS stop_codon 5494096 5494098 . + 0 transcript_id "g1288.t1"; gene_id "g1288"; # protein sequence = [MTLPIDEFIVWEPGTGSKRSQWSCLACDDHVWRDANLARRHENGKGHQQAVKHHREASHYSAPDPFVPNPGTSRRVSP # PLESLLMDLSEGPYKTQGHDEPFDFENVQPSSDRNTQPVYGITFDPTEDFTLQPSDVERGMARFAEEMHAWLLEEPDSENSEDEIEECDDLEDDVFGA # FSHYLPQLCSSQNAIHSWV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1288 ### # start gene g1289 3 AUGUSTUS gene 5496080 5496622 0.7 - . g1289 3 AUGUSTUS transcript 5496080 5496622 0.7 - . g1289.t1 3 AUGUSTUS stop_codon 5496080 5496082 . - 0 transcript_id "g1289.t1"; gene_id "g1289"; 3 AUGUSTUS CDS 5496080 5496622 0.7 - 0 transcript_id "g1289.t1"; gene_id "g1289"; 3 AUGUSTUS start_codon 5496620 5496622 . - 0 transcript_id "g1289.t1"; gene_id "g1289"; # protein sequence = [MVQYKVAFHHAQKDLRRSQMQLMLQEDEIAENRKFHSDSLHRNKRQVYVIKELGLRLYKSQMEAEVEHREQHLKQLKT # IEDLERRLGTSENNKYLSNIEELKVQLGREKLLRGNVARILLNEHNPAVAVAESLRLLTPSSEIFSKSTAEGLSIKAEQQPNLFHTAVAKQLLELEDE # AWRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1289 ### # start gene g1290 3 AUGUSTUS gene 5501139 5503626 0.22 + . g1290 3 AUGUSTUS transcript 5501139 5503626 0.22 + . g1290.t1 3 AUGUSTUS start_codon 5501139 5501141 . + 0 transcript_id "g1290.t1"; gene_id "g1290"; 3 AUGUSTUS CDS 5501139 5501742 0.23 + 0 transcript_id "g1290.t1"; gene_id "g1290"; 3 AUGUSTUS CDS 5501891 5503626 0.78 + 2 transcript_id "g1290.t1"; gene_id "g1290"; 3 AUGUSTUS stop_codon 5503624 5503626 . + 0 transcript_id "g1290.t1"; gene_id "g1290"; # protein sequence = [MHRVSTLRSALELKSVFDQIQAAEKAGNLSPEERQKLEEQAAEKGLQALFKGAKLEIDSVLREVCDRILLLEAEDPSS # SSVGREKAVLRAAALQILGEAYVGVGTRKGGVGIQASSASSADHQYPHSRTSSPAPGTHGKPEPSSTSHSTTSNGGSGLGGIGTGLGNLGRDIGTGLG # GMFGFGGGGSNLTTPSPSLSANASPRIIDVQLTVTCITEPTSPIDSSQTLYRNATSHLLAMVVHTLWKLGNLLARRNRLMSTTATRRFEPENFYAYTS # GRWIHDENRQLSLRYRSFNVDALKKVVVHAAGGNSVLKMEKLAEGSYNKVFVLTLDNGQELIARIPTVIAGPGKLVTASEVATMDYARSIGVPVPRVL # AWCADASSTPVQSEYIVMEKASGVELGRVWDQMSSDQKDDTVREVVNIEKRMIKPFFKAYGSVFYRGDVDSGVVHDRFVVGPNVSLPFWDEERRDMDL # DRGPWTDPFSYLKAISSRERKWILNYATSNPHPTLFEPPTHIQDQQAHISLLNRYDAVLPYIIPTQDSILLRPTLWHTDLHFGNIFLSQDDLAEGNIK # ITAIIDWQHACVLPLYLQARAPRFLPLPDQIPPSSDEEEEEEAFHQQAPAAAALADAELANRHELYHTITASLNPDYHRALSFSTRDLIITPVQFSGR # TWSGGYVPLQNTLIRIVDNWDYLGHRHFPCPIAFSQSEREAHAEDAQEWQVGEDLQVMIQDRIGVQEGGWVSHEGYHDALRRNEELKEQFLQQMPHGK # DKDAYLRTWPYRPVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1290 ### # start gene g1291 3 AUGUSTUS gene 5507160 5508166 0.4 + . g1291 3 AUGUSTUS transcript 5507160 5508166 0.4 + . g1291.t1 3 AUGUSTUS start_codon 5507160 5507162 . + 0 transcript_id "g1291.t1"; gene_id "g1291"; 3 AUGUSTUS CDS 5507160 5507176 0.4 + 0 transcript_id "g1291.t1"; gene_id "g1291"; 3 AUGUSTUS CDS 5507395 5508166 0.89 + 1 transcript_id "g1291.t1"; gene_id "g1291"; 3 AUGUSTUS stop_codon 5508164 5508166 . + 0 transcript_id "g1291.t1"; gene_id "g1291"; # protein sequence = [MWSLSXSSITGSGVAFPYDTWEEFVTAFKTRFETTDAKQLLKRLYQNRTTVGTYASTFQQYADCTGYSDKDLQDRFYD # HLADRVKDGLVFTTCPTGSLQELIEAAIDVDNQQIARAWEQGKKLVNDGILTNFRPSTVATPFTAPTQDPNAMDIDATTTRSPDAFCHFMIGQCYGCG # SKEHRKADGHHERDICRHCGLNGHIEAVCRRKFLGLPGRKATTISATSTPDTTQSAAPSTIIAATPDLAANQQVLAGQIAELHKNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1291 ### # start gene g1292 3 AUGUSTUS gene 5508343 5508885 0.46 + . g1292 3 AUGUSTUS transcript 5508343 5508885 0.46 + . g1292.t1 3 AUGUSTUS start_codon 5508343 5508345 . + 0 transcript_id "g1292.t1"; gene_id "g1292"; 3 AUGUSTUS CDS 5508343 5508885 0.46 + 0 transcript_id "g1292.t1"; gene_id "g1292"; 3 AUGUSTUS stop_codon 5508883 5508885 . + 0 transcript_id "g1292.t1"; gene_id "g1292"; # protein sequence = [MIDSGATGLFLHQKFVNKHHIYVQSLPCPIELYSIDGTANLAGQITHSARLLARVDQNQPQILEFLVTNIGSEDVILG # LPWLRKVNPDINWRDGQIQIPAKPKVQHHVAIEEIPEPKEPNVGGNTEQILEPNRPESSGLPHPVPRTEPGLETTETGTSLRDELVFEESGSPLYRLT # GNRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1292 ### # start gene g1293 3 AUGUSTUS gene 5509767 5510165 0.78 + . g1293 3 AUGUSTUS transcript 5509767 5510165 0.78 + . g1293.t1 3 AUGUSTUS start_codon 5509767 5509769 . + 0 transcript_id "g1293.t1"; gene_id "g1293"; 3 AUGUSTUS CDS 5509767 5510165 0.78 + 0 transcript_id "g1293.t1"; gene_id "g1293"; 3 AUGUSTUS stop_codon 5510163 5510165 . + 0 transcript_id "g1293.t1"; gene_id "g1293"; # protein sequence = [MDPVKFEAVKNWPAPTCLRDVQGFLGFANFYRRFIDGFAKKARALNDLTKKGVGWSWGTNEQVAFEALKEAFTTAPIL # VLWDPDKPTCIEVDASGFATGGALLQQQGDGLWHPVVFRSASMDPAEQNYEIYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1293 ### # start gene g1294 3 AUGUSTUS gene 5511226 5512020 0.65 + . g1294 3 AUGUSTUS transcript 5511226 5512020 0.65 + . g1294.t1 3 AUGUSTUS start_codon 5511226 5511228 . + 0 transcript_id "g1294.t1"; gene_id "g1294"; 3 AUGUSTUS CDS 5511226 5512020 0.65 + 0 transcript_id "g1294.t1"; gene_id "g1294"; 3 AUGUSTUS stop_codon 5512018 5512020 . + 0 transcript_id "g1294.t1"; gene_id "g1294"; # protein sequence = [MYVSQRQDDWDRLLPTAEFVINSRVHFAHNKAPFEVLYGYTPEFSIPIGSWKEYPSITDRLDALCHARKDAEAALHMS # KQQIADTITEHPNQPSFEVGQPVWLSVNNLKIRCKSEKLGSRRLGPFEVIEKTGAQTYRLALPTWMKIHDNINVKRLAPRKGNKVNGILPALPEPEVI # DGEEFYDVDRILDSRIHGRWKKLKYLVQWKGYDEGHDTWENEENVVGSSDKAINEFYAAHPNAPRKILVTIFYSLPWQPVVNFTEVNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1294 ### # start gene g1295 3 AUGUSTUS gene 5516514 5518205 0.98 + . g1295 3 AUGUSTUS transcript 5516514 5518205 0.98 + . g1295.t1 3 AUGUSTUS start_codon 5516514 5516516 . + 0 transcript_id "g1295.t1"; gene_id "g1295"; 3 AUGUSTUS CDS 5516514 5518205 0.98 + 0 transcript_id "g1295.t1"; gene_id "g1295"; 3 AUGUSTUS stop_codon 5518203 5518205 . + 0 transcript_id "g1295.t1"; gene_id "g1295"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPVRGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNNDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGLDPRKLKTFFVNLALVFN # DRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREESRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFS # GGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1295 ### # start gene g1296 3 AUGUSTUS gene 5518538 5522101 0.98 + . g1296 3 AUGUSTUS transcript 5518538 5522101 0.98 + . g1296.t1 3 AUGUSTUS start_codon 5518538 5518540 . + 0 transcript_id "g1296.t1"; gene_id "g1296"; 3 AUGUSTUS CDS 5518538 5522101 0.98 + 0 transcript_id "g1296.t1"; gene_id "g1296"; 3 AUGUSTUS stop_codon 5522099 5522101 . + 0 transcript_id "g1296.t1"; gene_id "g1296"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSATNTVVAKVAV # PLPELSPSVSPTILETPPGDSPRSRSRSRSRTSRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA # RAADRSSTAPTVPPLPPSIPAEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI # FSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFAN # FYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELN # YDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKILTRRQVRWSEFLHQFNMVIRFRPGRLGEKPDSITRRWDVYPKEGDIGYAQVN # PHNFRPIFTNEQLTASLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFH # DHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFI # PTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEF # AYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIDSEVFVLAKHIRSTRPTEK # FSEKYLGPFKVISRPGTLSYELKLPDYLHRFHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDKRYKRCPLRYYIRWAGYEGT # DDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1296 ### # start gene g1297 3 AUGUSTUS gene 5524397 5525689 1 + . g1297 3 AUGUSTUS transcript 5524397 5525689 1 + . g1297.t1 3 AUGUSTUS start_codon 5524397 5524399 . + 0 transcript_id "g1297.t1"; gene_id "g1297"; 3 AUGUSTUS CDS 5524397 5525689 1 + 0 transcript_id "g1297.t1"; gene_id "g1297"; 3 AUGUSTUS stop_codon 5525687 5525689 . + 0 transcript_id "g1297.t1"; gene_id "g1297"; # protein sequence = [MILTESPRDPPPHFNVDAGDHDNQDPPVDPKDPGADNNNDDLDNDSGGLPRGEPGDPSGPGGPGGPRSPISPDIPNEQ # RAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDSSDPQKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDLD # LDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIQKYNIRFNTLAARTNWDSAALKWAYGRGLAERIKDEMAYLPEPARLADYRQE # VLCINNCYWKREETRKHEAGKPFIAQNLKKGSSDFKTGSTNQQNNSQPSGSLALFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKV # LPSKRERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1297 ### # start gene g1298 3 AUGUSTUS gene 5526505 5527218 0.62 + . g1298 3 AUGUSTUS