# This output was generated with AUGUSTUS (version 3.4.0).
# AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de),
# O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff.
# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
# Using native and syntenically mapped cDNA alignments to improve de novo gene finding
# Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
# No extrinsic information on sequences given.
# Sources of extrinsic information: M RM 
# Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ...
# saccharomyces version. Using default transition matrix.
# Looks like split/input_1/input_1.fa_chunk_0000014 is in fasta format.
# We have hints for 0 sequences and for 0 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 5311644, name = Scaffold_1) -----
#
# Predicted genes for sequence number 1 on both strands
# start gene g1
Scaffold_1	AUGUSTUS	gene	8859	10002	0.78	-	.	g1
Scaffold_1	AUGUSTUS	transcript	8859	10002	0.78	-	.	g1.t1
Scaffold_1	AUGUSTUS	stop_codon	8859	8861	.	-	0	transcript_id "g1.t1"; gene_id "g1";
Scaffold_1	AUGUSTUS	CDS	8859	9886	0.79	-	2	transcript_id "g1.t1"; gene_id "g1";
Scaffold_1	AUGUSTUS	CDS	9996	10002	0.78	-	0	transcript_id "g1.t1"; gene_id "g1";
Scaffold_1	AUGUSTUS	start_codon	10000	10002	.	-	0	transcript_id "g1.t1"; gene_id "g1";
# protein sequence = [MINGIGATSLEGSESDRSPLGLYSLLLDQTGIPSPASPSFGMYEEYKCPWTPRSLDSSSNDDGNARYITKSMTTAPHL
# SYPSPKSSHWPHQIPLHPPSHPPLLSPHISTELPMQSEFPHPVSPSIRYIELNGPVYDGEAPGSQSPSIRTFELPELEEDEDLETGFDSGLGLSLTSF
# PTMSEISPAPEDSSSRFSSLSQYILQNSPSLITCSPPTSGPISKPTLESDWDTPTSNLSPANFNDAGYDSATPSSMLLLDVNIESSQNIKFNPGRLPS
# PNTLVESLDSRLSHLPLDSSPSDISSYADCPEYAVLRAQPDLYQDLLRLLACTGKHRHLRRRRKLRKESL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1
###
# start gene g2
Scaffold_1	AUGUSTUS	gene	12522	13220	0.98	-	.	g2
Scaffold_1	AUGUSTUS	transcript	12522	13220	0.98	-	.	g2.t1
Scaffold_1	AUGUSTUS	stop_codon	12522	12524	.	-	0	transcript_id "g2.t1"; gene_id "g2";
Scaffold_1	AUGUSTUS	CDS	12522	13220	0.98	-	0	transcript_id "g2.t1"; gene_id "g2";
Scaffold_1	AUGUSTUS	start_codon	13218	13220	.	-	0	transcript_id "g2.t1"; gene_id "g2";
# protein sequence = [MRSHRTLVPLVTIALTLAANAVPTSYYHDSGNSAGAYSTSVIGVASPTLSARGSGKPLSPIPEQDERPAPEPKASAAV
# VIKSKFTKSPGPPPDHPAPKLVDLRIPGDPPPHRPLPPIPKPKEHSQPPAPPPVPARNPNRPTPKSHERVPSSDPAVPNFSRPLTHSPSTSFNGLTPD
# KKNEPGAKTNETAVGEKNSSTGEKVAIAGALMAAAATGYVIAKETETVSLPTLVFA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g2
###
# start gene g3
Scaffold_1	AUGUSTUS	gene	13547	14600	0.33	-	.	g3
Scaffold_1	AUGUSTUS	transcript	13547	14600	0.33	-	.	g3.t1
Scaffold_1	AUGUSTUS	stop_codon	13547	13549	.	-	0	transcript_id "g3.t1"; gene_id "g3";
Scaffold_1	AUGUSTUS	CDS	13547	13756	0.97	-	0	transcript_id "g3.t1"; gene_id "g3";
Scaffold_1	AUGUSTUS	CDS	13806	14600	0.33	-	0	transcript_id "g3.t1"; gene_id "g3";
Scaffold_1	AUGUSTUS	start_codon	14598	14600	.	-	0	transcript_id "g3.t1"; gene_id "g3";
# protein sequence = [MRTYSTLIPFVTLAVALAANAAPPTYSSSEGSYTHTALIRDAMSPDGFVEARGFADDDRYLFERSPPSSSDAPPPPPS
# GVQDTSPGGATSPAAVPGSLFSGPSPYAPPTKPLPPIPQGSPQYRREAAPEHHNLPAPEGGEKKEPLTQQKVEEPHHTGQAPHPVDEKKNPEHSPPPP
# VPTKKPGFMNKLKGFTNKATTSAKDPNKQAALKNKGKKLAKYGGFAAAGMGAGALITGLGLMHAGSKESSPTGSTGSEGTASSTVSPLRGTGNIDATS
# GGGTSSSSSDTSSGSAAAGSDTTASDTTASDTSSSDGTTPAKRTVSRSMYRRRVSGWDLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g3
###
# start gene g4
Scaffold_1	AUGUSTUS	gene	21790	23006	0.36	-	.	g4
Scaffold_1	AUGUSTUS	transcript	21790	23006	0.36	-	.	g4.t1
Scaffold_1	AUGUSTUS	stop_codon	21790	21792	.	-	0	transcript_id "g4.t1"; gene_id "g4";
Scaffold_1	AUGUSTUS	CDS	21790	22507	0.9	-	1	transcript_id "g4.t1"; gene_id "g4";
Scaffold_1	AUGUSTUS	CDS	22582	23006	0.36	-	0	transcript_id "g4.t1"; gene_id "g4";
Scaffold_1	AUGUSTUS	start_codon	23004	23006	.	-	0	transcript_id "g4.t1"; gene_id "g4";
# protein sequence = [MMSVATRAAMLARRPGLRTLVITRSTFAGAGAHVGKWLGDNFSSWQEYRLSIAGMLGMAGVYQIPMVGSDICGYAENT
# TSTLCARWAMLGGFYPFMRNVSGFVTSFGNELILYSLIGSSIMPTRLLVKNSIGGLLLRKRRRMYRLMDYFYTTFHQASLDGSPVLQALWYKYPKDTS
# TYPIDLQFLFGPSILVSPVTDENSTSVTIYLPRDTFYEFLTLEPVSGTGANVTLTNVDFTEIPVHIVGGSILPLRVNGTMTTTELRQNDFEIVVAPSA
# AGNASGRLYVDDGVSLEQTNGTTALTFDYQDGALSVNGTFGYNLGVNVASVKILGVNQSPKNVSVVDQSGQSIGNGTFSYDAGTKVVEVALGVAFDKA
# FELHLQEA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g4
###
# start gene g5
Scaffold_1	AUGUSTUS	gene	26535	26831	0.74	+	.	g5
Scaffold_1	AUGUSTUS	transcript	26535	26831	0.74	+	.	g5.t1
Scaffold_1	AUGUSTUS	start_codon	26535	26537	.	+	0	transcript_id "g5.t1"; gene_id "g5";
Scaffold_1	AUGUSTUS	CDS	26535	26831	0.74	+	0	transcript_id "g5.t1"; gene_id "g5";
Scaffold_1	AUGUSTUS	stop_codon	26829	26831	.	+	0	transcript_id "g5.t1"; gene_id "g5";
# protein sequence = [MTAKRLSRFFPWISPSSFKATGHESSVESAPPLRALAAVVDATPSAKTWKDLPNFDDLPMFKNMKGCAWEVWGKDDQL
# GTINLLTDEVVKKAAAEEIM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g5
###
# start gene g6
Scaffold_1	AUGUSTUS	gene	28993	30111	0.4	-	.	g6
Scaffold_1	AUGUSTUS	transcript	28993	30111	0.4	-	.	g6.t1
Scaffold_1	AUGUSTUS	stop_codon	28993	28995	.	-	0	transcript_id "g6.t1"; gene_id "g6";
Scaffold_1	AUGUSTUS	CDS	28993	30111	0.4	-	0	transcript_id "g6.t1"; gene_id "g6";
Scaffold_1	AUGUSTUS	start_codon	30109	30111	.	-	0	transcript_id "g6.t1"; gene_id "g6";
# protein sequence = [MLAYKHWHELELTIYCTCGLITQYFLFYEPNRAPMGQYWRIMNIDNEESTGGLGKLGEFFWYSSQIISYLKTPPVIPS
# SFHTSSGIFEENHRNASKYDYYINISLLMLSQICREDPTSIILSLPNELLLAIAEELLEEYLDLICFSLTCSCIWDVTEQVRYRSLYSRLKTSSWAGG
# RIILLGDYAGALPKGLLTDAEKKQFELHGHDDDDLGALLYYYADEKFERPPANISLLTDKRIQANRILRKELLAYSHREPFSPWIWLWGDFTPIRSPQ
# DRWIVRNLTKQEYVIKTRSRNLTQILYCLIGCSDDPSVSMRGGELLIHGAWAGDRIDITLVSFHKQEHEDESGWTNITAGVKKTLEELAAREMREFEF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g6
###
# start gene g7
Scaffold_1	AUGUSTUS	gene	33562	34664	0.29	-	.	g7
Scaffold_1	AUGUSTUS	transcript	33562	34664	0.29	-	.	g7.t1
Scaffold_1	AUGUSTUS	stop_codon	33562	33564	.	-	0	transcript_id "g7.t1"; gene_id "g7";
Scaffold_1	AUGUSTUS	CDS	33562	34360	0.41	-	1	transcript_id "g7.t1"; gene_id "g7";
Scaffold_1	AUGUSTUS	CDS	34474	34664	0.3	-	0	transcript_id "g7.t1"; gene_id "g7";
Scaffold_1	AUGUSTUS	start_codon	34662	34664	.	-	0	transcript_id "g7.t1"; gene_id "g7";
# protein sequence = [MPRRRSPSSAALTVGVSTTLLFVTSLAVAGRNSKTIIRCESELDDELASSDKKDLSKGFQRPRCSLKKSIITLAITSS
# RNPESEDSIAVYFPSTDDEDDRRSYMALFDGHNGPAMSDFLCDHLVEYVASAISKLPQQYELSGYLEMHNSDESNSSAIPADDVISDTIKHAFKEVDD
# AMIDVSDVLSSTSKTNAIRTLRHAHSGSCALMSIYDTDTQILRVALTGDSRAVLGRKVLSKDGKTNGYQVHVLSQDQNAHNPKEIVRLETEHPGEEVV
# KNGRVMGWGMARAFGDAAYKWSVDIQEKLYEKYLGDRVRSNMKTPPYLTGAWISL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g7
###
# start gene g8
Scaffold_1	AUGUSTUS	gene	41860	43149	0.68	-	.	g8
Scaffold_1	AUGUSTUS	transcript	41860	43149	0.68	-	.	g8.t1
Scaffold_1	AUGUSTUS	stop_codon	41860	41862	.	-	0	transcript_id "g8.t1"; gene_id "g8";
Scaffold_1	AUGUSTUS	CDS	41860	42402	0.7	-	0	transcript_id "g8.t1"; gene_id "g8";
Scaffold_1	AUGUSTUS	CDS	42461	42678	0.71	-	2	transcript_id "g8.t1"; gene_id "g8";
Scaffold_1	AUGUSTUS	CDS	42729	43149	0.99	-	0	transcript_id "g8.t1"; gene_id "g8";
Scaffold_1	AUGUSTUS	start_codon	43147	43149	.	-	0	transcript_id "g8.t1"; gene_id "g8";
# protein sequence = [MKVKRLSASRLPLLSRVSSPPPITVPIDRSTNSASNSTRRKPIRRQSGLLVRQGSPVAGSHEAAEDDELAAVLDEAEE
# EVPVVKKEKRKIIREKGKEKEKDHETSLRKKLRDEMGNEGKKFKLADVTNSPRSQPSQSVDAVLSEVELDVARTSNNRREFLSSSPPRSSSGSHFSSN
# NYLPIPQQSSSPPQIPATHDNQDLDSELAQIGGRERRNLFTNMSDFCPHSKMRKPDSEPGGSSLRKRKSASAVMSSRSEECVPGHEVDADGDYEDPDG
# GARSSLEGPNAKPSRARSRATDPAQLILPASRPGSSADVASQPLASATSSTSIPSRRAKSRSYLYTAEDVPSPESDDADTEYIPSSGVARGGPSWVNT
# SERKKAGSGYLLRMTRRGDIA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g8
###
# start gene g9
Scaffold_1	AUGUSTUS	gene	48864	49691	0.87	-	.	g9
Scaffold_1	AUGUSTUS	transcript	48864	49691	0.87	-	.	g9.t1
Scaffold_1	AUGUSTUS	stop_codon	48864	48866	.	-	0	transcript_id "g9.t1"; gene_id "g9";
Scaffold_1	AUGUSTUS	CDS	48864	49691	0.87	-	0	transcript_id "g9.t1"; gene_id "g9";
Scaffold_1	AUGUSTUS	start_codon	49689	49691	.	-	0	transcript_id "g9.t1"; gene_id "g9";
# protein sequence = [MEDVHNYKGESRYNHGRLVQYDFGGDPEIEQWLTANLNRVNLGTVGLVFLDAQTGLIQNVSESDLSDVHQTLDLWTGI
# MSSEFTYEDTTIYVTTTSAQDISAITVTVSSPLLYPNTSNALTRLGIFLDFPWGDRSQMFSAPFVGNFSSALFDNHTTTLLDHSEIQAQIQHQMVDAI
# FYTAVESSTKFDITRDSPIAHRYTILPHSDTNSLSPVISYNSTLPSSLPSSDSLVQSSIAAWESYWMKSGFVDLFSGSTDSRADESQRMIILFEVFNE
# S]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g9
###
# start gene g10
Scaffold_1	AUGUSTUS	gene	52424	53599	1	-	.	g10
Scaffold_1	AUGUSTUS	transcript	52424	53599	1	-	.	g10.t1
Scaffold_1	AUGUSTUS	stop_codon	52424	52426	.	-	0	transcript_id "g10.t1"; gene_id "g10";
Scaffold_1	AUGUSTUS	CDS	52424	53599	1	-	0	transcript_id "g10.t1"; gene_id "g10";
Scaffold_1	AUGUSTUS	start_codon	53597	53599	.	-	0	transcript_id "g10.t1"; gene_id "g10";
# protein sequence = [MQNLPLDLQGTYEQAVQKCKNGPNSTEAYHILLWLLYAFEPLDQKQITAILSIDLEQQVVESSDEIAFKIENIVDSTL
# VAINSDGVVQLAHASVKEFLLLKQVAIQMKASFDMDAHLAHDTLAQMCIVYLLQWKDEEVLEQDFPFESYAIQHWAGHTASSLQGDQLGNVLRDLSHE
# ILKASSFQYHHWTDKYKLQTFPYTTKKGMNPFWWAACLGLLPAVNDITLLDKNFLNQPTGDLGTPLSAAAYFERENSVHFLLHIGADVNAQGGEFGNA
# LQAAACCGNINIVKCLFESGANVNAQGGLFGNALQAASWNDHRDVVQYLLKNGADANVQGGQYGSALVAAAYEGNEIIVKWLVAHGADVNIQVEFFLG
# MLSKLLHMKAMKPLSNIFF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g10
###
# start gene g11
Scaffold_1	AUGUSTUS	gene	53721	54665	0.66	-	.	g11
Scaffold_1	AUGUSTUS	transcript	53721	54665	0.66	-	.	g11.t1
Scaffold_1	AUGUSTUS	stop_codon	53721	53723	.	-	0	transcript_id "g11.t1"; gene_id "g11";
Scaffold_1	AUGUSTUS	CDS	53721	54377	0.74	-	0	transcript_id "g11.t1"; gene_id "g11";
Scaffold_1	AUGUSTUS	CDS	54654	54665	0.66	-	0	transcript_id "g11.t1"; gene_id "g11";
Scaffold_1	AUGUSTUS	start_codon	54663	54665	.	-	0	transcript_id "g11.t1"; gene_id "g11";
# protein sequence = [MRIVLDQAKQSYCNHPNSKVRLFEVVLTGTSHFSSTLIESLQTDPQKLVCYHYFDTRDTTGVKSSYQGLLSSILQQLG
# SSNSRIHPALKVLHQSSKTGLMYAKPSNKSMENAIKTIINDLQSEGPVCVILDALDECNESSSLQKFCTNLVSDMHHLWLVVTSRHLPDIHWGSRILI
# SLDIENTSGDIDVYLATKIAEDFQDFKSEPFKLEVKKTLKTKAEGV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g11
###
# start gene g12
Scaffold_1	AUGUSTUS	gene	69715	70203	0.98	-	.	g12
Scaffold_1	AUGUSTUS	transcript	69715	70203	0.98	-	.	g12.t1
Scaffold_1	AUGUSTUS	stop_codon	69715	69717	.	-	0	transcript_id "g12.t1"; gene_id "g12";
Scaffold_1	AUGUSTUS	CDS	69715	70203	0.98	-	0	transcript_id "g12.t1"; gene_id "g12";
Scaffold_1	AUGUSTUS	start_codon	70201	70203	.	-	0	transcript_id "g12.t1"; gene_id "g12";
# protein sequence = [MIDSGATGLFLHQKFVNKHHIYVQSLPRPIELYNIDGTANLAGRITHSARLLARVDQNQPQILEFLVTNIGSEDVILG
# LPWLRKVNPDINWRDGQIQIPAKPKVQHHVAIEEIPECKEPNVGGNTEQILEPNRPESSGLPHAVPRTEPGLETTETGTSSEMS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g12
###
# start gene g13
Scaffold_1	AUGUSTUS	gene	70378	71462	0.95	-	.	g13
Scaffold_1	AUGUSTUS	transcript	70378	71462	0.95	-	.	g13.t1
Scaffold_1	AUGUSTUS	stop_codon	70378	70380	.	-	0	transcript_id "g13.t1"; gene_id "g13";
Scaffold_1	AUGUSTUS	CDS	70378	71161	0.97	-	1	transcript_id "g13.t1"; gene_id "g13";
Scaffold_1	AUGUSTUS	CDS	71281	71462	0.97	-	0	transcript_id "g13.t1"; gene_id "g13";
Scaffold_1	AUGUSTUS	start_codon	71460	71462	.	-	0	transcript_id "g13.t1"; gene_id "g13";
# protein sequence = [MSSAQDVRDTITELTKNQAKLQDVVSELVSGLSTTKSVGKPQNYNGKRGEDARRFLAAFELSSITGSGVPFPYDTWEE
# FVTAFKTRFETTDASADAKQLLKRLYQNRTTVGTYASTFQQYADRTGYSDKDLRDRFYDHLADRVKDGLVFTTCPTGSLQELIEAAIDVDNRQITRAW
# EQGKKLVDDGILTNFRPTTVATPFTAPTRDPNAMDIDATTTRSPDAFRRFMIGRCYGCGSKEHRKADGHHERDICRHCGLNGHVEAVCRRKFLGLPGR
# KATTISATSIPDTTQSAATPDLAALLKELAANQQVLAGQIAELHKNF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g13
###
# start gene g14
Scaffold_1	AUGUSTUS	gene	84108	84872	0.24	+	.	g14
Scaffold_1	AUGUSTUS	transcript	84108	84872	0.24	+	.	g14.t1
Scaffold_1	AUGUSTUS	start_codon	84108	84110	.	+	0	transcript_id "g14.t1"; gene_id "g14";
Scaffold_1	AUGUSTUS	CDS	84108	84156	0.24	+	0	transcript_id "g14.t1"; gene_id "g14";
Scaffold_1	AUGUSTUS	CDS	84226	84872	1	+	2	transcript_id "g14.t1"; gene_id "g14";
Scaffold_1	AUGUSTUS	stop_codon	84870	84872	.	+	0	transcript_id "g14.t1"; gene_id "g14";
# protein sequence = [MSSRYDFHWKSWSKFFAGSSDLWVPSSSCTSSTCSAKSTYDSSASSTSSKESGSFSIEYGDGSTVSGPVYEDTVTVAG
# IQVSKQKFSPVTTLSSSFASDPVDGILGLAFPAISNLDADPFFVNANSQNAVDLNEFGFYLASSGSELYLGGANSDLYSGSIEYHDVDTSTGFWQISG
# ASIASDGTTAVSNFATIIDSGTTIMYGPPSAVKEFYAQVSGSKLYDSTDGLLIPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g14
###
# start gene g15
Scaffold_1	AUGUSTUS	gene	88573	89313	0.81	+	.	g15
Scaffold_1	AUGUSTUS	transcript	88573	89313	0.81	+	.	g15.t1
Scaffold_1	AUGUSTUS	start_codon	88573	88575	.	+	0	transcript_id "g15.t1"; gene_id "g15";
Scaffold_1	AUGUSTUS	CDS	88573	89313	0.81	+	0	transcript_id "g15.t1"; gene_id "g15";
Scaffold_1	AUGUSTUS	stop_codon	89311	89313	.	+	0	transcript_id "g15.t1"; gene_id "g15";
# protein sequence = [MFSPDGSLLAHATGKSCVYGKFRVVFLSVDPFFTIQKFSPWKSADNRYIASAAMSITDHSYDLSLNVVVFRVTTETMS
# PIFFRGIKVATVPEQTTMKFMVFSTDNKQLHTVTDYLDFGQEMDTWYIETGEPIKPSPQHTLPPSNLQSTKKAIFEHATGWLLNDNHFGASSAYCFIP
# YYAWNIRNIMLQLPCATAVHESSVIALVFDTNPIIVQFPKVWEVSYGFVIIMNQLMPSKRRKTYGAEAIA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g15
###
# start gene g16
Scaffold_1	AUGUSTUS	gene	98788	100155	0.51	+	.	g16
Scaffold_1	AUGUSTUS	transcript	98788	100155	0.51	+	.	g16.t1
Scaffold_1	AUGUSTUS	start_codon	98788	98790	.	+	0	transcript_id "g16.t1"; gene_id "g16";
Scaffold_1	AUGUSTUS	CDS	98788	99075	0.51	+	0	transcript_id "g16.t1"; gene_id "g16";
Scaffold_1	AUGUSTUS	CDS	99211	100155	0.97	+	0	transcript_id "g16.t1"; gene_id "g16";
Scaffold_1	AUGUSTUS	stop_codon	100153	100155	.	+	0	transcript_id "g16.t1"; gene_id "g16";
# protein sequence = [MALSTAEKLRIRSTRHAKFINELRELYVTESGLAAPSFRWDRSRDADYRCLAQAVYALSKWGPERNTALKTTGTLSQV
# EKWLDDDTSPMSGEFADQVSPMEIIGVVILIYVHSIIAPPFEKLTLSELSAAVAQMRQDVRREHKDIRLNDRVGKTVVTYVKAYRKPAPLPMTVPQAS
# RILSIGELTGHHQPKAVDTSIPAQAQIKSTSPKRKREPSLSDQHGAKRLTTKLSAPTLAPLPTSGVVPSNDYRARFSSFLSAPVPYPTPPAATSHLPH
# PSQYGAPPPYLIGTSGYQHPTKTAPQPFVHSYPSYYGHVPPPPLPPPQSQPPVPTPFRSEPSPSLSTSSSEPRDELRLVYPPIAVKAEPSPSPSPATM
# PLDALRHLQELNKMFDRRPPSAHQGGPWQSYQPYSDSK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g16
###
# start gene g17
Scaffold_1	AUGUSTUS	gene	129238	129668	0.43	-	.	g17
Scaffold_1	AUGUSTUS	transcript	129238	129668	0.43	-	.	g17.t1
Scaffold_1	AUGUSTUS	stop_codon	129238	129240	.	-	0	transcript_id "g17.t1"; gene_id "g17";
Scaffold_1	AUGUSTUS	CDS	129238	129353	0.48	-	2	transcript_id "g17.t1"; gene_id "g17";
Scaffold_1	AUGUSTUS	CDS	129425	129668	0.5	-	0	transcript_id "g17.t1"; gene_id "g17";
Scaffold_1	AUGUSTUS	start_codon	129666	129668	.	-	0	transcript_id "g17.t1"; gene_id "g17";
# protein sequence = [MFLTTSWSFTLFFSLMLSSNAYSIPIQRQQSRSTLIHPSAKHSVHLFHGTFESSLANSILKVGFDVNKAGKPEGGDFH
# RSPVHAGYMTDSIYAAAQFVCHAPDQDDGSMQTSAYVVGKQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g17
###
# start gene g18
Scaffold_1	AUGUSTUS	gene	133259	134425	0.91	+	.	g18
Scaffold_1	AUGUSTUS	transcript	133259	134425	0.91	+	.	g18.t1
Scaffold_1	AUGUSTUS	start_codon	133259	133261	.	+	0	transcript_id "g18.t1"; gene_id "g18";
Scaffold_1	AUGUSTUS	CDS	133259	134425	0.91	+	0	transcript_id "g18.t1"; gene_id "g18";
Scaffold_1	AUGUSTUS	stop_codon	134423	134425	.	+	0	transcript_id "g18.t1"; gene_id "g18";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g18
###
# start gene g19
Scaffold_1	AUGUSTUS	gene	134476	135549	0.55	+	.	g19
Scaffold_1	AUGUSTUS	transcript	134476	135549	0.55	+	.	g19.t1
Scaffold_1	AUGUSTUS	start_codon	134476	134478	.	+	0	transcript_id "g19.t1"; gene_id "g19";
Scaffold_1	AUGUSTUS	CDS	134476	135549	0.55	+	0	transcript_id "g19.t1"; gene_id "g19";
Scaffold_1	AUGUSTUS	stop_codon	135547	135549	.	+	0	transcript_id "g19.t1"; gene_id "g19";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE
# LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS
# ESASERLPAHQPWDHAIDLVPGAPATMCTKIYPMSLTSRRSWIVSRRKPMERLYRPLKSPISSPVFFVRRRMGNSVSYKTTGN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g19
###
# start gene g20
Scaffold_1	AUGUSTUS	gene	139361	140752	0.95	+	.	g20
Scaffold_1	AUGUSTUS	transcript	139361	140752	0.95	+	.	g20.t1
Scaffold_1	AUGUSTUS	start_codon	139361	139363	.	+	0	transcript_id "g20.t1"; gene_id "g20";
Scaffold_1	AUGUSTUS	CDS	139361	140752	0.95	+	0	transcript_id "g20.t1"; gene_id "g20";
Scaffold_1	AUGUSTUS	stop_codon	140750	140752	.	+	0	transcript_id "g20.t1"; gene_id "g20";
# protein sequence = [MNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGVVRMDPV
# KVAAVRDWPVPTNLRELRGFLGFANFYRCFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALWAPDRTRIEVDASGFATGGALM
# QQQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQAPFELTYGYLPLFNIPVGQRSGI
# PAVDDRIRILREARQDAGAALHLGKKQQKEGYKRGKRKAHQFKVGDLVWLGAEDINLQLSSEKIGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVF
# HVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g20
###
# start gene g21
Scaffold_1	AUGUSTUS	gene	146099	146530	0.6	-	.	g21
Scaffold_1	AUGUSTUS	transcript	146099	146530	0.6	-	.	g21.t1
Scaffold_1	AUGUSTUS	stop_codon	146099	146101	.	-	0	transcript_id "g21.t1"; gene_id "g21";
Scaffold_1	AUGUSTUS	CDS	146099	146530	0.6	-	0	transcript_id "g21.t1"; gene_id "g21";
Scaffold_1	AUGUSTUS	start_codon	146528	146530	.	-	0	transcript_id "g21.t1"; gene_id "g21";
# protein sequence = [MDTSESQVGTGSAADASSYMVEPNAHLTRGLKTLLVTFLPHSAYPPYGKMTEATEREQEQINEQLKMFFTSPAVVNKL
# GNVELTFVEGQKSWVCTTVFHYVQWKISNTDGLTRNGALWLLKDYSQWESGQININSELLHIKNE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g21
###
# start gene g22
Scaffold_1	AUGUSTUS	gene	148783	149130	0.46	-	.	g22
Scaffold_1	AUGUSTUS	transcript	148783	149130	0.46	-	.	g22.t1
Scaffold_1	AUGUSTUS	stop_codon	148783	148785	.	-	0	transcript_id "g22.t1"; gene_id "g22";
Scaffold_1	AUGUSTUS	CDS	148783	149130	0.46	-	0	transcript_id "g22.t1"; gene_id "g22";
Scaffold_1	AUGUSTUS	start_codon	149128	149130	.	-	0	transcript_id "g22.t1"; gene_id "g22";
# protein sequence = [MEVVKAALGVVQATVGGNPLIGDDTLLGDDDGQILFDITGDPNSKECIHGVMWAHESKIRSFKIARRYSLPIQYLAPD
# VKVSYPLFTSAVLIISAQPFEMFRTWPMPENMPQSSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g22
###
# start gene g23
Scaffold_1	AUGUSTUS	gene	150135	151046	0.28	-	.	g23
Scaffold_1	AUGUSTUS	transcript	150135	151046	0.28	-	.	g23.t1
Scaffold_1	AUGUSTUS	stop_codon	150135	150137	.	-	0	transcript_id "g23.t1"; gene_id "g23";
Scaffold_1	AUGUSTUS	CDS	150135	151046	0.28	-	0	transcript_id "g23.t1"; gene_id "g23";
Scaffold_1	AUGUSTUS	start_codon	151044	151046	.	-	0	transcript_id "g23.t1"; gene_id "g23";
# protein sequence = [MYFSPPSRVVQTTNNFVIAMLYLIFTFALVPSILAAAVPSPATLDLVSIFRSVYRLCSFGVMKHIQQRRISLRSTDPV
# NDFRRAKLDPRGGAQSSVQTYEMIQMSDVSATETAKLMQRAVAIIHFPNPTRPSKKYYSKKAQKRAIEGTSKLLEAAMTELGIKLPDSELRKAMLVYG
# FIGKPDPTMAQYDFKVEFLMSVGKGEDNKGEWMDCKGRVGYIYHEGEMKVTGSILNPEGKRIVRLRKGKIFHKVMSFYLIFLSQRWVRTLSTTFFVFQ
# SLPQDLGTESHNPAEMGGKVTGVHWADNP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g23
###
# start gene g24
Scaffold_1	AUGUSTUS	gene	156039	157475	0.37	+	.	g24
Scaffold_1	AUGUSTUS	transcript	156039	157475	0.37	+	.	g24.t1
Scaffold_1	AUGUSTUS	start_codon	156039	156041	.	+	0	transcript_id "g24.t1"; gene_id "g24";
Scaffold_1	AUGUSTUS	CDS	156039	156137	0.85	+	0	transcript_id "g24.t1"; gene_id "g24";
Scaffold_1	AUGUSTUS	CDS	156199	156329	0.66	+	0	transcript_id "g24.t1"; gene_id "g24";
Scaffold_1	AUGUSTUS	CDS	157313	157475	0.37	+	1	transcript_id "g24.t1"; gene_id "g24";
Scaffold_1	AUGUSTUS	stop_codon	157473	157475	.	+	0	transcript_id "g24.t1"; gene_id "g24";
# protein sequence = [MLHKTNVLLDTSLNTQLESALKNKLQHGPATQEVEILSWMGRTALELIGQAGLGYSFDPLTDEDSAHPYSQISKELFT
# RRDTMIPLLKPIIGLDGTEIHEVAAPNDTRVIVSIYNSNRNPDLWGEGKGLY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g24
###
# start gene g25
Scaffold_1	AUGUSTUS	gene	158614	159186	0.86	-	.	g25
Scaffold_1	AUGUSTUS	transcript	158614	159186	0.86	-	.	g25.t1
Scaffold_1	AUGUSTUS	stop_codon	158614	158616	.	-	0	transcript_id "g25.t1"; gene_id "g25";
Scaffold_1	AUGUSTUS	CDS	158614	159186	0.86	-	0	transcript_id "g25.t1"; gene_id "g25";
Scaffold_1	AUGUSTUS	start_codon	159184	159186	.	-	0	transcript_id "g25.t1"; gene_id "g25";
# protein sequence = [MTKTDIMNAIKAQKIDIVFQYPEKNRPPIVSLSLQANVQKGSLLLVKAAMEALGIDIKPSFSINYSGFVSKPRSIEDR
# FKVWFLKKEDGGGGMDKLIEFTGFLKMRLKDKNVEKKEVGEKEVKEADKLVFYGKVIDSKGEPIVTLNHKGKIVPKVCLTLFFSLAYIGFSFHNTDHT
# VVLSSPVETPWPIE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g25
###
# start gene g26
Scaffold_1	AUGUSTUS	gene	161724	162074	0.5	+	.	g26
Scaffold_1	AUGUSTUS	transcript	161724	162074	0.5	+	.	g26.t1
Scaffold_1	AUGUSTUS	start_codon	161724	161726	.	+	0	transcript_id "g26.t1"; gene_id "g26";
Scaffold_1	AUGUSTUS	CDS	161724	162074	0.5	+	0	transcript_id "g26.t1"; gene_id "g26";
Scaffold_1	AUGUSTUS	stop_codon	162072	162074	.	+	0	transcript_id "g26.t1"; gene_id "g26";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLLSMRKIPLSEEIGRRF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g26
###
# start gene g27
Scaffold_1	AUGUSTUS	gene	162940	164370	0.91	+	.	g27
Scaffold_1	AUGUSTUS	transcript	162940	164370	0.91	+	.	g27.t1
Scaffold_1	AUGUSTUS	start_codon	162940	162942	.	+	0	transcript_id "g27.t1"; gene_id "g27";
Scaffold_1	AUGUSTUS	CDS	162940	164370	0.91	+	0	transcript_id "g27.t1"; gene_id "g27";
Scaffold_1	AUGUSTUS	stop_codon	164368	164370	.	+	0	transcript_id "g27.t1"; gene_id "g27";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETRSELPEL
# EPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSE
# SASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLV
# ADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMV
# REVLTG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g27
###
# start gene g28
Scaffold_1	AUGUSTUS	gene	172504	172851	0.73	-	.	g28
Scaffold_1	AUGUSTUS	transcript	172504	172851	0.73	-	.	g28.t1
Scaffold_1	AUGUSTUS	stop_codon	172504	172506	.	-	0	transcript_id "g28.t1"; gene_id "g28";
Scaffold_1	AUGUSTUS	CDS	172504	172851	0.73	-	0	transcript_id "g28.t1"; gene_id "g28";
Scaffold_1	AUGUSTUS	start_codon	172849	172851	.	-	0	transcript_id "g28.t1"; gene_id "g28";
# protein sequence = [MQNQTSLTNPDVHRGPTGTNRHLFGLNPKGYFMNFGMWTPFGRWFSKYPDRQFIFENADFDGDYEQRFPSDAMYEELG
# PNARVWKTYLAETNSLDENMIGEARDGLDSMLVFVCG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g28
###
# start gene g29
Scaffold_1	AUGUSTUS	gene	174834	175524	0.99	-	.	g29
Scaffold_1	AUGUSTUS	transcript	174834	175524	0.99	-	.	g29.t1
Scaffold_1	AUGUSTUS	stop_codon	174834	174836	.	-	0	transcript_id "g29.t1"; gene_id "g29";
Scaffold_1	AUGUSTUS	CDS	174834	174979	0.99	-	2	transcript_id "g29.t1"; gene_id "g29";
Scaffold_1	AUGUSTUS	CDS	175054	175333	1	-	0	transcript_id "g29.t1"; gene_id "g29";
Scaffold_1	AUGUSTUS	CDS	175402	175524	1	-	0	transcript_id "g29.t1"; gene_id "g29";
Scaffold_1	AUGUSTUS	start_codon	175522	175524	.	-	0	transcript_id "g29.t1"; gene_id "g29";
# protein sequence = [MSSIHLYPTVGGLDPILNNTYKDSKARSNTLYVHQLPLRVLAEYCDDGADQDRILTDSDRTSINLDEAPVVADKQSLS
# TTENVEETVVEVEEDRMIEVGKIGWALFKSSMITFGKGPEQKADRYFQKESWVFGEGPDGKEYKWVLGFYTPEVSKTNRVVFESISHEMIIIDSSSST
# TGPTPP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g29
###
# start gene g30
Scaffold_1	AUGUSTUS	gene	181982	182890	0.82	-	.	g30
Scaffold_1	AUGUSTUS	transcript	181982	182890	0.82	-	.	g30.t1
Scaffold_1	AUGUSTUS	stop_codon	181982	181984	.	-	0	transcript_id "g30.t1"; gene_id "g30";
Scaffold_1	AUGUSTUS	CDS	181982	182890	0.82	-	0	transcript_id "g30.t1"; gene_id "g30";
Scaffold_1	AUGUSTUS	start_codon	182888	182890	.	-	0	transcript_id "g30.t1"; gene_id "g30";
# protein sequence = [MRGGKQWSIDHEADEPPPLALISQTPYSFVATLGELWVPQTYKQAMKWSDLWFAPMKREYDTLLEKDCWELVPLPTDV
# NLTGSRWTYAIKFDAKGNLLKCKARYVAQGYTQIQGQDYDKTYGRVARMESVRLVLAIIAVLCLSIFQVDFTAAFLNSPITHDVYLKQPNGFVKPGSE
# HLVCKLKKSIYGTMQGSHNWQETLTADYAEDGFIASRADPCIHYQRTGQEYTITSTYGDDVCGGLTTKTGRDRAVADLGKQWEANEVTTEVLLGMTIT
# QDPDTKVITITQKTYFQRMLSNFGLQNA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g30
###
# start gene g31
Scaffold_1	AUGUSTUS	gene	195676	196935	0.6	-	.	g31
Scaffold_1	AUGUSTUS	transcript	195676	196935	0.6	-	.	g31.t1
Scaffold_1	AUGUSTUS	stop_codon	195676	195678	.	-	0	transcript_id "g31.t1"; gene_id "g31";
Scaffold_1	AUGUSTUS	CDS	195676	196935	0.6	-	0	transcript_id "g31.t1"; gene_id "g31";
Scaffold_1	AUGUSTUS	start_codon	196933	196935	.	-	0	transcript_id "g31.t1"; gene_id "g31";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE
# LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS
# ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL
# VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFRNNPRLVRA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g31
###
# start gene g32
Scaffold_1	AUGUSTUS	gene	196986	197978	0.54	-	.	g32
Scaffold_1	AUGUSTUS	transcript	196986	197978	0.54	-	.	g32.t1
Scaffold_1	AUGUSTUS	stop_codon	196986	196988	.	-	0	transcript_id "g32.t1"; gene_id "g32";
Scaffold_1	AUGUSTUS	CDS	196986	197978	0.54	-	0	transcript_id "g32.t1"; gene_id "g32";
Scaffold_1	AUGUSTUS	start_codon	197976	197978	.	-	0	transcript_id "g32.t1"; gene_id "g32";
# protein sequence = [MAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSE
# IKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTP
# ADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPN
# ESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g32
###
# start gene g33
Scaffold_1	AUGUSTUS	gene	199711	200250	0.91	-	.	g33
Scaffold_1	AUGUSTUS	transcript	199711	200250	0.91	-	.	g33.t1
Scaffold_1	AUGUSTUS	stop_codon	199711	199713	.	-	0	transcript_id "g33.t1"; gene_id "g33";
Scaffold_1	AUGUSTUS	CDS	199711	200250	0.91	-	0	transcript_id "g33.t1"; gene_id "g33";
Scaffold_1	AUGUSTUS	start_codon	200248	200250	.	-	0	transcript_id "g33.t1"; gene_id "g33";
# protein sequence = [MHDNIRDPRNKVTKDNEQIDIAISYMQGPKVSSWVQNYTDDNFNDDKEEWRVTWKGFKDALNASFLDEGLTENAQEKL
# EHLHQGPNERAEDFFKEFEVIMRDAGYAKDAPYVIRLIEMNVKPKLIDQVYGTSNEQIKKFDELKQKIISINNMWWRCREMRRNWSSRYQRDAGQGPS
# NQR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g33
###
# start gene g34
Scaffold_1	AUGUSTUS	gene	206434	206904	0.76	-	.	g34
Scaffold_1	AUGUSTUS	transcript	206434	206904	0.76	-	.	g34.t1
Scaffold_1	AUGUSTUS	stop_codon	206434	206436	.	-	0	transcript_id "g34.t1"; gene_id "g34";
Scaffold_1	AUGUSTUS	CDS	206434	206904	0.76	-	0	transcript_id "g34.t1"; gene_id "g34";
Scaffold_1	AUGUSTUS	start_codon	206902	206904	.	-	0	transcript_id "g34.t1"; gene_id "g34";
# protein sequence = [MLSLLTPMPWILMPPTPVMGILGKHSWPACRDDVLAVVLKVMSSKTAHTEKLPAAIVDVEDIWKQSAKTSSWDSDETE
# ADASNLDANRYPLRDPRHSPYSQMNPSRSVLDPNICCTVPATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g34
###
# start gene g35
Scaffold_1	AUGUSTUS	gene	207163	207600	0.97	-	.	g35
Scaffold_1	AUGUSTUS	transcript	207163	207600	0.97	-	.	g35.t1
Scaffold_1	AUGUSTUS	stop_codon	207163	207165	.	-	0	transcript_id "g35.t1"; gene_id "g35";
Scaffold_1	AUGUSTUS	CDS	207163	207600	0.97	-	0	transcript_id "g35.t1"; gene_id "g35";
Scaffold_1	AUGUSTUS	start_codon	207598	207600	.	-	0	transcript_id "g35.t1"; gene_id "g35";
# protein sequence = [MSTPIPPATPAPPAPPASAEDLMTLLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSNEARCFRAQFQNWASEQPDL
# SNSQAKLIKSALGFFTEGAGDWATPHLLNFNAENPPFEGDWQKFLTEFSQRFELIDPGMEARNDPIP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g35
###
# start gene g36
Scaffold_1	AUGUSTUS	gene	209442	209807	0.63	-	.	g36
Scaffold_1	AUGUSTUS	transcript	209442	209807	0.63	-	.	g36.t1
Scaffold_1	AUGUSTUS	stop_codon	209442	209444	.	-	0	transcript_id "g36.t1"; gene_id "g36";
Scaffold_1	AUGUSTUS	CDS	209442	209807	0.63	-	0	transcript_id "g36.t1"; gene_id "g36";
Scaffold_1	AUGUSTUS	start_codon	209805	209807	.	-	0	transcript_id "g36.t1"; gene_id "g36";
# protein sequence = [MLPGDFKPTSTSSSKDLWMVRNLTKQEYAIPTRPQSLTQIVYSLIGCSDDPSVSMQGERCSVLIDGPWAGDRIDITLV
# SMHRQEHAPEEESNWKDVTISVKELLEALAAEDDDYSVGDFKF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g36
###
# start gene g37
Scaffold_1	AUGUSTUS	gene	213618	214801	0.8	-	.	g37
Scaffold_1	AUGUSTUS	transcript	213618	214801	0.8	-	.	g37.t1
Scaffold_1	AUGUSTUS	stop_codon	213618	213620	.	-	0	transcript_id "g37.t1"; gene_id "g37";
Scaffold_1	AUGUSTUS	CDS	213618	214154	0.8	-	0	transcript_id "g37.t1"; gene_id "g37";
Scaffold_1	AUGUSTUS	CDS	214211	214801	0.83	-	0	transcript_id "g37.t1"; gene_id "g37";
Scaffold_1	AUGUSTUS	start_codon	214799	214801	.	-	0	transcript_id "g37.t1"; gene_id "g37";
# protein sequence = [MENANELCFFLNSARFRVWIENPVQQHRAPPPAALMSVVLLWGVHLSQDSTLRQLEEDLFARVLRETAGISSAHRPDN
# FLYNLQTEFLLARYLFSTGKIIEGRYHVSCALSIGVGSGINKIRSNQPPPPRYAAISLLPPVSDMIEEGERIRCCWSGFMLDKSWAAALQTSSDMLCP
# AEIPGAQTDTPWPQDEEVYEQGGNFLPEGYSFTTLNFIRGTPTSDLGDSIEARLAKAVFCWERACNLTKDTWTLCKPSRSICPLAQPLKAASEEYIEY
# LISYDQRRQCIARFISTLSYTEDIEGLIPSKALKRLKAHSMAHAANIEILRILPSFEQNEDSQPQARSMVSSAEEIMKLLASPLLHTLQYIDSVMGVR
# FVP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g37
###
# start gene g38
Scaffold_1	AUGUSTUS	gene	217616	217975	0.95	-	.	g38
Scaffold_1	AUGUSTUS	transcript	217616	217975	0.95	-	.	g38.t1
Scaffold_1	AUGUSTUS	stop_codon	217616	217618	.	-	0	transcript_id "g38.t1"; gene_id "g38";
Scaffold_1	AUGUSTUS	CDS	217616	217975	0.95	-	0	transcript_id "g38.t1"; gene_id "g38";
Scaffold_1	AUGUSTUS	start_codon	217973	217975	.	-	0	transcript_id "g38.t1"; gene_id "g38";
# protein sequence = [MSATLLEPLKSLIDIISTQTAVLQSAYSKNNTEAPSLNTTFQPSLLEIDPIVLAARHLIVAAATQLIATVQSPVEFLQ
# SHAGRIYDTVTLGFVIDVNIPEILKEAGTQVAFISRCFSLF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g38
###
# start gene g39
Scaffold_1	AUGUSTUS	gene	236066	237404	0.29	+	.	g39
Scaffold_1	AUGUSTUS	transcript	236066	237404	0.29	+	.	g39.t1
Scaffold_1	AUGUSTUS	start_codon	236066	236068	.	+	0	transcript_id "g39.t1"; gene_id "g39";
Scaffold_1	AUGUSTUS	CDS	236066	236918	0.29	+	0	transcript_id "g39.t1"; gene_id "g39";
Scaffold_1	AUGUSTUS	CDS	237001	237404	0.99	+	2	transcript_id "g39.t1"; gene_id "g39";
Scaffold_1	AUGUSTUS	stop_codon	237402	237404	.	+	0	transcript_id "g39.t1"; gene_id "g39";
# protein sequence = [MAETLLAILLVNSSAKGSTLVYHWPPDPVVPPRLRRALPMDLTASQSISQSHIQQEDIDPSYRWERTNSSNRDRSLSY
# THSPSSGRTTPAQNDIDELEDREVRNKDKYENVFGYASEFLASILCPSTSMCHQKFQLTVDDLAFIGHPVCADWDGVWRFNSGRAKTTSSSRGGNSRD
# RGGAESGSPSPANRSLSLDKKNSGQEMSNSAGPSTKCTWLHTFNFVLVLDLPDPSSSASGNLSKYFDILYDQIGFIVAAVLFQEQVLSNFVEQECDLL
# GSLKDDCIRKSISSVASAMKTLYDAIKSSSVAYLSIHDLPLELQLPPHLDDLLHNEEDSELDTSHLDTNANYSEAEEFWGTEMSFGWQLPALAPWKSL
# LLLDEIDSEQGQEAFANLRSPYITPEDRPVVEGLMRFLDTVNVTLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g39
###
# start gene g40
Scaffold_1	AUGUSTUS	gene	237934	238731	1	+	.	g40
Scaffold_1	AUGUSTUS	transcript	237934	238731	1	+	.	g40.t1
Scaffold_1	AUGUSTUS	start_codon	237934	237936	.	+	0	transcript_id "g40.t1"; gene_id "g40";
Scaffold_1	AUGUSTUS	CDS	237934	238731	1	+	0	transcript_id "g40.t1"; gene_id "g40";
Scaffold_1	AUGUSTUS	stop_codon	238729	238731	.	+	0	transcript_id "g40.t1"; gene_id "g40";
# protein sequence = [MLKHDLIIVLHLRIRVVATPEVKSLVKAQKGNANARKVQRLDRKKKRKEKTDSDGNNERIIERGRERKRSTPALTTLN
# SSSFTTAESGLGLEIGASPISTPEQNQYDNDNKKAFAWLSMSPKSARKHSQNSQPTRAVSATRSTSTRVPSSDSVHSNHSGQSKLSELILDETDEDEG
# CGRDEGPDASDGDGRRMSQDIEEEGEDDDEADDENEEETEVDAETDTGSHNVDVPSMIKDPGRATSLQRRWLNAMSLGKDQILTRRFEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g40
###
# start gene g41
Scaffold_1	AUGUSTUS	gene	261892	262371	0.29	+	.	g41
Scaffold_1	AUGUSTUS	transcript	261892	262371	0.29	+	.	g41.t1
Scaffold_1	AUGUSTUS	start_codon	261892	261894	.	+	0	transcript_id "g41.t1"; gene_id "g41";
Scaffold_1	AUGUSTUS	CDS	261892	262371	0.29	+	0	transcript_id "g41.t1"; gene_id "g41";
Scaffold_1	AUGUSTUS	stop_codon	262369	262371	.	+	0	transcript_id "g41.t1"; gene_id "g41";
# protein sequence = [MYQSRYSKLGIPSSSYSSGTLFEEGSSSSISQRATELSGPSSQGVSLFPSNSSWPSQEFLSESQPLGLFCSDLSAEPS
# QAYHEPNELPQNYPTQMIPDVLHPPLPQATSQSNLLSPLTELTHQVPMGSNNDISVLPSFEMDHLVCFPEADLRILDSLDF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g41
###
# start gene g42
Scaffold_1	AUGUSTUS	gene	263321	264410	0.78	-	.	g42
Scaffold_1	AUGUSTUS	transcript	263321	264410	0.78	-	.	g42.t1
Scaffold_1	AUGUSTUS	stop_codon	263321	263323	.	-	0	transcript_id "g42.t1"; gene_id "g42";
Scaffold_1	AUGUSTUS	CDS	263321	264314	0.92	-	1	transcript_id "g42.t1"; gene_id "g42";
Scaffold_1	AUGUSTUS	CDS	264388	264410	0.78	-	0	transcript_id "g42.t1"; gene_id "g42";
Scaffold_1	AUGUSTUS	start_codon	264408	264410	.	-	0	transcript_id "g42.t1"; gene_id "g42";
# protein sequence = [MNRFPTRECGEANMYFEGIRCQVTPGSDPKPLGTPKAPVWCEDDTSACVTGPKQMLFWHQASGNNIEVDGLDLAGEFK
# SPGYNAKCGFSNGEIDRFNYALCRTHFCNLGAQNDIFDDSGTVSSSPSSSTSSSSTSAAATTSASTSAVAAAAITSAAGAVAVNIANPSSASDDSASS
# STDSSTTATDSSTSSTDALTTATDSLTSYTDASTSATDSWTSSSDTWTSSSDTWTSSSDTWTSSSDTWTSSSDTWTSSSDTWTSSSTESWTSTSDATL
# STTSDSSTYVATSTDVAAAAAVTTSTSSDGRRCKRREPRVGRRDLNHRAASVHRRNAYKHHDLH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g42
###
# start gene g43
Scaffold_1	AUGUSTUS	gene	270441	270896	0.8	-	.	g43
Scaffold_1	AUGUSTUS	transcript	270441	270896	0.8	-	.	g43.t1
Scaffold_1	AUGUSTUS	stop_codon	270441	270443	.	-	0	transcript_id "g43.t1"; gene_id "g43";
Scaffold_1	AUGUSTUS	CDS	270441	270896	0.8	-	0	transcript_id "g43.t1"; gene_id "g43";
Scaffold_1	AUGUSTUS	start_codon	270894	270896	.	-	0	transcript_id "g43.t1"; gene_id "g43";
# protein sequence = [MESLGATIVDPANLPSADEIKGLDHLVLYVDFKIELNEYLSALKEVPTGVRTLADLIQFNIDHAELELPEGYSDQGEL
# IKSQATNGRDEIYGKALAKNLELGATRGIDAVLKEYNLDALVLPAKDTHTPAAIAGYPTVTGMSQPLEFCFAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g43
###
# start gene g44
Scaffold_1	AUGUSTUS	gene	273124	273498	0.74	+	.	g44
Scaffold_1	AUGUSTUS	transcript	273124	273498	0.74	+	.	g44.t1
Scaffold_1	AUGUSTUS	start_codon	273124	273126	.	+	0	transcript_id "g44.t1"; gene_id "g44";
Scaffold_1	AUGUSTUS	CDS	273124	273498	0.74	+	0	transcript_id "g44.t1"; gene_id "g44";
Scaffold_1	AUGUSTUS	stop_codon	273496	273498	.	+	0	transcript_id "g44.t1"; gene_id "g44";
# protein sequence = [MSSTVTVPTTARAAVIATIKEDLVIKEVNVIQPSELAAGECLVKVEYAGKFNGSSTIFTTDKLSGCCHSDVHVKNNDW
# GRTQTPVIGGHEGVGHVVAIGANTVGSPVKVGDRVGMKWFANACLK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g44
###
# start gene g45
Scaffold_1	AUGUSTUS	gene	275315	275641	0.57	-	.	g45
Scaffold_1	AUGUSTUS	transcript	275315	275641	0.57	-	.	g45.t1
Scaffold_1	AUGUSTUS	stop_codon	275315	275317	.	-	0	transcript_id "g45.t1"; gene_id "g45";
Scaffold_1	AUGUSTUS	CDS	275315	275641	0.57	-	0	transcript_id "g45.t1"; gene_id "g45";
Scaffold_1	AUGUSTUS	start_codon	275639	275641	.	-	0	transcript_id "g45.t1"; gene_id "g45";
# protein sequence = [MEEYATTHESVQYVVEWHNRAKRKAKIKRFNKSNDDLSSEDLPVHNKTIGTISRPKKPTEKRTSPAMKRSRFSAAVFD
# PARIARMINATKRTTDQTRQVMVFNEKMEK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g45
###
# start gene g46
Scaffold_1	AUGUSTUS	gene	286503	286904	0.62	+	.	g46
Scaffold_1	AUGUSTUS	transcript	286503	286904	0.62	+	.	g46.t1
Scaffold_1	AUGUSTUS	start_codon	286503	286505	.	+	0	transcript_id "g46.t1"; gene_id "g46";
Scaffold_1	AUGUSTUS	CDS	286503	286904	0.62	+	0	transcript_id "g46.t1"; gene_id "g46";
Scaffold_1	AUGUSTUS	stop_codon	286902	286904	.	+	0	transcript_id "g46.t1"; gene_id "g46";
# protein sequence = [MTSIVRSTNDAVQAYPISSSCGAFSPELDAKMERQGSDFGETLNIHEEYTFPLPAQSRDDFPPRIVQSSALKTVPPTF
# TNPFDGNKKIEFRETCPGEVIYSTERAWTQRNYFGSDDDEVYIPLKRGMRSKFST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g46
###
# start gene g47
Scaffold_1	AUGUSTUS	gene	295543	296403	1	+	.	g47
Scaffold_1	AUGUSTUS	transcript	295543	296403	1	+	.	g47.t1
Scaffold_1	AUGUSTUS	start_codon	295543	295545	.	+	0	transcript_id "g47.t1"; gene_id "g47";
Scaffold_1	AUGUSTUS	CDS	295543	296403	1	+	0	transcript_id "g47.t1"; gene_id "g47";
Scaffold_1	AUGUSTUS	stop_codon	296401	296403	.	+	0	transcript_id "g47.t1"; gene_id "g47";
# protein sequence = [MPVEPASTSGISFATNLTPITFNDPDTGSVIAGDAPESELFPFANDPSSPRRPAHTKKKAENHIPRPPNAFILFRSSF
# IKSQHVSTEVETNHSTLSKIIGLTWQNLPEDERQVWHSKAKAALDDHRRKFPQYAFRPLHTKAKGGTEKRKVREVGPKDMKRCAKIAELLVEGKKGHE
# LDAAIQEFDKYHVPEMVTRFEAPITERTFQCSSESTVKTEDSDAIGPIPSRPSRSTSRSPQMQSPSVDGDAQYTQSRSASPGPPPLVDRDQVEQYLSQ
# LASSGFPPPLSG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g47
###
# start gene g48
Scaffold_1	AUGUSTUS	gene	307451	307975	0.54	+	.	g48
Scaffold_1	AUGUSTUS	transcript	307451	307975	0.54	+	.	g48.t1
Scaffold_1	AUGUSTUS	start_codon	307451	307453	.	+	0	transcript_id "g48.t1"; gene_id "g48";
Scaffold_1	AUGUSTUS	CDS	307451	307975	0.54	+	0	transcript_id "g48.t1"; gene_id "g48";
Scaffold_1	AUGUSTUS	stop_codon	307973	307975	.	+	0	transcript_id "g48.t1"; gene_id "g48";
# protein sequence = [MDMMRGVTGVVRESLERADAWVERLKTIGVQRGDGSSNPQADSDRPTSSSSSSPMEMDRGRTNHDLASMPYVYRDSED
# SALLSPLSLAGRSRRGSFGSSTGFDQRGGSLPTTPGLTSYPSGPYVPSPFLHNGLSMDASGPEVGLGLRRMSIRGDEGDMVDVKKEEQEVEMDLDG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g48
###
# start gene g49
Scaffold_1	AUGUSTUS	gene	309932	310540	0.78	+	.	g49
Scaffold_1	AUGUSTUS	transcript	309932	310540	0.78	+	.	g49.t1
Scaffold_1	AUGUSTUS	start_codon	309932	309934	.	+	0	transcript_id "g49.t1"; gene_id "g49";
Scaffold_1	AUGUSTUS	CDS	309932	310540	0.78	+	0	transcript_id "g49.t1"; gene_id "g49";
Scaffold_1	AUGUSTUS	stop_codon	310538	310540	.	+	0	transcript_id "g49.t1"; gene_id "g49";
# protein sequence = [MVPRTITSFEDRGVPSPPPHAYYPGHPSFPLSSAHPYSSSAYASASYSSGSPRNDRRASSTSSSPPASFLSSEWIDRP
# IGTEDRVERAQLNRNSARLEYDISVERIDQLPLEKSGHGAKGGKGSKEGKEQLRVAVQEVVELETEYEVDLLPEEHPQQLPLWRKWLAVVVVSCCSFC
# VTGSSSMVRLPCILYFLCQTHRILLQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g49
###
# start gene g50
Scaffold_1	AUGUSTUS	gene	314076	314528	0.83	+	.	g50
Scaffold_1	AUGUSTUS	transcript	314076	314528	0.83	+	.	g50.t1
Scaffold_1	AUGUSTUS	start_codon	314076	314078	.	+	0	transcript_id "g50.t1"; gene_id "g50";
Scaffold_1	AUGUSTUS	CDS	314076	314528	0.83	+	0	transcript_id "g50.t1"; gene_id "g50";
Scaffold_1	AUGUSTUS	stop_codon	314526	314528	.	+	0	transcript_id "g50.t1"; gene_id "g50";
# protein sequence = [MGRSLIDTNSFLHTSDDEHAVSLPDATIGDIFGDRNNVATTPVSPPPPMPRRRTIDHNFIYVAQIDWKVFRSSKIRFG
# TGQRSGLEIPVKDLFRKEGWGFWGRHRVFTGEDGQEYRWNLWEDSSPGTYIRLAVALFSDPRFKFGTPVSPK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g50
###
# start gene g51
Scaffold_1	AUGUSTUS	gene	323367	325185	0.63	-	.	g51
Scaffold_1	AUGUSTUS	transcript	323367	325185	0.63	-	.	g51.t1
Scaffold_1	AUGUSTUS	stop_codon	323367	323369	.	-	0	transcript_id "g51.t1"; gene_id "g51";
Scaffold_1	AUGUSTUS	CDS	323367	324469	0.69	-	2	transcript_id "g51.t1"; gene_id "g51";
Scaffold_1	AUGUSTUS	CDS	324519	325185	0.69	-	0	transcript_id "g51.t1"; gene_id "g51";
Scaffold_1	AUGUSTUS	start_codon	325183	325185	.	-	0	transcript_id "g51.t1"; gene_id "g51";
# protein sequence = [MARCRRDGSDEQPCRCQECLKHNPEGLLVSSSTLNAHRHRERLRAAFSGVENPESNRTDEKNNSESISSGSAQPGPMP
# HIPSPPPLSVEMEENENWLRSIVSEKDIRLETLYDSETHLEFINHPSPNLSFVSPDPETLLHVNSGDFSLKTTSTRNMRFLETEARLCGLLKQIQALP
# PAVRSIGELDVENELYTALDKIHRFKGRQWKLQAYPNGIGGMTVNNTRHFTAHKPNPDIAPIFIAALIIYIKFQTPVRQMRVILALLRCIIRALKRNL
# VDSHLSSQIPMDVHTIVDCYDIDPTLHAFVACPTCYALYPLTDEALKNAESVFQADQPLPVCDERSHPDSAPCGTTLWRTRRIDHRMFVTPIRKQIFQ
# DLKEWIGRIVATPGIEDAMDQHQQSSPPADGDPERDFVDSTTFRQFKGADGEPYAIPQVGPSGSPDLRLVTSLGFDAFNPFHSKTAHAIVQSTALYMV
# ILSLPEHLRYRPENMYLLTVMTGKPSQHHINFTLRKLVKQLLPFWEGLFYVRTARYLLGRRVFIVLIPAVCDTEGAHQLSGFASHSHTYFCRRCLLQI
# GDIHNLVPETWIMRDPLSIES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g51
###
# start gene g52
Scaffold_1	AUGUSTUS	gene	328740	330506	0.16	-	.	g52
Scaffold_1	AUGUSTUS	transcript	328740	330506	0.16	-	.	g52.t1
Scaffold_1	AUGUSTUS	stop_codon	328740	328742	.	-	0	transcript_id "g52.t1"; gene_id "g52";
Scaffold_1	AUGUSTUS	CDS	328740	328888	0.57	-	2	transcript_id "g52.t1"; gene_id "g52";
Scaffold_1	AUGUSTUS	CDS	328977	329279	0.49	-	2	transcript_id "g52.t1"; gene_id "g52";
Scaffold_1	AUGUSTUS	CDS	329408	329815	0.42	-	2	transcript_id "g52.t1"; gene_id "g52";
Scaffold_1	AUGUSTUS	CDS	329918	330506	0.72	-	0	transcript_id "g52.t1"; gene_id "g52";
Scaffold_1	AUGUSTUS	start_codon	330504	330506	.	-	0	transcript_id "g52.t1"; gene_id "g52";
# protein sequence = [MPLMLYWGSLNNWSIPPTLDHLISTPNSSIINTLISEQRPYPPPPLPIEEQIPREILTNKPRLRLPRLDGGSLPRPNE
# SLFDFIQRREVHRLKVIASESPVERQSRLQREENATKDRPRVEKVLAVYYWDLVEGTRVRTPVGRSNYEDIWERYGSHQRRYDSVADEWEVCTDFDPN
# DAPDDYDLDSDDDSDYFITVQFNEAIEDVAYHRFGFLKQPFAENRDIVLKSQVWKKVLGLFGCGRRHAALEVDIHIKLQLCRFISALSDAADLRHAPE
# VYDLSFRSLMQPLIPFEVDTLTSYNGRYYLIQAKDAKDNEEYVIAFRSAATVMELTRRSFRPVGFVPTLQDYRSYELIRNDFLRSARGRSALLAGGII
# ARLARGIVNVNDVYDGPTGHALHEGEQALCVWEAGQACAFWDDQLTGEEMDLICGSYEVATDGDKVLVASFRFLEILWSQLWILVERCRRLVPKPFGP
# NPKIYGAIDPDD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g52
###
# start gene g53
Scaffold_1	AUGUSTUS	gene	339359	339766	0.73	+	.	g53
Scaffold_1	AUGUSTUS	transcript	339359	339766	0.73	+	.	g53.t1
Scaffold_1	AUGUSTUS	start_codon	339359	339361	.	+	0	transcript_id "g53.t1"; gene_id "g53";
Scaffold_1	AUGUSTUS	CDS	339359	339766	0.73	+	0	transcript_id "g53.t1"; gene_id "g53";
Scaffold_1	AUGUSTUS	stop_codon	339764	339766	.	+	0	transcript_id "g53.t1"; gene_id "g53";