transcript 5526505 5527218 0.62 + . g1298.t1 3 AUGUSTUS start_codon 5526505 5526507 . + 0 transcript_id "g1298.t1"; gene_id "g1298"; 3 AUGUSTUS CDS 5526505 5527218 0.62 + 0 transcript_id "g1298.t1"; gene_id "g1298"; 3 AUGUSTUS stop_codon 5527216 5527218 . + 0 transcript_id "g1298.t1"; gene_id "g1298"; # protein sequence = [MEPILLRAIHSEVAARAADRSSTAPTVPPLPHSIPAEYAEFADIFDEIAADALPEHRPYDLKIDLEEGASPPLSRIYP # LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPRKDGGLRLCVDFRGLNRITKKDRYALPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDE # WKTTFRTRYGSYEWKVMPFGLTNAPAAFQCFVNDIFSDMLDVCVIVYLDDILIYSDTPEEH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1298 ### # start gene g1299 3 AUGUSTUS gene 5527294 5529585 0.37 + . g1299 3 AUGUSTUS transcript 5527294 5529585 0.37 + . g1299.t1 3 AUGUSTUS start_codon 5527294 5527296 . + 0 transcript_id "g1299.t1"; gene_id "g1299"; 3 AUGUSTUS CDS 5527294 5528932 0.37 + 0 transcript_id "g1299.t1"; gene_id "g1299"; 3 AUGUSTUS CDS 5529077 5529585 0.37 + 2 transcript_id "g1299.t1"; gene_id "g1299"; 3 AUGUSTUS stop_codon 5529583 5529585 . + 0 transcript_id "g1299.t1"; gene_id "g1299"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFYHRFIYNYSDIVVPMTWLTRKGTPWIWDNDC # QEAFENLKIAFTSAPILAHWEPNRPIIVETDTSNYAIAAILSIQTVDGEIHPLAFLSRTLHAAELNYDTHNKELLAIFEAFKAWRHYLEGSGDPVDVI # TDHKNLEYFSTAKILTRRQVRWSEYLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTTSLRATFLEGLMLRASIV # MDIEALHQAIILALLKDPSSVVGLELAKDPSNERWSLGSDELLCLDDHIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRD # YVTSCTTCGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTFDTITSEQLAELFVIHVFSKHGVPNHVTSD # RGSEFVSVFFRALGQALSMEPHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWLPLLPITEFAYNNAPNASTAQSHYKEQADRKRILHPEFPIG # SKVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLCRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRR # YKRCPLRYYIQWAGYEGTDDEFSWVAADELHADELVPTFHARYPQKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1299 ### # start gene g1300 3 AUGUSTUS gene 5529930 5531037 0.37 - . g1300 3 AUGUSTUS transcript 5529930 5531037 0.37 - . g1300.t1 3 AUGUSTUS stop_codon 5529930 5529932 . - 0 transcript_id "g1300.t1"; gene_id "g1300"; 3 AUGUSTUS CDS 5529930 5530547 0.53 - 0 transcript_id "g1300.t1"; gene_id "g1300"; 3 AUGUSTUS CDS 5530657 5531037 0.37 - 0 transcript_id "g1300.t1"; gene_id "g1300"; 3 AUGUSTUS start_codon 5531035 5531037 . - 0 transcript_id "g1300.t1"; gene_id "g1300"; # protein sequence = [MTTSRTTTTTASSTAGPSRSRPVPPPPPTDPAVHEEEGLEDKDEDDIIRRAQERVEKVRARKAAAAAKKAARAAAARE # RAVQEAREQARQQEEEIVERRRLLAKAATTRSQRGTSPSEMSASPRRPVPVSGDPDDRDDGDDDDDDEDDRAPCERCKNKKLPCQMQAGKRSSIICKL # CHDAKVRCSYSGRPTTSKQREGGSGERIAIMESQMAQSLADLRALPEVDLKTHQYLRQLLRKQEDNHARLIAIETRMAMMGMGGGLAAGPSRRTTERR # RVVEESDEEDEEEKEEGVQQGMEEDGEGEMEVEGEGEGEAPMTAKAVASEKGKEKAVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1300 ### # start gene g1301 3 AUGUSTUS gene 5533037 5533507 0.63 + . g1301 3 AUGUSTUS transcript 5533037 5533507 0.63 + . g1301.t1 3 AUGUSTUS start_codon 5533037 5533039 . + 0 transcript_id "g1301.t1"; gene_id "g1301"; 3 AUGUSTUS CDS 5533037 5533507 0.63 + 0 transcript_id "g1301.t1"; gene_id "g1301"; 3 AUGUSTUS stop_codon 5533505 5533507 . + 0 transcript_id "g1301.t1"; gene_id "g1301"; # protein sequence = [MHQPRPHCLVDLDHISTSAQLLPETQSALAVMSEFPQEHHHLFHNHPNIPWVHPPPHAPADHLYPMYYAPYPVYQNFQ # PPPASPRPMTPRFKIKYSSIHVTFLVTIKDADSLKDRKSWVKWNEGVWQAVTDGFVLGHICDEPSSGTPWMEWNTPLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1301 ### # start gene g1302 3 AUGUSTUS gene 5533637 5534734 0.51 + . g1302 3 AUGUSTUS transcript 5533637 5534734 0.51 + . g1302.t1 3 AUGUSTUS start_codon 5533637 5533639 . + 0 transcript_id "g1302.t1"; gene_id "g1302"; 3 AUGUSTUS CDS 5533637 5534734 0.51 + 0 transcript_id "g1302.t1"; gene_id "g1302"; 3 AUGUSTUS stop_codon 5534732 5534734 . + 0 transcript_id "g1302.t1"; gene_id "g1302"; # protein sequence = [MINDRGECRTARQIYLRLKGAYQAAPDRKACLHIQDELLNSQIHGMDIKKFNLKWSSTLTTLQNYGYDIPWDTLISKY # ILKLPSGPRYVYLKQTLEEDFDQPGVIPNRNLFDKFAICLENTRNRELLDLANSGGGAYNRCFQRNGTGGTSDKPPEQQKLKDSPNMSKPNNKLSAYV # TTTTSPTSNTNSKIETVDTVNSVPSVISTANTTVCSTYPARHLKPFAALLSSFPSSPLPIHHSEDDNPIAFSSIPQKTQTLLDSACTNHIIKNRRFFF # TFDEDGTLAVQTANSGILATKALGTCYFELQIDGTNDHLILEMHDCLYAPNAPVNLLSVGAMLEHRFTFTISPQTVQIHPDPDHFAIADVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1302 ### # start gene g1303 3 AUGUSTUS gene 5544037 5544378 0.85 - . g1303 3 AUGUSTUS transcript 5544037 5544378 0.85 - . g1303.t1 3 AUGUSTUS stop_codon 5544037 5544039 . - 0 transcript_id "g1303.t1"; gene_id "g1303"; 3 AUGUSTUS CDS 5544037 5544378 0.85 - 0 transcript_id "g1303.t1"; gene_id "g1303"; 3 AUGUSTUS start_codon 5544376 5544378 . - 0 transcript_id "g1303.t1"; gene_id "g1303"; # protein sequence = [MGESPIHQIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANHDKPIKTFEEMVPEQYQDFKKVFSESALN # YLPINPGSRYQLGARGTSNHANQDLPNVLEQAGGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1303 ### # start gene g1304 3 AUGUSTUS gene 5545715 5546146 1 - . g1304 3 AUGUSTUS transcript 5545715 5546146 1 - . g1304.t1 3 AUGUSTUS stop_codon 5545715 5545717 . - 0 transcript_id "g1304.t1"; gene_id "g1304"; 3 AUGUSTUS CDS 5545715 5546146 1 - 0 transcript_id "g1304.t1"; gene_id "g1304"; 3 AUGUSTUS start_codon 5546144 5546146 . - 0 transcript_id "g1304.t1"; gene_id "g1304"; # protein sequence = [MSDPAPTTSAAPTANDLMTLLIRQVANLAIAMEEHSSSKSSMNKPKVFKGKGSSETHRFMAQFQNWASEQPDLAKSQV # KLIKSALGFFTKSAGDWATPHLLHFSAENPPFRGNWDMFLKEFGQWFESMDPDMEARSEIKNLTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1304 ### # start gene g1305 3 AUGUSTUS gene 5552892 5554934 0.35 + . g1305 3 AUGUSTUS transcript 5552892 5554934 0.35 + . g1305.t1 3 AUGUSTUS start_codon 5552892 5552894 . + 0 transcript_id "g1305.t1"; gene_id "g1305"; 3 AUGUSTUS CDS 5552892 5554250 0.35 + 0 transcript_id "g1305.t1"; gene_id "g1305"; 3 AUGUSTUS CDS 5554308 5554934 0.57 + 0 transcript_id "g1305.t1"; gene_id "g1305"; 3 AUGUSTUS stop_codon 5554932 5554934 . + 0 transcript_id "g1305.t1"; gene_id "g1305"; # protein sequence = [MYLGRLRDTASAELKTTVSDIVIAVPGWFTDVQRRAILDAASIANLNVLRIINDTTAAALGYGITKADLPEADNPKHV # AFIDVGHSSLSVAIVAYSKGQLIVKSTAYDRNLGGRDIDYALVKHFAAEFKEKYKIDVLSNPKAVFRLAAATEKLKKVLSANAEAPINVESIMNDIDA # SSKLTRDDLEGLIADELSRIVAPIQRAIDDSGLNLDEIEVVELIGGSSRIPAVRARIAECFPGKTLSTTLNQDEAVARGATFSCAMLSPVFRVREFSV # SDINAYPIKVQWAPVPSDPEEDTELVVFGEGNAMPSTKILSFYRKDPFDIEAVYAKPENLPGGINPWIAKFTAKEVPLLGQENPADAVQVKLKTRLNA # NGILGFEGAYVETREDKDEPAPMDGVEGGEAAAAPPKKKKIIKHEVKFVVGNSAMDKGDVEKLKEQENSMWENDKLVKDTEDRKNALEEYIYDTRSKL # DDRYAPFVQQPEKDALLALLTEQEDWLYTEEGEDATKSTYVQRLDACKALGDPIYNRWRESEDRQRSIASLRETLNTYMAQATSSEEKFSHIDEKDKQ # SVVEKVAVTQKWLEDMTVRQMEREKFRDPVLTTAEISKKRDEVIYFATPILTKPKPKPPVVPTPTGSGAQTPKTEPEPEAKKEAPGPSEMDVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1305 ### # start gene g1306 3 AUGUSTUS gene 5556324 5556635 0.93 + . g1306 3 AUGUSTUS transcript 5556324 5556635 0.93 + . g1306.t1 3 AUGUSTUS start_codon 5556324 5556326 . + 0 transcript_id "g1306.t1"; gene_id "g1306"; 3 AUGUSTUS CDS 5556324 5556635 0.93 + 0 transcript_id "g1306.t1"; gene_id "g1306"; 3 AUGUSTUS stop_codon 5556633 5556635 . + 0 transcript_id "g1306.t1"; gene_id "g1306"; # protein sequence = [MNFMFKSDSEFDGDMEEDNEGSEWDSDEELQEYDAKIMEEIREEVADLLKKTPYEKVLLDKKDWKKVEKNHLLGYNRH # SIRSKQQEDKKRQDLQKANEEAKTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1306 ### # start gene g1307 3 AUGUSTUS gene 5557187 5559061 0.98 + . g1307 3 AUGUSTUS transcript 5557187 5559061 0.98 + . g1307.t1 3 AUGUSTUS start_codon 5557187 5557189 . + 0 transcript_id "g1307.t1"; gene_id "g1307"; 3 AUGUSTUS CDS 5557187 5559061 0.98 + 0 transcript_id "g1307.t1"; gene_id "g1307"; 3 AUGUSTUS stop_codon 5559059 5559061 . + 0 transcript_id "g1307.t1"; gene_id "g1307"; # protein sequence = [MSQLVTTGNNIHAILFSSVVLSVYELSADISVDFIQITMSSALFTAVTTTLKGDNYDTWASEMEAFLQATGLESAITT # DQPSEPSPLVAANTASVEAWKNYEVAFKAWKEIDTKAIGNICLRISPSIRILSKDNSDTAKKLWKYLAKSLGAVFNDFAAAIAIKIPYKQNPLSSMME # IGMHFTRMEEADIGLADHLEALILLSKLPSRYSVVVQTMSQLETAELKKLTFAKVRIAVMNTFSGDTIGNSQPQNAKKFSNVHRKGNDPKFSQQQHGN # NSHQQQKGQNGNNDNKKKRKRGSGKNKKAKKNANTAQADADCMDFSPIGSTVDFGPVHTDLTPSVPDVRKHSIHPPYNPPPNATSLRLHKKTRMAIQR # ARDIGVHATAEVIRTLEPTGHISELDSDDEQGSSDPPTKRTRVLPSEDDVEDSNKAATPPPPTPPMDFEVPETASFDPDELMNFDLDREILAITGFMD # TMGSVSSSDLDHTKYTNAPSSVAVTKTCKSAFEPDLLSRLYNYCIDVKYISNEQFCVHDVSYSVCKKCKGKERNQPKWWMNDSGCSEHTTFDLSDFIE # YEDFEEKVLIATATTTAYITGIGTVLINFKDVRGRMHSARIAPVFYMKELSHRLIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1307 ### # start gene g1308 3 AUGUSTUS gene 5559620 5561188 0.83 + . g1308 3 AUGUSTUS transcript 5559620 5561188 0.83 + . g1308.t1 3 AUGUSTUS start_codon 5559620 5559622 . + 0 transcript_id "g1308.t1"; gene_id "g1308"; 3 AUGUSTUS CDS 5559620 5561188 0.83 + 0 transcript_id "g1308.t1"; gene_id "g1308"; 3 AUGUSTUS stop_codon 5561186 5561188 . + 0 transcript_id "g1308.t1"; gene_id "g1308"; # protein sequence = [MSDSGGEFRSNALDEFFKNEGIKAQWSSPHIHQQNGRAERFIRTIIEKSEPQRFQACIPDSWWEFSVAHAVHVYNRTP # MCRHKWKTPYEILYNKVPRIDHLHVFGCGAYVFLHEEVRVNKQSPRSELMTYLGVSDGGHGNIYMRSNNAMFTATHAVFDEKLFPRRKSSERHRSTQL # PDCNPDPKDPIPPPGDDDVPIFHQPTTPQRRQDPEQDVAPPVPAEQPAQDLSPPPQPRNEQPPAEEQLRRSGRVRRPPTRLTGDPRSSSKLPTEQQVE # RPKRDIQRHAKAPQPGSSSAEQEHPEPEQVPGPSTEHPTPENEEQPSVTPGDEANTLIRLCREGGAELIYFLMAKAVPFEGELKSSENVREWTYKDIT # RLPKAEREEWLKACQEELEALKRRGTFELMDCPADQKVIKNRWVFDIKSDGRKKACLVVKGFSQIEGLDYDQVFSPVVRFETVRLLLALTALNNWYLT # GLDVQNAYLYGVLHETIYMEQPEGFRIKGKEDKVLLLRKALYGLKQAGLVWW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1308 ### # start gene g1309 3 AUGUSTUS gene 5561489 5562256 0.65 + . g1309 3 AUGUSTUS transcript 5561489 5562256 0.65 + . g1309.t1 3 AUGUSTUS start_codon 5561489 5561491 . + 0 transcript_id "g1309.t1"; gene_id "g1309"; 3 AUGUSTUS CDS 5561489 5562256 0.65 + 0 transcript_id "g1309.t1"; gene_id "g1309"; 3 AUGUSTUS stop_codon 5562254 5562256 . + 0 transcript_id "g1309.t1"; gene_id "g1309"; # protein sequence = [MENAKMADTPLPAGFQPEPTKGQSNSALRSKFQMVIGSLLYLMLGTCPDISFAVTKLAQHAANPSQEHLNKALYICRY # LLGTRSYALCYDGESGIGLSAWTDLDWASDPYTCRSQTGFFMKLANGIFSWTSHAQKTIAHSSTEAEYMALSDCSRQVVWIRNLLEELGYKLDAIPIA # GDNQGSIFMASNPVTRKHSKHIDIRYHYIREVVERGLVQVFFVDGSNNPADLFTKNLGRIKFELFRSMLGLEFYSSTNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1309 ### # start gene g1310 3 AUGUSTUS gene 5570906 5572213 0.54 - . g1310 3 AUGUSTUS transcript 5570906 5572213 0.54 - . g1310.t1 3 AUGUSTUS stop_codon 5570906 5570908 . - 0 transcript_id "g1310.t1"; gene_id "g1310"; 3 AUGUSTUS CDS 5570906 5571495 0.98 - 2 transcript_id "g1310.t1"; gene_id "g1310"; 3 AUGUSTUS CDS 5571655 5572213 0.55 - 0 transcript_id "g1310.t1"; gene_id "g1310"; 3 AUGUSTUS start_codon 5572211 5572213 . - 0 transcript_id "g1310.t1"; gene_id "g1310"; # protein sequence = [MKEFVLYNVAEDIVQKNISVYFQNKPQHISPTEEQLCILTKLSQQLFIYAATVVRFVTEPHGMSRQKTRLLDCIENAA # HMMDLNTLYVKILDDAIPTKIEKEMKDDLNILYTIVSVGRPLTCKTIAELLQPEVKVEIVSELIDKLNAVFYQAEQDGPILIFHKSFYDFFSNYKNSK # YRYNAGTQHENHFEIGQTDELFQRVKEILIEKGIYWLEAMSLLKSLPRCSKMLDAILGTSNNNADHPSIQKIVGYLQNLIKQFINGDVYGMTPHLYLS # IMPFWENNVGCKPKLQRGVKLINRVMNWLPETTVTVNVSRSVRSVHFSPIGDKIVTGCDDYSIRIWDAKTGTQIGEPLQGHDNWVTSVSFSPDGTRIV # SGSEDMALRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1310 ### # start gene g1311 3 AUGUSTUS gene 5573162 5573685 0.66 + . g1311 3 AUGUSTUS transcript 5573162 5573685 0.66 + . g1311.t1 3 AUGUSTUS start_codon 5573162 5573164 . + 0 transcript_id "g1311.t1"; gene_id "g1311"; 3 AUGUSTUS CDS 5573162 5573297 0.66 + 0 transcript_id "g1311.t1"; gene_id "g1311"; 3 AUGUSTUS CDS 5573381 5573685 0.98 + 2 transcript_id "g1311.t1"; gene_id "g1311"; 3 AUGUSTUS stop_codon 5573683 5573685 . + 0 transcript_id "g1311.t1"; gene_id "g1311"; # protein sequence = [MLTLPEAMEEEEQFEYSTLYTGDGQPVQVLTPHRGQPPWSLRLGAESPHDLPPHFDLDAGDHDDLDPPVDPNDPGADN # DNDNLDDDSGSLPCGEPGDPSGPGGPGGPGSPSGPGGPGSPSGPGGPGGPRSPISPDIVRPGSEWVLW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1311 ### # start gene g1312 3 AUGUSTUS gene 5576524 5577471 0.58 + . g1312 3 AUGUSTUS transcript 5576524 5577471 0.58 + . g1312.t1 3 AUGUSTUS start_codon 5576524 5576526 . + 0 transcript_id "g1312.t1"; gene_id "g1312"; 3 AUGUSTUS CDS 5576524 5577471 0.58 + 0 transcript_id "g1312.t1"; gene_id "g1312"; 3 AUGUSTUS stop_codon 5577469 5577471 . + 0 transcript_id "g1312.t1"; gene_id "g1312"; # protein sequence = [MTKISPVNLCLFDGSLSSKPITDMANIAVWFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNT # SHFDSPQTSVPSATNTVDAKVAVPLPELSPLVSPTILETPPGDSLRSCSCSRSRTLRAKPLPSKFPFEAIYSYPTVSQFAAQLETPKVNIAPVSAAVF # NRACKDAGMEPILLRAIHSEVAARAADRSSTTPTVPPLHHSIPEEYAEFADVFAEIAADSLPEHGPYDLKIDLEEGAVPPLGQIYPLSEKELVALKDF # IDKQLATGAITPSSSPHGNELASFLCERERKESNGHSNQPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1312 ### # start gene g1313 3 AUGUSTUS gene 5579524 5581032 0.79 - . g1313 3 AUGUSTUS transcript 5579524 5581032 0.79 - . g1313.t1 3 AUGUSTUS stop_codon 5579524 5579526 . - 0 transcript_id "g1313.t1"; gene_id "g1313"; 3 AUGUSTUS CDS 5579524 5581032 0.79 - 0 transcript_id "g1313.t1"; gene_id "g1313"; 3 AUGUSTUS start_codon 5581030 5581032 . - 0 transcript_id "g1313.t1"; gene_id "g1313"; # protein sequence = [MDRLLREGTPAYFLHISPTKEESPTEEMLQASDSSSPEEVQQPTDPESGRTRLEQREAVKELDEEELKRQEMEELKKS # IPVQYQDYLDVFSPGEARTLPLHQPYDIKIKMEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPVGAPVLFAKKKDGTLRLCIDYRALN # KITKKNRYSLPLIGTLVDQLRKAKIFTKIDLRAGYNNIRVAQGHEWKTAFRTQYDSFEYLVMPFGLANAPSAFQFFMNEIFHDMVDICVVIYLDDILI # YSDNEKSHVEHVRKVLEQLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLRFANFYRRFIDNYLGITKVFTK # LLRRDSVWNWTPQCSSAFELLKTAFSEAPVLGHYSPDLLVILECDASGLAIAGILSQLDPETGEIHPIAFHVQSMILAELNYDIYDKELLAIVDCFKQ # WRVYCEGSRHQIQVYSDHNNLQYFSTMKQLTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1313 ### # start gene g1314 3 AUGUSTUS gene 5584159 5584644 1 + . g1314 3 AUGUSTUS transcript 5584159 5584644 1 + . g1314.t1 3 AUGUSTUS start_codon 5584159 5584161 . + 0 transcript_id "g1314.t1"; gene_id "g1314"; 3 AUGUSTUS CDS 5584159 5584644 1 + 0 transcript_id "g1314.t1"; gene_id "g1314"; 3 AUGUSTUS stop_codon 5584642 5584644 . + 0 transcript_id "g1314.t1"; gene_id "g1314"; # protein sequence = [MSVTSTERPSSSKIESKKQKSTLSRGNTTQAQKSSQAASSTVITVATGQHLMSIPEQSFGDEVVSGIRTPEGRQPAVQ # EPPPVEPVMGPTQRRYTSMGYAQSASSPMGGFAYSPTWGARGPPPGPVPQLDMESASNSGGRVSGQVATIERIQGESTDPLTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1314 ### # start gene g1315 3 AUGUSTUS gene 5585668 5588460 0.42 + . g1315 3 AUGUSTUS transcript 5585668 5588460 0.42 + . g1315.t1 3 AUGUSTUS start_codon 5585668 5585670 . + 0 transcript_id "g1315.t1"; gene_id "g1315"; 3 AUGUSTUS CDS 5585668 5588460 0.42 + 0 transcript_id "g1315.t1"; gene_id "g1315"; 3 AUGUSTUS stop_codon 5588458 5588460 . + 0 transcript_id "g1315.t1"; gene_id "g1315"; # protein sequence = [MLSEELSGSNLERALEFCRRLVADNQGTSYMVQCEPENAGEFPLEQFDPKGQLHGSDGRFRGQKHSSPRNNEVPEFLN # PGNTDTRSPQLRSGTSPTVHALGQNSTPPPRVNLQTKPITPVSTQWYQFGEVRMDGAQHSSRIYGQDLTARLVPNPVHIPPRLSNPSVIPYQGSVSMQ # SQAVGAESQRDLNQRRTLVVHKEAVPSQGAPLGTPFVTGAQTNRPGMVVDSARSQELIAMIQQQARVIETLQEQLREVKKGFAAGEVPTGGPLSKAGN # TAGLFGRAPRVMREYTRGGPFPVVPQPRSWQATEPISFNRNTPTGAKDRNPQVEQAGQIPATPSVDRRRIHEWGARVQRAELGEYVRPEGEVYALENE # GGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGEGAPPLPPLPPPPSGGPGDSNSEGSDEGEQNQSSRNGGRREEDRGELPTGAPEV # PPTPYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHL # TGAALSHFDTLNRQRLKGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQV # VTGREEPRSYDKWTRVFTKLDGAVHAQAESLRNLHGEKALQGWLSRFPGLELAPEAPYKSPLCWERDPADVWTSNPKPAVMGRFQNRSNWKEGRQRAS # AAWGEEESYDSENREEDEDCCHCRDGGEWTEAVLRAGVTDTGRKWTPEERAEKWRRRRQELCMCCGRKEHWAKDCPNPESLERPAEDQGSSERASKAN # STRGRGTANQGGGRKDDSTRPLERIRAGIVVEKQEGMDNLWNVHILDSPKGGEQELLDEVGNGQGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1315 ### # start gene g1316 3 AUGUSTUS gene 5588877 5590577 0.98 + . g1316 3 AUGUSTUS transcript 5588877 5590577 0.98 + . g1316.t1 3 AUGUSTUS start_codon 5588877 5588879 . + 0 transcript_id "g1316.t1"; gene_id "g1316"; 3 AUGUSTUS CDS 5588877 5590577 0.98 + 0 transcript_id "g1316.t1"; gene_id "g1316"; 3 AUGUSTUS stop_codon 5590575 5590577 . + 0 transcript_id "g1316.t1"; gene_id "g1316"; # protein sequence = [MHNPVIDWKELCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHEGTLQPPPEVPQPPPKAPQQPPEAPQ # PPPEVPQQPPEAPLRAPRTGVKLEEVEDEEYEASQPGPHELFPSDKNLGPDDPILMGINKWLAFASESTEEEVEEILEAGQSAMEKVTPQPAKDSEEA # YQKWKSKDTNRSSSWPGAKQKVRWRKKRREHGPYPDLPTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAA # GMDRLLREGTPAYFLHISPTKEESPTEEMLWANDSSAPEGVQQPKDPESGDPSPEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEART # LPPHRPYDIKIKTERDVIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSNSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQ # LRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTWYGSFEYLVMPFGLTDAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEVSHVKHVRKVLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1316 ### # start gene g1317 3 AUGUSTUS gene 5591406 5592950 0.24 + . g1317 3 AUGUSTUS transcript 5591406 5592950 0.24 + . g1317.t1 3 AUGUSTUS start_codon 5591406 5591408 . + 0 transcript_id "g1317.t1"; gene_id "g1317"; 3 AUGUSTUS CDS 5591406 5592950 0.24 + 0 transcript_id "g1317.t1"; gene_id "g1317"; 3 AUGUSTUS stop_codon 5592948 5592950 . + 0 transcript_id "g1317.t1"; gene_id "g1317"; # protein sequence = [MNEDLLVNRVREAPKDTTIIEALKRIACNEEGSLVWEDGLIKRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTK # KLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPAMVGPEKYDAILVVVCRLTKQAIYIPCHMTDNAEDF # ANLFITHVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIKSRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNNTPNMTTS # VSPFFANKGYHPKLSITLEQVQGAEVNKYASNLKELHAYLQERIRVANGAYAKYANRKRQEAPDWKEGDHVWLNMENVRTRRPMKKLDHKWTGPYSIL # AKVGTHTYQLDLPGDLHKIHNVFHVDRLKHHFHDKFKRQNSPPPPVFIKGKTEHFVESILDSKPIKGQPGEIEYPVKWEGYGDKFNSWVGWEGMVGSI # ELLRNWHQQHLRKHQPSRLQWASLEQEAREDEEEDWKGSREHRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1317 ### # start gene g1318 3 AUGUSTUS gene 5593205 5593951 0.35 - . g1318 3 AUGUSTUS transcript 5593205 5593951 0.35 - . g1318.t1 3 AUGUSTUS stop_codon 5593205 5593207 . - 0 transcript_id "g1318.t1"; gene_id "g1318"; 3 AUGUSTUS CDS 5593205 5593951 0.35 - 0 transcript_id "g1318.t1"; gene_id "g1318"; 3 AUGUSTUS start_codon 5593949 5593951 . - 0 transcript_id "g1318.t1"; gene_id "g1318"; # protein sequence = [MEAAHFIHAELHLRFLSSIQWFFANAAEREEGIYRLVLAHSRFLDDAPFLNVAQHAGFIAPFSDSLEPPLHRRMFALE # TALPYHGAGNWEDLVPAVPSLDTLMQEWEAMMSSYIRFVTEPPLPQGDPQGEGSAHHEEVSALQEGEGGGQEKGSVCPKEVSALQEGEGGVTAAVPLF # LPDPLTPTPVASAASPPSLPPRFGSVVNLVINMTADEDNEDIYESPGSIERRNHSEGNPGEDNPMEDGPVVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1318 ### # start gene g1319 3 AUGUSTUS gene 5594491 5595822 0.42 - . g1319 3 AUGUSTUS transcript 5594491 5595822 0.42 - . g1319.t1 3 AUGUSTUS stop_codon 5594491 5594493 . - 0 transcript_id "g1319.t1"; gene_id "g1319"; 3 AUGUSTUS CDS 5594491 5595822 0.42 - 0 transcript_id "g1319.t1"; gene_id "g1319"; 3 AUGUSTUS start_codon 5595820 5595822 . - 0 transcript_id "g1319.t1"; gene_id "g1319"; # protein sequence = [MSSSPSKAPSAAGPSRSSLPCSPSEGEVASDGEVEQDQLAFMIESPSIPQIQLFENIFNTGKSLAAYCRDDPLRSTLV # AVALPCSNCTKHPETCKVPEGSPRCAFCTGKKTCSLGKLLQYRYFAQDLAYSRRFLETHGTPAQRVSWTIPEDVWRRYDELLHSSTSATKVLVELNML # DERDSWAIDRSKLRRFQEAQEQETLLAAKRKRVNASPLPKVRPKKRRLARVVEERRVEEPVVEEVPRLVRLVIPPLRPAPSDPGSAPSGSKHSSVALP # LVSAHATGRLGSVQDPSPLARLADLVDQRTGSQAEASTCSLGPGFSSIKASREDPVVPKMSPVVRPPLVPRILSQHPYRVENERLAARVRLLESQLAS # SRQENATLTSALHDTSVSLEARQGELDQLRESVSSAAQQQELYDRLLDQVETLKRALPGPPNEVCHHLSPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1319 ### # start gene g1320 3 AUGUSTUS gene 5597213 5600149 0.99 - . g1320 3 AUGUSTUS transcript 5597213 5600149 0.99 - . g1320.t1 3 AUGUSTUS stop_codon 5597213 5597215 . - 0 transcript_id "g1320.t1"; gene_id "g1320"; 3 AUGUSTUS CDS 5597213 5600149 0.99 - 0 transcript_id "g1320.t1"; gene_id "g1320"; 3 AUGUSTUS start_codon 5600147 5600149 . - 0 transcript_id "g1320.t1"; gene_id "g1320"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGF # LGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTQQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ # PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVLDSDDN # RQQTVLKPGHFVKIAASILQNPLEDRIRKASEWEAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPG # LHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEG # VADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSAL # GMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYR # ILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSR # APKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1320 ### # start gene g1321 3 AUGUSTUS gene 5603477 5604870 0.37 + . g1321 3 AUGUSTUS transcript 5603477 5604870 0.37 + . g1321.t1 3 AUGUSTUS start_codon 5603477 5603479 . + 0 transcript_id "g1321.t1"; gene_id "g1321"; 3 AUGUSTUS CDS 5603477 5603833 0.44 + 0 transcript_id "g1321.t1"; gene_id "g1321"; 3 AUGUSTUS CDS 5604205 5604870 0.9 + 0 transcript_id "g1321.t1"; gene_id "g1321"; 3 AUGUSTUS stop_codon 5604868 5604870 . + 0 transcript_id "g1321.t1"; gene_id "g1321"; # protein sequence = [MEAQVMLAGISFKSTLPLFFESAVFQRLQQGDYSPPIIDSNNSPDYDGSGPFPAFSYPRSLVPFCFPFETLRPLSVAS # GLDLYCSAQMAVRTLQVLTDDSPSTESSGDYDVFEEAAPFLTHLSHFEAKCSFWSSENCFLSQGSDLISPSPANKAQAVPPRALRRIGKSKASRLTLP # RFVSIFLISSFLFDYSFCLSSVASPQSIHSKDSDNELLRGSPSVDPAPRTSTSTKVPVDSKKPKSKTTIKVVEDSKASISSPAGMAYKRVRLPPRSRK # IAPATAKGKSRQVVVSEDDSASNEVESEDEEEDEDEEEDSAPPPKCLKTTSSISGKISFFISLLMF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1321 ### # start gene g1322 3 AUGUSTUS gene 5607836 5608613 0.32 + . g1322 3 AUGUSTUS transcript 5607836 5608613 0.32 + . g1322.t1 3 AUGUSTUS start_codon 5607836 5607838 . + 0 transcript_id "g1322.t1"; gene_id "g1322"; 3 AUGUSTUS CDS 5607836 5607862 0.35 + 0 transcript_id "g1322.t1"; gene_id "g1322"; 3 AUGUSTUS CDS 5607969 5608104 0.56 + 0 transcript_id "g1322.t1"; gene_id "g1322"; 3 AUGUSTUS CDS 5608186 5608613 1 + 2 transcript_id "g1322.t1"; gene_id "g1322"; 3 AUGUSTUS stop_codon 5608611 5608613 . + 0 transcript_id "g1322.t1"; gene_id "g1322"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERA # TTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1322 ### # start gene g1323 3 AUGUSTUS gene 5608949 5609176 0.44 - . g1323 3 AUGUSTUS transcript 5608949 5609176 0.44 - . g1323.t1 3 AUGUSTUS stop_codon 5608949 5608951 . - 0 transcript_id "g1323.t1"; gene_id "g1323"; 3 AUGUSTUS CDS 5608949 5609176 0.44 - 0 transcript_id "g1323.t1"; gene_id "g1323"; 3 AUGUSTUS start_codon 5609174 5609176 . - 0 transcript_id "g1323.t1"; gene_id "g1323"; # protein sequence = [MVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPEND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1323 ### # start gene g1324 3 AUGUSTUS gene 5610241 5610684 0.6 - . g1324 3 AUGUSTUS transcript 5610241 5610684 0.6 - . g1324.t1 3 AUGUSTUS stop_codon 5610241 5610243 . - 0 transcript_id "g1324.t1"; gene_id "g1324"; 3 AUGUSTUS CDS 5610241 5610684 0.6 - 0 transcript_id "g1324.t1"; gene_id "g1324"; 3 AUGUSTUS start_codon 5610682 5610684 . - 0 transcript_id "g1324.t1"; gene_id "g1324"; # protein sequence = [MANKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIR # RNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESWVKCQK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1324 ### # start gene g1325 3 AUGUSTUS gene 5610818 5611645 1 - . g1325 3 AUGUSTUS transcript 5610818 5611645 1 - . g1325.t1 3 AUGUSTUS stop_codon 5610818 5610820 . - 0 transcript_id "g1325.t1"; gene_id "g1325"; 3 AUGUSTUS CDS 5610818 5611645 1 - 0 transcript_id "g1325.t1"; gene_id "g1325"; 3 AUGUSTUS start_codon 5611643 5611645 . - 0 transcript_id "g1325.t1"; gene_id "g1325"; # protein sequence = [MGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKY # AGGTFSGTKAFLCCKETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELK # DGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKA # C] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1325 ### # start gene g1326 3 AUGUSTUS gene 5731823 5732260 0.5 - . g1326 3 AUGUSTUS transcript 5731823 5732260 0.5 - . g1326.t1 3 AUGUSTUS stop_codon 5731823 5731825 . - 0 transcript_id "g1326.t1"; gene_id "g1326"; 3 AUGUSTUS CDS 5731823 5732167 0.87 - 0 transcript_id "g1326.t1"; gene_id "g1326"; 3 AUGUSTUS CDS 5732237 5732260 0.51 - 0 transcript_id "g1326.t1"; gene_id "g1326"; 3 AUGUSTUS start_codon 5732258 5732260 . - 0 transcript_id "g1326.t1"; gene_id "g1326"; # protein sequence = [MENAANDVDVYSFNQEQFKGDNHNMIVVLIHNSPNMSLEEAVKYVADRTYMAMDYFNQLKATLPKWGPKIDTEVGTYI # NGLQNWMGGVFFWSFETERYFGKEVERVKMSKSVVLLNRPSKNK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1326 ### # start gene g1327 3 AUGUSTUS gene 5740466 5740796 0.66 + . g1327 3 AUGUSTUS transcript 5740466 5740796 