# protein sequence = [MEMRLPALFSLSTNTVDIDRSSDSDSSRTMDSYDSVPQSPDAGEDDPMPLAPLNPQTMPQMAPQVPQAHFHTQSPHPP
# QTPPPQTPPPQTPPPQTPPPQTPPPRSEDFQMDDINATPRAPPDMTPRAPQAPEINR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g53
###
# start gene g54
Scaffold_1	AUGUSTUS	gene	342753	343226	0.56	-	.	g54
Scaffold_1	AUGUSTUS	transcript	342753	343226	0.56	-	.	g54.t1
Scaffold_1	AUGUSTUS	stop_codon	342753	342755	.	-	0	transcript_id "g54.t1"; gene_id "g54";
Scaffold_1	AUGUSTUS	CDS	342753	343226	0.56	-	0	transcript_id "g54.t1"; gene_id "g54";
Scaffold_1	AUGUSTUS	start_codon	343224	343226	.	-	0	transcript_id "g54.t1"; gene_id "g54";
# protein sequence = [MFEYNSGLDTTLRPPTPHVKLWTHLNNYQHDHVMFEYNSGLDTTLRPPTPHVKLWTHLNNYQHDHVMFEYNSDLDTTL
# RSSTTSNSSCQTLDAPSHLPLDQWNCVIWFRYQRNVLPNSMNCGINAQKMSRRRSTTRDPLTISSLKQFNRFFTFSSID]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g54
###
# start gene g55
Scaffold_1	AUGUSTUS	gene	361362	362369	0.5	-	.	g55
Scaffold_1	AUGUSTUS	transcript	361362	362369	0.5	-	.	g55.t1
Scaffold_1	AUGUSTUS	stop_codon	361362	361364	.	-	0	transcript_id "g55.t1"; gene_id "g55";
Scaffold_1	AUGUSTUS	CDS	361362	362369	0.5	-	0	transcript_id "g55.t1"; gene_id "g55";
Scaffold_1	AUGUSTUS	start_codon	362367	362369	.	-	0	transcript_id "g55.t1"; gene_id "g55";
# protein sequence = [MPSISKIRQTNAAALSAKQYIPTAVFVGGTSGIGEGMAEAFAKTHSRECSYHPRRSKSRRGREHHITLPQANLADAKH
# EFVQCDVALMRNIRNASAEIRSKLPKLNYLAMSPGFMTTSGRNETEEGIDRKLAVHYYSRWMFTKELISLLEKAQEQGEDAKVFTVLAAGAGGPIDVN
# DLGLKKTYSLKNAALQAPTYNDLMTEVRFLAQRLFSTDTARQEFAARHPTITFAHAIPGAVRTNLFSAAEVSTFTKKAMGLSMTMFGFLLTSIEDCGE
# YMLNGMLNVASAPGAWRIDSHGEDLAKRRYYGSEEERKKLWEHTVEATREKLRGVTRLALF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g55
###
# start gene g56
Scaffold_1	AUGUSTUS	gene	369503	370839	0.88	-	.	g56
Scaffold_1	AUGUSTUS	transcript	369503	370839	0.88	-	.	g56.t1
Scaffold_1	AUGUSTUS	stop_codon	369503	369505	.	-	0	transcript_id "g56.t1"; gene_id "g56";
Scaffold_1	AUGUSTUS	CDS	369503	370528	0.88	-	0	transcript_id "g56.t1"; gene_id "g56";
Scaffold_1	AUGUSTUS	CDS	370591	370839	0.95	-	0	transcript_id "g56.t1"; gene_id "g56";
Scaffold_1	AUGUSTUS	start_codon	370837	370839	.	-	0	transcript_id "g56.t1"; gene_id "g56";
# protein sequence = [MHTQVISRSTVKTKSLAPEWNELWRVKNVPTTSELRVEILDKDTDTPHDDYIGKFKTTIEAGEKEIDIQGPLFRKDRG
# TFKLKIETAPSTDPAEPKYLFDGPIRYSRHFSPLVGKLTDLDDARLYSTWKMYLIDVPVYFKDVYQHWNVKYKAAQSIFGSGPTSLAIRAGIHAGHKM
# LYARSTSNGFGVIQSVDDVMRLFEGGSLDPKGILRSEREDLSQEEQRQLEVAEEVDATAAPTKESPFARRIKPAVYTYIISAQDDSLRFSETGAAFFV
# DFASKHALHANCAEQVRYSGEFHLRPRAKDHSSWCGWQDFNDSMPDDSVDWEVVIDNNSGTYAPDKAMLPTLRDLIDCNFPGLDVVALDREDEELKKS
# VDACQEYALKYRGVKSEHLQPHQQEGHRSLLKPLGAVMGKVAHLQRGNKEEA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g56
###
# start gene g57
Scaffold_1	AUGUSTUS	gene	371746	372861	0.38	-	.	g57
Scaffold_1	AUGUSTUS	transcript	371746	372861	0.38	-	.	g57.t1
Scaffold_1	AUGUSTUS	stop_codon	371746	371748	.	-	0	transcript_id "g57.t1"; gene_id "g57";
Scaffold_1	AUGUSTUS	CDS	371746	372351	0.75	-	0	transcript_id "g57.t1"; gene_id "g57";
Scaffold_1	AUGUSTUS	CDS	372427	372861	0.38	-	0	transcript_id "g57.t1"; gene_id "g57";
Scaffold_1	AUGUSTUS	start_codon	372859	372861	.	-	0	transcript_id "g57.t1"; gene_id "g57";
# protein sequence = [MQAIVVKFNRQVVVCSLFKSKVTVCDLPGPFEIIVVVSRDQTRTTWISFPMKRTPSSPSSPTHKASRTTASKSNSANP
# LLCTLPPTCSTHPTALADTRELEAHYAKYHAWVCQAAKPTSGTCGNVFPDARLLELHHTECHDPIAAFACFLPLTVCPKVFASPKARRLHLIAVHGYP
# KEYFFAVVNKGVAGLLAKWGDGAGMIRRTWKPRPKEGEQVNNPNKTEDDQEDSEGTTDSEESEDSSEPETTTKAKTSNGNQPSSMAMDIDALATSFQT
# SLSVSSVPSSIRFGRGAKRGTRGGRGANSITSKSHRYRLSDPDEEATMDAAPSRDRGGYRGGRVMRGRINRN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g57
###
# start gene g58
Scaffold_1	AUGUSTUS	gene	375475	376119	0.95	+	.	g58
Scaffold_1	AUGUSTUS	transcript	375475	376119	0.95	+	.	g58.t1
Scaffold_1	AUGUSTUS	start_codon	375475	375477	.	+	0	transcript_id "g58.t1"; gene_id "g58";
Scaffold_1	AUGUSTUS	CDS	375475	376119	0.95	+	0	transcript_id "g58.t1"; gene_id "g58";
Scaffold_1	AUGUSTUS	stop_codon	376117	376119	.	+	0	transcript_id "g58.t1"; gene_id "g58";
# protein sequence = [MTSFESSGAATIDKVADFPDALLLNGMGLLNLEEGLVYVADPYAGAISILNVNTGAHYVAINNSLTIPAAPFTTPLGV
# NGVHVFQEPDGPLYVYFSNTAQSLLARMPIDATGTPIGDAEVVASGIMADDFTFDSDGNVLQAVIGSDEIVKIDPSTGTVTVIAGSPNNTELRSVSAA
# QFGRLSNETTTLFVTLNGGNLGAGGPVVPGAVKMLDLG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g58
###
# start gene g59
Scaffold_1	AUGUSTUS	gene	383045	383623	0.61	+	.	g59
Scaffold_1	AUGUSTUS	transcript	383045	383623	0.61	+	.	g59.t1
Scaffold_1	AUGUSTUS	start_codon	383045	383047	.	+	0	transcript_id "g59.t1"; gene_id "g59";
Scaffold_1	AUGUSTUS	CDS	383045	383623	0.61	+	0	transcript_id "g59.t1"; gene_id "g59";
Scaffold_1	AUGUSTUS	stop_codon	383621	383623	.	+	0	transcript_id "g59.t1"; gene_id "g59";
# protein sequence = [MLSTKITSFTTLADQRPRREGLRSNNKQVSDSLPVERAPSCQIGSDRSSPVQITESQDTSPDSNCPDSNSPRLSLPSS
# DDSMTTRVNESGNIELCSGKYGPRVKPGVVLSPEDLDDLYEEARRHAKTKSTEDIENVREIIADAFPSRVHRDWFRSEKLGHLGLALESKDASDETAP
# PTFPFLDALPTQILRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g59
###
# start gene g60
Scaffold_1	AUGUSTUS	gene	386886	389702	0.64	-	.	g60
Scaffold_1	AUGUSTUS	transcript	386886	389702	0.64	-	.	g60.t1
Scaffold_1	AUGUSTUS	stop_codon	386886	386888	.	-	0	transcript_id "g60.t1"; gene_id "g60";
Scaffold_1	AUGUSTUS	CDS	386886	389702	0.64	-	0	transcript_id "g60.t1"; gene_id "g60";
Scaffold_1	AUGUSTUS	start_codon	389700	389702	.	-	0	transcript_id "g60.t1"; gene_id "g60";
# protein sequence = [MRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIIS
# RLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLT
# RLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKA
# FDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDH
# SNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEG
# LKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHP
# RAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLG
# IKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQ
# DAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSING
# EIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g60
###
# start gene g61
Scaffold_1	AUGUSTUS	gene	390650	391812	0.14	-	.	g61
Scaffold_1	AUGUSTUS	transcript	390650	391812	0.14	-	.	g61.t1
Scaffold_1	AUGUSTUS	stop_codon	390650	390652	.	-	0	transcript_id "g61.t1"; gene_id "g61";
Scaffold_1	AUGUSTUS	CDS	390650	390858	0.43	-	2	transcript_id "g61.t1"; gene_id "g61";
Scaffold_1	AUGUSTUS	CDS	390954	391812	0.14	-	0	transcript_id "g61.t1"; gene_id "g61";
Scaffold_1	AUGUSTUS	start_codon	391810	391812	.	-	0	transcript_id "g61.t1"; gene_id "g61";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYYIRYGTRFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g61
###
# start gene g62
Scaffold_1	AUGUSTUS	gene	392569	394601	0.79	+	.	g62
Scaffold_1	AUGUSTUS	transcript	392569	394601	0.79	+	.	g62.t1
Scaffold_1	AUGUSTUS	start_codon	392569	392571	.	+	0	transcript_id "g62.t1"; gene_id "g62";
Scaffold_1	AUGUSTUS	CDS	392569	393717	0.86	+	0	transcript_id "g62.t1"; gene_id "g62";
Scaffold_1	AUGUSTUS	CDS	393795	394601	0.89	+	0	transcript_id "g62.t1"; gene_id "g62";
Scaffold_1	AUGUSTUS	stop_codon	394599	394601	.	+	0	transcript_id "g62.t1"; gene_id "g62";
# protein sequence = [MIGAAYFIDNDPGANKIFLVTDASDWRHGAILMWGPTLDSARPVAFDSAQFSGAELNYPVHEKELLAIIRALRKWRAD
# CLGMRVHVLTDHRTLENFEKQKDLSRRQMRWQEEISQFDLEIAYIPGDENLGADALSRIRAWALPSEIREQLPGSSNVESWKANPFTCASVLSLSADK
# EFLNQIKLGYVSDPFIVKLVEGGSLVPNVTREHGLWFVSGRLVIPNYLSLREDLFHLAHDTCGHFGADKTYAMLADSYYWPHMRRDLYKFYVPGCEDC
# QRNKGRTAKNVKGPLHPLPVPEGRCDSVGMDFIGPLPNDQGFDCILTMTDRLGSDLKIIPTNIDISAPALAKLVFDHWYCDNGLPLEWVSDRDKLFVS
# DFWRTLNGLTGAIRFYVERNQMGWVNALPKIRFDIMNTVHASTGLSMFELRHGRSPRVLPPLVGDVDVSGFDPSQNDNDAKVFLDNIALTVREARDNL
# TLAKVVQAFQSDKNRGPCELFEEGDWVMLSTYHRQEVFKKSGEKRAAKFFARFDGPYEVIKAFPETSHYTLDMPNQPGAFPSFYVDQLKRFVPNDAAL
# FPGRERHMPEPTIVDGHEEFFIDRILDSRRRGRGWQFLVRWVDQGPSEDRWLSYTSLHNCSALEDWVRNGGDGPADLLNSVEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g62
###
# start gene g63
Scaffold_1	AUGUSTUS	gene	398628	399263	0.91	-	.	g63
Scaffold_1	AUGUSTUS	transcript	398628	399263	0.91	-	.	g63.t1
Scaffold_1	AUGUSTUS	stop_codon	398628	398630	.	-	0	transcript_id "g63.t1"; gene_id "g63";
Scaffold_1	AUGUSTUS	CDS	398628	399263	0.91	-	0	transcript_id "g63.t1"; gene_id "g63";
Scaffold_1	AUGUSTUS	start_codon	399261	399263	.	-	0	transcript_id "g63.t1"; gene_id "g63";
# protein sequence = [MISIACDAYHNFSIDGHRLTVIEVDGENHEPATVDNIQIFPGQRYSFVLTATQPVDNYWVRALSSSGVGFSGFTGGLN
# SGILRYQGAPDADPTTTNSTGVVLTESMLHPLENPGAPGLPFPGGADEVLNLTLGFNLPATFFMNDTQYIPPTVPVLLQILSGAQSPQDLLPPGSVYT
# LPINKTIEINFFGNATPGGPHPFHLHGVRLIQSSY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g63
###
# start gene g64
Scaffold_1	AUGUSTUS	gene	409467	409991	0.34	+	.	g64
Scaffold_1	AUGUSTUS	transcript	409467	409991	0.34	+	.	g64.t1
Scaffold_1	AUGUSTUS	start_codon	409467	409469	.	+	0	transcript_id "g64.t1"; gene_id "g64";
Scaffold_1	AUGUSTUS	CDS	409467	409991	0.34	+	0	transcript_id "g64.t1"; gene_id "g64";
Scaffold_1	AUGUSTUS	stop_codon	409989	409991	.	+	0	transcript_id "g64.t1"; gene_id "g64";
# protein sequence = [MNVFDSHCGSKPVQTQHTQPPLSLPQSKHQGLLDGLSDIFEGKETRNGRQEEEKAERQRLELKADTAKHAHLPLDIFE
# KLGFGNPPESKYHSAPPSKANGETLLEQLGSKLHPSGGDVGEHSLSLKDQSFAERLDSMMHHRKADNSSQLSGGITDKIQSALGGGSEAEENEGQE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g64
###
# start gene g65
Scaffold_1	AUGUSTUS	gene	412599	414736	0.72	-	.	g65
Scaffold_1	AUGUSTUS	transcript	412599	414736	0.72	-	.	g65.t1
Scaffold_1	AUGUSTUS	stop_codon	412599	412601	.	-	0	transcript_id "g65.t1"; gene_id "g65";
Scaffold_1	AUGUSTUS	CDS	412599	414517	0.97	-	2	transcript_id "g65.t1"; gene_id "g65";
Scaffold_1	AUGUSTUS	CDS	414571	414736	0.72	-	0	transcript_id "g65.t1"; gene_id "g65";
Scaffold_1	AUGUSTUS	start_codon	414734	414736	.	-	0	transcript_id "g65.t1"; gene_id "g65";
# protein sequence = [MEPDIWTSIPNTTNAQEAQHWKLYSAVGRDHGLLEGLEALHAVAETTVKLFTANLEGGLIRYGKAEPWKAMINLIGRS
# KPSRAPGGRSTKQKSDGRPPDTKKDLLSRTPKKSKELPSTHHTNSAIVGPASYRWDNMSCWADSAWDLLYRSIVKDWASFSSRFSSDSQTERPIRDFY
# NLMLLRRNAEHDSFILKVPDYDLSTALSSQRDQFRRRLVEWRIIKSDNAVGNAFVSYSSYVSQQSYLNLTYCWKDWFPQVLKDKLNDDLDDDNWTQSY
# FQTMFVTIKHCSGDGNGHHYQVCQKPEIRYLIVLRQAACQEFKGDLLSWLQTFANVNHSPQALPTCWRARDGESWCKGSQTDVKFILSLPVVLILEEE
# ECTTSTEFWNFPALLQPYKSGELATVTYDIVGRIFYSRSKNHYISRFLDEDGKTVWTYDDMAHGGCPYVEPGATAGTHLTGSSSTLKLPSDFIGAFAI
# YHLRNGTSTQEAIYTSQLAVARRVHHMMVEPDSLRHHVPKIWLSRVKFAQLTPHDLTWLKNPFRLDTLDYQETTESSGTIRIPPRSTLSYQPNHESSP
# FLSSPTSKNLLEPNSVSPQEQDQMHSVETLDHGLNVDLIEEYLQEGTSDFQFMCRCGITTTNETLVVHNSSTGDIIQCDNCDIWSHIACQKEGRAGGL
# RQTREPFQCDGCAGNSRAIIDSFIPGKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g65
###
# start gene g66
Scaffold_1	AUGUSTUS	gene	415095	416456	0.61	-	.	g66
Scaffold_1	AUGUSTUS	transcript	415095	416456	0.61	-	.	g66.t1
Scaffold_1	AUGUSTUS	stop_codon	415095	415097	.	-	0	transcript_id "g66.t1"; gene_id "g66";
Scaffold_1	AUGUSTUS	CDS	415095	416456	0.61	-	0	transcript_id "g66.t1"; gene_id "g66";
Scaffold_1	AUGUSTUS	start_codon	416454	416456	.	-	0	transcript_id "g66.t1"; gene_id "g66";
# protein sequence = [MPMYGFAHNQVFPQPPVSTSGPPVQPVQNPTLGKKNSSQQPNTVPGHLSAADAGLNTVPSINIVPPTPVLGSVVLPSQ
# QTAKSTSPSEYQLAGKKNPLLSPNTTPESWDGWLDGNLEADFTWEELAQTGDLRVHWARKDYGSRAGVGNAFAEHWSAGKKNTRSCLGVISCTNEQCL
# TIIRPHSVSGGIQRQLLKQCQCGAQLQHFPCAVKTIIWTWQGGKHWQNIGFHNHQRITHILHLLPGEQTRFEELIDINPDTTPSQLLVGRRTLHGKRK
# SASDISPVYNNRDRIAKDRQKVINGAKYSGGDSFVSGFRDFHRDFPGFIVHTIFGEINMICLQSEFMRSRLGGMFKHHQEPVNGIVSDAAHGFWRERN
# SLLITSSIYEAELHCWVPGLFSYSDGASAEHYMHHFLVLMLSIAHECEANDTIIADRHFAGVRSSTHSHQNWNLNDILVDH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g66
###
# start gene g67
Scaffold_1	AUGUSTUS	gene	418639	418974	0.55	+	.	g67
Scaffold_1	AUGUSTUS	transcript	418639	418974	0.55	+	.	g67.t1
Scaffold_1	AUGUSTUS	start_codon	418639	418641	.	+	0	transcript_id "g67.t1"; gene_id "g67";
Scaffold_1	AUGUSTUS	CDS	418639	418974	0.55	+	0	transcript_id "g67.t1"; gene_id "g67";
Scaffold_1	AUGUSTUS	stop_codon	418972	418974	.	+	0	transcript_id "g67.t1"; gene_id "g67";
# protein sequence = [MYTERINDAGFAFVSADYRLIPTGSITAHHILEDVKDAFAFLRSKTFEAALDSLDVEGKLPYPKFRVDPRRIAAAGSS
# AGGTCAYFAATHVEPKPAAILSVFGMGGDILVR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g67
###
# start gene g68
Scaffold_1	AUGUSTUS	gene	420467	421288	0.4	-	.	g68
Scaffold_1	AUGUSTUS	transcript	420467	421288	0.4	-	.	g68.t1
Scaffold_1	AUGUSTUS	stop_codon	420467	420469	.	-	0	transcript_id "g68.t1"; gene_id "g68";
Scaffold_1	AUGUSTUS	CDS	420467	421288	0.4	-	0	transcript_id "g68.t1"; gene_id "g68";
Scaffold_1	AUGUSTUS	start_codon	421286	421288	.	-	0	transcript_id "g68.t1"; gene_id "g68";
# protein sequence = [MEFCEEHILRRQYEPDDYIFPTINANGVTFQSKQPITPEAVQKMIDNFTVAAGVPGAFTTHCFRRGGAQYRFMFAPIG
# ERWTLARIRWWGGWAPNEKVILSDSLSLLVTAIKRDTLIRYLLDELNTYEEDHSDALAPIDRRASESHAGEAAEMGPLSAAEGRQLFTMVGSTIKKEF
# AAIYTSQHHLPQGSAPYGPYPYQGYIWPSLPVPKPSLMPSLSSYLSQMAAPAPNQVIYSSTGSFTPQPSTKILPELDYLPNYSEDTTFPECMEASHH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g68
###
# start gene g69
Scaffold_1	AUGUSTUS	gene	427020	428383	0.81	+	.	g69
Scaffold_1	AUGUSTUS	transcript	427020	428383	0.81	+	.	g69.t1
Scaffold_1	AUGUSTUS	start_codon	427020	427022	.	+	0	transcript_id "g69.t1"; gene_id "g69";
Scaffold_1	AUGUSTUS	CDS	427020	427031	0.87	+	0	transcript_id "g69.t1"; gene_id "g69";
Scaffold_1	AUGUSTUS	CDS	427118	428383	0.81	+	0	transcript_id "g69.t1"; gene_id "g69";
Scaffold_1	AUGUSTUS	stop_codon	428381	428383	.	+	0	transcript_id "g69.t1"; gene_id "g69";
# protein sequence = [MSKPPVPLPRELSDFIPADIYELIISFLNHDPVTLKFCSLTCKSWLWPSWKTLFQSRTIHIHRKNIDDFLKLINLNAH
# TITIIRFIQHLHIEQGGSKRLPVSWQLPWGIQESGDYEIFQFDDFLHLFTGLTAVKTLKLGWIRCDTSKSTSDALRGNFGSVTTLDLDSVILSSSDHF
# FDILGAFPLLSSLSLTGVLFNGGRLYDGLDNWDELDARRTVLEHTPPPPSSLNELYTNVTEDVSEFLFSWMTYHHIPLPMRSLSTGLFSESSNAALSK
# FLFHSGSTLENIMIRDAHESTALDLSPCVNLRTLEIGCVDLQSSSVDERELGSETFVTNILRTVASDNVEYLKIVLAISGYEDAHVQIRAFDWRGLIS
# ILERSQFQDILVEISVSGYETDVEDAISEYVLAVNTAQRAALLATFNVKKWTR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g69
###
# start gene g70
Scaffold_1	AUGUSTUS	gene	429712	430077	0.91	-	.	g70
Scaffold_1	AUGUSTUS	transcript	429712	430077	0.91	-	.	g70.t1
Scaffold_1	AUGUSTUS	stop_codon	429712	429714	.	-	0	transcript_id "g70.t1"; gene_id "g70";
Scaffold_1	AUGUSTUS	CDS	429712	430077	0.91	-	0	transcript_id "g70.t1"; gene_id "g70";
Scaffold_1	AUGUSTUS	start_codon	430075	430077	.	-	0	transcript_id "g70.t1"; gene_id "g70";
# protein sequence = [MDWLDDLDQSWAAVLQAQVWNPSEGIGEDLIVDAGDVVRGVKSTPMSQTERTRLKSLLLGGVATLEEWLEGKPIGVNR
# QATAVEEEDGLNDIFSNTLEELGHLGLVAVEPEELCSMDLDDD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g70
###
# start gene g71
Scaffold_1	AUGUSTUS	gene	434119	435063	0.81	+	.	g71
Scaffold_1	AUGUSTUS	transcript	434119	435063	0.81	+	.	g71.t1
Scaffold_1	AUGUSTUS	start_codon	434119	434121	.	+	0	transcript_id "g71.t1"; gene_id "g71";
Scaffold_1	AUGUSTUS	CDS	434119	435063	0.81	+	0	transcript_id "g71.t1"; gene_id "g71";
Scaffold_1	AUGUSTUS	stop_codon	435061	435063	.	+	0	transcript_id "g71.t1"; gene_id "g71";
# protein sequence = [MRAQQLRPDRKRLSTAFTDFIQVLTLRIIVVALLDPDRDIESIDAEDLRVSAMLITKLWGISKLKISSTVPLMDAPCT
# SPDIDDLTTLNYHLRRLLPDTEKYPNPINFVIPTWETLWRVVATCLAHVHENVEFRQVFEELLEDPTSERFKTTSFDSKLCADWIVSETLRLHPPSRH
# ISRSFVVEQPPFLQFVRTLLPRSVSDQLGLAPLIRSEIADVEGIHLSIGIWGADALEFNPRRWARYTSSLEAPTLFAFGYGPLICIGKNWAPMAAALI
# VGAILEGIEREELEIVGTGIIGGRAGWIGWRVQSREAFKA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g71
###
# start gene g72
Scaffold_1	AUGUSTUS	gene	439876	440466	1	+	.	g72
Scaffold_1	AUGUSTUS	transcript	439876	440466	1	+	.	g72.t1
Scaffold_1	AUGUSTUS	start_codon	439876	439878	.	+	0	transcript_id "g72.t1"; gene_id "g72";
Scaffold_1	AUGUSTUS	CDS	439876	440466	1	+	0	transcript_id "g72.t1"; gene_id "g72";
Scaffold_1	AUGUSTUS	stop_codon	440464	440466	.	+	0	transcript_id "g72.t1"; gene_id "g72";
# protein sequence = [MAWRSFLKKKDWCTSQTVGVGIVNILNVNTGENFVAINNSLTNQPPGASEISNCVHGVHVVQLTPNSQKYLYFSNYAQ
# GIIGRVPIHDSGLASGAAEVVAGNLTTPEDFILDTEGNIFLALFQANQFIRIDAHTHEITVLAGSPDSSEYKWAAAVEFGRRESDKDSLYATIDGGYL
# ESDNVGGALFRIRGGDIAVN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g72
###
# start gene g73
Scaffold_1	AUGUSTUS	gene	440844	442010	0.52	-	.	g73
Scaffold_1	AUGUSTUS	transcript	440844	442010	0.52	-	.	g73.t1
Scaffold_1	AUGUSTUS	stop_codon	440844	440846	.	-	0	transcript_id "g73.t1"; gene_id "g73";
Scaffold_1	AUGUSTUS	CDS	440844	441229	0.79	-	2	transcript_id "g73.t1"; gene_id "g73";
Scaffold_1	AUGUSTUS	CDS	441349	441501	0.66	-	2	transcript_id "g73.t1"; gene_id "g73";
Scaffold_1	AUGUSTUS	CDS	441770	442010	0.53	-	0	transcript_id "g73.t1"; gene_id "g73";
Scaffold_1	AUGUSTUS	start_codon	442008	442010	.	-	0	transcript_id "g73.t1"; gene_id "g73";
# protein sequence = [MSFENRVQKALVIESPKTPFVLKTVPIPKPGPGEVLVKIIASGLNPADWVIQTRDYFAPHTPYPAIIGFDIAGDVEEV
# GPASVSLTFTTAVYGLLPAHPIGMGLNPTFDDTVSYPEEAALVIGGSTSVGQYEFLKSLGATHVIDRNQISFADLPAALPKVYVQPIKVIYSAVTLPE
# AQNAAYACLANDGKLAVATPQLALKEDAETTGKKLYGVFGSPYTPANREFGLVLWRHLPRLLESGVFVVSTKSKFVSLLTFRP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g73
###
# start gene g74
Scaffold_1	AUGUSTUS	gene	442943	443380	0.74	-	.	g74
Scaffold_1	AUGUSTUS	transcript	442943	443380	0.74	-	.	g74.t1
Scaffold_1	AUGUSTUS	stop_codon	442943	442945	.	-	0	transcript_id "g74.t1"; gene_id "g74";
Scaffold_1	AUGUSTUS	CDS	442943	443380	0.74	-	0	transcript_id "g74.t1"; gene_id "g74";
Scaffold_1	AUGUSTUS	start_codon	443378	443380	.	-	0	transcript_id "g74.t1"; gene_id "g74";
# protein sequence = [MVDDAIMKLLTFPDRPTDNTASLSRLDTDNQNTDVGNEKEFLCPRLEQLTLRRCIAAADGKTSRMVKSRWTLPSPGLS
# NGRIDVDVDKEGDELARKLRCVHIEFSNPEHAEDFDVLKEMYSTGLGGDVVVKKGYNSPHVYSHSRH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g74
###
# start gene g75
Scaffold_1	AUGUSTUS	gene	460324	462856	0.32	+	.	g75
Scaffold_1	AUGUSTUS	transcript	460324	462856	0.32	+	.	g75.t1
Scaffold_1	AUGUSTUS	start_codon	460324	460326	.	+	0	transcript_id "g75.t1"; gene_id "g75";
Scaffold_1	AUGUSTUS	CDS	460324	461517	0.32	+	0	transcript_id "g75.t1"; gene_id "g75";
Scaffold_1	AUGUSTUS	CDS	461996	462856	0.93	+	0	transcript_id "g75.t1"; gene_id "g75";
Scaffold_1	AUGUSTUS	stop_codon	462854	462856	.	+	0	transcript_id "g75.t1"; gene_id "g75";
# protein sequence = [MFSFFRQSPYVDIFSSSTVSQSDGLVSISPSPPKNLTSIVVNGQTYYASDDPTFTNLVLSPSSPLRGGAPARSVVTNP
# VSSRMDSPSSRPSSFLPDVVGVDHQVDEDSFDLCYPPESPKNTMSPIPAPSSSHGLSIEDYDSMDIDLPANFRSIPALRTPSPDLPSNPLEGWIPTPR
# SSSTLESRMRPVLPTTSSSKTKIFPSKLERGMSPLKIPYGASPSPPRSLLSSPSHSNSDTSTVNTSPSKSSATGSPSSRLKGKDHLRFHPFSNSKRTT
# PSPLVTTPVKTPKPSAAGKKHRDAIIHRALTDALPSPSIPPSGFDNLASSSPPRKSRKELICDALSENDLMDSGDSAGFEEQYHEPQDVVPFIDNNLG
# ENGVLNAEWIDPRFAASFRSVVDLPSESQRLFAFFGSLIGSSKFGCPVSEGIIDFRSNQRFDSDAWKDDPDNLSPLEPGQSSPIIIIRPFHVLFFALV
# TPGKKRDISNVPKNIHCKNPLPFSRAGAYRSYFPYFVVLTSITVPIFDGRDSFVAAPAQLNQIGSRTYPLYKNSEEDPPTGCIVCVGYTAHTWQSSGS
# YKAPPLSLSLGLQFVVVLALPPGYDGPDLPKPISSRPFPKPIYNTPTRTKDFPGPPRRKPPRSKPSSEDAAGSSRISRHAKVNSDDDSPYLHAGGLKE
# GFEYHEDVMASKSNRNGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g75
###
# start gene g76
Scaffold_1	AUGUSTUS	gene	465961	469207	0.62	+	.	g76
Scaffold_1	AUGUSTUS	transcript	465961	469207	0.62	+	.	g76.t1
Scaffold_1	AUGUSTUS	start_codon	465961	465963	.	+	0	transcript_id "g76.t1"; gene_id "g76";
Scaffold_1	AUGUSTUS	CDS	465961	467770	0.62	+	0	transcript_id "g76.t1"; gene_id "g76";
Scaffold_1	AUGUSTUS	CDS	467883	469207	0.91	+	2	transcript_id "g76.t1"; gene_id "g76";
Scaffold_1	AUGUSTUS	stop_codon	469205	469207	.	+	0	transcript_id "g76.t1"; gene_id "g76";
# protein sequence = [MQRNFGGGRPPNKLKGVLAPTLFIEPFTFTCPIQKTNTAPPKMIENLTFKFPPPPISRSHMAGVIDKWCKASTAVHFE
# EAGCAVCGQLTLCTNLSALKNMKNYLHLLEAQSVTRAFRDSPNVPFSDIKGPVLDKSAGDRICNNCRSSLRSGTVPKLALCKGLWLGDIPDELKNLTF
# YEKMLIARVRHTKCFVRVQKGSTNYSKLVSNVIAFENPIPKIYDTLPPPREEIEEVLAVMFSGSTKPTQDDYARALLLVRRNVVAKALQVLILNHFDY
# NDVVFSSANLNSYADNVPIVAVEYFQKGSNRNAEGVSVHDDLNDDGTEEGTCVFTVHGIVGPSIKNMTRDQMIGIAAMHLDNEGKFMRTSHAENPESL
# WNNPQLYPKMFPWLFPFGLGGIGTSNIKSFSESSHLNFLLLYHDKRFQLDPNFPLIAFSHQQVKASSSQSYLLAESNKFDEVSNRFLSIDKSVLQNIA
# TRMANGEHVKPANDSEIQCFKLLGDLSHAGAKTQGSISSKKNMQSEIWSLINHIGGPSWYITVSPCDFKHPICIYYADTKEKFDVPLRTSSECRLLIS
# NNPVAGARFFHLLVNLFLKHVVDIESSEGGLFGPTNPASSFQSQLISFLESVRIGEFLTGSHAYVKETVALQSKSNINYISPERTLPTPPPPYCDCGI
# TDCHKCSTFQHWFEEFKCTVDDLLLKSNVHDCFRGISPDGSVLNQDKFETSCLNNAHKKCKARFPRECFQQTSVDPDNGHIDLKKLEEWLNDISPGLT
# YLVRGNTDVTSILSGTAIKSAVIYIADYITKTGLKTHVVFDSIKTIFDKSTEIIDGSFSTKEKSRRLISRIVNLLSTKLELGSPMISLYLLKNPDHYT
# SHNFIPFYWKTYVSTARSFFGENDSTSEPKLILTKRWDKIVGLSSSLDYTHRPVQHVNYNLYNWVCSFYKVAKRKSKDEVLSDHETELKSSKSVKSTK
# GLPFLVGHPLVETHVISTRRNSSMTVPNFIGALPRPNKDDREYYCCTMLTLFCPWRTGEDLKKKDQSWHEPLKLMIFVNKVNCI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g76
###
# start gene g77
Scaffold_1	AUGUSTUS	gene	469363	471351	0.9	+	.	g77
Scaffold_1	AUGUSTUS	transcript	469363	471351	0.9	+	.	g77.t1
Scaffold_1	AUGUSTUS	start_codon	469363	469365	.	+	0	transcript_id "g77.t1"; gene_id "g77";
Scaffold_1	AUGUSTUS	CDS	469363	471351	0.9	+	0	transcript_id "g77.t1"; gene_id "g77";
Scaffold_1	AUGUSTUS	stop_codon	471349	471351	.	+	0	transcript_id "g77.t1"; gene_id "g77";
# protein sequence = [MNSSDIEDIGHNYDQYTEDKKGNFFLRRESAMRAMKDMLFNIGWVIPLTGSVQSKSITTCSPILLPKEKPQHWDLILK
# GMRDQVLATRDKDRGLPPSNNNENINDPGKYRPNIVEICDKHYFDKLGIDYGSIKELTLNIIKCHNLNNEQERAFRIIAQHSAGLVSEPLYMYIGGMG
# GTGKSQVIKAVLQFFADRNSSFAIVTSAPTGNAAALLGGSTYHFLLGLNNKVEEVGRGTMAQVCARLEHVQYMILDEVSMLSCSDLYRISVQLCGAKN
# KHDIAFGGMNMIFAGDFAQLPPVGGESVSLYSYRRPTDANKYNGQCAAMGKSLWHNVTHVVILRKNMRNTGSSKADISFRLALDNMRYKSCTKEDIGF
# LNTLVSSKSPGRPFVGKSPWRDAAIIVGENKHKDEINRLGCLRFASDTNQILTHFYSDDLASSNTDQPMYVKSKKKKQIKSSISKELQHHLWELPTCA
# HETHAPPVLSLCIGLPIIIRHNIATELSITKGQRGTVYAWHESTGAFDQCVLDVLFVLLDNPPTPIHVPGLPPNVVPLTRRKTKGIVTLRNDVKISVT
# RNQVDILPGFSMTAYASQGQGLNPNATDLNTLNDHHAIYTALSRSRTAASTVILQGFDSRLITGGASGPLRKEYRELEMLDEITCLRYEGALDP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g77
###
# start gene g78
Scaffold_1	AUGUSTUS	gene	471719	472624	0.8	+	.	g78
Scaffold_1	AUGUSTUS	transcript	471719	472624	0.8	+	.	g78.t1
Scaffold_1	AUGUSTUS	start_codon	471719	471721	.	+	0	transcript_id "g78.t1"; gene_id "g78";
Scaffold_1	AUGUSTUS	CDS	471719	472624	0.8	+	0	transcript_id "g78.t1"; gene_id "g78";
Scaffold_1	AUGUSTUS	stop_codon	472622	472624	.	+	0	transcript_id "g78.t1"; gene_id "g78";
# protein sequence = [MSLGNKLRRSSAGRQALLKRSQKNIVNSDFANPTQLASLPISLLWSNNSCAFDSVVTIFVYIWMETNITGDEYTNLPQ
# LIKDFTEYRQGKHTLESVRDSLRSSLNSKRPREFSLTGFCSSTTILEELLKMKSSFMTTKLQCEQGHLSKRRPHNLKHSLLEDHRLDLPSSTNEWISV
# NSPASSNLLCDTCKGSLKKFFHIECAPNVLAFACDGRPHLSIDNVVHLRYNNEDFVYVLKGVIYYIPMREHFVSRIVSSENVIYIYDGMTNNGVPVLE
# YTNVNEIDWAQCQSGSASAAIYSRSNN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g78
###
# start gene g79
Scaffold_1	AUGUSTUS	gene	474660	475711	0.32	-	.	g79
Scaffold_1	AUGUSTUS	transcript	474660	475711	0.32	-	.	g79.t1
Scaffold_1	AUGUSTUS	stop_codon	474660	474662	.	-	0	transcript_id "g79.t1"; gene_id "g79";
Scaffold_1	AUGUSTUS	CDS	474660	475157	0.92	-	0	transcript_id "g79.t1"; gene_id "g79";
Scaffold_1	AUGUSTUS	CDS	475258	475610	0.56	-	2	transcript_id "g79.t1"; gene_id "g79";
Scaffold_1	AUGUSTUS	CDS	475702	475711	0.62	-	0	transcript_id "g79.t1"; gene_id "g79";
Scaffold_1	AUGUSTUS	start_codon	475709	475711	.	-	0	transcript_id "g79.t1"; gene_id "g79";
# protein sequence = [MSKTFYDRVYTAIRAVDPEHAIFFDGNTFASDFSHFGDSHKKWENTAYSIHDYSTFGFPAAPEDYVGTESQQRRLRRS
# YEKKREWMDARGLCVWNGEWGPVYARKQYEGKATEKINEVRYHDRLSWSIWCVYSEPSLNIFAYVYVRLYKDIGFQGMVYVSTKSAYMTKFADFLAKK
# HRLAVDAWGADVSAVQHVYQPLINHVLEEIPERFRDLYPAPVWKLSDRVGRLARNILVAEFLVNEWAAHFVGMDEAQLDELAKSFLFEECEKREGLNK
# ILTDNATLVKEA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g79
###
# start gene g80
Scaffold_1	AUGUSTUS	gene	504807	505595	0.92	+	.	g80
Scaffold_1	AUGUSTUS	transcript	504807	505595	0.92	+	.	g80.t1
Scaffold_1	AUGUSTUS	start_codon	504807	504809	.	+	0	transcript_id "g80.t1"; gene_id "g80";
Scaffold_1	AUGUSTUS	CDS	504807	505595	0.92	+	0	transcript_id "g80.t1"; gene_id "g80";
Scaffold_1	AUGUSTUS	stop_codon	505593	505595	.	+	0	transcript_id "g80.t1"; gene_id "g80";
# protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGTEACRFMAQFQNWASEQSDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIQQHLITINIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g80
###
# start gene g81
Scaffold_1	AUGUSTUS	gene	508139	508543	0.82	+	.	g81
Scaffold_1	AUGUSTUS	transcript	508139	508543	0.82	+	.	g81.t1
Scaffold_1	AUGUSTUS	start_codon	508139	508141	.	+	0	transcript_id "g81.t1"; gene_id "g81";
Scaffold_1	AUGUSTUS	CDS	508139	508543	0.82	+	0	transcript_id "g81.t1"; gene_id "g81";
Scaffold_1	AUGUSTUS	stop_codon	508541	508543	.	+	0	transcript_id "g81.t1"; gene_id "g81";
# protein sequence = [MDTQQQAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREM
# LAIIEALKDWRNFWRDYPSHLTSSLITLTSNFGAQLKTSPAAKLAGLYTFHGLTST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g81
###
# start gene g82
Scaffold_1	AUGUSTUS	gene	514391	516491	0.45	-	.	g82
Scaffold_1	AUGUSTUS	transcript	514391	516491	0.45	-	.	g82.t1
Scaffold_1	AUGUSTUS	stop_codon	514391	514393	.	-	0	transcript_id "g82.t1"; gene_id "g82";
Scaffold_1	AUGUSTUS	CDS	514391	515774	0.56	-	1	transcript_id "g82.t1"; gene_id "g82";
Scaffold_1	AUGUSTUS	CDS	515896	516491	0.66	-	0	transcript_id "g82.t1"; gene_id "g82";
Scaffold_1	AUGUSTUS	start_codon	516489	516491	.	-	0	transcript_id "g82.t1"; gene_id "g82";
# protein sequence = [MVDSYPKLFTLFFAGRDFAPKCIIDGKNIQDYLQEHYIEAMGQMADRIRDAGDLLEECVIGWDSMNEPFEGFCGWEDL
# NANPTKQGSTLKKGSSPTPAQSFRLGMGTAQTVDNWNFGTFGPSKNGSVTIDPNGDKIWADPDIEDTDGIHPRWGWQRDSGWKLGTCIWAQHGVWDLE
# TGDILRPDYFRYLPRPENLSTVVHHVHPTSCVCCSPPIEETGVDGLNGRCAFAGHYYDGLTLITRHWNWFNADALGVIRGRYSSPIQAVKIGERAIRK
# SLQEQLGILKSDTLTLGPYPTIIGEIGTPFDMDDKRSYGWTDDGKYRGDYSRQERALDASLNGADGPNAINYTIWTYCPDSTHQWGDGWNMEDLSLWS
# ADDIGLTGRTPTIGDLLKQQGDEASMYGMGRDDSQAVLLRKKVEASQGRIFRQPSAADSSALSLATLGPLEVWSEITSRWKENPFDFLTDGARAVKAF
# ARPWPTKVVGKPSNIQFDIASTSFKLTVLVRSEDKLNEEGIDDKDLATEVYVPLVHFAHPRLLPSRENEQTPSEDDTLDGGEVRIAPSPSEISTSTTP
# TITNASVGWEGLTEQPDVLDIEVTVSAGRWSVQGQTIKWWYEVPQVGEVDREYTMEIRRTGGAIKTNESLNYESWFEQLCPDLCPESCCVM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g82
###
# start gene g83
Scaffold_1	AUGUSTUS	gene	516825	517196	0.59	-	.	g83
Scaffold_1	AUGUSTUS	transcript	516825	517196	0.59	-	.	g83.t1
Scaffold_1	AUGUSTUS	stop_codon	516825	516827	.	-	0	transcript_id "g83.t1"; gene_id "g83";
Scaffold_1	AUGUSTUS	CDS	516825	517196	0.59	-	0	transcript_id "g83.t1"; gene_id "g83";
Scaffold_1	AUGUSTUS	start_codon	517194	517196	.	-	0	transcript_id "g83.t1"; gene_id "g83";
# protein sequence = [MPPVPSISPATGNPTTSSFIHTLDSNFVDNAGRTLLLRGVNLSGSSKAPVDQPSYILDNFWESAEHGGKTFIGRPLDL
# DDGSADVHLARLRGWGFNMLRFPITWEALEHEGPYVPLSGIQDIP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g83
###
# start gene g84
Scaffold_1	AUGUSTUS	gene	517573	518232	1	+	.	g84
Scaffold_1	AUGUSTUS	transcript	517573	518232	1	+	.	g84.t1
Scaffold_1	AUGUSTUS	start_codon	517573	517575	.	+	0	transcript_id "g84.t1"; gene_id "g84";
Scaffold_1	AUGUSTUS	CDS	517573	518232	1	+	0	transcript_id "g84.t1"; gene_id "g84";
Scaffold_1	AUGUSTUS	stop_codon	518230	518232	.	+	0	transcript_id "g84.t1"; gene_id "g84";
# protein sequence = [MSTLSTVTVPTSSKTHATVTSLPTVSMSASSKTSTTVTSTALLTVSVSASSKTSKTVTSSALLTVTVTSSSKTGATVS
# SLPAVSVSASSKTSTTFTSSTFLAVSMTSNNETGTTVTSLLAVSVLTGSKAGATFSSFPTVSVSASSKTNTTVTSSTFLAVSVTSSNKTGATVTSLLA
# IAMLANSEASTTIPSLPAVSVSASSKAGTAIIFRALGCRRAYE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g84
###
# start gene g85
Scaffold_1	AUGUSTUS	gene	523710	524393	0.73	+	.	g85
Scaffold_1	AUGUSTUS	transcript	523710	524393	0.73	+	.	g85.t1
Scaffold_1	AUGUSTUS	start_codon	523710	523712	.	+	0	transcript_id "g85.t1"; gene_id "g85";
Scaffold_1	AUGUSTUS	CDS	523710	524393	0.73	+	0	transcript_id "g85.t1"; gene_id "g85";
Scaffold_1	AUGUSTUS	stop_codon	524391	524393	.	+	0	transcript_id "g85.t1"; gene_id "g85";
# protein sequence = [MSVLNKAEIHAPIQSKLLGVAKDMEERLRPIFFQLQLERDEKRTLQEKVNLWQHRVTQVEASEVEVARLKKELERAKR
# ANQGMAAENCRLTKRLEAEVTESEKLRKDVIDERRLNKERDELVQQLERELENAGKLVRYKRPRFSRSLISEQAGLTNKKLKVLARSSNRMPFANSAD
# DSLIVEPAVLECSSSVSLHGNDHHQLHKGHSMKWESFLKVVNLVLMDSDSI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g85
###
# start gene g86
Scaffold_1	AUGUSTUS	gene	525852	526959	0.89	-	.	g86
Scaffold_1	AUGUSTUS	transcript	525852	526959	0.89	-	.	g86.t1
Scaffold_1	AUGUSTUS	stop_codon	525852	525854	.	-	0	transcript_id "g86.t1"; gene_id "g86";
Scaffold_1	AUGUSTUS	CDS	525852	526743	0.89	-	1	transcript_id "g86.t1"; gene_id "g86";
Scaffold_1	AUGUSTUS	CDS	526826	526959	0.96	-	0	transcript_id "g86.t1"; gene_id "g86";
Scaffold_1	AUGUSTUS	start_codon	526957	526959	.	-	0	transcript_id "g86.t1"; gene_id "g86";
# protein sequence = [MSEVQEFDAIIVGAGFAGVHQLIQFRKLGLKVRLLEAGGGLGGTWVDSENPIYQFSDPELYKDWNYTEKFPGWREIQQ
# YFEYVDKKLDLSRDVSYNSRVVSAVWDDTTDRWTLTTEAGDVYRVQWLSLCTGIGSKYYIPPYKGLDSFKGEVHHTSRWPTDYDLKGKKVGVIGTGST
# GVQFIQEIAPVVEHLTVFQRTPNLSLPMKQTKLDLEEQKKLKEYLYPIQFGRRNQTFSGYLHDLDMKPTLEATLEERVLNYEDKWEKGGFHFWIGSYG
# DIFFNQDANDVAYAFWRDKTRARINDPEMKDKLAPMKSPHPFGVKRPSLEQVSSNFSIYENMILTGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g86
###
# start gene g87
Scaffold_1	AUGUSTUS	gene	528475	528954	0.72	-	.	g87
Scaffold_1	AUGUSTUS	transcript	528475	528954	0.72	-	.	g87.t1
Scaffold_1	AUGUSTUS	stop_codon	528475	528477	.	-	0	transcript_id "g87.t1"; gene_id "g87";
Scaffold_1	AUGUSTUS	CDS	528475	528954	0.72	-	0	transcript_id "g87.t1"; gene_id "g87";
Scaffold_1	AUGUSTUS	start_codon	528952	528954	.	-	0	transcript_id "g87.t1"; gene_id "g87";
# protein sequence = [MVDNGVLRLNEAQQVHEMLNQNLGINLTVVDASDLFLSRLQDVEDPEKKRKIIGNTFINVFEEEATKIEAAANEEEKQ
# GAEAKGRIEWLLQGTLYPDVIESISFKGPSATIKTHHNVGGLLKDMKLKLIEPLRELFKGIVGSLPSDQHIKNADIDFPVF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g87
###
# start gene g88
Scaffold_1	AUGUSTUS	gene	535946	536362	0.45	+	.	g88
Scaffold_1	AUGUSTUS	transcript	535946	536362	0.45	+	.	g88.t1
Scaffold_1	AUGUSTUS	start_codon	535946	535948	.	+	0	transcript_id "g88.t1"; gene_id "g88";
Scaffold_1	AUGUSTUS	CDS	535946	536362	0.45	+	0	transcript_id "g88.t1"; gene_id "g88";
Scaffold_1	AUGUSTUS	stop_codon	536360	536362	.	+	0	transcript_id "g88.t1"; gene_id "g88";
# protein sequence = [MINGGSTHFISATPYQVHVSAAKAAVDALSNVLAVEEGPHGVRSNVIAPGFIAGTEGFDRLSNKDDQSHGFSAPLGRF
# GDVKDVANAAVFLFSDAASYVTGQVIPVDGGSEHLRSTFFPYPQSVLDPTSMQKLMKGKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g88
###
# start gene g89
Scaffold_1	AUGUSTUS	gene	537947	538471	0.88	+	.	g89
Scaffold_1	AUGUSTUS	transcript	537947	538471	0.88	+	.	g89.t1
Scaffold_1	AUGUSTUS	start_codon	537947	537949	.	+	0	transcript_id "g89.t1"; gene_id "g89";
Scaffold_1	AUGUSTUS	CDS	537947	538471	0.88	+	0	transcript_id "g89.t1"; gene_id "g89";
Scaffold_1	AUGUSTUS	stop_codon	538469	538471	.	+	0	transcript_id "g89.t1"; gene_id "g89";
# protein sequence = [MELQLVYRILRKISDWAVTGYYSEILIDGPENVLNVQQGVDGKGAKRTNGPVILCSSHHNEMIDIATLAMTMPKCQGE
# RRHVSFWAKDSMFKNTVGGWVMRSSGAIPVKRNPNKSESAELNRKGKLGKDNRSESLFASTTGTLALGKVVGVFPEGTSLPNRESSKSCLVRQGLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g89
###
# start gene g90
Scaffold_1	AUGUSTUS	gene	549893	550513	0.42	+	.	g90
Scaffold_1	AUGUSTUS	transcript	549893	550513	0.42	+	.	g90.t1
Scaffold_1	AUGUSTUS	start_codon	549893	549895	.	+	0	transcript_id "g90.t1"; gene_id "g90";
Scaffold_1	AUGUSTUS	CDS	549893	550513	0.42	+	0	transcript_id "g90.t1"; gene_id "g90";
Scaffold_1	AUGUSTUS	stop_codon	550511	550513	.	+	0	transcript_id "g90.t1"; gene_id "g90";
# protein sequence = [MEETHVAVSPSKKRPFLQFRSKSSRTIPTSSSHPPSSSLDLPRPNFLGEIKSISSPVTVELGHASSPSIATNASWEHI
# QGSTSLDLLRSTDNPPVNTFLHGKHSPAPGIPFPSQRESRGGSLFLKLSTAVARPFSAGSIHPDLDACSSAASSTTNSIRRTQSRPPEATEALKVTPL
# RTNFPSSFSSPSSPIGANPTTRALAAMEVL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g90
###
# start gene g91
Scaffold_1	AUGUSTUS	gene	551429	552178	0.93	+	.	g91
Scaffold_1	AUGUSTUS	transcript	551429	552178	0.93	+	.	g91.t1
Scaffold_1	AUGUSTUS	start_codon	551429	551431	.	+	0	transcript_id "g91.t1"; gene_id "g91";
Scaffold_1	AUGUSTUS	CDS	551429	552178	0.93	+	0	transcript_id "g91.t1"; gene_id "g91";
Scaffold_1	AUGUSTUS	stop_codon	552176	552178	.	+	0	transcript_id "g91.t1"; gene_id "g91";
# protein sequence = [MFSPTPTSFPTYPTPTVEIIDGKILALPPETTSTVTEFVTAIVTVLPISTSTSTVEVVVTDTVTPSTAVPATTTVDIV
# TVTVVPSPSKPTTWTAPAQMTDLSAFNITNFAGGSQNLRIVDNLSTNSSTELSNSSAPTEVVTFEVSSDHSSNNDSSTVWTNATSALQILYPENSIDP
# ARKPQGGAEFYAAPLELKNAKNVTLEYSVFFPQAFDWVLGGKLPGLYGGRQGCSGGDAAVDCFSTRLMWRKMV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g91
###
# start gene g92
Scaffold_1	AUGUSTUS	gene	553909	554307	0.39	-	.	g92
Scaffold_1	AUGUSTUS	transcript	553909	554307	0.39	-	.	g92.t1
Scaffold_1	AUGUSTUS	stop_codon	553909	553911	.	-	0	transcript_id "g92.t1"; gene_id "g92";
Scaffold_1	AUGUSTUS	CDS	553909	554307	0.39	-	0	transcript_id "g92.t1"; gene_id "g92";
Scaffold_1	AUGUSTUS	start_codon	554305	554307	.	-	0	transcript_id "g92.t1"; gene_id "g92";
# protein sequence = [MSMVGYQGLCAGIPSSRVLSRNSFEDIFAEVERPVLQSIPLKSDAVTDVNCVFRRRCVHCRRISKISRRISSGTGTTS
# RGVNHPSIVDTFMTGELVGGIPDFDFIHSVAQRQRGCRDSTGQEAGPEEDEQAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g92
###
# start gene g93
Scaffold_1	AUGUSTUS	gene	555132	555858	0.78	-	.	g93
Scaffold_1	AUGUSTUS	transcript	555132	555858	0.78	-	.	g93.t1
Scaffold_1	AUGUSTUS	stop_codon	555132	555134	.	-	0	transcript_id "g93.t1"; gene_id "g93";
Scaffold_1	AUGUSTUS	CDS	555132	555622	1	-	2	transcript_id "g93.t1"; gene_id "g93";
Scaffold_1	AUGUSTUS	CDS	555681	555858	0.78	-	0	transcript_id "g93.t1"; gene_id "g93";
Scaffold_1	AUGUSTUS	start_codon	555856	555858	.	-	0	transcript_id "g93.t1"; gene_id "g93";
# protein sequence = [MSSFDSDPNNFDNTNNESQNRRREFTGQPGGGYDQQASRFDNSNSMGGGGFDQQTPGHDQFSASGYNDDSFGPQSQSQ
# TGRSEFKNERSYGGDSYGQSPSLILTHSPRSNQSLLPKGAGNGTESNRSTGYGTGNDFSGDRNDDSSYGSGNNNSNNKPSFGDKMKGTCSFLHQTAKF
# LCAHDFVLLGTAEVAAGKMTKNPGMVERGQDRKVCYPSIALTQEFR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g93
###
# start gene g94
Scaffold_1	AUGUSTUS	gene	556305	557037	0.25	-	.	g94
Scaffold_1	AUGUSTUS	transcript	556305	557037	0.25	-	.	g94.t1
Scaffold_1	AUGUSTUS	stop_codon	556305	556307	.	-	0	transcript_id "g94.t1"; gene_id "g94";
Scaffold_1	AUGUSTUS	CDS	556305	556594	0.33	-	2	transcript_id "g94.t1"; gene_id "g94";
Scaffold_1	AUGUSTUS	CDS	556669	556812	0.65	-	2	transcript_id "g94.t1"; gene_id "g94";
Scaffold_1	AUGUSTUS	CDS	556872	557037	0.59	-	0	transcript_id "g94.t1"; gene_id "g94";
Scaffold_1	AUGUSTUS	start_codon	557035	557037	.	-	0	transcript_id "g94.t1"; gene_id "g94";
# protein sequence = [MASFDSNSNDNFDSTGRDSQNRQVQFDQSDTVGSGMAGVGAGGYNDQQNQTSGRDQFSSSANNDDSFGADSQTGQGYG
# ASTNQSDFAQSYGDTTGSQQGSQGTGNGNGSVNEFENNNHSAGNYGSGNDNTSSGYGTSDDFSGNRNDNSYGSENTKPSFGDKVKGTFIPSCIHSNTN
# DLSLFFQVLLKLQLVKSQGTVAW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g94
###
# start gene g95
Scaffold_1	AUGUSTUS	gene	563196	564547	0.47	+	.	g95
Scaffold_1	AUGUSTUS	transcript	563196	564547	0.47	+	.	g95.t1
Scaffold_1	AUGUSTUS	start_codon	563196	563198	.	+	0	transcript_id "g95.t1"; gene_id "g95";
Scaffold_1	AUGUSTUS	CDS	563196	563449	0.9	+	0	transcript_id "g95.t1"; gene_id "g95";
Scaffold_1	AUGUSTUS	CDS	563971	564547	0.54	+	1	transcript_id "g95.t1"; gene_id "g95";
Scaffold_1	AUGUSTUS	stop_codon	564545	564547	.	+	0	transcript_id "g95.t1"; gene_id "g95";
# protein sequence = [MLFTVPSPSLPCTARLSPTTPDHSNTSNPIGKFLDIEAAASDADSNGEYDTSVNKYEVDSVIVADEAGDGSPIEWSPS
# PSRGHVFNAPMSPLPPSKLISNCPSCRTYYASDDPVFTDLVSFPSSSQRHGSVQHPGAANTVSSHLDPTSPRPFPISSNSVDADVGLQVDDDSSSYCY
# PPEEPTIPTSAPTLSSALSADEYDDMDIDSAADFRSSEHCELLHLIYHLTVRRLVAYSSLTSLPRFCVKEKGRNLMGTPTNQSNTQYASSLLSNLFNS
# KG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g95
###
# start gene g96
Scaffold_1	AUGUSTUS	gene	567245	567950	0.25	+	.	g96
Scaffold_1	AUGUSTUS	transcript	567245	567950	0.25	+	.	g96.t1
Scaffold_1	AUGUSTUS	start_codon	567245	567247	.	+	0	transcript_id "g96.t1"; gene_id "g96";
Scaffold_1	AUGUSTUS	CDS	567245	567455	0.35	+	0	transcript_id "g96.t1"; gene_id "g96";
Scaffold_1	AUGUSTUS	CDS	567514	567950	0.7	+	2	transcript_id "g96.t1"; gene_id "g96";
Scaffold_1	AUGUSTUS	stop_codon	567948	567950	.	+	0	transcript_id "g96.t1"; gene_id "g96";
# protein sequence = [MMRLAPSKDLDVFASLRGKVSPAVTSKITTPSPPLEIKPSTPAPKAPVAPPRLIRRNRELENLKTDASSFLASPRSAR
# SKDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRSRKVAPAASKGKARQIVVTDEDSASNEVESED
# EDEEEDSAPPPKRLKTTSSISGKVYSSFISFYFTNLMGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g96
###
# start gene g97
Scaffold_1	AUGUSTUS	gene	568862	569206	0.46	+	.	g97
Scaffold_1	AUGUSTUS	transcript	568862	569206	0.46	+	.	g97.t1
Scaffold_1	AUGUSTUS	start_codon	568862	568864	.	+	0	transcript_id "g97.t1"; gene_id "g97";
Scaffold_1	AUGUSTUS	CDS	568862	569206	0.46	+	0	transcript_id "g97.t1"; gene_id "g97";
Scaffold_1	AUGUSTUS	stop_codon	569204	569206	.	+	0	transcript_id "g97.t1"; gene_id "g97";
# protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGAS
# SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g97
###
# start gene g98
Scaffold_1	AUGUSTUS	gene	571205	571727	0.12	+	.	g98
Scaffold_1	AUGUSTUS	transcript	571205	571727	0.12	+	.	g98.t1
Scaffold_1	AUGUSTUS	start_codon	571205	571207	.	+	0	transcript_id "g98.t1"; gene_id "g98";
Scaffold_1	AUGUSTUS	CDS	571205	571219	0.12	+	0	transcript_id "g98.t1"; gene_id "g98";
Scaffold_1	AUGUSTUS	CDS	571311	571727	0.19	+	0	transcript_id "g98.t1"; gene_id "g98";
Scaffold_1	AUGUSTUS	stop_codon	571725	571727	.	+	0	transcript_id "g98.t1"; gene_id "g98";
# protein sequence = [MFLLTQAYQSCSCSSRIFNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQ
# DSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g98
###
# start gene g99
Scaffold_1	AUGUSTUS	gene	571988	572671	0.65	-	.	g99
Scaffold_1	AUGUSTUS	transcript	571988	572671	0.65	-	.	g99.t1
Scaffold_1	AUGUSTUS	stop_codon	571988	571990	.	-	0	transcript_id "g99.t1"; gene_id "g99";
Scaffold_1	AUGUSTUS	CDS	571988	572671	0.65	-	0	transcript_id "g99.t1"; gene_id "g99";
Scaffold_1	AUGUSTUS	start_codon	572669	572671	.	-	0	transcript_id "g99.t1"; gene_id "g99";
# protein sequence = [MILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANK
# VAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHEL
# IDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g99
###
# start gene g100
Scaffold_1	AUGUSTUS	gene	573343	574415	0.37	-	.	g100
Scaffold_1	AUGUSTUS	transcript	573343	574415	0.37	-	.	g100.t1
Scaffold_1	AUGUSTUS	stop_codon	573343	573345	.	-	0	transcript_id "g100.t1"; gene_id "g100";
Scaffold_1	AUGUSTUS	CDS	573343	573857	0.86	-	2	transcript_id "g100.t1"; gene_id "g100";
Scaffold_1	AUGUSTUS	CDS	573995	574415	0.38	-	0	transcript_id "g100.t1"; gene_id "g100";
Scaffold_1	AUGUSTUS	start_codon	574413	574415	.	-	0	transcript_id "g100.t1"; gene_id "g100";
# protein sequence = [MASCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLA
# VDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGE
# PINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSS
# EGNRLDELIPLIGKYLSNPSDESWVKCQKMNGLNLLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g100
###
# start gene g101
Scaffold_1	AUGUSTUS	gene	575444	576700	0.37	-	.	g101
Scaffold_1	AUGUSTUS	transcript	575444	576700	0.37	-	.	g101.t1
Scaffold_1	AUGUSTUS	stop_codon	575444	575446	.	-	0	transcript_id "g101.t1"; gene_id "g101";
Scaffold_1	AUGUSTUS	CDS	575444	575921	1	-	1	transcript_id "g101.t1"; gene_id "g101";
Scaffold_1	AUGUSTUS	CDS	575977	576253	0.54	-	2	transcript_id "g101.t1"; gene_id "g101";
Scaffold_1	AUGUSTUS	CDS	576328	576700	0.69	-	0	transcript_id "g101.t1"; gene_id "g101";
Scaffold_1	AUGUSTUS	start_codon	576698	576700	.	-	0	transcript_id "g101.t1"; gene_id "g101";
# protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV
# GTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQ
# VFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTES
# FQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKR
# LTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g101
###
# start gene g102
Scaffold_1	AUGUSTUS	gene	577083	577757	0.49	-	.	g102
Scaffold_1	AUGUSTUS	transcript	577083	577757	0.49	-	.	g102.t1
Scaffold_1	AUGUSTUS	stop_codon	577083	577085	.	-	0	transcript_id "g102.t1"; gene_id "g102";
Scaffold_1	AUGUSTUS	CDS	577083	577757	0.49	-	0	transcript_id "g102.t1"; gene_id "g102";
Scaffold_1	AUGUSTUS	start_codon	577755	577757	.	-	0	transcript_id "g102.t1"; gene_id "g102";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA
# ALSPAIRKLLCARYAIGESVQGLKRITTYQLYPKMEKLKFWTIHLGYR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g102
###
# start gene g103
Scaffold_1	AUGUSTUS	gene	577787	578107	0.4	-	.	g103
Scaffold_1	AUGUSTUS	transcript	577787	578107	0.4	-	.	g103.t1
Scaffold_1	AUGUSTUS	stop_codon	577787	577789	.	-	0	transcript_id "g103.t1"; gene_id "g103";
Scaffold_1	AUGUSTUS	CDS	577787	578107	0.4	-	0	transcript_id "g103.t1"; gene_id "g103";
Scaffold_1	AUGUSTUS	start_codon	578105	578107	.	-	0	transcript_id "g103.t1"; gene_id "g103";
# protein sequence = [MPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEE
# LSDRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g103
###
# start gene g104
Scaffold_1	AUGUSTUS	gene	578418	579312	0.57	-	.	g104