0.66 + . g1327.t1 3 AUGUSTUS start_codon 5740466 5740468 . + 0 transcript_id "g1327.t1"; gene_id "g1327"; 3 AUGUSTUS CDS 5740466 5740616 0.82 + 0 transcript_id "g1327.t1"; gene_id "g1327"; 3 AUGUSTUS CDS 5740672 5740796 0.77 + 2 transcript_id "g1327.t1"; gene_id "g1327"; 3 AUGUSTUS stop_codon 5740794 5740796 . + 0 transcript_id "g1327.t1"; gene_id "g1327"; # protein sequence = [MTVSSFDYLIVGGGPSGLVLASRLTEDADVTVCVLEAGNDFTNTPEIQIPGLSWGNMGRTDIHWMFQTVPQAGSNSRS # IFLPRYAYHLLNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1327 ### # start gene g1328 3 AUGUSTUS gene 5742608 5742928 0.51 + . g1328 3 AUGUSTUS transcript 5742608 5742928 0.51 + . g1328.t1 3 AUGUSTUS start_codon 5742608 5742610 . + 0 transcript_id "g1328.t1"; gene_id "g1328"; 3 AUGUSTUS CDS 5742608 5742928 0.51 + 0 transcript_id "g1328.t1"; gene_id "g1328"; 3 AUGUSTUS stop_codon 5742926 5742928 . + 0 transcript_id "g1328.t1"; gene_id "g1328"; # protein sequence = [MDGIDIDLMVEAIKYTRKLTDTGPFKKVIREEIHPGTNVQNDEDLRHLVQETIQSVYHPIGTASMLPQEDGGVVDSYL # KVYGVENLRIVREVPHSVLLRFLQLVLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1328 ### # start gene g1329 3 AUGUSTUS gene 5749054 5749467 0.22 - . g1329 3 AUGUSTUS transcript 5749054 5749467 0.22 - . g1329.t1 3 AUGUSTUS stop_codon 5749054 5749056 . - 0 transcript_id "g1329.t1"; gene_id "g1329"; 3 AUGUSTUS CDS 5749054 5749467 0.22 - 0 transcript_id "g1329.t1"; gene_id "g1329"; 3 AUGUSTUS start_codon 5749465 5749467 . - 0 transcript_id "g1329.t1"; gene_id "g1329"; # protein sequence = [MSRSKSLRTIVILSAGSIGTPQILMLSGIGDVEHLSSLGVTGKVNLPNVGRNMQDQAVLGIQYLVNDSSLQDVMTNNT # LLQTALTDWGATQTGFAASNVLINTQGFLRLDSDVPPLSLYPDPSAGGNSPHISFAFEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1329 ### # start gene g1330 3 AUGUSTUS gene 5765212 5766825 0.95 - . g1330 3 AUGUSTUS transcript 5765212 5766825 0.95 - . g1330.t1 3 AUGUSTUS stop_codon 5765212 5765214 . - 0 transcript_id "g1330.t1"; gene_id "g1330"; 3 AUGUSTUS CDS 5765212 5766825 0.95 - 0 transcript_id "g1330.t1"; gene_id "g1330"; 3 AUGUSTUS start_codon 5766823 5766825 . - 0 transcript_id "g1330.t1"; gene_id "g1330"; # protein sequence = [MDVWIDFKNASKWQAEALFRNFFPSCEEDSSSGDQEKKASRASTPTPASPSSSLPSLRSSFSSPSPSYRQSRASSTSP # AEPTDDGTITLDPGSLPPSAPELSAEEEAEFAAMGLVLPDVPRSASTPEGDIENLGAEGSGQSSRPSTASSGVGSWVGMPTGLSSSMANSPKVTEVST # RHTAASNGTWSPSPSLSSLSSIGSAVWSMPTFMSSTASLVTGAVGAVTGSSPRSPAASSPSLPRATSSTSPQRQPQSKTPRQHTHSPAPLSPSVLSKL # AQEFAQKVPDEEFSVAALQGYLLRNKSRPEEAVKGVEAWVEEERRNKEKQKGGKGKGKGSEEERKKRREQRKERREKKKKGSAQSNPVSAAVSVNTNQ # PSDPPSAPPTDSMILMPLAQSDPVSAPPVVLSPTIMAQPLPVIPIQKAVPPESEASTKKIKSKSKSKSRKSKSASKSDDNDGSDSDSSSSSSTDSESS # SNSDSDSDSSSDSSSDDDDENTDPRPRQSTTSMARSPPSPPIPSYDWSVEPAAWEATPANGGWGKGW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1330 ### # start gene g1331 3 AUGUSTUS gene 5766931 5767350 0.64 - . g1331 3 AUGUSTUS transcript 5766931 5767350 0.64 - . g1331.t1 3 AUGUSTUS stop_codon 5766931 5766933 . - 0 transcript_id "g1331.t1"; gene_id "g1331"; 3 AUGUSTUS CDS 5766931 5767350 0.64 - 0 transcript_id "g1331.t1"; gene_id "g1331"; 3 AUGUSTUS start_codon 5767348 5767350 . - 0 transcript_id "g1331.t1"; gene_id "g1331"; # protein sequence = [MLDIYALSLSAAWINDATLTTLMGRVPARCIVLLEDLDAAFTRSTGRRSKKDKKRKDKKDKKDKKSKDKSKSDSNNNG # SGTTTGINSGSSSRRRRTGTSGINGGANTTDALSEVNTLSLSGLLNALDGVAAAEGRLLFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1331 ### # start gene g1332 3 AUGUSTUS gene 5773127 5773489 0.86 + . g1332 3 AUGUSTUS transcript 5773127 5773489 0.86 + . g1332.t1 3 AUGUSTUS start_codon 5773127 5773129 . + 0 transcript_id "g1332.t1"; gene_id "g1332"; 3 AUGUSTUS CDS 5773127 5773489 0.86 + 0 transcript_id "g1332.t1"; gene_id "g1332"; 3 AUGUSTUS stop_codon 5773487 5773489 . + 0 transcript_id "g1332.t1"; gene_id "g1332"; # protein sequence = [MSRAPNWAYPPSQSSQATAEQEQKLYFTANSVRNTTLATKDDSLYYEVVTRYWHPKLTKINILDPDTQALRLIAEIEQ # VSGNKWQNGRFRVRFLNSVAPGEELGQWMSDIDFLKPTSDKM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1332 ### # start gene g1333 3 AUGUSTUS gene 5780518 5781585 0.58 + . g1333 3 AUGUSTUS transcript 5780518 5781585 0.58 + . g1333.t1 3 AUGUSTUS start_codon 5780518 5780520 . + 0 transcript_id "g1333.t1"; gene_id "g1333"; 3 AUGUSTUS CDS 5780518 5781585 0.58 + 0 transcript_id "g1333.t1"; gene_id "g1333"; 3 AUGUSTUS stop_codon 5781583 5781585 . + 0 transcript_id "g1333.t1"; gene_id "g1333"; # protein sequence = [MQSHPLNVLTKVCTQWSQLAVGTSELWRDIRIDFVDCDVDYKAGFWNELGKGILEFWFDQSAAHMLQVELIIEEPNYA # DHHWGDPMHQNLDISFPRCMRSFDDAFSMLPWARLHHLGLRGVGITPTQALALRDCTKLHSLVLTNIYSWDPNLDHSLPSKSSIILPDLYQLTTSLGV # SDHWEYLEYLHAENLIDLTLHLMARVHVNEMLSSFLSFCEKSHCRLEHLTLVYCWAPTADNVREIFRTLPTLKSFNAIEGSESEAEWVEPFLNEDVFV # SLIWEPQWGPVLLPLLQTFTGNGVDIDAFDVAMAIMESRVNRGLKKVSFNIEAGDSYKDVWEKLEKLKMLGLDVSGIGLTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1333 ### # start gene g1334 3 AUGUSTUS gene 5785106 5785618 0.94 - . g1334 3 AUGUSTUS transcript 5785106 5785618 0.94 - . g1334.t1 3 AUGUSTUS stop_codon 5785106 5785108 . - 0 transcript_id "g1334.t1"; gene_id "g1334"; 3 AUGUSTUS CDS 5785106 5785618 0.94 - 0 transcript_id "g1334.t1"; gene_id "g1334"; 3 AUGUSTUS start_codon 5785616 5785618 . - 0 transcript_id "g1334.t1"; gene_id "g1334"; # protein sequence = [MSDYPPPPVNMSMDEYARPLPIQSMPLSQLSREIRDPRDAYYDKYDKYDSRPPPSSGGASAYPPQSSIPANYDRPRSP # PPPRSAAYPAGYRDPRDVRDSRDVSDMRDPRDIVRDARDPRDIRDVRDVRDVRDMRDIRDPRDMRDVRDVRDMRYPRDDPRRFSMPPPPLPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1334 ### # start gene g1335 3 AUGUSTUS gene 5786542 5788728 1 - . g1335 3 AUGUSTUS transcript 5786542 5788728 1 - . g1335.t1 3 AUGUSTUS stop_codon 5786542 5786544 . - 0 transcript_id "g1335.t1"; gene_id "g1335"; 3 AUGUSTUS CDS 5786542 5788056 1 - 0 transcript_id "g1335.t1"; gene_id "g1335"; 3 AUGUSTUS CDS 5788126 5788728 1 - 0 transcript_id "g1335.t1"; gene_id "g1335"; 3 AUGUSTUS start_codon 5788726 5788728 . - 0 transcript_id "g1335.t1"; gene_id "g1335"; # protein sequence = [MQRYNNNKRPVRKRPIRDRTVTTLTGNDDEHNQEVLFSGPSASGAAADKTNNNKPSGFNDDPSVFSDSNPVNSGVASF # EYSTMPSPSTFGFGYNSFVGPMNPGGVTAQQNHLSSSSSTYYNQPMLPPGKSDLEILENLKERIKKGQHEFFRATPMPELLAGLYLGPSGGSAQDLDA # VQEKGSVAVAAAASTNGDGNVGNNKASFSTTTMTSPLAISSENSPSKITSMSTFHQETNGPKSSNENGSKSATSMPPNPTDSSSHGLNNSINMGLPAK # PPLTNAHGTSMNGSFTKDERSPSSFGREIYPPLPSRTRGSSSSGASSSLPHSHSVSAPENTHATNKYYDARDIRDTRERDRDNHNNNRDKDHDSRRSS # SVSVSGAEYASVRYGPIRDIRDIRDNKDGITSMRRDGRRPSTAFHYDSASYREEDYLPPSDDYRRLSGPPSTPQALPNERYSRPPPSTDERHRLDDRY # PERVPLPLSSTPSSSIPTSSAYGPSFRPDERERHRYDTHSNTNYPANHNHHVPHTGITPPTRPNHVHNSTHVLASRYNENRPQIGESPVAAAAAAERE # QRERAAAEREQREKLERERDRERMGNTRDFRERDMRPPPPPPSQVHQAAPAKLEERIASRAPTLQERLSQPPVGESSRTLSLEERLSNHPNTGTGTNT # VAGPPASPASSKGGSVAPVPPDSASSAASSEFIFTWVLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1335 ### # start gene g1336 3 AUGUSTUS gene 5791169 5791786 0.93 - . g1336 3 AUGUSTUS transcript 5791169 5791786 0.93 - . g1336.t1 3 AUGUSTUS stop_codon 5791169 5791171 . - 0 transcript_id "g1336.t1"; gene_id "g1336"; 3 AUGUSTUS CDS 5791169 5791786 0.93 - 0 transcript_id "g1336.t1"; gene_id "g1336"; 3 AUGUSTUS start_codon 5791784 5791786 . - 0 transcript_id "g1336.t1"; gene_id "g1336"; # protein sequence = [MFPDHSNLQNSALILANQKLDDLWNLASDHNRNRISAEQLHAAKLDDQREQLLLIQQAVASLSSSGTNTNMLDAILET # INVDATVTVTGMTALLERHETGRIQLQESVIKFLRAGITRINEQRSAKDSIVQIKSWTVTAWEVERGFLLGSDITSFIRAGRWLGKSVGIVELKDGET # TMRFVKVSTVLSQGRHSYVGSSGLEKSSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1336 ### # start gene g1337 3 AUGUSTUS gene 5793230 5794327 0.94 - . g1337 3 AUGUSTUS transcript 5793230 5794327 0.94 - . g1337.t1 3 AUGUSTUS stop_codon 5793230 5793232 . - 0 transcript_id "g1337.t1"; gene_id "g1337"; 3 AUGUSTUS CDS 5793230 5794327 0.94 - 0 transcript_id "g1337.t1"; gene_id "g1337"; 3 AUGUSTUS start_codon 5794325 5794327 . - 0 transcript_id "g1337.t1"; gene_id "g1337"; # protein sequence = [MDVLRMGLGGRDLDGGTANVDPVLRRNVIQPLEIPEPDESSDEGYLPESEYSALPQTASTMSILSAMSSMSAVHGMPG # IPSQSESEAPPEPSFTVPHANNHSESHSEETHPHPQSRSRSSSQRGIKSPPSSRPGSRTSRRSGYSDFAGYSRPNSVVIPFQNDGGTEGYPSHGDLSQ # VKESPPAPSTSGSVPTPATLTVKRNEPNQFSRSSSSHLDQLAHGIPNSNLFTNKLQTSSSFSTQSHSTLDSALDSTRAISRSPSPVAYSHQPPQSQPP # SHSPPSDSQEPSSFVPPSDSKSSDSTHSKLAQAVKVDQEDEEWDNDTSQRTGTEESKAEEDVSKFASTSSPVLTPTMNFIPGMEEKSPWAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1337 ### # start gene g1338 3 AUGUSTUS gene 5794478 5795814 0.84 - . g1338 3 AUGUSTUS transcript 5794478 5795814 0.84 - . g1338.t1 3 AUGUSTUS stop_codon 5794478 5794480 . - 0 transcript_id "g1338.t1"; gene_id "g1338"; 3 AUGUSTUS CDS 5794478 5795251 0.95 - 0 transcript_id "g1338.t1"; gene_id "g1338"; 3 AUGUSTUS CDS 5795386 5795814 0.86 - 0 transcript_id "g1338.t1"; gene_id "g1338"; 3 AUGUSTUS start_codon 5795812 5795814 . - 0 transcript_id "g1338.t1"; gene_id "g1338"; # protein sequence = [MFPSTSPSIPSAGKRFDSLNATQRRAPTNNVLSKSRPVNEFGRNNAQGSTRKVFIAKDEGFFMSVEDELHDLRRVHTH # GQEDDLRMALDRCMGRVGELVGLLAAAYSALTDVRVELDVTRSNLQMITANNDMLEDALKSMSNKHGTDPRDVGSVGWRRSGPNPNSTAVTPSSSSTH # INTISNDLTRPMNGEAPIPGTSPPSSPPLPASESTTQPMAIPPAPTPQPAPAPQESRFFKFRFNSTSSSSTNSRPQTPIVGNDTASPTIGNLTGRHRT # ESSSSVSLLAGGGSIASGPDDVANANSFDDLRRDIEALKTQMARDKAELEKLKAELDVEKARREKEEEKVGKAKKEKEELEAELESLSQALFEEVGFS # LLHSIHFPYHFLLRRISFLRILTYPCST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1338 ### # start gene g1339 3 AUGUSTUS gene 5800452 5800961 0.95 + . g1339 3 AUGUSTUS transcript 5800452 5800961 0.95 + . g1339.t1 3 AUGUSTUS start_codon 5800452 5800454 . + 0 transcript_id "g1339.t1"; gene_id "g1339"; 3 AUGUSTUS CDS 5800452 5800961 0.95 + 0 transcript_id "g1339.t1"; gene_id "g1339"; 3 AUGUSTUS stop_codon 5800959 5800961 . + 0 transcript_id "g1339.t1"; gene_id "g1339"; # protein sequence = [MSDSKELSMSPPISIDDSIVKKYALTKEEWQAVQFGIDINHLSYFLLFRTKLLESETNQKMFHEWLQTQKLDSLETAA # LACRTFRDVAEFWSDRSTGAESQFKLQHRTGWKLWTKKYQEFSEGALSFMQDLKPLFDIVTGMGIPYVGLAIGTVTMLFTVRNPFEHCPKC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1339 ### # start gene g1340 3 AUGUSTUS gene 5824223 5824819 0.52 + . g1340 3 AUGUSTUS transcript 5824223 5824819 0.52 + . g1340.t1 3 AUGUSTUS start_codon 5824223 5824225 . + 0 transcript_id "g1340.t1"; gene_id "g1340"; 3 AUGUSTUS CDS 5824223 5824819 0.52 + 0 transcript_id "g1340.t1"; gene_id "g1340"; 3 AUGUSTUS stop_codon 5824817 5824819 . + 0 transcript_id "g1340.t1"; gene_id "g1340"; # protein sequence = [MSYAIRITTHAVQAVTGADDEVIVSASSSGAKGGLRSKWGGGELRARGKMVRQGSGWTMESNPASPAIGSGYGSYTNT # PLSQSFSPAPSPYLASPSFGSPMMPSSNPGTPIPGASFPASPRPSSLYHSRPPSMSGGLVPGPGASTIGLGGAYPPSIPGTPSFSNFPPTPNPVNGNG # SGFPAGPPPRRTPSGGSGKKDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1340 ### # start gene g1341 3 AUGUSTUS gene 5825640 5826068 0.98 - . g1341 3 AUGUSTUS transcript 5825640 5826068 0.98 - . g1341.t1 3 AUGUSTUS stop_codon 5825640 5825642 . - 0 transcript_id "g1341.t1"; gene_id "g1341"; 3 AUGUSTUS CDS 5825640 5826068 0.98 - 0 transcript_id "g1341.t1"; gene_id "g1341"; 3 AUGUSTUS start_codon 5826066 5826068 . - 0 transcript_id "g1341.t1"; gene_id "g1341"; # protein sequence = [MKFLVAVSIIALLTSSTLARPGSNLRQRIASRRANGRKSQPKIKSQSSIVETNSTFHEEYSENWAGVFFESPPSGETY # STVTGTFTVPSISGNGAASAWVGIDGVTYTDAILQAGLDFTISDGTISYDAWYEWYVVFKFLFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1341 ### # start gene g1342 3 AUGUSTUS gene 5830884 5831243 0.48 - . g1342 3 AUGUSTUS transcript 5830884 5831243 0.48 - . g1342.t1 3 AUGUSTUS stop_codon 5830884 5830886 . - 0 transcript_id "g1342.t1"; gene_id "g1342"; 3 AUGUSTUS CDS 5830884 5831243 0.48 - 0 transcript_id "g1342.t1"; gene_id "g1342"; 3 AUGUSTUS start_codon 5831241 5831243 . - 0 transcript_id "g1342.t1"; gene_id "g1342"; # protein sequence = [MVSGSTALRFFTRVEYGGDLDCYCHLPQAIASGLWFLAHDFLFMPTVDQLDDFAADFTRLCKLFDDETPLGGIAVEED # IREYKLNNIAAVWNFKRGPLIVQLMGTLGSPLATILLFHSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1342 ### # start gene g1343 3 AUGUSTUS gene 5831938 5832207 0.75 - . g1343 3 AUGUSTUS transcript 5831938 5832207 0.75 - . g1343.t1 3 AUGUSTUS stop_codon 5831938 5831940 . - 0 transcript_id "g1343.t1"; gene_id "g1343"; 3 AUGUSTUS CDS 5831938 5832207 0.75 - 0 transcript_id "g1343.t1"; gene_id "g1343"; 3 AUGUSTUS start_codon 5832205 5832207 . - 0 transcript_id "g1343.t1"; gene_id "g1343"; # protein sequence = [MADRLPELSSSAATALATIDWSTSSTPPSTSGSDHTLEDANDSLESDVREGSERPTELKVVLDGSGPSVHLENDRIEH # ATENRKKKPRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1343 ### # start gene g1344 3 AUGUSTUS gene 5832310 5833505 0.69 - . g1344 3 AUGUSTUS transcript 5832310 5833505 0.69 - . g1344.t1 3 AUGUSTUS stop_codon 5832310 5832312 . - 0 transcript_id "g1344.t1"; gene_id "g1344"; 3 AUGUSTUS CDS 5832310 5832581 0.73 - 2 transcript_id "g1344.t1"; gene_id "g1344"; 3 AUGUSTUS CDS 5832658 5832799 0.85 - 0 transcript_id "g1344.t1"; gene_id "g1344"; 3 AUGUSTUS CDS 5833191 5833505 0.98 - 0 transcript_id "g1344.t1"; gene_id "g1344"; 3 AUGUSTUS start_codon 5833503 5833505 . - 0 transcript_id "g1344.t1"; gene_id "g1344"; # protein sequence = [MSTNYGYLPGCINTPAFVTRSKPGGVYDKITTGFAGMGSNAIANAELNQDFFRFNFGQAWSSNYSFRGIDSKQYTGNV # FGEIVGQAHGTHIGAQGNHFVGNDLSKVLKRNTNADSSSSSLPNSPTKRNLKKRNWSASNDNETQEHEDIQPVEAQQIYAGAEYDHRLMPDFGGPVFA # MRQAKLIQPQWTNINNDLIVPWEYYKHLRPGTVIVATICIEVFVMPTGPGNGAMRKVFTLWFVLIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1344 ### # start gene g1345 3 AUGUSTUS gene 5835638 5839939 0.5 - . g1345 3 AUGUSTUS transcript 5835638 5839939 0.5 - . g1345.t1 3 AUGUSTUS stop_codon 5835638 5835640 . - 0 transcript_id "g1345.t1"; gene_id "g1345"; 3 AUGUSTUS CDS 5835638 5839939 0.5 - 0 transcript_id "g1345.t1"; gene_id "g1345"; 3 AUGUSTUS start_codon 5839937 5839939 . - 0 transcript_id "g1345.t1"; gene_id "g1345"; # protein sequence = [MQQVNLVTSSVPGSTSSLVNMRNEIRALMIDQGLPSFYITINPADVYNPLVKFLAGSDINIDCMLPRDVPEYWDQAIL # VAKNPVIAAKFFNVYLNAFIHSLLGYDATHQDMKGGILGLVKGYYGCIEAQGRGTLHCHMMIWLEGGLNPNEIRRRAIEDPNSDFCRRLIAFLDDTIT # NQLPVDDSVGIHVPSDDFHPCSVRGTTMVGYDAQDSNPEDAVRKDFHNLVQTCQIHKHTATCFKYCKGSQPKECRFGLHESNTTAETVFDENTGELTL # RCLDGLVNNFNETILRAIRCNMDIKFIGSGASAKAVLYYITNYITKSQLKAHVAYAALERAVRRLDEQCSTDTPFTIRAKRLLQKCAYSMISQQELSA # QQVNTYLLDLDDHFTSHQYKNFYWTQFEHLVECQIPSPECQLARKAYQCVEDTFGDKDVIDASGNDTCHDELASDAPGSTTFDDTHKPVDQYDDDDEV # GISVGNEGFLVAKASQLDDYRYRPIAVEDLSLWENIARCTKSRKPRSKNNDVSEDFDNDDDSVVVDDNEEEVVIGLQENISSDNRESVPSLPELLEHR # TRSHPKFEFEHGHPEQLSHTFVLGSSKNRKIPVPIGPALPRRDRENDWPRYCRLMLMFFKPWRNAVDLREQHESWPDAFAAFNARCSDEVKRMMDNMQ # ILHECRDSRDDHFANRASARRLRTTHGYVGSLEQERVVEDDFLAEHDNESEILEHLLSIEGTNSRRIDQSRYEALSCVQQMESCGFFGPQHTDFNSNM # THKPGEDVTTDLHLIQDDCPEHEQTWKDAYVARKQTWQQQLLVEPVNVNSDSNRYDSHYDSHIHNLDETDLRLDNATLRPPINDCQPSSLVDIDDFVT # TFTPALNKEQERAFRLIASHTQLGKSDPLRMFLGGPGGTGKSHVISALKLFFEAQGESRRFRLASYTGVAAKNISGMTLHSALLLSTTASAKVNSKSR # KNLLAMWQGVDYLFIDEVSMLGCRFLLKISRALSQAKDNTSPFGGINIIFAGDFAQLGPVREQRLFSYIDTRRATTIHGQEIVFGKLLWLTVKTVVLL # TQIMRQTGTQNEPFVDLLSRLRIGNCTQSDYEILNARVVGNVQPDWNDPKWAGTPTIVSCNRVKDLINERATEAFAKRTGKPLYWYHSFDTRSGKPIV # EPTLQNYLETLDSGKTNQRLGRIPLVIGMPVIITQNFDVHAGIVNGSQGILKSIRYKVDEQGHRHAISCVITLSTTNTTEPLPYMDSKDDVVALEDKV # SLSFVHEYTKKRCTFQRTQLPIAPAFAMTTHKAQGQTMDSAIVDIESCHGTEAPYVMISRVKTLDGLLILRPFQLKKIQCRQSQDNRVEQQRLHYLSL # TTIVSVGSVIERAKAKKSLRTYKGPGPTVADSDVQSLSKLEAIQRNLSGMQQLSSPECVSVISEVRFFFVFLLPALSHSNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1345 ### # start gene g1346 3 AUGUSTUS gene 5840000 5842827 0.59 - . g1346 3 AUGUSTUS transcript 5840000 5842827 0.59 - . g1346.t1 3 AUGUSTUS stop_codon 5840000 5840002 . - 0 transcript_id "g1346.t1"; gene_id "g1346"; 3 AUGUSTUS CDS 5840000 5842728 0.9 - 2 transcript_id "g1346.t1"; gene_id "g1346"; 3 AUGUSTUS CDS 5842785 5842827 0.6 - 0 transcript_id "g1346.t1"; gene_id "g1346"; 3 AUGUSTUS start_codon 5842825 5842827 . - 0 transcript_id "g1346.t1"; gene_id "g1346"; # protein sequence = [MFTPPSTVSSLFSCSQNSASSSSRLVSNPQISFVMNNIGSSPAGTPIVSNPSSEIPFPRCIHITDAFRLRFFFSVNEP # GPSQRTLYVGGPHASEDIITNNLVSPNGCSAHNELHNLINREKHTVTSTASTSEYHPVVSALPTSNDVLTACLFGNFQSGVRCSMFVSDANTLSRYAS # LHGLDLKGLVGQRRQREAVIYHILNAQCVHNSQSTSAPACRIFSNGLSSVMEFLTSMDDLLAKSKAVSMSVDKLKLILEALNIRELIRPKQPRRQMLG # LLHRYLSRIRGAHIEAEKCANPVLPCSVLDIFQDFNKLRFPVLLQYCLMHKLDVNVILATAEDLRVQLASHILSAECYTNVSVLSKSNCPGGCQSIAT # TFSPPVMNEVSEFESATDFKRALIHLLSTKLSLLTLRNILQILEIPFNQNDNKRVLRHRLQVYNETVGVDLERVENEKKLQNLRTQWPSLVPQELKHE # LLDRFRDCTSSYALRKLVCASCSSEELATACHVVTSDSVDLSLLKRPDMRLKKGFPSTVVDSNWLDSDCVAPDIDKVLEDFPDAVLDCKGVQTDEQNN # VTLCLCPVCYSALRNKRTPALSLANHMYLGNVPDVLQNLTVVEEAMISRCRAKSWIIQLKEADEIANKTTQRGLKGNIIVYPQKPTALAKILPPSLDE # LTAPICVIFVGSSRPSEEWLRNKAKPLTARPKVVRDALIWLKSHNKWYKDIIIDYDFLATLPDQFVLPVHVECVESGKSADSLTAGYDPTHSTSSYPT # VERGTSENHDEEVIFESVVIADVDANATMNELRAAAMRHIKFKGGSYIEIPHDTEPMNEFFNPSLFPMIYPTLFPYGIGGFEDYSRSEPVSLKRHVKY # LLSLTDHRFQEHYSFSFTAFNILQRQSMLLRTALKAKKSNFPVLASQFASVTPSAIAAVSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1346 ### # start gene g1347 3 AUGUSTUS gene 5843208 5843468 0.7 + . g1347 3 AUGUSTUS transcript 5843208 5843468 0.7 + . g1347.t1 3 AUGUSTUS start_codon 5843208 5843210 . + 0 transcript_id "g1347.t1"; gene_id "g1347"; 3 AUGUSTUS CDS 5843208 5843468 0.7 + 0 transcript_id "g1347.t1"; gene_id "g1347"; 3 AUGUSTUS stop_codon 5843466 5843468 . + 0 transcript_id "g1347.t1"; gene_id "g1347"; # protein sequence = [MLEVYTKYCIETCNIIDNDKIYGQRVTEIVKTEVNGGRDEIVVPIAKICSTNERSGNNGLIDSDIFTCNAGLARDCEQ # HEGHKRKC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1347 ### # start gene g1348 3 AUGUSTUS gene 5856080 5857246 0.9 + . g1348 3 AUGUSTUS transcript 5856080 5857246 0.9 + . g1348.t1 3 AUGUSTUS start_codon 5856080 5856082 . + 0 transcript_id "g1348.t1"; gene_id "g1348"; 3 AUGUSTUS CDS 5856080 5857246 0.9 + 0 transcript_id "g1348.t1"; gene_id "g1348"; 3 AUGUSTUS stop_codon 5857244 5857246 . + 0 transcript_id "g1348.t1"; gene_id "g1348"; # protein sequence = [MSTPIPPAPNTSADDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSASAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1348 ### # start gene g1349 3 AUGUSTUS gene 5857297 5861013 0.95 + . g1349 3 AUGUSTUS transcript 5857297 5861013 0.95 + . g1349.t1 3 AUGUSTUS start_codon 5857297 5857299 . + 0 transcript_id "g1349.t1"; gene_id "g1349"; 3 AUGUSTUS CDS 5857297 5861013 0.95 + 0 transcript_id "g1349.t1"; gene_id "g1349"; 3 AUGUSTUS stop_codon 5861011 5861013 . + 0 transcript_id "g1349.t1"; gene_id "g1349"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQEQWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VWEVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAEWNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSWFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPADDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVAHIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIHLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDTGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1349 ### # start gene g1350 3 AUGUSTUS gene 5861606 5862024 0.24 - . g1350 3 AUGUSTUS transcript 5861606 5862024 0.24 - . g1350.t1 3 AUGUSTUS stop_codon 5861606 5861608 . - 0 transcript_id "g1350.t1"; gene_id "g1350"; 3 AUGUSTUS CDS 5861606 5861872 0.71 - 0 transcript_id "g1350.t1"; gene_id "g1350"; 3 AUGUSTUS CDS 5861971 5862024 0.24 - 0 transcript_id "g1350.t1"; gene_id "g1350"; 3 AUGUSTUS start_codon 5862022 5862024 . - 0 transcript_id "g1350.t1"; gene_id "g1350"; # protein sequence = [MSTQTSRRFRASPARLALIAIGMIYDNDINQISQRGEKAELIYESSSPINAVELDKTRRMMLICAGAYVNVMEQQEGI # NSTGTFIPISTYNRSHLDNTESHKLHWT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1350 ### # start gene g1351 3 AUGUSTUS gene 5862690 5864906 0.76 + . g1351 3 AUGUSTUS transcript 5862690 5864906 0.76 + . g1351.t1 3 AUGUSTUS start_codon 5862690 5862692 . + 0 transcript_id "g1351.t1"; gene_id "g1351"; 3 AUGUSTUS CDS 5862690 5864906 0.76 + 0 transcript_id "g1351.t1"; gene_id "g1351"; 3 AUGUSTUS stop_codon 5864904 5864906 . + 0 transcript_id "g1351.t1"; gene_id "g1351"; # protein sequence = [MPNFFVPGWVTSSFPFMGFAPSSNPFKCDFLRCLDFSAQTLPIVGDADCGYSLKPSLKTDWDSLERNLRVFLRACMKV # NGVGVPDDLRLWSFPLQYGYSRTYTTLDDARAAAYQSRQAFIPLIASVSFFLHLLYHMQNKWVTLIATDIRVSLPKSNPFWSARQNAEAERRRGPVPS # KWDWQDRLQKETFISTEWLSYFYEIMEIPMVGVFMDVHNSGCLPWLNIFLETKMPVVLFWGTVQNWRIPRELSPALPVPTGVMVKSLISKQSPYSPIE # PVLDNTQYSSTRTRQLRLPRIDGGTQPRRNEGIFEFLKRRASDKARAIATESAKDRQSRLQREEHASKDMPPGRKGARVYYWDLVEGIRVRNPVGRSN # YEDIWERYGPRQRCYDAVADEWDICTELDPNDEPSFGDDDEDDDDDYFITPQSVMSQEIDHHHGPSSSNAYLTRLQSSSHSRDPVIFSEEIDNVVKHR # FGFLPRDNHSDRPVKFSASVWCQALALIGYGRQPRPSLRNSQSELALCTFLFDLLKATNLASAPRNFDLVSLRPPLPFEVDVLPSRDRLYFLVQASKA # HDHEPFHLAFSSAGTVMEIARRNWGPQTADLLQNLIKGGFSFNTLSAYFPPTGYISPPQRKSVLLGRRPCGFSPGLEEYCSYEHRRDIFLRSVRGRAA # ILSGGIIARLAREVVNVNDVLDGPTERALHGQNALCVWDPRQKAAFWDDELTEDEIDLICGTYEIATGKLLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1351 ### # start gene g1352 3 AUGUSTUS gene 5869345 5869973 0.39 + . g1352 3 AUGUSTUS transcript 5869345 5869973 0.39 + . g1352.t1 3 AUGUSTUS start_codon 5869345 5869347 . + 0 transcript_id "g1352.t1"; gene_id "g1352"; 3 AUGUSTUS CDS 5869345 5869470 0.39 + 0 transcript_id "g1352.t1"; gene_id "g1352"; 3 AUGUSTUS CDS 5869563 5869973 0.89 + 0 transcript_id "g1352.t1"; gene_id "g1352"; 3 AUGUSTUS stop_codon 5869971 5869973 . + 0 transcript_id "g1352.t1"; gene_id "g1352"; # protein sequence = [MLSIFSCWPTADQLPPPLDSLEEFHQYKPAIAIAFGALVGAVLLNYLFGWEGEAFKEGWEQLSSNVLLTNENFLVDFF # QDIGPVASDRCLIDDGRDRELSRRENEILRRERELHRQLISFEQRRARFHRETAQYHAQQAAIHQFQARFGKDLETKGLALKTGAPAISEGSERESDV # EA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1352 ### # start gene g1353 3 AUGUSTUS gene 5871260 5871967 0.63 + . g1353 3 AUGUSTUS transcript 5871260 5871967 0.63 + . g1353.t1 3 AUGUSTUS start_codon 5871260 5871262 . + 0 transcript_id "g1353.t1"; gene_id "g1353"; 3 AUGUSTUS CDS 5871260 5871967 0.63 + 0 transcript_id "g1353.t1"; gene_id "g1353"; 3 AUGUSTUS stop_codon 5871965 5871967 . + 0 transcript_id "g1353.t1"; gene_id "g1353"; # protein sequence = [MNEGNTKRDSQLQRQEGQLQRQEARMAELQRTQEQILSHLHLASPLASTTRAVPVHTSFEPSRPFAPAAVGVNTQSSI # PSGFRPFAPSASGPVPVPGGASGSVPDDSTGPTTATGTPGPGGFRSTGIANPVGSDSAPAGATGVPNADNLPSGNEWGKFPAGYRVTNSPITGPNSLW # NVELQVKDCTPVHKSPDQIARQVSALIEPDLFHGLSLISLSEIDVTMGRHGLGGTSQSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1353 ### # start gene g1354 3 AUGUSTUS gene 5876707 5876955 0.76 - . g1354 3 AUGUSTUS transcript 5876707 5876955 0.76 - . g1354.t1 3 AUGUSTUS stop_codon 5876707 5876709 . - 0 transcript_id "g1354.t1"; gene_id "g1354"; 3 AUGUSTUS CDS 5876707 5876955 0.76 - 0 transcript_id "g1354.t1"; gene_id "g1354"; 3 AUGUSTUS start_codon 5876953 5876955 . - 0 transcript_id "g1354.t1"; gene_id "g1354"; # protein sequence = [MNELAQIHGSKAAKTMNESARVHGSKVAERSPEGEEMRETTERWTMNELAQIHGSKAAETMNELAQVHGGKAAERSPE # GKEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1354 ### # start gene g1355 3 AUGUSTUS gene 5878659 5882551 0.12 + . g1355 3 AUGUSTUS transcript 5878659 5882551 0.12 + . g1355.t1 3 AUGUSTUS start_codon 5878659 5878661 . + 0 transcript_id "g1355.t1"; gene_id "g1355"; 3 AUGUSTUS CDS 5878659 5879975 0.56 + 0 transcript_id "g1355.t1"; gene_id "g1355"; 3 AUGUSTUS CDS 5880360 5880689 0.63 + 0 transcript_id "g1355.t1"; gene_id "g1355"; 3 AUGUSTUS CDS 5880764 5881171 0.54 + 0 transcript_id "g1355.t1"; gene_id "g1355"; 3 AUGUSTUS CDS 5881232 5881766 0.48 + 0 transcript_id "g1355.t1"; gene_id "g1355"; 3 AUGUSTUS CDS 5881815 5882551 0.71 + 2 transcript_id "g1355.t1"; gene_id "g1355"; 3 AUGUSTUS stop_codon 5882549 5882551 . + 0 transcript_id "g1355.t1"; gene_id "g1355"; # protein sequence = [MRVVLALHRGILWATESPNAIDAASNLPKDVHTIIDHYDLDPHCHARLACPKCFKLHEFSPQSIQRNEESYRTDKKLD # KCVACSTTLWRIQRIGNRFFVVPIRKQLFQDLKQWFGRILAVPGMEEAMENHLRSSSDDEILRDIRDSPVFKAIPGPDGNPFMQLDENSHDLPVMFSL # GYDAFHPFHFSNEKSHISSTAIYMVNLCLPEHLRYRKGYMALVTVFNGDPNVNDINHILDWIVDLLLPFWDGIYFTQTCSHPLGRVVRGILIPIVCDV # VGAHHVSGFGSHSHKLFCTQCLLLKSDINNIDMATWPRRNLQEHQLRAQEYHKATSDEERDHIVNTYGVRWTALLRLPYWNPIAYTVIDGMHLCKGLA # ETHVRGVLGIEGDAKPKATLKSKFKPPAALLRSLWDGIRKAPENLSQWLDSKVNKNTTVFLCSCLPDGTDSRESSALSSTSLQSILSSQSTPNKDPEP # AHSVPMADWDHVDEKKFSNLKAKLLDHDNQQETQKLLPQTVTKAYLHALCEDLRIPYRKSEKRNLTDTKPHLITRLDYWGFHNPDTPAQEPSTSSAVS # STNPPGSSVNLVVASFALSPSSVPSPVPSPAPSPAPGISSAVLDSSISNPLPEMVPQSSFDNAGYQALKRKFLEDTKPLSISSLSKYAKDLLVRLCKE # FGVPTYGDKALLAENLLLWHAEHRDTPIPHTPFSGNLLTSSIMEEVRTDIQRSILPTWIQPAPLAWGTPSGGKLSADHWKVICTIHLVVTLIRVWAYG # NDGTKMPLLQNFLHLVRALQILNLRSTSKQLSEAYTSEMLQYLTTLKELFPNWEFVPNQHYSLHMGEFLQTMGPLHARDTSAFERVNHELQDTTTNRR # IAYDIGQAENTMLRSYCRLGNLRLLIDNRQELHDRIGETLEVLDDIACEDHWGMFADTQTLAWTSTKFKSRKVFISSDVVQHIQDYLCLNYQVLAEKW # PTNLTTEVTEVDGVSVGRAIYTSFHHQHRNSFIILELQQNQYFAARIQQIFYHAHQHPHDPHLSMSEIYTSVDLLNPLDTDVLPDWYWQFKMGWLCCD # PSNPSTPTPVQVTVPLKYAVSHCVWTPFEINNQAILHVLPVPKVRIGFTC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1355 ### # start gene g1356 3 AUGUSTUS gene 5888834 5889994 0.21 + . g1356 3 AUGUSTUS transcript 5888834 5889994 0.21 + . g1356.t1 3 AUGUSTUS start_codon 5888834 5888836 . + 0 transcript_id "g1356.t1"; gene_id "g1356"; 3 AUGUSTUS