Scaffold_1	AUGUSTUS	transcript	578418	579312	0.57	-	.	g104.t1
Scaffold_1	AUGUSTUS	stop_codon	578418	578420	.	-	0	transcript_id "g104.t1"; gene_id "g104";
Scaffold_1	AUGUSTUS	CDS	578418	578773	0.66	-	2	transcript_id "g104.t1"; gene_id "g104";
Scaffold_1	AUGUSTUS	CDS	578835	579312	0.64	-	0	transcript_id "g104.t1"; gene_id "g104";
Scaffold_1	AUGUSTUS	start_codon	579310	579312	.	-	0	transcript_id "g104.t1"; gene_id "g104";
# protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT
# RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNKTVVKDVSVTSMSDRRK
# EDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTKNNSK
# WLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g104
###
# start gene g105
Scaffold_1	AUGUSTUS	gene	581775	582848	1	+	.	g105
Scaffold_1	AUGUSTUS	transcript	581775	582848	1	+	.	g105.t1
Scaffold_1	AUGUSTUS	start_codon	581775	581777	.	+	0	transcript_id "g105.t1"; gene_id "g105";
Scaffold_1	AUGUSTUS	CDS	581775	582848	1	+	0	transcript_id "g105.t1"; gene_id "g105";
Scaffold_1	AUGUSTUS	stop_codon	582846	582848	.	+	0	transcript_id "g105.t1"; gene_id "g105";
# protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN
# EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA
# SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKGWETPFRTGLPETE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g105
###
# start gene g106
Scaffold_1	AUGUSTUS	gene	584637	585482	0.37	+	.	g106
Scaffold_1	AUGUSTUS	transcript	584637	585482	0.37	+	.	g106.t1
Scaffold_1	AUGUSTUS	start_codon	584637	584639	.	+	0	transcript_id "g106.t1"; gene_id "g106";
Scaffold_1	AUGUSTUS	CDS	584637	585482	0.37	+	0	transcript_id "g106.t1"; gene_id "g106";
Scaffold_1	AUGUSTUS	stop_codon	585480	585482	.	+	0	transcript_id "g106.t1"; gene_id "g106";
# protein sequence = [MRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGY
# LPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYR
# LDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKK
# HPTAAKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g106
###
# start gene g107
Scaffold_1	AUGUSTUS	gene	592625	593469	0.38	+	.	g107
Scaffold_1	AUGUSTUS	transcript	592625	593469	0.38	+	.	g107.t1
Scaffold_1	AUGUSTUS	start_codon	592625	592627	.	+	0	transcript_id "g107.t1"; gene_id "g107";
Scaffold_1	AUGUSTUS	CDS	592625	592855	0.44	+	0	transcript_id "g107.t1"; gene_id "g107";
Scaffold_1	AUGUSTUS	CDS	592908	593179	0.6	+	0	transcript_id "g107.t1"; gene_id "g107";
Scaffold_1	AUGUSTUS	CDS	593247	593469	0.78	+	1	transcript_id "g107.t1"; gene_id "g107";
Scaffold_1	AUGUSTUS	stop_codon	593467	593469	.	+	0	transcript_id "g107.t1"; gene_id "g107";
# protein sequence = [MVLFDAFSNSCLKRMIFNFNHGTEVAALQRQGRVGGDMIPFGTRVPKGGAPADGLRPFEGINATTTSGVDEFFAQAEN
# AMAYDKVAKYLDPDLYHEIQRRTIDSEKLGRIGGTVYSCHNYMAIQHLENTDACRSFCSQLELIRNHQYEMAFVYSQMGYWIETESNTFCLVHGTMLP
# AEKTAAQMRTRTRLRDGQPAGGGGDVPVSNGQHKPTRERDNRRAAEHVRIQREREQRDAYWNIAE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g107
###
# start gene g108
Scaffold_1	AUGUSTUS	gene	596354	597867	0.12	+	.	g108
Scaffold_1	AUGUSTUS	transcript	596354	597867	0.12	+	.	g108.t1
Scaffold_1	AUGUSTUS	start_codon	596354	596356	.	+	0	transcript_id "g108.t1"; gene_id "g108";
Scaffold_1	AUGUSTUS	CDS	596354	596391	0.47	+	0	transcript_id "g108.t1"; gene_id "g108";
Scaffold_1	AUGUSTUS	CDS	596456	596661	0.49	+	1	transcript_id "g108.t1"; gene_id "g108";
Scaffold_1	AUGUSTUS	CDS	596775	596962	0.28	+	2	transcript_id "g108.t1"; gene_id "g108";
Scaffold_1	AUGUSTUS	CDS	597073	597087	0.79	+	0	transcript_id "g108.t1"; gene_id "g108";
Scaffold_1	AUGUSTUS	CDS	597161	597187	0.84	+	0	transcript_id "g108.t1"; gene_id "g108";
Scaffold_1	AUGUSTUS	CDS	597247	597867	0.97	+	0	transcript_id "g108.t1"; gene_id "g108";
Scaffold_1	AUGUSTUS	stop_codon	597865	597867	.	+	0	transcript_id "g108.t1"; gene_id "g108";
# protein sequence = [MLADNVELKIQANTNDDEELDELGMDEFSECVKFLRPFIIRLNFHSDELRGPAQAFDFGSDAEDDEPEVIIGKSKKSK
# QSEQQAAAEDALDVEEMQQAAFNEEDDDDDLDMDEDEEETDGEPFRLPTREENEAESKAGGPDVHVISKFTLFQLFPVAEAIEFFEANEVPRPVTIRT
# NTLRTRRRDLAQALINRGVNLEPIGKWTNVGLQVFESSVPIGKCAELSCKCIIEHSLGATPEYLAGHYMLQAASSFLPVIALSPQPNERVLDMASAPG
# GKTTHIAALLQNTGIVFANDANKARTKSLSANVHRLGCKNVVVCSYDGREFPKVIGGFDRVLLDAPCSGTGVISKDSSVKVNKVCTYFPH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/6
# CDS introns: 0/5
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g108
###
# start gene g109
Scaffold_1	AUGUSTUS	gene	598195	598392	0.98	+	.	g109
Scaffold_1	AUGUSTUS	transcript	598195	598392	0.98	+	.	g109.t1
Scaffold_1	AUGUSTUS	start_codon	598195	598197	.	+	0	transcript_id "g109.t1"; gene_id "g109";
Scaffold_1	AUGUSTUS	CDS	598195	598392	0.98	+	0	transcript_id "g109.t1"; gene_id "g109";
Scaffold_1	AUGUSTUS	stop_codon	598390	598392	.	+	0	transcript_id "g109.t1"; gene_id "g109";
# protein sequence = [MDGFYVAKFKVEKRGKISKASDSTAEVGLTGIEEEGEQIASEKEKIAFDDDEDRPYIEGMPSLHS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g109
###
# start gene g110
Scaffold_1	AUGUSTUS	gene	600591	601835	0.64	+	.	g110
Scaffold_1	AUGUSTUS	transcript	600591	601835	0.64	+	.	g110.t1
Scaffold_1	AUGUSTUS	start_codon	600591	600593	.	+	0	transcript_id "g110.t1"; gene_id "g110";
Scaffold_1	AUGUSTUS	CDS	600591	600749	0.82	+	0	transcript_id "g110.t1"; gene_id "g110";
Scaffold_1	AUGUSTUS	CDS	600798	600977	0.87	+	0	transcript_id "g110.t1"; gene_id "g110";
Scaffold_1	AUGUSTUS	CDS	601029	601205	0.95	+	0	transcript_id "g110.t1"; gene_id "g110";
Scaffold_1	AUGUSTUS	CDS	601551	601835	1	+	0	transcript_id "g110.t1"; gene_id "g110";
Scaffold_1	AUGUSTUS	stop_codon	601833	601835	.	+	0	transcript_id "g110.t1"; gene_id "g110";
# protein sequence = [MSAMETVAAPVALVEEVKPIESTTEPAAPVETTPAPAEDAPKAEEATTVRLIFVEAKAEVRVFRILRACYLTYSVQET
# HAAAAEEPVASTEPASEAAPAEETTKDAAKDEAKPAEESSKKEDAPKSPTLLAKLLAPFKSDKHKAEKKVKAAKSPKKEKKKEEKKEEKKETSEKEEK
# VAKPTKVGRRLSARVGDFFKPKPKSEVSTPAKVDEHPPKIEEPTPVAPLENPASEPTTEAPAATAEATEEAVADKPTETSEAAPVVAAAA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g110
###
# start gene g111
Scaffold_1	AUGUSTUS	gene	602658	605068	0.1	+	.	g111
Scaffold_1	AUGUSTUS	transcript	602658	605068	0.1	+	.	g111.t1
Scaffold_1	AUGUSTUS	start_codon	602658	602660	.	+	0	transcript_id "g111.t1"; gene_id "g111";
Scaffold_1	AUGUSTUS	CDS	602658	602911	0.55	+	0	transcript_id "g111.t1"; gene_id "g111";
Scaffold_1	AUGUSTUS	CDS	603609	604178	0.56	+	1	transcript_id "g111.t1"; gene_id "g111";
Scaffold_1	AUGUSTUS	CDS	604231	604660	0.57	+	1	transcript_id "g111.t1"; gene_id "g111";
Scaffold_1	AUGUSTUS	CDS	604739	605068	0.99	+	0	transcript_id "g111.t1"; gene_id "g111";
Scaffold_1	AUGUSTUS	stop_codon	605066	605068	.	+	0	transcript_id "g111.t1"; gene_id "g111";
# protein sequence = [MVKTRLRYQNCTYSNCKRDVLPGDAMRDIYTRGLVTGDFVLVMGDLVSNIRIDEVVKVHKERRKTNKDAIMTMVVKES
# GAKHRTRTSTVGNKCLIGSSTRVSDNAQIISSVVGRDCFIGAGAIIDNSYIFSGTRIGPGCVIERSIIGSNVDIKENTRIDRGSLVGDGVIIGPNAHL
# KAFGRLSKKRETKTTGDESDADEYADSEEEEVESGNRFLIRFSGSSTLIQIHLPAQDSITVDLGTASNAIVWPPNAPDEDEDSEDVENVKNQRFMRLG
# SASDLAFSDPGSESSGEESESSDEDSDFDRHLDNLPTSSATSLSLDPNGSSTDAIAESEFRNEVRLSLERAFTEGHSVDNAAVELKTLRMASNVPLSR
# VRESVVSAIVEKIKIIDGGGVTQRQEIANVVSRWGPLINKIGGVDMTHCASSERLPLFGQILAALYQDDIIEEDDIREWHQAATSQGLGLSPSVRTDN
# IKRCWEIGSHMIQQFDEQADDSENDSEEEEGEGTEDEDEEGDNSVDEDDEEEDEEDE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g111
###
# start gene g112
Scaffold_1	AUGUSTUS	gene	606775	607263	1	-	.	g112
Scaffold_1	AUGUSTUS	transcript	606775	607263	1	-	.	g112.t1
Scaffold_1	AUGUSTUS	stop_codon	606775	606777	.	-	0	transcript_id "g112.t1"; gene_id "g112";
Scaffold_1	AUGUSTUS	CDS	606775	607263	1	-	0	transcript_id "g112.t1"; gene_id "g112";
Scaffold_1	AUGUSTUS	start_codon	607261	607263	.	-	0	transcript_id "g112.t1"; gene_id "g112";
# protein sequence = [MPSQFSPVEGAGGFQQSNPSILAIASLLGSLQTFKKAGMMAPLRKQSILLTNYLEKLLFQSKYFVPLEEVSTKYKEGK
# GPPGFTIITPRDTKDRGAQLSLLFLPSGTGVMQKIFESLQSHGVIGDERQPDVIRLAPIHLYNNEADCEAAAQYLNRAFDEFEA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g112
###
# start gene g113
Scaffold_1	AUGUSTUS	gene	613342	613937	0.52	+	.	g113
Scaffold_1	AUGUSTUS	transcript	613342	613937	0.52	+	.	g113.t1
Scaffold_1	AUGUSTUS	start_codon	613342	613344	.	+	0	transcript_id "g113.t1"; gene_id "g113";
Scaffold_1	AUGUSTUS	CDS	613342	613389	0.52	+	0	transcript_id "g113.t1"; gene_id "g113";
Scaffold_1	AUGUSTUS	CDS	613461	613937	0.99	+	0	transcript_id "g113.t1"; gene_id "g113";
Scaffold_1	AUGUSTUS	stop_codon	613935	613937	.	+	0	transcript_id "g113.t1"; gene_id "g113";
# protein sequence = [MSDTILLVKETRTCAYAQIRCREIVHTQSEEFHDVPETDYPQKIPRIKKALPPKSAEKFEKSSGGVSTESILLKTLEA
# FFGENSNGQVVVQQVTDDGEMVIEFLDDLSDDGDDGEDVADKITNVLRAAGYNIKGEERNKQTTPGDSDKKRQDRSSDSSSSEKQAALQEQVRDEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g113
###
# start gene g114
Scaffold_1	AUGUSTUS	gene	615182	616906	0.79	-	.	g114
Scaffold_1	AUGUSTUS	transcript	615182	616906	0.79	-	.	g114.t1
Scaffold_1	AUGUSTUS	stop_codon	615182	615184	.	-	0	transcript_id "g114.t1"; gene_id "g114";
Scaffold_1	AUGUSTUS	CDS	615182	616906	0.79	-	0	transcript_id "g114.t1"; gene_id "g114";
Scaffold_1	AUGUSTUS	start_codon	616904	616906	.	-	0	transcript_id "g114.t1"; gene_id "g114";
# protein sequence = [MTTDNVVKLIDFGTATVFHYPGKTTHTKAKGVVGSDPYLAPEVLADEEYDPRKTDVWSVAVIFLCMVLRRFPWKSPDV
# KNDASFRAFVNAHPDLSVPKTTKPKALTSTSQVELGLGQTIKKPPIPIRHSTMPSEMKIAAASPRKDLLNSIEVDQNLASPTASSYRVPSPSSSSFSS
# DYDDDDESERSDSQLSHTPSVVSKQRNSERQFALATSPRISRSTATLPAFVLGAIQNDLYNELSIAGEVDMDPSVRRFGRPGNSTESLPVSASRTFGI
# TNGIFNGGINTAPATPGSTVPPPASPIGLLSAPYMSEDELPTPKVANGIIPLPPASALSSRTVRARSATLNSIGGPELLASMKEDHSVSNGIPTTSPM
# ASAPINSPTSDMIPNITISEREPETPKELPAPEQTTRRRQRSDSVTTFHGGGAESIFRLLPRETRPALRRMLHVEPGARCTLTDLLKGRGKHGNLLCG
# CQAGFPHLNIDGSISTLTGTTIGGGKEPGLNGSVNGDSGTNSSTSTLSTVHQPYCVDHDCEPEEEDNGDPWLTSIIPCSTLGVKPDHVHIKVAIDEKA
# GKRKLF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g114
###
# start gene g115
Scaffold_1	AUGUSTUS	gene	623615	624069	0.35	-	.	g115
Scaffold_1	AUGUSTUS	transcript	623615	624069	0.35	-	.	g115.t1
Scaffold_1	AUGUSTUS	stop_codon	623615	623617	.	-	0	transcript_id "g115.t1"; gene_id "g115";
Scaffold_1	AUGUSTUS	CDS	623615	623889	0.35	-	2	transcript_id "g115.t1"; gene_id "g115";
Scaffold_1	AUGUSTUS	CDS	624051	624069	0.96	-	0	transcript_id "g115.t1"; gene_id "g115";
Scaffold_1	AUGUSTUS	start_codon	624067	624069	.	-	0	transcript_id "g115.t1"; gene_id "g115";
# protein sequence = [MGSIVDPSCLLAVNAQGNIDWIVHDVKDSSIQETLLQKGLLNTDVEIVALQEGQFIMPGFVDTHTVCDIYFSGSLNRT
# DPRISMLLKYPILERESTP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g115
###
# start gene g116
Scaffold_1	AUGUSTUS	gene	641886	644194	0.84	-	.	g116
Scaffold_1	AUGUSTUS	transcript	641886	644194	0.84	-	.	g116.t1
Scaffold_1	AUGUSTUS	stop_codon	641886	641888	.	-	0	transcript_id "g116.t1"; gene_id "g116";
Scaffold_1	AUGUSTUS	CDS	641886	642487	0.94	-	2	transcript_id "g116.t1"; gene_id "g116";
Scaffold_1	AUGUSTUS	CDS	642544	644194	0.84	-	0	transcript_id "g116.t1"; gene_id "g116";
Scaffold_1	AUGUSTUS	start_codon	644192	644194	.	-	0	transcript_id "g116.t1"; gene_id "g116";
# protein sequence = [MVAEIEVMVRGIEDEKVEWEDREKTRDVLGRIEWGEGNGSGSGGSGKEWVGRPKPGRVLVEESVYLPPSPIPPPPTSS
# SSSSASPLSPIQIKKSKSSFRRLSDALSSSNPSSPSSSSNQGTQSNKPVKAFSKKDLWVVHFNDVVLLCQRTGLTTVPIWSSGGNGSGSGGGSGNGLE
# RLNKGKDPPGGGLGPGRRQLRVTPRNLYKFIKVETWVIGDVVQPREGVVAMADIERARLQQQQQQQLPPQQQQSYPSKQRSNHNHNHNSLHPSTQPRI
# IPMPPDDENLPRLRPNHLNSNSDPDDSDPDSSDSDRKSKMSFSYWGADKVTIQRPPRTTTNTNPNTNNTPGSGSGSGMTKVIIRGGRGTGVGGSAGSG
# TGRMRVVGLGTRSLTSSSTGSGSGSGAGTPSYRSGVGVPGGGGGGAPQGRIVVPSRRGGGGTGGGHGHGHGHLGHGHGHLGGGYGVGVHGHVIPPSAY
# SRESSANAKFGSRLVSERDRGERERDREKDRDRDRDRDRERDRDRDRERDRDRGDKEKDKDKDKEKDKDKDKEKERPSSRPKATVTRSPAGASTPVTA
# SASSTASASASSSTPTPSSNSNPNSNSNPNTLPPPPRITPSTSQTSARSRRSSTTTATTTTTPVPVPVPVPVPVPTSTPTVQGSAKSKPTTTGGERGE
# RGTGTGGAISRGPSNTGPSASTPGNARGSSSTTSTASTTGTTGTTPKATTGTTPVSPAASEDSGVGLYRQMMAKERRGRGGGCR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g116
###
# start gene g117
Scaffold_1	AUGUSTUS	gene	645906	646328	0.84	-	.	g117
Scaffold_1	AUGUSTUS	transcript	645906	646328	0.84	-	.	g117.t1
Scaffold_1	AUGUSTUS	stop_codon	645906	645908	.	-	0	transcript_id "g117.t1"; gene_id "g117";
Scaffold_1	AUGUSTUS	CDS	645906	646328	0.84	-	0	transcript_id "g117.t1"; gene_id "g117";
Scaffold_1	AUGUSTUS	start_codon	646326	646328	.	-	0	transcript_id "g117.t1"; gene_id "g117";
# protein sequence = [MKAFFSRLHLGSNNTTNTSNPNSTSNNPNSTNGSNTLGGNFSNNFSGTLGNTFGTNSANASREKEIGKLPASLRTWPP
# QPVPVPSPSPSPSTTPASLPPHPLPASVPAAPVRTESRESGRRTSQYAVYKPLPEVLGWEVG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g117
###
# start gene g118
Scaffold_1	AUGUSTUS	gene	654098	655014	0.35	+	.	g118
Scaffold_1	AUGUSTUS	transcript	654098	655014	0.35	+	.	g118.t1
Scaffold_1	AUGUSTUS	start_codon	654098	654100	.	+	0	transcript_id "g118.t1"; gene_id "g118";
Scaffold_1	AUGUSTUS	CDS	654098	654562	0.78	+	0	transcript_id "g118.t1"; gene_id "g118";
Scaffold_1	AUGUSTUS	CDS	654613	655014	0.43	+	0	transcript_id "g118.t1"; gene_id "g118";
Scaffold_1	AUGUSTUS	stop_codon	655012	655014	.	+	0	transcript_id "g118.t1"; gene_id "g118";
# protein sequence = [MAIKRARDIGVRATAEVIRTLEPAGHISELDSDDELDPPTKRTRAMSPVDDVENGSKAPTPPPPSPPMDFEVPGTASF
# DPDELMNFDLDREILAITGFMDTMGSVPSSDLDHMGYTNAPSSVAVAKTCKSAFEPDLLSHLYNYRIDAKYISNEHFRNQPKWWMNDSGCSEHTTFDL
# SDFIEYEDLEEKVLIATATTTAYITGVGTVLINFKDVRGRMHSARIAPVFYMKELSHRLIAQGHFLQDGKTVRGNADKVDFWDKDGLFLSFEPRTHSN
# TIYISKIIRHSLWL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g118
###
# start gene g119
Scaffold_1	AUGUSTUS	gene	655047	656482	0.08	+	.	g119
Scaffold_1	AUGUSTUS	transcript	655047	656482	0.08	+	.	g119.t1
Scaffold_1	AUGUSTUS	start_codon	655047	655049	.	+	0	transcript_id "g119.t1"; gene_id "g119";
Scaffold_1	AUGUSTUS	CDS	655047	655655	0.11	+	0	transcript_id "g119.t1"; gene_id "g119";
Scaffold_1	AUGUSTUS	CDS	656147	656482	0.24	+	0	transcript_id "g119.t1"; gene_id "g119";
Scaffold_1	AUGUSTUS	stop_codon	656480	656482	.	+	0	transcript_id "g119.t1"; gene_id "g119";
# protein sequence = [MHRRMGHPSREALTQLRKHAEGVPTFSIPHEEDLCEGCAKGKMTLRPFPPTNRRASRPFEIIHSDLKEWPTISYHKYK
# YTIFFIDDYTSHGFYCHLKKKSGALPVIKQFIATVKNLYETNVKEWMSDGGGEFRSNALDEFFKNEGIKAQWSSPHITSRMEEPKGLSGLLLRKVNHS
# AFKPVFLIPGGNSLLHTLCMCITALLCLRRSGRVRKPPTRLTGDPRSSTKLPAEQQVERPKRDIQRRAPQPGSSSAEQERPEPEQVPGPSTEHPTPEN
# GEQPSVTPGDEANTLIRLCREGGAELIYFLMAKAVPFEGS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g119
###
# start gene g120
Scaffold_1	AUGUSTUS	gene	657799	658637	0.39	+	.	g120
Scaffold_1	AUGUSTUS	transcript	657799	658637	0.39	+	.	g120.t1
Scaffold_1	AUGUSTUS	start_codon	657799	657801	.	+	0	transcript_id "g120.t1"; gene_id "g120";
Scaffold_1	AUGUSTUS	CDS	657799	658051	0.93	+	0	transcript_id "g120.t1"; gene_id "g120";
Scaffold_1	AUGUSTUS	CDS	658120	658637	0.41	+	2	transcript_id "g120.t1"; gene_id "g120";
Scaffold_1	AUGUSTUS	stop_codon	658635	658637	.	+	0	transcript_id "g120.t1"; gene_id "g120";
# protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQLSTALYTGDGQPV
# QVLTPRPRRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGLVVPAVPAAGSWWTWWTSFSNSP
# DIPNEQRAMLELLSGSRVPLRPLVPSSPLSAVPLTALNPRARSRSQRYSTVRIPENSRRSSSISPWSSMTVPSTSPTNGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g120
###
# start gene g121
Scaffold_1	AUGUSTUS	gene	662251	663246	0.17	+	.	g121
Scaffold_1	AUGUSTUS	transcript	662251	663246	0.17	+	.	g121.t1
Scaffold_1	AUGUSTUS	start_codon	662251	662253	.	+	0	transcript_id "g121.t1"; gene_id "g121";
Scaffold_1	AUGUSTUS	CDS	662251	662439	0.39	+	0	transcript_id "g121.t1"; gene_id "g121";
Scaffold_1	AUGUSTUS	CDS	662555	662859	0.28	+	0	transcript_id "g121.t1"; gene_id "g121";
Scaffold_1	AUGUSTUS	CDS	662934	663246	0.72	+	1	transcript_id "g121.t1"; gene_id "g121";
Scaffold_1	AUGUSTUS	stop_codon	663244	663246	.	+	0	transcript_id "g121.t1"; gene_id "g121";
# protein sequence = [MDFIEQLPMSNGFTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSIVTLEQYIRIYCSYQQD
# DWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEKISWSFQGHQS
# TWYFVLRAQAPRLSSPHSSGFPRLTAGAGYAESFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDDSLGCC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g121
###
# start gene g122
Scaffold_1	AUGUSTUS	gene	665546	666490	0.56	+	.	g122
Scaffold_1	AUGUSTUS	transcript	665546	666490	0.56	+	.	g122.t1
Scaffold_1	AUGUSTUS	start_codon	665546	665548	.	+	0	transcript_id "g122.t1"; gene_id "g122";
Scaffold_1	AUGUSTUS	CDS	665546	666490	0.56	+	0	transcript_id "g122.t1"; gene_id "g122";
Scaffold_1	AUGUSTUS	stop_codon	666488	666490	.	+	0	transcript_id "g122.t1"; gene_id "g122";
# protein sequence = [MAKKIYIDQCAYLDKVLKRCGMENAKMADTPLPAGFQPEPTIGQSNSALRSKFQMVIGSLLYLMLGTRPDISFAVTKL
# AQHAANPSQEHLNKALYICRYLLGTRSYALCYDGESGIGLSAWTDSDWASDPYTRRSQTGFFMKLANGIFSWTSHAQKTIAHSSTEAEYMALSDCSRQ
# VVWIRNLLEELGYKLDAIPIAGDNQGSIFMASNPVTSKHSKHIDIRYHYIREVVERGLVQVFFVDGSNNPADLFTKNLGRIKFELFAQCLDLSSTRPP
# ILRLSVLSDAYRYCFEQSTLLCCSARGCVERGYAVHMPLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g122
###
# start gene g123
Scaffold_1	AUGUSTUS	gene	670028	670417	0.76	+	.	g123
Scaffold_1	AUGUSTUS	transcript	670028	670417	0.76	+	.	g123.t1
Scaffold_1	AUGUSTUS	start_codon	670028	670030	.	+	0	transcript_id "g123.t1"; gene_id "g123";
Scaffold_1	AUGUSTUS	CDS	670028	670162	0.76	+	0	transcript_id "g123.t1"; gene_id "g123";
Scaffold_1	AUGUSTUS	CDS	670244	670417	0.98	+	0	transcript_id "g123.t1"; gene_id "g123";
Scaffold_1	AUGUSTUS	stop_codon	670415	670417	.	+	0	transcript_id "g123.t1"; gene_id "g123";
# protein sequence = [MHAADIKGSIAYAKGLKRVGILTEDEEAKMIAGLEAVGKEWEDGTFEPAPDDEDIHTANERRLVSSLVLSEESYTPDD
# RETTKSLLTCGYGSSKRSRTSKTD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g123
###
# start gene g124
Scaffold_1	AUGUSTUS	gene	671006	671332	0.99	+	.	g124
Scaffold_1	AUGUSTUS	transcript	671006	671332	0.99	+	.	g124.t1
Scaffold_1	AUGUSTUS	start_codon	671006	671008	.	+	0	transcript_id "g124.t1"; gene_id "g124";
Scaffold_1	AUGUSTUS	CDS	671006	671074	0.99	+	0	transcript_id "g124.t1"; gene_id "g124";
Scaffold_1	AUGUSTUS	CDS	671153	671332	0.99	+	0	transcript_id "g124.t1"; gene_id "g124";
Scaffold_1	AUGUSTUS	stop_codon	671330	671332	.	+	0	transcript_id "g124.t1"; gene_id "g124";
# protein sequence = [MPQKKNPDSLELLRGKSGRVFGNMAGFIMTLKGLPSTYNKDLQEDKEPLFDALVNVSMSFKIAEGVIATLDVSFWFII
# DFES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g124
###
# start gene g125
Scaffold_1	AUGUSTUS	gene	678413	680080	0.57	+	.	g125
Scaffold_1	AUGUSTUS	transcript	678413	680080	0.57	+	.	g125.t1
Scaffold_1	AUGUSTUS	start_codon	678413	678415	.	+	0	transcript_id "g125.t1"; gene_id "g125";
Scaffold_1	AUGUSTUS	CDS	678413	680080	0.57	+	0	transcript_id "g125.t1"; gene_id "g125";
Scaffold_1	AUGUSTUS	stop_codon	680078	680080	.	+	0	transcript_id "g125.t1"; gene_id "g125";
# protein sequence = [MVKEAFSSKLVTIIWWFFTVSVSLITLSSYHNDEYHQRCQLTPGDIVDEDSLNPPEFHDHEGIPTISVQAFTPILGTL
# LLSPNVLVGGATRYAVVALLGRIKRVNAMESKPGSDSPNVQIPRLNEVANSQNFSVGSLAEIDDEEEIVIGYFGKEERSLFQKEILFQVVVGMGRLDS
# DEPDAESTGERDQHAIGSSPSDSGAAWQTHTGRTDLEPQIDIVIDEAEAPTQQPPQGFQIISPQREAPDTELALSQVDAKAISQTNNPYFPPLPSSGF
# THIKVTSSGSPMSTSSSGSSSSTPSSTTDTSASGSESSFSPHSNISPRISTSSPSPNSSSSSTARASSSPSMSPPPPFPTGTDTTPFARPASPSSRRS
# DFDMFSSGSTADPFNSNSPVTLASPSVASAFPIATTDLTPQNGLSPPSSYRPDIHAFPHESNWPPSPSRFQRQDTNAFGANISADVSMSSPSINSDIQ
# SYDELDEEGEYDQATIGRLSSMSLVAAVAASGRQYYINLFIFQEKLFLQDIWMISQPIFSCPRLRVFPRILSTGFAGKRALLLEH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g125
###
# start gene g126
Scaffold_1	AUGUSTUS	gene	680319	681185	0.44	+	.	g126
Scaffold_1	AUGUSTUS	transcript	680319	681185	0.44	+	.	g126.t1
Scaffold_1	AUGUSTUS	start_codon	680319	680321	.	+	0	transcript_id "g126.t1"; gene_id "g126";
Scaffold_1	AUGUSTUS	CDS	680319	681185	0.44	+	0	transcript_id "g126.t1"; gene_id "g126";
Scaffold_1	AUGUSTUS	stop_codon	681183	681185	.	+	0	transcript_id "g126.t1"; gene_id "g126";
# protein sequence = [MDESADVRAGVLEALGEVIYTFHEEDKLKIDHNFADTEMKESQTPPEELLKMFLGRTQDRRIIDGQQPLAFEEEERVK
# PVRRIVDKQKASEAFYTDPNRPLICAFNFPAVALTVGRTRWASTLRDTYLWLAESSIPGVKRTLAASLGEMAKIIGEDHAQQDLLPVWGNAFRVPEDD
# VRLKLIDCLAPFIVALPRNGRLEVFNALLDAWSSGAFTSWREREGIAKSLNDLLSVGGLEVTQVVANLLMYALADTVNTVREAAITNVSFMAIFPTYV
# TDSTIKSTSFQVFG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g126
###
# start gene g127
Scaffold_1	AUGUSTUS	gene	684365	685126	0.9	-	.	g127
Scaffold_1	AUGUSTUS	transcript	684365	685126	0.9	-	.	g127.t1
Scaffold_1	AUGUSTUS	stop_codon	684365	684367	.	-	0	transcript_id "g127.t1"; gene_id "g127";
Scaffold_1	AUGUSTUS	CDS	684365	685012	0.97	-	0	transcript_id "g127.t1"; gene_id "g127";
Scaffold_1	AUGUSTUS	CDS	685103	685126	0.9	-	0	transcript_id "g127.t1"; gene_id "g127";
Scaffold_1	AUGUSTUS	start_codon	685124	685126	.	-	0	transcript_id "g127.t1"; gene_id "g127";
# protein sequence = [MSFIQNLVSHSNLTHLTIRGIFAEGPNELVHLLQCVSSVTSLELEDHILIDDARTIRPVLILLVVPWHSGEEGLRVGD
# ISDEDTPRSDEDSDCDPKPQELDYYKTPGEQCLLPRLKDFSLTIRPHRKTLRTLLKVVHSRWIRPETASSSYSVNHQFVVPDTLQMCVCLKKLRVKST
# LVTRLPAQVLTERFHGLQKDLEEFKKDGMEIDIEIPEHRLDDPTWRN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g127
###
# start gene g128
Scaffold_1	AUGUSTUS	gene	692689	695274	0.97	-	.	g128
Scaffold_1	AUGUSTUS	transcript	692689	695274	0.97	-	.	g128.t1
Scaffold_1	AUGUSTUS	stop_codon	692689	692691	.	-	0	transcript_id "g128.t1"; gene_id "g128";
Scaffold_1	AUGUSTUS	CDS	692689	695274	0.97	-	0	transcript_id "g128.t1"; gene_id "g128";
Scaffold_1	AUGUSTUS	start_codon	695272	695274	.	-	0	transcript_id "g128.t1"; gene_id "g128";
# protein sequence = [MNPPPPRQKKGGGGGGSSSHHSAPPKTRSLPVLGTTTEAGISAPGAGESISSGPVTRGRSPLRSASSKGVKRPRSTTP
# PPAVEGGAAVTVTMPPSDSGPSGISGVSAPQSKKTRTSLRTITKPQPEAQSQSQSQRPQSQRNTSKVNIGGGGVSITTPVTSNQGFVRPISTATPAIS
# AQSQNQTSTLTLSEIKSLKSQVDNLIQRDEKSQAVLDQHSAMLDAVLVNMRMLLGDKFVDVNAKGDGSRSPPVQQRKEKGIGEDGNKDGKVSVSAVVQ
# DVDQDELDELDELTPIEKLTPTPSNGIGGSTAVNATSTNAIALAASKSPVPPPSGLIGPAVAGSYEPQRVDPPPRLISVPSGRVPVQAPVPIIAAVPA
# PIPIRDTIRDVPRDSSRDNAAHIAASVPSPHFTQINNGIHTDKLKLKAKAKNPYPNISPVLSAPVISSTAPHVAHPPPPPRDNPPRAIISSARMVNPP
# PNIPAISTLPAISTLPAPAAPLSPASTTSAVDDEEGVDKADGVDGIDRGYIADASHGPTPVVTPALIPRGTNREHRSRSPPRRSRSPLPGRAVRGVHN
# SFFTSRHPLASHGSHVSHRSSHASRPSYKPLASHAPRRLSRSPPPPSHIRRPTSLSRSPTPPHIRYGYPDPYRAQQPQQPNDAQPSTQRHHVYSPLPR
# SRSRSPYSRSPPPYAHSSLSAHPPNPSSRPSQPPRPLHARDNTDMHIDSLVEPYPDYVYTETRDSRDHVDHDEDRLGRSSRPRTSSPKDVQESRSEDT
# EDIRDLNGASDERLGRGGGEGGGGKPDRGNSTGRGDEVDGADAADGGDMELEYPSDDIRDTGIVRDTKDTRDAGDAEHPEDDEDMYYPEEVRYSSSR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g128
###
# start gene g129
Scaffold_1	AUGUSTUS	gene	701916	702422	0.26	+	.	g129
Scaffold_1	AUGUSTUS	transcript	701916	702422	0.26	+	.	g129.t1
Scaffold_1	AUGUSTUS	start_codon	701916	701918	.	+	0	transcript_id "g129.t1"; gene_id "g129";
Scaffold_1	AUGUSTUS	CDS	701916	702422	0.26	+	0	transcript_id "g129.t1"; gene_id "g129";
Scaffold_1	AUGUSTUS	stop_codon	702420	702422	.	+	0	transcript_id "g129.t1"; gene_id "g129";
# protein sequence = [MNTTNMTSKIENVDTVPHVTTVIPTNNTTIRSTYPARRPKPFAALLSNFSSSPLQSEESKQNQPSAYSSLVRKNHILL
# DSACTNHIVNDRQFFHTYDVDGAIAVQTANSGLLSSLASGTCYFETQIKGTNDTLILEMNDCLFALDAPVSLISVARCLNMALPSRYYPT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g129
###
# start gene g130
Scaffold_1	AUGUSTUS	gene	703890	704426	0.78	+	.	g130
Scaffold_1	AUGUSTUS	transcript	703890	704426	0.78	+	.	g130.t1
Scaffold_1	AUGUSTUS	start_codon	703890	703892	.	+	0	transcript_id "g130.t1"; gene_id "g130";
Scaffold_1	AUGUSTUS	CDS	703890	704426	0.78	+	0	transcript_id "g130.t1"; gene_id "g130";
Scaffold_1	AUGUSTUS	stop_codon	704424	704426	.	+	0	transcript_id "g130.t1"; gene_id "g130";
# protein sequence = [MLLRSDANDWIAAEEKEIAGLFELEYLRYTETCPKGKFPIGLKMVYDLKIDGTKKAQLVAQGFTQRPEDYGNVHAPVT
# RMVSYRIVMAWTASMNLELYSFDVKQAFLNAPLEEEIYVKQIPGRPFRINPPLYTVYDEHSMVYQASAAWYSTLCNALEDLGFTVVNATMQFHWKMDD
# TS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g130
###
# start gene g131
Scaffold_1	AUGUSTUS	gene	714682	716004	0.82	+	.	g131
Scaffold_1	AUGUSTUS	transcript	714682	716004	0.82	+	.	g131.t1
Scaffold_1	AUGUSTUS	start_codon	714682	714684	.	+	0	transcript_id "g131.t1"; gene_id "g131";
Scaffold_1	AUGUSTUS	CDS	714682	716004	0.82	+	0	transcript_id "g131.t1"; gene_id "g131";
Scaffold_1	AUGUSTUS	stop_codon	716002	716004	.	+	0	transcript_id "g131.t1"; gene_id "g131";
# protein sequence = [MFSFVLLDESVAPSRIIAARDPIGITTLYQGWSSKRPGTVYFASELKALVNDCDKIISFPPGHVYDSQDQSTTRYYTP
# SWWNGDLDGDAANIPTTKADLELIRTTLEDAVRKRLMSEVPYGVLLSGGLDSSLIASIAARETEKVAQAQYELRQKKLKELSSGPSTPTLASELSKSN
# DLSISSVHLNLIFPATLVAWPQLHSFSIGLENSPDLIAARKAAHFLGTVHHEYVFTVQEGIDAIPEVIYHLETFDVTTVRASTPMYLLSRKIKAMGVK
# MVLSGEGSDEILGGWSSINGCTDNLLINSQVISTSTLHRMQNHSIKNALSGSRTSIPPTACELTSKFACVVLDIALIHPVSIPFRSTMAWGLEARVPF
# LDKQFLEVAMNVDPKEKMFSKGSSQEVDEDGRPKMEKVEISFHQCYQVSPALYSTFSGKHLTVRQTER]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g131
###
# start gene g132
Scaffold_1	AUGUSTUS	gene	724191	724733	0.4	+	.	g132
Scaffold_1	AUGUSTUS	transcript	724191	724733	0.4	+	.	g132.t1
Scaffold_1	AUGUSTUS	start_codon	724191	724193	.	+	0	transcript_id "g132.t1"; gene_id "g132";
Scaffold_1	AUGUSTUS	CDS	724191	724733	0.4	+	0	transcript_id "g132.t1"; gene_id "g132";
Scaffold_1	AUGUSTUS	stop_codon	724731	724733	.	+	0	transcript_id "g132.t1"; gene_id "g132";
# protein sequence = [MSKTGKGFQIEYPSITLHAVSRGDTPPSIYCQLDESSAKAMEMLVDPEAPKTNGNVKKPSADESDEEDENEEEETQEG
# MDMRVLNIVPSRVESRAFDAFSLSFSKTDLNYPVDPIFEALSLCAALHPDPPGSDDEEDFDEAFIDAPDDTFEVFTGTEDEELSEVGRVRGDFINDNR
# YAPY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g132
###
# start gene g133
Scaffold_1	AUGUSTUS	gene	725208	727019	0.62	-	.	g133
Scaffold_1	AUGUSTUS	transcript	725208	727019	0.62	-	.	g133.t1
Scaffold_1	AUGUSTUS	stop_codon	725208	725210	.	-	0	transcript_id "g133.t1"; gene_id "g133";
Scaffold_1	AUGUSTUS	CDS	725208	727019	0.62	-	0	transcript_id "g133.t1"; gene_id "g133";
Scaffold_1	AUGUSTUS	start_codon	727017	727019	.	-	0	transcript_id "g133.t1"; gene_id "g133";
# protein sequence = [MSSTDMDAIRSRYLGVDKKKRKIRKMNDRKFVFDWDAQDDTFANDPPPANRQGAQTMFGRGHLAGMDDIRPTSTQTSS
# ITANLADPLERRKALKSGLDERHWSEKPLSELKERDWRIFREDFSISARGGQIPHPLRSWEESEIPKPILDVIATIGYKEPSPIQRQAIPIGLSNRDV
# IGIAETGSGKTAAFVIPMLAFISSLPTFTDENRHLGPYALILAPTRELAQQIESESRKFATPLGFKCVSIVGGRAVEEQQFNLREGAEIIIATPGRLK
# DVLERHVLVLSQCRYVVMDEADRMVHLGFEADLLFILDRLPRSAMDDGGAVESAFDLTPMDVDSNEYGEGQESEDLSLDSKSKVRNRVTTLFSATMPP
# AVERLARKYLKRPAIITIGEAGRAVDTVEQRVEFVHGGEEKKKQKLLEILNTGQWGSPIIVFVNQKKTADLIAKEVGRAGWSTSTLHSGKNQEQREAA
# LQALRDGAADILVATDLAGRGIDVQDVTLVINYQMASTIEAYVHRIGRTGRAGKLGTAITLLTNEDDEVMCVSTDFFTRCLCFLTCFSSCRYDLKQEI
# SKSPVSKVPPELAKHEAAQHKVSREMKRKREDDVE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g133
###
# start gene g134
Scaffold_1	AUGUSTUS	gene	727252	727770	0.72	-	.	g134
Scaffold_1	AUGUSTUS	transcript	727252	727770	0.72	-	.	g134.t1
Scaffold_1	AUGUSTUS	stop_codon	727252	727254	.	-	0	transcript_id "g134.t1"; gene_id "g134";
Scaffold_1	AUGUSTUS	CDS	727252	727770	0.72	-	0	transcript_id "g134.t1"; gene_id "g134";
Scaffold_1	AUGUSTUS	start_codon	727768	727770	.	-	0	transcript_id "g134.t1"; gene_id "g134";
# protein sequence = [MNWRISSFVSSENGSPLVSEAQESSPAESKYAFGGNSPEKGNVDFGLQYFVKICFKQFSNDSEIAPSSSRSDAMILLG
# DKKISAKNAWVRRFLGVSLNLLRIIIMSRTEPVSIESLLKKQKEEKEAAAKVYIVKALRDRSNHPAAKIPVQRGASSTGHCETNTGNQGAETQG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g134
###
# start gene g135
Scaffold_1	AUGUSTUS	gene	731509	731832	0.41	+	.	g135
Scaffold_1	AUGUSTUS	transcript	731509	731832	0.41	+	.	g135.t1
Scaffold_1	AUGUSTUS	start_codon	731509	731511	.	+	0	transcript_id "g135.t1"; gene_id "g135";
Scaffold_1	AUGUSTUS	CDS	731509	731832	0.41	+	0	transcript_id "g135.t1"; gene_id "g135";
Scaffold_1	AUGUSTUS	stop_codon	731830	731832	.	+	0	transcript_id "g135.t1"; gene_id "g135";
# protein sequence = [MALPQWELTSVKVGYSMRVECLHSSIWLLQAQLRLTSQRLGHLQEKNDSRGSITRRDIATLLQQGNVGLARVKAQNLF
# QDDIQGDVFEMLVMHVGVILEHIMELEHK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g135
###
# start gene g136
Scaffold_1	AUGUSTUS	gene	734357	736111	0.99	+	.	g136
Scaffold_1	AUGUSTUS	transcript	734357	736111	0.99	+	.	g136.t1
Scaffold_1	AUGUSTUS	start_codon	734357	734359	.	+	0	transcript_id "g136.t1"; gene_id "g136";
Scaffold_1	AUGUSTUS	CDS	734357	736111	0.99	+	0	transcript_id "g136.t1"; gene_id "g136";
Scaffold_1	AUGUSTUS	stop_codon	736109	736111	.	+	0	transcript_id "g136.t1"; gene_id "g136";
# protein sequence = [MEPPPSPLERSRSSSPSVPHTPSSPSIVVTESEPPASTSKGWPSSTSLWNYAEKLKESNAAATFSKVSSNWQAKALAS
# SWSTRKSDTTENHPVHPHSVDPLRHSDPHQDSWFKSTETRRISVPDPDRSKVYSPPARPAFFKPPRDTMVFHGNGPVVDVPSSPELSPSSEGGLMQKT
# RNLQASLAALTRSSETTPVVPATPQPRPKSGPRPLLLGSTSVITPRGERPISRSENSTPLNGPAQWNEVMQTRNKHPIHRDSLSSVSSLSPSDALARN
# RSEYDSDSPAPVSRKVALNRKSISPMAPHARTGSIPAGSNVPPVPHFRTGSTSHLSLSSSSGSSAALASPIAVSPLKSPGWGQVYLPDSPPAALNGLH
# MRSPSLASSIQTIIPEEHPLEKTQSADEMPLEPPLQSRKLMRKKTPPPPGDTSDSSVPEIPRRNNRVRTKRNVRPPNLRLQQQPTDDSPERIITASPN
# SLAVEWPHDEQELATTPKASSFSDVNNSTSPRSARKVRKVSAEGRSPTRQRKTSGEGQESRPRKISTEARTRKASDVKKYRDSTADMGDDEGYDELLS
# AYSESEGSSRPILSDN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g136
###
# start gene g137
Scaffold_1	AUGUSTUS	gene	737651	738172	0.49	-	.	g137
Scaffold_1	AUGUSTUS	transcript	737651	738172	0.49	-	.	g137.t1
Scaffold_1	AUGUSTUS	stop_codon	737651	737653	.	-	0	transcript_id "g137.t1"; gene_id "g137";
Scaffold_1	AUGUSTUS	CDS	737651	738172	0.49	-	0	transcript_id "g137.t1"; gene_id "g137";
Scaffold_1	AUGUSTUS	start_codon	738170	738172	.	-	0	transcript_id "g137.t1"; gene_id "g137";
# protein sequence = [MNRKIVLSLPTSASTAYLMSLTILLNLRLDTLATNVVRSACSLPDFPVYLHDAFDLDRFKDYVSAKVPDFSIQDHHSY
# YVYTPQDDAEPAENHTTDVQTTVTSQLASANDTLPHNLIIGEWSCALTPDSLKNESDPQQARRDFCTAQYVAYTRDTPGNSFWCTSSTFSTCFPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g137
###
# start gene g138
Scaffold_1	AUGUSTUS	gene	738353	738712	0.64	-	.	g138
Scaffold_1	AUGUSTUS	transcript	738353	738712	0.64	-	.	g138.t1
Scaffold_1	AUGUSTUS	stop_codon	738353	738355	.	-	0	transcript_id "g138.t1"; gene_id "g138";
Scaffold_1	AUGUSTUS	CDS	738353	738712	0.64	-	0	transcript_id "g138.t1"; gene_id "g138";
Scaffold_1	AUGUSTUS	start_codon	738710	738712	.	-	0	transcript_id "g138.t1"; gene_id "g138";
# protein sequence = [MVPSIFECAAEPKIAEIDIANGGCNPQGILEKHWDNFITQQDFNYLASIGINTVRLPIGYWSLGPNFVQDTPFANVSS
# VYENAWPHVVRAINMAEVSNIAVIVDLHGAPGSQKWPGTWI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g138
###
# start gene g139
Scaffold_1	AUGUSTUS	gene	741128	742079	0.49	-	.	g139
Scaffold_1	AUGUSTUS	transcript	741128	742079	0.49	-	.	g139.t1
Scaffold_1	AUGUSTUS	stop_codon	741128	741130	.	-	0	transcript_id "g139.t1"; gene_id "g139";
Scaffold_1	AUGUSTUS	CDS	741128	741537	0.53	-	2	transcript_id "g139.t1"; gene_id "g139";
Scaffold_1	AUGUSTUS	CDS	741584	742079	0.54	-	0	transcript_id "g139.t1"; gene_id "g139";
Scaffold_1	AUGUSTUS	start_codon	742077	742079	.	-	0	transcript_id "g139.t1"; gene_id "g139";
# protein sequence = [MPLPEEASTSTDPVSFSSLGLIKPLLEALEQLKFTEPTEIQQQSIPYALEGRDIIGVASTGSGKTAAFALPILQKLWD
# EPKGLFACVLAPTRELAYQISQQFEALGSAMGVRCAVIVGGMEITAQAVALAKKPHIIVATPGRLNDHLENTKGFSLRNLKYLVRTFDEADRLLDMDF
# GPVIDKILKVIPKERSTYLFSATMTTKSQNYNEQVCQIPSGWKYRLSELYAHPVSLSTTKNCYRYQTVSTLLQYYCLMPQKEKDTYLIYLANTLAQNS
# IIIFTRTVHDAARCGIPETLCFSCSQI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g139
###
# start gene g140
Scaffold_1	AUGUSTUS	gene	742227	742901	0.37	+	.	g140
Scaffold_1	AUGUSTUS	transcript	742227	742901	0.37	+	.	g140.t1
Scaffold_1	AUGUSTUS	start_codon	742227	742229	.	+	0	transcript_id "g140.t1"; gene_id "g140";
Scaffold_1	AUGUSTUS	CDS	742227	742901	0.37	+	0	transcript_id "g140.t1"; gene_id "g140";
Scaffold_1	AUGUSTUS	stop_codon	742899	742901	.	+	0	transcript_id "g140.t1"; gene_id "g140";
# protein sequence = [MDEIGIEIQKHVRWSKLIDMQYSSHIALQEPTFESVVTEKTALFQELQEEDLYTKYKKLSRHLELLEIQEGYIKDEQA
# NLKRELIRAQEEVKRIQSVPLVIGQFLEAIDQHTGIVGSTTGSNYVVRILSTLDRELLKPSSSVALHRHSNALVDILPPEADSSISMLGASEKPDVTY
# QDVGGMDTQKQEIREAVELPLTHFDLYKKIGIDPPRGVLLYGPPGILS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g140
###
# start gene g141
Scaffold_1	AUGUSTUS	gene	744672	746516	0.96	-	.	g141
Scaffold_1	AUGUSTUS	transcript	744672	746516	0.96	-	.	g141.t1
Scaffold_1	AUGUSTUS	stop_codon	744672	744674	.	-	0	transcript_id "g141.t1"; gene_id "g141";
Scaffold_1	AUGUSTUS	CDS	744672	746516	0.96	-	0	transcript_id "g141.t1"; gene_id "g141";
Scaffold_1	AUGUSTUS	start_codon	746514	746516	.	-	0	transcript_id "g141.t1"; gene_id "g141";
# protein sequence = [MPSAADAWSFNLRNHNLDFSDSDSDSDSGDASSNIAPAFDETKLLNDFDLSTREETVIYKPNPFNIARINAASRAQKF
# ISSAPKPDLLLTSKSGLAKGTIIDCFRLQAQKSKLVAPSTSNDIDIDKPATPLNHHLVKSQNDNTPSSLPSSIPNLSDAKNNGHNKYPVAHIFPHIAP
# GSHAPRFRQNSGTFSSPIRPAASIANLKSHLNRGHASSPVAPSHRLELHAPLPHSSSSYHPPNALAISNDHSCVDSTKFPALASIYPLRPQDNIYSEI
# HDPAFTYSPLRAHMTTTPPNRPLQVQVPNQTLNSNNLKHRTNFIRHSPILSPRSSRLPAHKIASAKKHRDTTSRSARTNLKPNPYDSLPMGEGEEWGT
# LEPAKKKMKPSRQVDTFETICSSIETPQFRENEFGIRTSSKFTLGSLGMDLGKGKKTGMSAESSRRVITFLPPPLNSKSRSLSEDETRSPPPKIVEDA
# IDLNYTSVQARNFEHDDHDLCASPEHSNVQHHITMVLLGGRAHKSPVTPARKISNPYPSPQVSALSVGDAPRDLEVPSGRRVTAIDKTCSDLYRPPSP
# PTSDPPQQNETFGRDTSIPLDIGSISRRYPGIQRMSRKVRVERNYS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g141
###
# start gene g142
Scaffold_1	AUGUSTUS	gene	750811	751212	0.69	+	.	g142
Scaffold_1	AUGUSTUS	transcript	750811	751212	0.69	+	.	g142.t1
Scaffold_1	AUGUSTUS	start_codon	750811	750813	.	+	0	transcript_id "g142.t1"; gene_id "g142";
Scaffold_1	AUGUSTUS	CDS	750811	751212	0.69	+	0	transcript_id "g142.t1"; gene_id "g142";
Scaffold_1	AUGUSTUS	stop_codon	751210	751212	.	+	0	transcript_id "g142.t1"; gene_id "g142";
# protein sequence = [MTSMQRLLQAVSPWHGRILIYVWAVEQDDLSKRQIPVVDDPHAVGQSGKDVFVPWVLSSSADSEKLQAEQVFNRYYHM
# FAKGELEQLVSEAAKELGLHVGLKSESAGACRGIDFEQDGWERSNHYVELRCWAV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g142
###
# start gene g143
Scaffold_1	AUGUSTUS	gene	751349	752320	1	-	.	g143
Scaffold_1	AUGUSTUS	transcript	751349	752320	1	-	.	g143.t1
Scaffold_1	AUGUSTUS	stop_codon	751349	751351	.	-	0	transcript_id "g143.t1"; gene_id "g143";
Scaffold_1	AUGUSTUS	CDS	751349	752320	1	-	0	transcript_id "g143.t1"; gene_id "g143";
Scaffold_1	AUGUSTUS	start_codon	752318	752320	.	-	0	transcript_id "g143.t1"; gene_id "g143";
# protein sequence = [MSAYIQNKLAKGEKLQFFITGATGYIGLVLTEFAIAQGFSVRGLSRSEAGDEKLKSLGATPVRGDITTHEVLARESAA
# ADAIIHLAWNHDWSGDYNKIVDTDIAAVEAICAQIKDTGKPLVIASGCAGAQPNADGSDSDENAPLRPNLPVARRLESEINAIKKQGIHGCSIRLSPY
# VYGRGGKGFLVMLMGQAVKLNESLYINDGSFHTSVLHVEDAARLFIAAVLKGKAGEAYNGVGQTDVSLKDMAEAIGKVIGVPVRPASLEEAIEKWSPP
# ILPRFNYLDVRGSNKKAKELLGWKPEGVDFITDIVSGSYVPVAAYLKTQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g143
###
# start gene g144
Scaffold_1	AUGUSTUS	gene	754230	754966	0.58	-	.	g144
Scaffold_1	AUGUSTUS	transcript	754230	754966	0.58	-	.	g144.t1
Scaffold_1	AUGUSTUS	stop_codon	754230	754232	.	-	0	transcript_id "g144.t1"; gene_id "g144";
Scaffold_1	AUGUSTUS	CDS	754230	754670	0.86	-	0	transcript_id "g144.t1"; gene_id "g144";
Scaffold_1	AUGUSTUS	CDS	754745	754966	0.58	-	0	transcript_id "g144.t1"; gene_id "g144";
Scaffold_1	AUGUSTUS	start_codon	754964	754966	.	-	0	transcript_id "g144.t1"; gene_id "g144";
# protein sequence = [MSAHIEEVTSDHSDHEGHVHDHDHDHDHDHDHNHDHDEDPTSAAALDKIQSRSERKARKALISLGLKRVPNITRILFV
# LASPDVYKSPNSDCYIVFGEAKVRSLISASKIPAHGFVDRGHERAKSKSAQQLAGAGGADIPNLESSGVGGGDDDDIPELEAAEEEGPVDETGVDPKD
# IDLVMTQVRNQYPGRHWTHITDILGELLPGKGCSSTKRKWRRPH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g144
###
# start gene g145
Scaffold_1	AUGUSTUS	gene	758843	760022	0.23	+	.	g145
Scaffold_1	AUGUSTUS	transcript	758843	760022	0.23	+	.	g145.t1
Scaffold_1	AUGUSTUS	start_codon	758843	758845	.	+	0	transcript_id "g145.t1"; gene_id "g145";
Scaffold_1	AUGUSTUS	CDS	758843	759154	0.23	+	0	transcript_id "g145.t1"; gene_id "g145";
Scaffold_1	AUGUSTUS	CDS	759228	760022	1	+	0	transcript_id "g145.t1"; gene_id "g145";
Scaffold_1	AUGUSTUS	stop_codon	760020	760022	.	+	0	transcript_id "g145.t1"; gene_id "g145";
# protein sequence = [MEALSSGADISMIGQFGVGFYSAYLVAERVQVISKHNDDEQYIWESAAGGTFTITQDTVNPPLGRGSEIRLHLKEDQL
# EYLEEKRIKDIVKKHSEFISYPIQLAEVSDDEAEEEEDAENKPKIEEVDDEEKPKDKKTKKIKEVETTNEELNKTKPIWTRNPSDITPDEYSAFYKSL
# TNDWEDHLSVKHFSVEGQLEFKAILFVPKRYGIHSWVSNALLNHFHSAPFDLFESKKKRNNIKLYVRRVFIMDDCEDIIPEYLNFVKGIVDSEDLPLN
# ISRETLQQNKILKVIRKNIVKKCMDMFSEIAEDKDNFNKFYEAFGKNLKLGIHEDAQNRSKLAEFLRFFSTKSTDEQTSLKGKLIILVFRVAYH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g145
###
# start gene g146
Scaffold_1	AUGUSTUS	gene	760049	760462	0.99	+	.	g146
Scaffold_1	AUGUSTUS	transcript	760049	760462	0.99	+	.	g146.t1
Scaffold_1	AUGUSTUS	start_codon	760049	760051	.	+	0	transcript_id "g146.t1"; gene_id "g146";
Scaffold_1	AUGUSTUS	CDS	760049	760462	0.99	+	0	transcript_id "g146.t1"; gene_id "g146";
Scaffold_1	AUGUSTUS	stop_codon	760460	760462	.	+	0	transcript_id "g146.t1"; gene_id "g146";
# protein sequence = [MPEVQKSIYYLTGESLAATRDSPFLEVLKKKGFEVLLLVDPIDEYAITQLKEFDDKKLVCVSKEGLELEETEEEKKAR
# EAETTAFSELCTVVKDALGDKVEKVVISNRITDSPCVLVTGQFGWSSNMVRCVVFSYPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g146
###
# start gene g147
Scaffold_1	AUGUSTUS	gene	762981	763688	0.91	+	.	g147
Scaffold_1	AUGUSTUS	transcript	762981	763688	0.91	+	.	g147.t1
Scaffold_1	AUGUSTUS	start_codon	762981	762983	.	+	0	transcript_id "g147.t1"; gene_id "g147";
Scaffold_1	AUGUSTUS	CDS	762981	763688	0.91	+	0	transcript_id "g147.t1"; gene_id "g147";
Scaffold_1	AUGUSTUS	stop_codon	763686	763688	.	+	0	transcript_id "g147.t1"; gene_id "g147";
# protein sequence = [MTEARPVNFGAGPSALPESVLEEACKGLFNFKGTGIGIAEISHRSKEFTSLVADLENNIRTQLGVPPTHKIIFTQGGG
# TGQFSAVVLNLLARHRLLHPDLSDEQRVLDYVITGSWSKKAMEEAKRLGGGSVHIAVDARAKSEDSKSYDNIPAHEDFDFSADPALIYYCENETVDGV
# QFSNDVQSPASFPFHLLPAGGLWPLVADYSSSFMSRKIPRIADHAVIFAGAQKNIGPAD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g147
###
# start gene g148
Scaffold_1	AUGUSTUS	gene	768988	769770	0.63	+	.	g148
Scaffold_1	AUGUSTUS	transcript	768988	769770	0.63	+	.	g148.t1
Scaffold_1	AUGUSTUS	start_codon	768988	768990	.	+	0	transcript_id "g148.t1"; gene_id "g148";
Scaffold_1	AUGUSTUS	CDS	768988	769098	0.64	+	0	transcript_id "g148.t1"; gene_id "g148";
Scaffold_1	AUGUSTUS	CDS	769197	769282	0.85	+	0	transcript_id "g148.t1"; gene_id "g148";
Scaffold_1	AUGUSTUS	CDS	769341	769770	0.89	+	1	transcript_id "g148.t1"; gene_id "g148";
Scaffold_1	AUGUSTUS	stop_codon	769768	769770	.	+	0	transcript_id "g148.t1"; gene_id "g148";
# protein sequence = [MAHVVQPLDQPSNYKDSQARVDRKRQNEMLSNSTTLYIYELFSKCANAADGGGIKRIIMGLDRNTRTPCGFCFVEYYT
# HTEALASMRYVSGTKLDERIIRCDLDLGYKEGRQFGRGKSGGQVRDEHRQDYDPGRGGWGAQAQRLEVERRRAVEERYADAQDGPGAVAGGGEDWKEI
# ETSEGKLKRGRSPEDEGDNARMVRSATFSLLV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g148
###
# start gene g149
Scaffold_1	AUGUSTUS	gene	772623	773249	0.97	+	.	g149
Scaffold_1	AUGUSTUS	transcript	772623	773249	0.97	+	.	g149.t1
Scaffold_1	AUGUSTUS	start_codon	772623	772625	.	+	0	transcript_id "g149.t1"; gene_id "g149";
Scaffold_1	AUGUSTUS	CDS	772623	773249	0.97	+	0	transcript_id "g149.t1"; gene_id "g149";
Scaffold_1	AUGUSTUS	stop_codon	773247	773249	.	+	0	transcript_id "g149.t1"; gene_id "g149";
# protein sequence = [MVTSATEVHKKKKPPSFNHYPEAKGKTLINVLSLNHLIYVSLAKSLKKAWVEKTKIKSKWRAERRKMGLPSRSFPTQN
# VDAQKEKQNDKADSEAEDDKESELADETVTTPELPVKFQRGPPRPNVSSTAQSKQPKEQLKEHETPDLRELTRKAYSRETLHTYKSDPLNRRGGINGG
# KRHSRGGNRGRGQPNMKLRMGVMLEKIKRDFT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g149
###
# start gene g150
Scaffold_1	AUGUSTUS	gene	773266	774674	0.29	-	.	g150
Scaffold_1	AUGUSTUS	transcript	773266	774674	0.29	-	.	g150.t1
Scaffold_1	AUGUSTUS	stop_codon	773266	773268	.	-	0	transcript_id "g150.t1"; gene_id "g150";
Scaffold_1	AUGUSTUS	CDS	773266	773639	0.98	-	2	transcript_id "g150.t1"; gene_id "g150";
Scaffold_1	AUGUSTUS	CDS	774080	774308	0.98	-	0	transcript_id "g150.t1"; gene_id "g150";
Scaffold_1	AUGUSTUS	CDS	774549	774674	0.3	-	0	transcript_id "g150.t1"; gene_id "g150";
Scaffold_1	AUGUSTUS	start_codon	774672	774674	.	-	0	transcript_id "g150.t1"; gene_id "g150";
# protein sequence = [MSQYFLTVNTSAYAKPKVIILRCLEPLLSIEKSTARAELHKPQKITDHDNVLKQIADTDVVEYEQSTVPVSISINDHD
# SVKWDLLKDIIKYKTEQVHPPSLLFPIIPNDGSFTGRTFPXSQPLSIPNTPLFSPIPFLHNDARRSKSRSPPPSPLALSSAGPVSGGHPETLSLEPAP
# LGLVDELDDPRPGHMSDHPTALSAVTTVDDGKEGTPIVQSLESRFVKAEDEDSTMAVDENKENQST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g150
###
# start gene g151
Scaffold_1	AUGUSTUS	gene	776541	777299	0.7	-	.	g151
Scaffold_1	AUGUSTUS	transcript	776541	777299	0.7	-	.	g151.t1
Scaffold_1	AUGUSTUS	stop_codon	776541	776543	.	-	0	transcript_id "g151.t1"; gene_id "g151";
Scaffold_1	AUGUSTUS	CDS	776541	777299	0.7	-	0	transcript_id "g151.t1"; gene_id "g151";
Scaffold_1	AUGUSTUS	start_codon	777297	777299	.	-	0	transcript_id "g151.t1"; gene_id "g151";
# protein sequence = [MVLQFLLSPLDAPASALSSVATTSASSYPQSVSSSSHGRNTVDPFTMSSYLLSASSLVSDTRGLPSRLQRLSVARGGS
# GADVILDDELLAEGEWEIMQRTSEEMQQLEQRWRDDGTLDTMDEASFKASQKHETTRRKEKQTQARTESLAADSARHPVSKRINPEALSSFMLNPGNG
# FDQALDLDTSEILGLEFLEDDMDDKGAGDEILVLDEGNEADAFRMAPDTGSGDEITVDDWRPPSPGLNNTFDDYYS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g151
###
# start gene g152
Scaffold_1	AUGUSTUS	gene	777440	778234	0.9	-	.	g152