CDS 5888834 5889328 0.36 + 0 transcript_id "g1356.t1"; gene_id "g1356"; 3 AUGUSTUS CDS 5889390 5889507 0.68 + 0 transcript_id "g1356.t1"; gene_id "g1356"; 3 AUGUSTUS CDS 5889609 5889994 0.97 + 2 transcript_id "g1356.t1"; gene_id "g1356"; 3 AUGUSTUS stop_codon 5889992 5889994 . + 0 transcript_id "g1356.t1"; gene_id "g1356"; # protein sequence = [MPSTQNRSLSDQDLIQFCLAVREKKDWERKIWDEKLVLKWSIEAELMPLGSTILKGEALEAVRYLTFSSFSACPTQKF # TPRELRRSALIHKLDQQITLFSGPNSNTAQHHEPVKEPVVEVDHFDLKNALKYARGSRHALWEPELREKGLGIFVSDDLVPESVHRELERELDALAAK # QPKDYHPGSFGKVRSSHSAFSIIESFHRYPYILGVTPVSSPSIKLPPTVDGKFYTKLSNLFNEEMISSYAWIPSVFKVSPDGTDVHIDGYINGLGTRE # EHPGLFRVIEKMFLLALPHFEKTVEKAEEYEPKMSPSGRYTSFYPRTSVSSSKADFTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1356 ### # start gene g1357 3 AUGUSTUS gene 5892149 5892673 0.54 + . g1357 3 AUGUSTUS transcript 5892149 5892673 0.54 + . g1357.t1 3 AUGUSTUS start_codon 5892149 5892151 . + 0 transcript_id "g1357.t1"; gene_id "g1357"; 3 AUGUSTUS CDS 5892149 5892673 0.54 + 0 transcript_id "g1357.t1"; gene_id "g1357"; 3 AUGUSTUS stop_codon 5892671 5892673 . + 0 transcript_id "g1357.t1"; gene_id "g1357"; # protein sequence = [MSPKQKRNPTAQDLGQFCLAVRQKKDWERKIWDEKLVLKWSIEAELMPLGSTVLRGETLEAVRYPTFGPFFASLSRLK # INIPRELRRASTIRKLDQEIILSNGPHHEPVKEPVLEVDNSDWNNALKYARGSRHALWEPELREKGLGIFVSDDLVPESVHREVSALSVTSVMSFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1357 ### # start gene g1358 3 AUGUSTUS gene 5900127 5901161 0.35 + . g1358 3 AUGUSTUS transcript 5900127 5901161 0.35 + . g1358.t1 3 AUGUSTUS start_codon 5900127 5900129 . + 0 transcript_id "g1358.t1"; gene_id "g1358"; 3 AUGUSTUS CDS 5900127 5900650 0.38 + 0 transcript_id "g1358.t1"; gene_id "g1358"; 3 AUGUSTUS CDS 5900774 5901161 0.86 + 1 transcript_id "g1358.t1"; gene_id "g1358"; 3 AUGUSTUS stop_codon 5901159 5901161 . + 0 transcript_id "g1358.t1"; gene_id "g1358"; # protein sequence = [MARVCTPLSLVKVMIVSYYICVYYGILQCSHLLPRVNKVRYQDQADIEDAAGILRFDYTSSIIQQQQPPLIDTTLVTP # SPNAHHSNFSTDYSIAARNQPDIQYLPQTSVNTRASHFSPGPGGEALDFRYNSSERRSSGRQSHDPMVRRVMDGDQPLTPVSPVELSESSTAFAGNRR # SRKIRCDSARPVCTNCHRRKNVCEYDAAPKRRGPDKRPGTRRRSCKKRPADGSTPPPSKRKKIETDEVTSTNQISPSTKSKTAMTEKKRSLSTDKHGQ # VPIESTYEDTPPGLRISTDNTVIKVILAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1358 ### # start gene g1359 3 AUGUSTUS gene 5906187 5907344 0.96 + . g1359 3 AUGUSTUS transcript 5906187 5907344 0.96 + . g1359.t1 3 AUGUSTUS start_codon 5906187 5906189 . + 0 transcript_id "g1359.t1"; gene_id "g1359"; 3 AUGUSTUS CDS 5906187 5907344 0.96 + 0 transcript_id "g1359.t1"; gene_id "g1359"; 3 AUGUSTUS stop_codon 5907342 5907344 . + 0 transcript_id "g1359.t1"; gene_id "g1359"; # protein sequence = [MSTPVLPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKQAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGQCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRAN # AMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1359 ### # start gene g1360 3 AUGUSTUS gene 5907395 5911102 0.66 + . g1360 3 AUGUSTUS transcript 5907395 5911102 0.66 + . g1360.t1 3 AUGUSTUS start_codon 5907395 5907397 . + 0 transcript_id "g1360.t1"; gene_id "g1360"; 3 AUGUSTUS CDS 5907395 5908738 0.69 + 0 transcript_id "g1360.t1"; gene_id "g1360"; 3 AUGUSTUS CDS 5908826 5911102 0.87 + 0 transcript_id "g1360.t1"; gene_id "g1360"; 3 AUGUSTUS stop_codon 5911100 5911102 . + 0 transcript_id "g1360.t1"; gene_id "g1360"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEIITATEESPIHRIRANHKARRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGAQYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAHDLYLRPEKCEFEQQQIEYLGL # IISEGEVRMDPVKVAAVRDWPIPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALWAPDRPTRIE # VDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFNIITDHSNLEFWRTAQDLTRRQARWALYLSRF # DFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQVLEGLETVKKHGLQRLANGIAEWEEDNGLV # YYRGRVYVPADNNLCTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLP # NSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEK # YIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQ # FKVGDLVWLSAEDINLQLSSEKLGDRQLGPYHILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNPINGEMPTPPEPVYLEDEDEPEYEVEEILD # SRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1360 ### # start gene g1361 3 AUGUSTUS gene 5914503 5915174 0.62 - . g1361 3 AUGUSTUS transcript 5914503 5915174 0.62 - . g1361.t1 3 AUGUSTUS stop_codon 5914503 5914505 . - 0 transcript_id "g1361.t1"; gene_id "g1361"; 3 AUGUSTUS CDS 5914503 5914760 0.95 - 0 transcript_id "g1361.t1"; gene_id "g1361"; 3 AUGUSTUS CDS 5915025 5915174 0.67 - 0 transcript_id "g1361.t1"; gene_id "g1361"; 3 AUGUSTUS start_codon 5915172 5915174 . - 0 transcript_id "g1361.t1"; gene_id "g1361"; # protein sequence = [MGEDIEGDILVDMEMDTEVTMEVDTEVDSEVDTEVDTNIGGIVPPFLMQMVEGETEVLKKRKQNLLKPPNPAILKIHS # KSHVLTTEEDFINEELAEFEHDRYADDEDDENADAEDEDADNNGEDVTLTSQEYKRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1361 ### # start gene g1362 3 AUGUSTUS gene 5917583 5918041 1 + . g1362 3 AUGUSTUS transcript 5917583 5918041 1 + . g1362.t1 3 AUGUSTUS start_codon 5917583 5917585 . + 0 transcript_id "g1362.t1"; gene_id "g1362"; 3 AUGUSTUS CDS 5917583 5918041 1 + 0 transcript_id "g1362.t1"; gene_id "g1362"; 3 AUGUSTUS stop_codon 5918039 5918041 . + 0 transcript_id "g1362.t1"; gene_id "g1362"; # protein sequence = [MDVDDARVNVNANPNVNAKLNAKANLNVNPSVNLNVNPSVNANVNASVNANVNPKNVKPNANANPNMNPNVNANVNAN # VNANMNVNPNMNANTNMNPNANVNVNANANVEANPNPNFDPNLDPNANLNANLNANVDSRVDGTGKNERLKMGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1362 ### # start gene g1363 3 AUGUSTUS gene 5921441 5924168 0.3 + . g1363 3 AUGUSTUS transcript 5921441 5924168 0.3 + . g1363.t1 3 AUGUSTUS start_codon 5921441 5921443 . + 0 transcript_id "g1363.t1"; gene_id "g1363"; 3 AUGUSTUS CDS 5921441 5922535 0.54 + 0 transcript_id "g1363.t1"; gene_id "g1363"; 3 AUGUSTUS CDS 5922753 5922903 0.36 + 0 transcript_id "g1363.t1"; gene_id "g1363"; 3 AUGUSTUS CDS 5922997 5923375 0.89 + 2 transcript_id "g1363.t1"; gene_id "g1363"; 3 AUGUSTUS CDS 5923514 5924168 0.95 + 1 transcript_id "g1363.t1"; gene_id "g1363"; 3 AUGUSTUS stop_codon 5924166 5924168 . + 0 transcript_id "g1363.t1"; gene_id "g1363"; # protein sequence = [MSLPSSSAATGAPNPVLPPVSSPSHPNISEMTADAAIDELANTLEEPPLGQLALFCSVFGVGVSLARYIVDDPLWPVL # AAAGLPCSFCIRGKKEANCSVVPHLARCSNCDDKKPCVLGRLARFRYFSRKCSRDLAFARRFLEVHGDPGQRTRFTLPSEQWRDIAAKIEASTNSTVA # LIELNSLDAQDQQELDRLELGEFLRKQPQLPRPSTTTSLPSPLPSVVATPRVLAKKRKRSIRQEEGGSSSLRKRPVKEVSEPEVAPEVHDCKHKRPVE # ESQGAEVPGYRRVVLVLRPPLVDSSGSVPLTGDRVDEVVHPPLPSEESETARVPLPPSQAHSSPGSSSRFIPPVVSERRSAVTISTPPPSQTTTSLDD # RNKDLEASRRALQDVAADRLEYGRVLAQFRAIEAELPQAPLEVEVDAYREVAVRQKQELSELRAQVDKEQKRSYEAHEELDAANACAIRLQDRLEDLE # ETVHRYWTRAHVAEELIRKYPEDEGLSEVDLPSLSSLQDKLTASEVMLRRMATFAHRLHSADPANLLHHHNTRLLFYYSNAADRVDGLYQDMFAHSRF # ASDKAFLTAAQHAGYVDARPGSLEPPLHRQLFSFDHPIPLPRSPTSDHIPAVPMMDTVMLMWEDMIGAYVREVLGYPASPGRILPPVEVPNFTDPLLA # TTSLVVDDPRPVLGASDSVSRSAPLFLPGSLSPTSPRSPSPIPSSPRVPDVAREVVDLTMDDAEDLYESQEEFLARTGGTVTVKQEITESGVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1363 ### # start gene g1364 3 AUGUSTUS gene 5924317 5926074 0.88 + . g1364 3 AUGUSTUS transcript 5924317 5926074 0.88 + . g1364.t1 3 AUGUSTUS start_codon 5924317 5924319 . + 0 transcript_id "g1364.t1"; gene_id "g1364"; 3 AUGUSTUS CDS 5924317 5926074 0.88 + 0 transcript_id "g1364.t1"; gene_id "g1364"; 3 AUGUSTUS stop_codon 5926072 5926074 . + 0 transcript_id "g1364.t1"; gene_id "g1364"; # protein sequence = [MEVPQKGLSMQGPNDPVRLRTVAGGTFWFGSPVASSLSVRIPIKGVGQVLLPSIMPPTPRPTLVPRTSNAHPYRAENQ # RLVARIRLLESQLADSQRENSSLTSALRNTSRALESRQREVEQLRFSRREVLEREMEDCRVLDQFPALDEALPGAPGQVSTSFSPRFPPLFNPSSQSV # SERFRKVQEDLQNATRERRVAVEKLITSTRKNSQLRTTLLHQQGLVDESNALATRQRRLVEELEEEVHRVRGRAVFVEQMLKEYPDEGYYEVVLPPLS # QLEGDLNKAHEDLRRVATFAHRLYRCDPATVLHHHHRYLGAIIEAVVAFLCRGLDSEDLDVIIHNFRLALDYVQAARGVHGDMYMRSISSIQWFFNNA # VDEDEGLYRMILEHSRFDNDRPFLTAAHHAGFVPPPDDSVEPPLHRRMLALSTVLPHSDGVGRWEDIVPALPSIDQLSADWEQMMLQYIHHITDTPLS # GTDTQGPMSSVEPTNGSLSEVLVRQSPEAPAALESTSSASPHPRVPLFLPEQESLTSPSPTLPPLFGSVADLVIHLTGDDDELYETEEVSAGRFSVTR # EVIDLAAGQEVVKDESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1364 ### # command line: # augustus --species=saccharomyces split/input_2/input_2.fa_chunk_0000005