Scaffold_1	AUGUSTUS	transcript	777440	778234	0.9	-	.	g152.t1
Scaffold_1	AUGUSTUS	stop_codon	777440	777442	.	-	0	transcript_id "g152.t1"; gene_id "g152";
Scaffold_1	AUGUSTUS	CDS	777440	778234	0.9	-	0	transcript_id "g152.t1"; gene_id "g152";
Scaffold_1	AUGUSTUS	start_codon	778232	778234	.	-	0	transcript_id "g152.t1"; gene_id "g152";
# protein sequence = [MHGFIKSLTLTLSVSGLSPRVCNLFDQAMKTAQFKWGTKAKAVAGACLSIALRESSRPDSLKDIAFLIEQSDVNLKRT
# LSSVLSALKLTLKSSSPAQFLTILQSHLSSILQAPMDSSGMDISLWSELKSLSIRSAVETARLFIDILSRSASESTILRNSPAAAACAIFIMSLEAEK
# RGPLSCLADISACFADSCTVAKVTVTSRYQALHKEVSSWIKEVEWLDSYQKPNQRAKVSKRLLCARGLKDVLNCKNVHGKPGRGGRQV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g152
###
# start gene g153
Scaffold_1	AUGUSTUS	gene	781295	781609	0.85	+	.	g153
Scaffold_1	AUGUSTUS	transcript	781295	781609	0.85	+	.	g153.t1
Scaffold_1	AUGUSTUS	start_codon	781295	781297	.	+	0	transcript_id "g153.t1"; gene_id "g153";
Scaffold_1	AUGUSTUS	CDS	781295	781609	0.85	+	0	transcript_id "g153.t1"; gene_id "g153";
Scaffold_1	AUGUSTUS	stop_codon	781607	781609	.	+	0	transcript_id "g153.t1"; gene_id "g153";
# protein sequence = [MANARIALQLSTREGFEVKVSEAIHAGVPIIASLTGGIPLQVEHGKSGYLTAPGDNAAVAKHLLELYTDDDLWQKVSD
# YAKTHVSDEVGTVGMYCSPFLSVLQI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g153
###
# start gene g154
Scaffold_1	AUGUSTUS	gene	783604	784125	0.95	+	.	g154
Scaffold_1	AUGUSTUS	transcript	783604	784125	0.95	+	.	g154.t1
Scaffold_1	AUGUSTUS	start_codon	783604	783606	.	+	0	transcript_id "g154.t1"; gene_id "g154";
Scaffold_1	AUGUSTUS	CDS	783604	784125	0.95	+	0	transcript_id "g154.t1"; gene_id "g154";
Scaffold_1	AUGUSTUS	stop_codon	784123	784125	.	+	0	transcript_id "g154.t1"; gene_id "g154";
# protein sequence = [MDATKSQGSMTGQEERDVLFARLFGMTAIIQSGLIVRTKPLPTSQSSATLASSFEGYEQVLTELLALGEKKSWLRESA
# WWAISLAADSLKATEVPWKDEAVHATAQHLFVENKIWSPEKIALALKLQSAFEEFNWRPLFSPTFKNPDLLSNVNLQTLALILKASERHDKVTGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g154
###
# start gene g155
Scaffold_1	AUGUSTUS	gene	786081	787155	0.6	+	.	g155
Scaffold_1	AUGUSTUS	transcript	786081	787155	0.6	+	.	g155.t1
Scaffold_1	AUGUSTUS	start_codon	786081	786083	.	+	0	transcript_id "g155.t1"; gene_id "g155";
Scaffold_1	AUGUSTUS	CDS	786081	786396	0.67	+	0	transcript_id "g155.t1"; gene_id "g155";
Scaffold_1	AUGUSTUS	CDS	786467	787155	0.91	+	2	transcript_id "g155.t1"; gene_id "g155";
Scaffold_1	AUGUSTUS	stop_codon	787153	787155	.	+	0	transcript_id "g155.t1"; gene_id "g155";
# protein sequence = [MDEVEVEDNEDEDKSANGEDAEDGSQSSDDDEEDDENEDSDNEEVDEELRQRILEALAVNGIKAANEEDEDSEEEEYM
# DDDQMMAIDEHLAEVFRSRVNEKKASKDLDAQREATHFKNRVLDLIDIFIKKQPSSPLIVRLIIPLVDLITRSTTDEKQLSDKARGIARSRIGKAKEF
# ASAEKKKVGGGGEKEEGEGEEQEEVTSIFETLHKRARTERSPDHLSILSDCCIYISQVMLRAGMQDHVVVQYRHSLIDFISRKNSSLNVSFFQQFFRR
# SRTAAWNLRNDLLEVSGKAANLYRQFQAYQLIHDLLTEPPFDVSTTSLLLSFVYNQFADP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g155
###
# start gene g156
Scaffold_1	AUGUSTUS	gene	789446	790847	0.36	-	.	g156
Scaffold_1	AUGUSTUS	transcript	789446	790847	0.36	-	.	g156.t1
Scaffold_1	AUGUSTUS	stop_codon	789446	789448	.	-	0	transcript_id "g156.t1"; gene_id "g156";
Scaffold_1	AUGUSTUS	CDS	789446	789784	0.91	-	0	transcript_id "g156.t1"; gene_id "g156";
Scaffold_1	AUGUSTUS	CDS	789908	790176	0.99	-	2	transcript_id "g156.t1"; gene_id "g156";
Scaffold_1	AUGUSTUS	CDS	790283	790847	0.38	-	0	transcript_id "g156.t1"; gene_id "g156";
Scaffold_1	AUGUSTUS	start_codon	790845	790847	.	-	0	transcript_id "g156.t1"; gene_id "g156";
# protein sequence = [MDPRLLAAFNVSGPPIWRIVTGAQDQQQNQSQDIINMRPMLFGVSLQRVTNTGDSYGDGDIFHPGHGYGYGYGYGVDL
# ELGGEAAAPCEHPRASIISQNHISGLLTIGGLPPNLTDADLTWALVRRYTVPQGGLKGGVGAEDEVYPITWEIPIDGVYLDGNRIPDPAELESGDIGV
# TALIDTVSFMKRWREDASSSSHPSTDTSTSCTTPHTLAFQIGGRMFPVEWRDLVWVEEEDEDRDSQQGDSEYENDEDNGEAEEEKGNGSRKRQCYLNL
# APTDWCICGRVSVFHPSIHFINSQLSSSGFFNALSLTPFSIPSVIAAFYYGDTVHPSWDPPRIGLISTVIHGVDLGVDVEGGEDVGAEESESDVRSTV
# AFEGGVEKDIGSEGVSLN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g156
###
# start gene g157
Scaffold_1	AUGUSTUS	gene	795833	796480	1	-	.	g157
Scaffold_1	AUGUSTUS	transcript	795833	796480	1	-	.	g157.t1
Scaffold_1	AUGUSTUS	stop_codon	795833	795835	.	-	0	transcript_id "g157.t1"; gene_id "g157";
Scaffold_1	AUGUSTUS	CDS	795833	796480	1	-	0	transcript_id "g157.t1"; gene_id "g157";
Scaffold_1	AUGUSTUS	start_codon	796478	796480	.	-	0	transcript_id "g157.t1"; gene_id "g157";
# protein sequence = [MPQSPEVQHQTRLSSYFTPSPSPKKAKRRASAIVDLTIDSSDEERPFKRQRGSSTSLDISPGPSKSSSASASYNRAEQ
# WSFDSSHSTSTEKDRTHISNSELGSNKLSKREALKKKLLLERESSFFLQSRSSTEKGSSSRIQSGAIDENRDTDSEPEFWATSNASTSNISKGKQKVM
# PRAKRPEELGPSGEPWTPLEKQVALQFPIFLRLLTNYCH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g157
###
# start gene g158
Scaffold_1	AUGUSTUS	gene	803388	806560	0.91	-	.	g158
Scaffold_1	AUGUSTUS	transcript	803388	806560	0.91	-	.	g158.t1
Scaffold_1	AUGUSTUS	stop_codon	803388	803390	.	-	0	transcript_id "g158.t1"; gene_id "g158";
Scaffold_1	AUGUSTUS	CDS	803388	805425	0.97	-	1	transcript_id "g158.t1"; gene_id "g158";
Scaffold_1	AUGUSTUS	CDS	805500	806560	0.91	-	0	transcript_id "g158.t1"; gene_id "g158";
Scaffold_1	AUGUSTUS	start_codon	806558	806560	.	-	0	transcript_id "g158.t1"; gene_id "g158";
# protein sequence = [MSPPFLQRSPVDPAQRGERGVELIDFGSSAVPGRRRPASPLSGPSYQPFTAAAVSTSRPGTPSNVTWTIPASKSSPQK
# SSGHNRNGSWFSDAEGSTDPHGGYSTSNGHSKSASASRSLRSPALPDSPILERGHANTAYFGGTYPYDNRPPSTISGIDLNSPTSNRPMRSPTPTQSP
# ARSPTSPTFSGVDGSPKHSRRSSKQNGTSVPFSLAPYNPVLFSPLANSSRSSLESTGSSYHSWEADKFLFVDADSQVPPWHDLSLSSQSSSTTPAGSP
# DTEWNPEDVIGSYAGLHKLDFAAIQETLVSAVASKNMTVSETRERVPSLRRRRPSTSQSNYSLNYTVRLSSFYYWSLIHLDQISKASALLNSVLESIN
# TQHNDVSYDSSSPAINTADTPSASQDVSPTTRRNRDLAQILFGEDTHEGSPPAGASSPEDDSLQPKTFKEKELTTTLPLNVTTSSLDTSTIGLSSPSQ
# SALYNPLRSPSTPHIPQTSEAQAELAREIQRKTDAAMLALRKRPSNSNLSKEGLVSPGPVRKKFNTNQISTPTLLSASTSVDTIPLRTPPFTSATSSG
# PPSKIASRFRKLRGTLRKGNIPIEEIKVTPYPLDVKSNPSSHGSQPQFARYDSSKLHPMDSAVSATEIGRFRVPAVPVPSPPASAGPGLKGFMARFRG
# KVRTADSVEYKGQQLRPSPYQMSPAQNPLFLSNSPLTEEVKPEREMNAQFLHPSQSPSSSSQPPLTPQLHMHPSDDSGDGVNQYESQALKQLFNAAND
# LGLDQSKLSELLVRSGSISSKSTDWTMLTRNNSSATKSRQESRDERQFQSPTPQSEWSTFEDPGHRASKMPVSRKSSMKQSENVGVRRPRQRGPDDTN
# TVIRRTIIYPEDRGVSVADLNALGRKNSSHRRRASAISATSSNRSIHERVPTPPPPHSPTGKRFSADESPPVPQLPQSWAARMDKGLVVPSAGGQSNT
# PYDSVYAYNSNVIPPILISESRYDMYTGEKGSQSAPAEGSGSSDPGPALEVIELANGETIWWVHLIISGSLF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g158
###
# start gene g159
Scaffold_1	AUGUSTUS	gene	806620	807463	0.15	-	.	g159
Scaffold_1	AUGUSTUS	transcript	806620	807463	0.15	-	.	g159.t1
Scaffold_1	AUGUSTUS	stop_codon	806620	806622	.	-	0	transcript_id "g159.t1"; gene_id "g159";
Scaffold_1	AUGUSTUS	CDS	806620	806907	0.95	-	0	transcript_id "g159.t1"; gene_id "g159";
Scaffold_1	AUGUSTUS	CDS	806994	807330	0.15	-	1	transcript_id "g159.t1"; gene_id "g159";
Scaffold_1	AUGUSTUS	CDS	807444	807463	0.32	-	0	transcript_id "g159.t1"; gene_id "g159";
Scaffold_1	AUGUSTUS	start_codon	807461	807463	.	-	0	transcript_id "g159.t1"; gene_id "g159";
# protein sequence = [MRQSTRSKHGSSRVTSAAPSEVSTSTSSVFGPSHEFRSTTPENDVLNNKQAVRSAPLIPPAPYGERSIPASAEYRLSK
# SLGPSAFKRASLALEEAIRELEEDAEDEIVMPRSAPITRANDNPNSLPLDVYQAGMAISSDHQGQTETEEKRMSPIPSRILPGYIPGMPRPMTPREDM
# DNDILRSHSITPRAATVTNPNDPTAFYPDMPNTPTPPQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g159
###
# start gene g160
Scaffold_1	AUGUSTUS	gene	809707	810931	0.52	-	.	g160
Scaffold_1	AUGUSTUS	transcript	809707	810931	0.52	-	.	g160.t1
Scaffold_1	AUGUSTUS	stop_codon	809707	809709	.	-	0	transcript_id "g160.t1"; gene_id "g160";
Scaffold_1	AUGUSTUS	CDS	809707	810647	0.53	-	2	transcript_id "g160.t1"; gene_id "g160";
Scaffold_1	AUGUSTUS	CDS	810709	810931	0.64	-	0	transcript_id "g160.t1"; gene_id "g160";
Scaffold_1	AUGUSTUS	start_codon	810929	810931	.	-	0	transcript_id "g160.t1"; gene_id "g160";
# protein sequence = [MPKSLPGAVLDPASTSINSRWLWFHKGFVEGLKRARAPSETDQNFENLAYDLAETQVKLEETQTKLDDTAQVLGEVQK
# LFREEIIVSSQGSDNNNDCTPSTNSSPTSPSLQSTRTYAESLQLPITPVATPLSARRALTLSNRRPNSRSSYEAIPDYYSTSEASQTSVDAALGTLIQ
# KAHDGDERSISLIKVLCREAHGTPPERKTYGQRYILARWRNPSFCPRRGRSNTNPSSTSNPHLPQLINPQSNDPPEAWIAYYTRYPKSLPKGVRVNSK
# TRAPLFGDIVASRLLARLRPTASQYRAEFNVAMINLFIHRGQFRQMVQDGQIQIPRIADIYQPFEPEGRIEQGQLISVLDVARHYAKCGVSIEDVENY
# VEPWTEEYAKQKYEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g160
###
# start gene g161
Scaffold_1	AUGUSTUS	gene	813221	813604	0.97	+	.	g161
Scaffold_1	AUGUSTUS	transcript	813221	813604	0.97	+	.	g161.t1
Scaffold_1	AUGUSTUS	start_codon	813221	813223	.	+	0	transcript_id "g161.t1"; gene_id "g161";
Scaffold_1	AUGUSTUS	CDS	813221	813604	0.97	+	0	transcript_id "g161.t1"; gene_id "g161";
Scaffold_1	AUGUSTUS	stop_codon	813602	813604	.	+	0	transcript_id "g161.t1"; gene_id "g161";
# protein sequence = [MYDDLIIVDDDEPQAGPSNTNTSSDAMNVPTSPAASTSTPGPSGPRTSSRLRASSQAQQNAPLVSTPSLASTAPEKVS
# TRSGSQRGKPQPKLKLKLSEKLAAQAPGMSFLGQYDRELDSDDTRGSNV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g161
###
# start gene g162
Scaffold_1	AUGUSTUS	gene	813836	815038	0.47	+	.	g162
Scaffold_1	AUGUSTUS	transcript	813836	815038	0.47	+	.	g162.t1
Scaffold_1	AUGUSTUS	start_codon	813836	813838	.	+	0	transcript_id "g162.t1"; gene_id "g162";
Scaffold_1	AUGUSTUS	CDS	813836	814001	0.51	+	0	transcript_id "g162.t1"; gene_id "g162";
Scaffold_1	AUGUSTUS	CDS	814123	814242	0.79	+	2	transcript_id "g162.t1"; gene_id "g162";
Scaffold_1	AUGUSTUS	CDS	814301	814698	0.81	+	2	transcript_id "g162.t1"; gene_id "g162";
Scaffold_1	AUGUSTUS	CDS	814760	815038	1	+	0	transcript_id "g162.t1"; gene_id "g162";
Scaffold_1	AUGUSTUS	stop_codon	815036	815038	.	+	0	transcript_id "g162.t1"; gene_id "g162";
# protein sequence = [MESQKTLDNKQMFKVADICQVIHVLYETDHTLARIDLPIQMLVVENRIDNEDVVTLPLRGADADDHPCCGQTIETVEQ
# EVERLLEEDNLAKEIKYEILENVNPDLSDSEFLEREEPIDAPTPAISDLGDPSTPSVIPGDDGEDDEEGDEEPEGDIDEELAAELDLALGDEDEDGDD
# EEEEDSDEDDEDDDDDEISQARKLLNEEIRDLQAAVAKKGSEIASSANPLIRKRFEDALKKLTSDLEMKLAQRDELQEKQRMEDEGIVVNNVGGGGDS
# DFEEVEVDGIAGGVLGSVVGGSGQLGQLGPEDDDLFGGEDATMDMT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g162
###
# start gene g163
Scaffold_1	AUGUSTUS	gene	817857	818821	0.86	+	.	g163
Scaffold_1	AUGUSTUS	transcript	817857	818821	0.86	+	.	g163.t1
Scaffold_1	AUGUSTUS	start_codon	817857	817859	.	+	0	transcript_id "g163.t1"; gene_id "g163";
Scaffold_1	AUGUSTUS	CDS	817857	817872	0.92	+	0	transcript_id "g163.t1"; gene_id "g163";
Scaffold_1	AUGUSTUS	CDS	817935	818821	0.86	+	2	transcript_id "g163.t1"; gene_id "g163";
Scaffold_1	AUGUSTUS	stop_codon	818819	818821	.	+	0	transcript_id "g163.t1"; gene_id "g163";
# protein sequence = [MPFIEEEPTTNSQPDIVVANTGFIQERINDEPSLSSTQAADSEPHKPASITTLPFDIIEEITLLATGYYDDCVDLPDT
# LDTHADVPAKFVQVCSRWRSAVFASARAWSTVIIKDTRTPYFRLRKLQASISRARTTPLRVYIDLKHGACVKIFEEIMESFSESRLFDLEVRVPGYLF
# SCLRELPPQSTETTLRRLSLVQLPYADRIPIDDLVGVIPFTPSFITRDISSPIILRSVPELRELSLRDIAYPRFMLKKIKSKRLTTLALSFPHTRRSR
# TPHPPSEPERAFGFSITQSAFTSHDV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g163
###
# start gene g164
Scaffold_1	AUGUSTUS	gene	819887	821456	0.32	-	.	g164
Scaffold_1	AUGUSTUS	transcript	819887	821456	0.32	-	.	g164.t1
Scaffold_1	AUGUSTUS	stop_codon	819887	819889	.	-	0	transcript_id "g164.t1"; gene_id "g164";
Scaffold_1	AUGUSTUS	CDS	819887	821195	0.81	-	1	transcript_id "g164.t1"; gene_id "g164";
Scaffold_1	AUGUSTUS	CDS	821431	821456	0.4	-	0	transcript_id "g164.t1"; gene_id "g164";
Scaffold_1	AUGUSTUS	start_codon	821454	821456	.	-	0	transcript_id "g164.t1"; gene_id "g164";
# protein sequence = [MDDRLDLGIGGLAPPNTGNPVQSTKSKNPQTSTFTTNNTLRPLPTLPNSRIAFFINGQPQGTAFHTLYDFLQLPQSER
# KFKEKDKRKPRTRDGLKESHKDNPFDDGSLGYYPFISLFNDAEVRINPGPVFEYPPVEDIDAVLDGTNDPDAIIPDTPTDPSLNPNPRPSTRTWRPLS
# ARYPEYMAEQWELDEREELEAQETLAELDAQDRAVAQRERQKKVQRERKRKEKEKEKETEARKRTRVGSKDKGGVVKEKSKSPSVGLAGGLGLLSQPQ
# PSPLRHASVTAYEEYEEYGEFKDSPAAYAAPGTPLETPLEPLHHTLQYTLPDITMDTLPDITTDTPVDIDTPPHDTPMEMIIIQETPSSPAPVVDPVD
# TPGPDFDIGNGDDVLNGGEDRGGGGGGVEDRGGGEEEEEEEEGYVVSGVGNDTAGIGDIAGIGIVTEAVEEE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g164
###
# start gene g165
Scaffold_1	AUGUSTUS	gene	824357	825244	0.4	+	.	g165
Scaffold_1	AUGUSTUS	transcript	824357	825244	0.4	+	.	g165.t1
Scaffold_1	AUGUSTUS	start_codon	824357	824359	.	+	0	transcript_id "g165.t1"; gene_id "g165";
Scaffold_1	AUGUSTUS	CDS	824357	825244	0.4	+	0	transcript_id "g165.t1"; gene_id "g165";
Scaffold_1	AUGUSTUS	stop_codon	825242	825244	.	+	0	transcript_id "g165.t1"; gene_id "g165";
# protein sequence = [MQTFNNSSHSRIPELNLLSFTFLPLVHEDNYALALLYIDYNEHIQLVSRNLRISPSSESNVDLDISSYSHLLPPTTIS
# YKHLPNPAETAVHLIPIPPDEDYMYDMHMHMDEDEHETDVFLGGILVVGGRKVLLYELTSQETREFKPVKGKGKRKRDSKKQIDVSTSTPTPNTDFGS
# SKQKNLNEIKKRDPRATVEWPWSWVTAYVFVALPDCLNYAHILCIILLCSCTPVDEDESSHKILIGDAFGRLAMLSLYRFKEFGMALIPLGEVSSSFL
# PRSLLNVQKLFVLCLTGNGLM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g165
###
# start gene g166
Scaffold_1	AUGUSTUS	gene	828361	828876	0.43	+	.	g166
Scaffold_1	AUGUSTUS	transcript	828361	828876	0.43	+	.	g166.t1
Scaffold_1	AUGUSTUS	start_codon	828361	828363	.	+	0	transcript_id "g166.t1"; gene_id "g166";
Scaffold_1	AUGUSTUS	CDS	828361	828876	0.43	+	0	transcript_id "g166.t1"; gene_id "g166";
Scaffold_1	AUGUSTUS	stop_codon	828874	828876	.	+	0	transcript_id "g166.t1"; gene_id "g166";
# protein sequence = [MEWNHNYMVTSLSAYRNHLVVADQFSSVSLLRLEGEEGDDNGDGDGDGDDDGGGNRKLVTVARDYSPLWPVCVEAVDD
# KSFVGADVSFFFKLCWMNGGFLREIVVDLWFGTYASCGSQQSLNMFTFSLSGSTTNNRTILVRDGFYHVGDLITKFIRGKIHSPIYLSFCLPN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g166
###
# start gene g167
Scaffold_1	AUGUSTUS	gene	831838	832353	0.49	+	.	g167
Scaffold_1	AUGUSTUS	transcript	831838	832353	0.49	+	.	g167.t1
Scaffold_1	AUGUSTUS	start_codon	831838	831840	.	+	0	transcript_id "g167.t1"; gene_id "g167";
Scaffold_1	AUGUSTUS	CDS	831838	832353	0.49	+	0	transcript_id "g167.t1"; gene_id "g167";
Scaffold_1	AUGUSTUS	stop_codon	832351	832353	.	+	0	transcript_id "g167.t1"; gene_id "g167";
# protein sequence = [MISIPIKRSPHSITGIEGHEAQWHTSPNGSTRSGPSNIAWLRHDPSRDEDQLPVRPPAARLGMVRHTAIPLSRSISSP
# ASSQLQVYPARRLGMNPAHAGSTFSLRMDGQSHVSTLYGDAYNYPLVKPLSPIAEQDYFSPESLRKTIQLPPDTSTSISPSVSSPAGSHSTRE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g167
###
# start gene g168
Scaffold_1	AUGUSTUS	gene	832793	833716	0.7	+	.	g168
Scaffold_1	AUGUSTUS	transcript	832793	833716	0.7	+	.	g168.t1
Scaffold_1	AUGUSTUS	start_codon	832793	832795	.	+	0	transcript_id "g168.t1"; gene_id "g168";
Scaffold_1	AUGUSTUS	CDS	832793	833716	0.7	+	0	transcript_id "g168.t1"; gene_id "g168";
Scaffold_1	AUGUSTUS	stop_codon	833714	833716	.	+	0	transcript_id "g168.t1"; gene_id "g168";
# protein sequence = [MDYGSTPSPLPVPAPVAQSQSYSKILPVEFTETDVSMIRSDGSSVQAYTRSPASVSSSFIRRRWDKDAGYPVGPGAFN
# LKPKRQCFYIDATPALWAFLLGFFFPVLWFVGGWHFTNFGEQPARLTLWEFYFNGAYWRELFCCGRGKLKWNDQLKESESSESKKGKGKEREKPLRIR
# HPPPLPRWITEKLSTDVKKARLNDAKRSLRGISFGYPFVPRPVVCSSSSHSNATQAARRIMSVLSRPNRFLDQFYGVRLRDVRGKREGPRRIFDPWIQ
# RCRYAFCYAMVLFLCGLATAATTLIIFSLRDFR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g168
###
# start gene g169
Scaffold_1	AUGUSTUS	gene	845249	845623	0.4	-	.	g169
Scaffold_1	AUGUSTUS	transcript	845249	845623	0.4	-	.	g169.t1
Scaffold_1	AUGUSTUS	stop_codon	845249	845251	.	-	0	transcript_id "g169.t1"; gene_id "g169";
Scaffold_1	AUGUSTUS	CDS	845249	845623	0.4	-	0	transcript_id "g169.t1"; gene_id "g169";
Scaffold_1	AUGUSTUS	start_codon	845621	845623	.	-	0	transcript_id "g169.t1"; gene_id "g169";
# protein sequence = [MEGDPVAGSELPVPIPVVNAGPSTSPTTPSAHTQYNIYITTPSSALSWYSPDSCTYSTIEAAQEAGIWDFPLNLQDRA
# RYGVFKDLWEQGYFLGGGIRFGGDYLVYPGAYGLSSPGVTPLMFKF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g169
###
# start gene g170
Scaffold_1	AUGUSTUS	gene	848450	850181	0.7	+	.	g170
Scaffold_1	AUGUSTUS	transcript	848450	850181	0.7	+	.	g170.t1
Scaffold_1	AUGUSTUS	start_codon	848450	848452	.	+	0	transcript_id "g170.t1"; gene_id "g170";
Scaffold_1	AUGUSTUS	CDS	848450	849226	0.75	+	0	transcript_id "g170.t1"; gene_id "g170";
Scaffold_1	AUGUSTUS	CDS	849310	849566	0.9	+	0	transcript_id "g170.t1"; gene_id "g170";
Scaffold_1	AUGUSTUS	CDS	849620	850181	1	+	1	transcript_id "g170.t1"; gene_id "g170";
Scaffold_1	AUGUSTUS	stop_codon	850179	850181	.	+	0	transcript_id "g170.t1"; gene_id "g170";
# protein sequence = [MDVDTSSFHLEPPPPAYSFPQAVASAAPTVTTFADAIDNLFYESMSPRRCVESPPAHQPKKRRSLSPNPPRLVEDHSS
# PSPALPVSPVQRKLERKASGPLLASFSKPSLQGLGNPSINGLKRPRRPALSAMVPPSDAALHSAYPAPTSADNQITDGRFPPTRRAFSAMLPPAPSSP
# LGESSGDSSFDLSADMSSPAQAYAKRQQMKTIRRCDGTDDFRPLTGATAMIMNESPSSKFMVDGGMPGFGDNETHGKILPCHRLQMDLLLDGAFDDKI
# RDFHVIDCRFDYEYAGGHVPGAVNINTTASVEDLLLGPSLMKPKPSVSGDGQKKTVLIFHCEFSAKRAPTFAKHLRSKDRAMNNHFYPKIHYPELYIL
# EGGYCSYYKRSAHRCEPSGYVSMDDPQHAASRKGDLDQFRKNKFGRHKSYAYGDGASKLSLASQQIKRNSAPTVGGPPVLFAAGNAARHRRGTIGNGS
# LSTLSEDSHHTTEGDETDIDLGDSPCPAPSKSIALKVKKGNRAPLSRAETYGPTRMPFLGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g170
###
# start gene g171
Scaffold_1	AUGUSTUS	gene	855163	855651	1	-	.	g171
Scaffold_1	AUGUSTUS	transcript	855163	855651	1	-	.	g171.t1
Scaffold_1	AUGUSTUS	stop_codon	855163	855165	.	-	0	transcript_id "g171.t1"; gene_id "g171";
Scaffold_1	AUGUSTUS	CDS	855163	855651	1	-	0	transcript_id "g171.t1"; gene_id "g171";
Scaffold_1	AUGUSTUS	start_codon	855649	855651	.	-	0	transcript_id "g171.t1"; gene_id "g171";
# protein sequence = [MGYTYPEFNNLDVGNEVAVRSAIAAQVNKLYGGPFTKFAAAIQQPSCQTTADASAIGNVTSDASSHLVDSKINLTLNR
# SIDDAPQVKIASTVRNNEQKEFWEWTARVQVKKYEIGGSFKVLFFLGSVPSDPKEWATDPHFVGAFHGFVNRLAAISLSQYFNL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g171
###
# start gene g172
Scaffold_1	AUGUSTUS	gene	859346	859876	0.99	-	.	g172
Scaffold_1	AUGUSTUS	transcript	859346	859876	0.99	-	.	g172.t1
Scaffold_1	AUGUSTUS	stop_codon	859346	859348	.	-	0	transcript_id "g172.t1"; gene_id "g172";
Scaffold_1	AUGUSTUS	CDS	859346	859876	0.99	-	0	transcript_id "g172.t1"; gene_id "g172";
Scaffold_1	AUGUSTUS	start_codon	859874	859876	.	-	0	transcript_id "g172.t1"; gene_id "g172";
# protein sequence = [MLLTTGNYFASHGIVAVIINYRLVPDVAYPGGGNDIQMAREWVYHNISKQQSGNGDPEKVVLVGSSVGGLHIATNIYL
# ADHSNVNSKPVFPPIAGIVYLSTPFSFDTTPEDRQTALRAYYETEDAKEIYEYSPVGLIEALSASSLVLDPRKFPCLIVLAQYDPYVITFGLLSRDDS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g172
###
# start gene g173
Scaffold_1	AUGUSTUS	gene	861700	862811	0.23	-	.	g173
Scaffold_1	AUGUSTUS	transcript	861700	862811	0.23	-	.	g173.t1
Scaffold_1	AUGUSTUS	stop_codon	861700	861702	.	-	0	transcript_id "g173.t1"; gene_id "g173";
Scaffold_1	AUGUSTUS	CDS	861700	862028	0.98	-	2	transcript_id "g173.t1"; gene_id "g173";
Scaffold_1	AUGUSTUS	CDS	862089	862580	0.67	-	2	transcript_id "g173.t1"; gene_id "g173";
Scaffold_1	AUGUSTUS	CDS	862697	862811	0.24	-	0	transcript_id "g173.t1"; gene_id "g173";
Scaffold_1	AUGUSTUS	start_codon	862809	862811	.	-	0	transcript_id "g173.t1"; gene_id "g173";
# protein sequence = [MGTITNHFPLDDARKTKLQSLKAQVEDAQKQLDAAHARRSGAEKEAENKPLTSAERVVSNDADTETRPNSSKRRRTDA
# GYEDSAATSLARTKEEISGLHVTLREVLERVSIVENNIASQETEVREVMQAYHAQGEAGESSIVNPLEASYQSYAGEQMDDIAMNLTELSEWIAELYI
# DNASIDERHKDMIAKKEGEEAEIRVVTRVEEHEKSRAKDRNEIEALSAALTAYYEKPVSPPSSPFDPETVVLDMEEQIKELVRNAIKPHVEETRTTLS
# EDLQKYDSELYRSLWKKLSMTNQVIAAVSEATTRPPT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g173
###
# start gene g174
Scaffold_1	AUGUSTUS	gene	868166	868555	0.6	+	.	g174
Scaffold_1	AUGUSTUS	transcript	868166	868555	0.6	+	.	g174.t1
Scaffold_1	AUGUSTUS	start_codon	868166	868168	.	+	0	transcript_id "g174.t1"; gene_id "g174";
Scaffold_1	AUGUSTUS	CDS	868166	868555	0.6	+	0	transcript_id "g174.t1"; gene_id "g174";
Scaffold_1	AUGUSTUS	stop_codon	868553	868555	.	+	0	transcript_id "g174.t1"; gene_id "g174";
# protein sequence = [MDPTFTPDTKSNSPIYATPSVRHIARQRGVDLSQLAPGSGKDGRIERRDIDDYLAGAATTGAPVALQDDQDVVVELGR
# TRHSMWKAMEKVHSSINHVDINTDQQSRVYIYPTLGEFLDTSTRSGLNTQW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g174
###
# start gene g175
Scaffold_1	AUGUSTUS	gene	868932	869303	0.75	+	.	g175
Scaffold_1	AUGUSTUS	transcript	868932	869303	0.75	+	.	g175.t1
Scaffold_1	AUGUSTUS	start_codon	868932	868934	.	+	0	transcript_id "g175.t1"; gene_id "g175";
Scaffold_1	AUGUSTUS	CDS	868932	869303	0.75	+	0	transcript_id "g175.t1"; gene_id "g175";
Scaffold_1	AUGUSTUS	stop_codon	869301	869303	.	+	0	transcript_id "g175.t1"; gene_id "g175";
# protein sequence = [MYALSSQLKYLSHLGRQIPCGLTPKEMPKRGGTLTVSNVGAIGAGDFAAPVLVPGGGVAIVALGRAKWVWDVDRGDGS
# GERRLKLGVSWSADHRVIEGAELAAFVECWRGYVENPARLIADSV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g175
###
# start gene g176
Scaffold_1	AUGUSTUS	gene	869385	869876	0.19	-	.	g176
Scaffold_1	AUGUSTUS	transcript	869385	869876	0.19	-	.	g176.t1
Scaffold_1	AUGUSTUS	stop_codon	869385	869387	.	-	0	transcript_id "g176.t1"; gene_id "g176";
Scaffold_1	AUGUSTUS	CDS	869385	869770	0.99	-	2	transcript_id "g176.t1"; gene_id "g176";
Scaffold_1	AUGUSTUS	CDS	869867	869876	0.19	-	0	transcript_id "g176.t1"; gene_id "g176";
Scaffold_1	AUGUSTUS	start_codon	869874	869876	.	-	0	transcript_id "g176.t1"; gene_id "g176";
# protein sequence = [MGKFLDVDSHSILIDFEGLAGSVTSIAPSPTFMVSVARDRYCRIHSTFPAPEQPGQQQEHKGEVLEKIFSKSTPTVVV
# WDGDHSSTKPIASSQELEEGDGDSDEDVWDNMEEVDDDGKVQGSKTTKKQRND]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g176
###
# start gene g177
Scaffold_1	AUGUSTUS	gene	875717	876908	0.32	+	.	g177
Scaffold_1	AUGUSTUS	transcript	875717	876908	0.32	+	.	g177.t1
Scaffold_1	AUGUSTUS	start_codon	875717	875719	.	+	0	transcript_id "g177.t1"; gene_id "g177";
Scaffold_1	AUGUSTUS	CDS	875717	876080	0.49	+	0	transcript_id "g177.t1"; gene_id "g177";
Scaffold_1	AUGUSTUS	CDS	876303	876609	0.39	+	2	transcript_id "g177.t1"; gene_id "g177";
Scaffold_1	AUGUSTUS	CDS	876710	876908	0.53	+	1	transcript_id "g177.t1"; gene_id "g177";
Scaffold_1	AUGUSTUS	stop_codon	876906	876908	.	+	0	transcript_id "g177.t1"; gene_id "g177";
# protein sequence = [METYIKKAEDLEAVNNNFMPPLLDAILGDYNRNVPAARDAEVLNVMATITSRLGVRPVSNTSLLYCADCRSQALLTPQ
# IPAILDAVFEPTLTMINQDFAEFPEHRVGFFKLLRAININCFPLCLEVVNNFANAGDPSVSNAFFQQYFLSIVQDIFFVLTDTDHKSGFKLQSALLAR
# MFELVELNAIQTPLYDPSQVSDPNVTNSMFLREYTANLLKTAFPHIQPDINRFKLALRDFLIQLKEFSGDNTELFLEEKEAENLKKAEEERQAALRIP
# GMLKPSQLEDKDEEI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g177
###
# start gene g178
Scaffold_1	AUGUSTUS	gene	878668	879522	0.99	-	.	g178
Scaffold_1	AUGUSTUS	transcript	878668	879522	0.99	-	.	g178.t1
Scaffold_1	AUGUSTUS	stop_codon	878668	878670	.	-	0	transcript_id "g178.t1"; gene_id "g178";
Scaffold_1	AUGUSTUS	CDS	878668	879522	0.99	-	0	transcript_id "g178.t1"; gene_id "g178";
Scaffold_1	AUGUSTUS	start_codon	879520	879522	.	-	0	transcript_id "g178.t1"; gene_id "g178";
# protein sequence = [MSSETSSSLSSLARSKLHQCNLHRWVLLKNSIINALPVASTSSTTDYADAGLPQAEVEDEEISTEDTDSFMFPDAGKL
# VDSSGRDNASEAQWLDSLLETLGDDEEDDFGADSGSVSQIDDDYDQMLSPLPSPMSSSDDLINDSYLSSSFSYPYLAPYPPFHPPLINPYHFDSTSAS
# SPYVDPLPYYELDDDVPDLPVPDAIEDTSDDESDSPLTPSGQSSSSLTLIDPAAIPLPADRPRIVSRAALHIFIDSDDSSFYPYELGPDPLPFSDDFR
# SPYNMYQQEC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g178
###
# start gene g179
Scaffold_1	AUGUSTUS	gene	880062	880611	0.62	-	.	g179
Scaffold_1	AUGUSTUS	transcript	880062	880611	0.62	-	.	g179.t1
Scaffold_1	AUGUSTUS	stop_codon	880062	880064	.	-	0	transcript_id "g179.t1"; gene_id "g179";
Scaffold_1	AUGUSTUS	CDS	880062	880463	0.82	-	0	transcript_id "g179.t1"; gene_id "g179";
Scaffold_1	AUGUSTUS	CDS	880522	880611	0.62	-	0	transcript_id "g179.t1"; gene_id "g179";
Scaffold_1	AUGUSTUS	start_codon	880609	880611	.	-	0	transcript_id "g179.t1"; gene_id "g179";
# protein sequence = [MSKLRLAEYHFRKAVEIHPDNAVLLGCVGMVAERRGDREGARAFFDKAVGISPDNALVRYRRAKILISAKAYKVSDRV
# NTCYKNSSVHTQAAIKDLEHLRNSSPEESNVVFQLAKVYRLVGDEVKSAQLLAIARDISPKSMGKIKKLLDTKKDDGGDDKMDEG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g179
###
# start gene g180
Scaffold_1	AUGUSTUS	gene	883954	884965	0.28	-	.	g180
Scaffold_1	AUGUSTUS	transcript	883954	884965	0.28	-	.	g180.t1
Scaffold_1	AUGUSTUS	stop_codon	883954	883956	.	-	0	transcript_id "g180.t1"; gene_id "g180";
Scaffold_1	AUGUSTUS	CDS	883954	884280	0.47	-	0	transcript_id "g180.t1"; gene_id "g180";
Scaffold_1	AUGUSTUS	CDS	884375	884965	0.59	-	0	transcript_id "g180.t1"; gene_id "g180";
Scaffold_1	AUGUSTUS	start_codon	884963	884965	.	-	0	transcript_id "g180.t1"; gene_id "g180";
# protein sequence = [MDRYFSTPTSFIALQPLSTKDLPFLTAVLVAFTPPHTSTSSMTFPADSEIFFDLVQADLECLEESCSLIESLSLDVED
# VRLCLALGFKTPSEHPTGSSLRSILDFIEKGEYPSLWANAPDDFDVPRKQKAFDMCRAALIKTVVEVAGEEAAEMSLWDDSEGRAGGEFVVRMVEWLK
# GYVIDMDAGKGAFFDRSDWQHNATVLLSPPHYLAPALSSQHLLSISTDIKVKHGVLGLLKHIAQAGPPGSDIHVILGRAGLIQSICDSGVWDEKTDGM
# AEVLQVSAIGVVKHMCNTNGWIVSFNLHLVC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g180
###
# start gene g181
Scaffold_1	AUGUSTUS	gene	890392	890849	0.58	+	.	g181
Scaffold_1	AUGUSTUS	transcript	890392	890849	0.58	+	.	g181.t1
Scaffold_1	AUGUSTUS	start_codon	890392	890394	.	+	0	transcript_id "g181.t1"; gene_id "g181";
Scaffold_1	AUGUSTUS	CDS	890392	890692	0.58	+	0	transcript_id "g181.t1"; gene_id "g181";
Scaffold_1	AUGUSTUS	CDS	890818	890849	0.66	+	2	transcript_id "g181.t1"; gene_id "g181";
Scaffold_1	AUGUSTUS	stop_codon	890847	890849	.	+	0	transcript_id "g181.t1"; gene_id "g181";
# protein sequence = [MYSHPDDFIPFLPSTSGEDGPGALNAGIISPKGFEYYCQAIRDTSEWGGEPEILALSRAFNVPIHVIQSGQPPIVIHN
# PTGTPNDGDVRDKRVVRISYHRQYPELNTPKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g181
###
# start gene g182
Scaffold_1	AUGUSTUS	gene	890916	891239	1	-	.	g182
Scaffold_1	AUGUSTUS	transcript	890916	891239	1	-	.	g182.t1
Scaffold_1	AUGUSTUS	stop_codon	890916	890918	.	-	0	transcript_id "g182.t1"; gene_id "g182";
Scaffold_1	AUGUSTUS	CDS	890916	891239	1	-	0	transcript_id "g182.t1"; gene_id "g182";
Scaffold_1	AUGUSTUS	start_codon	891237	891239	.	-	0	transcript_id "g182.t1"; gene_id "g182";
# protein sequence = [MGPIVVAGPGPTEPQAQSSPVAPLPPAKTDVDTSALPTQSSQLISPTQDDVANDQDETEEDDEPPHSRQASNLDPYSN
# LDNAFGGYLADEPRPMASRQHDDDDDLLF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g182
###
# start gene g183
Scaffold_1	AUGUSTUS	gene	897555	897908	0.46	-	.	g183
Scaffold_1	AUGUSTUS	transcript	897555	897908	0.46	-	.	g183.t1
Scaffold_1	AUGUSTUS	stop_codon	897555	897557	.	-	0	transcript_id "g183.t1"; gene_id "g183";
Scaffold_1	AUGUSTUS	CDS	897555	897908	0.46	-	0	transcript_id "g183.t1"; gene_id "g183";
Scaffold_1	AUGUSTUS	start_codon	897906	897908	.	-	0	transcript_id "g183.t1"; gene_id "g183";
# protein sequence = [MPSWAYDAVVENVMFTRNVLAMNPDIMNADGSVNLASIGSTPMMVPPDVGSALNAASSPSSDSSSTSTASSVASSSAS
# SASSTSSPVGASSTNGAMSVTSSKALVGAVVLAVTFFAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g183
###
# start gene g184
Scaffold_1	AUGUSTUS	gene	898868	899233	0.21	+	.	g184
Scaffold_1	AUGUSTUS	transcript	898868	899233	0.21	+	.	g184.t1
Scaffold_1	AUGUSTUS	start_codon	898868	898870	.	+	0	transcript_id "g184.t1"; gene_id "g184";
Scaffold_1	AUGUSTUS	CDS	898868	899233	0.21	+	0	transcript_id "g184.t1"; gene_id "g184";
Scaffold_1	AUGUSTUS	stop_codon	899231	899233	.	+	0	transcript_id "g184.t1"; gene_id "g184";
# protein sequence = [MVLVESIIMVLVESIIMVLLDSIIMVLLESIIDIDVSEQSPLEQPEEIIELEDEQSPLLQLESEDEDEQSPLLHPLDA
# ADDDEPEQSPFVQALVELELYGRADAKPDKRATAIKDLGRTML]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g184
###
# start gene g185
Scaffold_1	AUGUSTUS	gene	904553	905771	0.49	+	.	g185
Scaffold_1	AUGUSTUS	transcript	904553	905771	0.49	+	.	g185.t1
Scaffold_1	AUGUSTUS	start_codon	904553	904555	.	+	0	transcript_id "g185.t1"; gene_id "g185";
Scaffold_1	AUGUSTUS	CDS	904553	905075	0.53	+	0	transcript_id "g185.t1"; gene_id "g185";
Scaffold_1	AUGUSTUS	CDS	905170	905771	0.61	+	2	transcript_id "g185.t1"; gene_id "g185";
Scaffold_1	AUGUSTUS	stop_codon	905769	905771	.	+	0	transcript_id "g185.t1"; gene_id "g185";
# protein sequence = [MGKSIRRRFKSVTGVLTRRSMSISYSANRTRDTGFPFEASELKKKPRGSMSLDSKTVMRPLQSSQNGLLRTTLNSPSI
# HPLELPESLSETETQHTEIAFIFPVQSPSPHAAAIDQFIPEDQMLSPIIPFSDSILTESLIDFVVPQFLQQGTPLLKISKKRHKPIQFVFRLDADQVA
# VENIKEIRTGQAALHHITQLQCTPVEDYLPRWLTLIYLGPSPSKARSKPNLSPLPLGSPKSNYSVHTYKTLHLVASSHLVIQLWERTLRSMVALRVSL
# TSGLGFGGGMNSDRIMEETRQALWERSFWTAAGENMRSRFGSNADWSVGEGDESLELSGAHEGQRLTFNEMRALCERLNVRMSEKEVRRLFNVCGQMY
# RM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g185
###
# start gene g186
Scaffold_1	AUGUSTUS	gene	907373	908566	0.54	+	.	g186
Scaffold_1	AUGUSTUS	transcript	907373	908566	0.54	+	.	g186.t1
Scaffold_1	AUGUSTUS	start_codon	907373	907375	.	+	0	transcript_id "g186.t1"; gene_id "g186";
Scaffold_1	AUGUSTUS	CDS	907373	908566	0.54	+	0	transcript_id "g186.t1"; gene_id "g186";
Scaffold_1	AUGUSTUS	stop_codon	908564	908566	.	+	0	transcript_id "g186.t1"; gene_id "g186";
# protein sequence = [MLHKVRGRGKPDSSPPPSSYSPRRPIKKALASGHSSTSSVASSKTRMRMSPDLLSLLVYTVGVKYRGINKKEVYRSEE
# MFSLSENMANKMLKVGMIDLIKHTRGHLVRIYPKGTRVRSTNYQPHRYWSAGAQLVAINWQTVGKLPGTAFFSAETYQRSDLGYMINHAMFQRNGGCG
# YLLKPLPLRMPHKGLLSKQTQHYLELTIVSAQHLPAPKDASGKDVSESSPVNPYVQVTIHVPDWPTPPSVSANSIASGLVSANDAVSAVLSQGSGPPS
# PASGYFPTNPRFPGSTSYCTSVVKNNGFNPVWEENMRIPFTCVGDMKDLIYVNFAVRHTEREDVEPLAQFFASLGCLQHGMCFHWKLDLANGVVSSGY
# RHLPLHDSQMSQYLFSTLFVRIDIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g186
###
# start gene g187
Scaffold_1	AUGUSTUS	gene	910692	912643	0.28	+	.	g187
Scaffold_1	AUGUSTUS	transcript	910692	912643	0.28	+	.	g187.t1
Scaffold_1	AUGUSTUS	start_codon	910692	910694	.	+	0	transcript_id "g187.t1"; gene_id "g187";
Scaffold_1	AUGUSTUS	CDS	910692	911840	0.46	+	0	transcript_id "g187.t1"; gene_id "g187";
Scaffold_1	AUGUSTUS	CDS	911899	911993	0.42	+	0	transcript_id "g187.t1"; gene_id "g187";
Scaffold_1	AUGUSTUS	CDS	912244	912643	0.38	+	1	transcript_id "g187.t1"; gene_id "g187";
Scaffold_1	AUGUSTUS	stop_codon	912641	912643	.	+	0	transcript_id "g187.t1"; gene_id "g187";
# protein sequence = [MSAPPNVSPSSSPAKSSFIPTFSPPQSKFEPEIPEFDNSRLSSPPPRTSSQWKFVSKPYTPPSRSSRRQEVQYEDVEV
# PLRDEDEPQSSFPDPVPMKLVAELDRDAGEISEIDLPNMESEGSDDADEQNAVIQQHIADEGTIVKLSRQSLLTEDTKPMSVLSRLLLLALVGVVSYF
# TFEYKEESASIGYCDTGSSTNRVLEELKSTRSLIIECNNENRTTLYDHVLVLDSPPCPVVPIPLYPESCTPCPEHAICSGHTIACEKAYILKSPFLLS
# FLPPIADPSKTTLSTSVSPSDIAWKVISIIFDGLPGFGNVAFPPSCVEDPRRKRHIGALGKGIEALLGQHRGSLLCNAEADMIIKDVDGGEARRWGMQ
# VHELKEKMREGPQHVLPNFDDLFNEAVQQLVQWGGVLISEDANRRSKKKIESKRIASLVQIAIDALQHQELAHYTDPVSTPQPFLSSIQLRDLVLQEE
# HSVTVRQKVWEKVEKIVEGNANVRANLEEVYGGDELRVWRWVGSTAGSIDGGRGIVKQNDSLELNSPSSFHEDMEEM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g187
###
# start gene g188
Scaffold_1	AUGUSTUS	gene	918020	918865	0.54	+	.	g188
Scaffold_1	AUGUSTUS	transcript	918020	918865	0.54	+	.	g188.t1
Scaffold_1	AUGUSTUS	start_codon	918020	918022	.	+	0	transcript_id "g188.t1"; gene_id "g188";
Scaffold_1	AUGUSTUS	CDS	918020	918865	0.54	+	0	transcript_id "g188.t1"; gene_id "g188";
Scaffold_1	AUGUSTUS	stop_codon	918863	918865	.	+	0	transcript_id "g188.t1"; gene_id "g188";
# protein sequence = [MSTAPNYPEQTPRTTIIHRQEPPNCTQQLEHCEPQLDSLIGSMQSTFTSIAGIEQALAEETTAFVSDHKAQNRQRHQL
# HKSVSVPLSSDYHSPATTIVTSEKPLAAPITPTKLYLFTDAMLPLIVNLDKLPGDGVAYLCLQLDVPKPQAISSLAKKSLSGFGVQLEATCPVTRSPF
# TNYKCITQVWGVSSDLNYSARTIGFPGTKQEPLAASPYMLRREVLVAQTPHKISEDQVPMSCLARQEAVVTLSEQALSRSSNRRLMMLYFPESALSSC
# QLLEQGM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g188
###
# start gene g189
Scaffold_1	AUGUSTUS	gene	924475	924888	1	+	.	g189
Scaffold_1	AUGUSTUS	transcript	924475	924888	1	+	.	g189.t1
Scaffold_1	AUGUSTUS	start_codon	924475	924477	.	+	0	transcript_id "g189.t1"; gene_id "g189";
Scaffold_1	AUGUSTUS	CDS	924475	924888	1	+	0	transcript_id "g189.t1"; gene_id "g189";
Scaffold_1	AUGUSTUS	stop_codon	924886	924888	.	+	0	transcript_id "g189.t1"; gene_id "g189";
# protein sequence = [MDGPPPQEEDFSSIPVAERLAHKNWKARVSAYETLLKTFQNTASDTDPAFKPYTNNPDLLKRIATDSNAVAQEKAIEC
# LVAYVKFAGETAAKTREVVLPALVDKCYGSSRAGTKANALELTLQYVEIENSGTGVVVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g189
###
# start gene g190
Scaffold_1	AUGUSTUS	gene	925263	926884	0.16	+	.	g190
Scaffold_1	AUGUSTUS	transcript	925263	926884	0.16	+	.	g190.t1
Scaffold_1	AUGUSTUS	start_codon	925263	925265	.	+	0	transcript_id "g190.t1"; gene_id "g190";
Scaffold_1	AUGUSTUS	CDS	925263	925404	0.9	+	0	transcript_id "g190.t1"; gene_id "g190";
Scaffold_1	AUGUSTUS	CDS	925488	925840	0.27	+	2	transcript_id "g190.t1"; gene_id "g190";
Scaffold_1	AUGUSTUS	CDS	925906	926385	0.59	+	0	transcript_id "g190.t1"; gene_id "g190";
Scaffold_1	AUGUSTUS	CDS	926441	926884	0.89	+	0	transcript_id "g190.t1"; gene_id "g190";
Scaffold_1	AUGUSTUS	stop_codon	926882	926884	.	+	0	transcript_id "g190.t1"; gene_id "g190";
# protein sequence = [MEKEGKGKGTLKPERLTRAQAREAEATAENDGDGDNEQTLDGAGDDVEPEDIVSKLPASLSTALTSSKWKERKEVLDE
# LQAVLNATPRIKDAPALGDLAKSLAARVQADANINCVMTAAACLEALAKGMSASFSRFRETVVPPMLERLKERKATVTDAIGTALDATTLSDIIPDLG
# PALGHKNPQVKEGTLKFLRRCLAISRTPIQPPQVKPLAETLASILEDSFEGCRNEAANCLGTLMKMVGERSLNAVIDSLADVRKAKIKEAFEKATVKC
# KVGGAAPPTMKPAAPLAKKAPPKIAPPMKEELLIDDVEPPKKVAKPPARLMKAKPSVPSGTSSVPPSAPPPKKPPPATGAKPAKSTAPAAPGALDTFK
# YKHTPEDAETLAADLITASILTDLGDANWKTRLAALDEMSAWLDGVIVNVDSEVMIRLLAKKGWAEKNFQVNFPLTSNSNLFKSDSEYRFQRKYTVSA
# LC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g190
###
# start gene g191
Scaffold_1	AUGUSTUS	gene	927273	929077	0.74	+	.	g191
Scaffold_1	AUGUSTUS	transcript	927273	929077	0.74	+	.	g191.t1
Scaffold_1	AUGUSTUS	start_codon	927273	927275	.	+	0	transcript_id "g191.t1"; gene_id "g191";
Scaffold_1	AUGUSTUS	CDS	927273	927294	0.76	+	0	transcript_id "g191.t1"; gene_id "g191";
Scaffold_1	AUGUSTUS	CDS	927351	929077	0.9	+	2	transcript_id "g191.t1"; gene_id "g191";
Scaffold_1	AUGUSTUS	stop_codon	929075	929077	.	+	0	transcript_id "g191.t1"; gene_id "g191";
# protein sequence = [MKLFAGSGIKDLLEDLNPQLLNTISSEFDKVEGIAPSEPTRLSADVAAAPTATSQSGGTGSDALDELFPRVEIDALLK
# GTTILADAKNEAWKTKKEALETLQGILDQGSNKRLKPNMGERCSSCCVDLSLTKLPGEIAQVLKARVVDTNKSVQLLALDIVARIATGMGKPFEKQNR
# FFVIPIATVLADQKAPIRSAALTTLTCIANACETLDSLVPGIASGLETANPLQKATLLHWISDWFKEHEPTPGLDLSGWAAPIVSSLDDRNGDVRKGA
# QALLPVLITCAGFDYVLQQTNSLKPASRTSAAPLIQAARPLAPVEPPAAPASKGKASAPPFQSQASSPRSESPAITENPPSKSVKLTGVRRKLPLGST
# RRPESRSETPVEATASKLAKPPAGLKRPGPLASSAVKGAPIAASPASPSLSLPFFSSNVEARKSRCNRDPGRWINESGTTRKDLADLLCSQMEGHASK
# EVISRLFSHDHNAINDHIAGINMLCDMYNLAQGADETVEAVCLANFDLPLKYASIKAHEPQPSLISKCLELVETVLAFLRNINYQLTDNEALCFIPTI
# IFKVGPEFYPTIFA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g191
###
# start gene g192
Scaffold_1	AUGUSTUS	gene	929763	931641	0.21	+	.	g192
Scaffold_1	AUGUSTUS	transcript	929763	931641	0.21	+	.	g192.t1
Scaffold_1	AUGUSTUS	start_codon	929763	929765	.	+	0	transcript_id "g192.t1"; gene_id "g192";
Scaffold_1	AUGUSTUS	CDS	929763	930433	0.72	+	0	transcript_id "g192.t1"; gene_id "g192";
Scaffold_1	AUGUSTUS	CDS	930949	931394	0.85	+	1	transcript_id "g192.t1"; gene_id "g192";
Scaffold_1	AUGUSTUS	CDS	931445	931641	0.64	+	2	transcript_id "g192.t1"; gene_id "g192";
Scaffold_1	AUGUSTUS	stop_codon	931639	931641	.	+	0	transcript_id "g192.t1"; gene_id "g192";
# protein sequence = [MKGPTTSHLPGPSQSSTPLSPTIANRKPTLPSRLGRPKSHFSHPSDSHLTLTNEKPLLDKNINGGDEDPDDLQPAGSD
# DITLTISSILSSDPSRSVDALKKIQKILSVGPEGCNSSPLYRDLAEHTEGLIETITLQMAHIFERPEDIASEENFRLAKHLIQTLNNFCDHPLLAESL
# TIDILTSLLEELTLRLLETDDSSVKQVKDLSRFINMIILRLFATGRRIAHATSEPPQNGHDDLDRRSRPVSTTSSRPISPQTASSATSGGLRQSPGRR
# DSPLPASGNGYAPVEEPDPDAQLLVIIGHISSETTGALHKEGITELHHFLKAYPHKRPRVEKMLESTGAAFRKYINRALASRAAEDQERGVAVADTLS
# KLESNHQEPPSSPIHSDSAPQSPRRVSGGAAEDKLSRLHDIFQYRSSTVSNGSSQGPAPTRTSAG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g192
###
# start gene g193
Scaffold_1	AUGUSTUS	gene	945638	945901	0.97	-	.	g193
Scaffold_1	AUGUSTUS	transcript	945638	945901	0.97	-	.	g193.t1
Scaffold_1	AUGUSTUS	stop_codon	945638	945640	.	-	0	transcript_id "g193.t1"; gene_id "g193";
Scaffold_1	AUGUSTUS	CDS	945638	945901	0.97	-	0	transcript_id "g193.t1"; gene_id "g193";
Scaffold_1	AUGUSTUS	start_codon	945899	945901	.	-	0	transcript_id "g193.t1"; gene_id "g193";
# protein sequence = [MLSQKEANSSAGVFRAVSPGVSDIDEGPTVPVDRSRAYLESVQRWMNDVVDSNHVMEPVDEPEPQPAENAAQHPPFDG
# GEWLAPDGE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g193
###
# start gene g194
Scaffold_1	AUGUSTUS	gene	951687	952808	0.2	+	.	g194
Scaffold_1	AUGUSTUS	transcript	951687	952808	0.2	+	.	g194.t1
Scaffold_1	AUGUSTUS	start_codon	951687	951689	.	+	0	transcript_id "g194.t1"; gene_id "g194";
Scaffold_1	AUGUSTUS	CDS	951687	951832	0.2	+	0	transcript_id "g194.t1"; gene_id "g194";
Scaffold_1	AUGUSTUS	CDS	951905	952808	0.53	+	1	transcript_id "g194.t1"; gene_id "g194";
Scaffold_1	AUGUSTUS	stop_codon	952806	952808	.	+	0	transcript_id "g194.t1"; gene_id "g194";
# protein sequence = [MASNRHRVASSHRDGQPFDTSERGKVTEQIHNRGLSTTINGNTLNKVRSASILATDSKRPQTIVTLPTFPTVSQEEAK
# GRAERFVSMFRDVAMYVGTVTGTLLTPMLNFHCRVSSQIIQDTVLLDQEERKLQTFNEISSTLAKISASSAASVAGPIADILLAHAQSKERLDENFRL
# LGAAWEKVFNSLMVEFSMGLENRLQAALASVKNEAEIVMNGIRVESNSLKRRSDRASMSPEPDRQRRRSRDHRTNEEHNGSYRRSRSSTRDRKRRKLA
# PSSRSCSPDPGLDPKGEAHSSRNSIVRVSLDDILNQMKMKIDQQTNSLQQLSKENEEVPCNHIIFIHLRAERRSV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g194
###
# start gene g195
Scaffold_1	AUGUSTUS	gene	953484	956434	0.74	-	.	g195
Scaffold_1	AUGUSTUS	transcript	953484	956434	0.74	-	.	g195.t1
Scaffold_1	AUGUSTUS	stop_codon	953484	953486	.	-	0	transcript_id "g195.t1"; gene_id "g195";
Scaffold_1	AUGUSTUS	CDS	953484	954729	0.75	-	1	transcript_id "g195.t1"; gene_id "g195";
Scaffold_1	AUGUSTUS	CDS	954804	956434	0.74	-	0	transcript_id "g195.t1"; gene_id "g195";
Scaffold_1	AUGUSTUS	start_codon	956432	956434	.	-	0	transcript_id "g195.t1"; gene_id "g195";
# protein sequence = [MRAHDNPSPPPQSPEIFNHLNLPTLSLPFPLVSTSEDTSDSSTPASPPSIFTPLPVSELTGDESGTLISFETSTFLSN
# TLETPTRLGLPNNILHQSLTSDITPIAQPDMSLFHDTDLAPTDTVDEQSVADALVLSVDEVETINPESTSNDTQDPFEESSHKPFQRSTRPRRSTARY
# SIRPETFEFDASDTDDPGPSDETKRDDSETKISSPRRKTITLVPNQVEMPEPLLFSQQPRSRSPIRKSALKNMRELGSLSPSSSTILKSLFPPAISPP
# GEPPETEPTSTQPPSEQILTPARPTPPIRFTSPVRKASPKKFQLQPADLDNPNRTPARRIPIEAAVANGQVSVQKAARLMANGRTTTSSRPVFNIPST
# DSPVRRVLLHDANPINSPTKHLLGSPMRSRSVEPNPVEPMRLNLKKRSESVEPATSKSQGKVSSRASPFSRSNLAERVPLPSKVNLSLHPAIPEEGQS
# TKLHEKFQRPAARTGPAPVERSHLRQPTSKIPRIGLKPYARPPITSTSKSQEKTTTMRMVDSHKLQPSSNKVLRRSHTPSHVPTFSPTKQRDPVPGTP
# LSLKRKRGPEASSPTKPTPVVLLSRRLAAPSPSPAKKSGVTKLRMVSESDGTLPDRSNAASSGTEGMKSAESTATRDNTNTLRPATTLRMVSDSDGVL
# PDRFVVMPSVLQAVDEEKTTSSSPPSTVTTQSMDLPPQAQDEVTPSSDNIPDSSDPAEPQSSSPVETVRRTTRSSRNAAAAMKPVSSSRPPSARRKNI
# PTFTDTGPFSGMTALALRTLTDSNTTKNKEYVTVLLKTEVVRREGARPESPGMNVKSISQKEKESKTLERNARADRRAKRDNSTELGTDENEAYEDED
# CENDWASSPSDHKHTWGPGDEEDYQTPVQSKRLRLDEEISEDEYEKKRVKWDRGLYQEIYLDEIKPRTTHARITQESIQKGCLAPIAKVSCHAFFV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g195
###
# start gene g196
Scaffold_1	AUGUSTUS	gene	956498	956920	1	-	.	g196
Scaffold_1	AUGUSTUS	transcript	956498	956920	1	-	.	g196.t1
Scaffold_1	AUGUSTUS	stop_codon	956498	956500	.	-	0	transcript_id "g196.t1"; gene_id "g196";
Scaffold_1	AUGUSTUS	CDS	956498	956920	1	-	0	transcript_id "g196.t1"; gene_id "g196";
Scaffold_1	AUGUSTUS	start_codon	956918	956920	.	-	0	transcript_id "g196.t1"; gene_id "g196";
# protein sequence = [MRIQFKLNFESRSSNHYILNAFALPLASYLVMSNGDASSSGLLQLYTTDVSNNVQARIFSGPVDPPEKPIAASESNNY
# LSPSPPSPSRRSPRLLKGPEPDYTDPNGGSVGAIVNQDEELFGLSRPLTPENEAIVQNGECQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g196
###
# start gene g197
Scaffold_1	AUGUSTUS	gene	957185	959431	0.14	+	.	g197
Scaffold_1	AUGUSTUS	transcript	957185	959431	0.14	+	.	g197.t1
Scaffold_1	AUGUSTUS	start_codon	957185	957187	.	+	0	transcript_id "g197.t1"; gene_id "g197";
Scaffold_1	AUGUSTUS	CDS	957185	958180	0.33	+	0	transcript_id "g197.t1"; gene_id "g197";
Scaffold_1	AUGUSTUS	CDS	958231	958578	0.26	+	0	transcript_id "g197.t1"; gene_id "g197";
Scaffold_1	AUGUSTUS	CDS	958667	959431	0.26	+	0	transcript_id "g197.t1"; gene_id "g197";
Scaffold_1	AUGUSTUS	stop_codon	959429	959431	.	+	0	transcript_id "g197.t1"; gene_id "g197";
# protein sequence = [MQAAPRAPSPLRQFETRRGESTPGIDSDPHFRNSDSDDDSDDDREHDSAASVTQFAANFANKFGNFVGGMTSPSPSPS
# PGPVMMSSSEIEREAQRERERGRREAERILQAENQRTSLENRVLAMLDSTRALPPPPSRSQTMPNPESSQPSSPSSNVSWWSAAKNRLTPTKDKDLTP
# AQQVIIDVKRSEKDRERAEKEFQKEVKRLSKGKEKEWPAVAETKYSDPAFFNLNVPQTPTPQHRRTGSPTSPSPNPNSSPGRVLGSPSATGSPARSFT
# APNLTPSPNRSTTSTGAGASPGRAEQPPLYAQFNPQGGLDVHLTLITIAKRQVPFLLFLEKWTVGHVRALEERMGDVERWLVDKEEREQRTTGKDNEA
# EVTDSSSKEEGSNQVQDGDIRNEVQNLREEVLELQGRISELGREMAESSRERAFEKVMPEKLSSSKQSQSAQIRRSRVPSVRESTSPPLLRSLSRQTT
# GSRLPYPTGDYAPIPLDAGAVMTGTFSPPVSPPGSLNSRTPTGKITSAISGVSANTNHTPSGIGLGLAIAAPSGAPGISSSASTYSTSYSNASFSSVS
# SISPSTSPSPSPRPRGPQQSANVNASPSNASKGRVLPIPPSSAKDQQGMSTSPSGGRKRYTVALGTPITRASAMMAGDNGSDSSYVNGNTGNEEHGRL
# PRKGSNSSIGRAFFSSSPVSVSRGEDVGGGGEERIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g197
###
# start gene g198
Scaffold_1	AUGUSTUS	gene	967516	967920	0.75	+	.	g198
Scaffold_1	AUGUSTUS	transcript	967516	967920	0.75	+	.	g198.t1
Scaffold_1	AUGUSTUS	start_codon	967516	967518	.	+	0	transcript_id "g198.t1"; gene_id "g198";
Scaffold_1	AUGUSTUS	CDS	967516	967920	0.75	+	0	transcript_id "g198.t1"; gene_id "g198";
Scaffold_1	AUGUSTUS	stop_codon	967918	967920	.	+	0	transcript_id "g198.t1"; gene_id "g198";
# protein sequence = [MDHDDPISTFFPAEESVDLYAVLSVSKDSKLDEIKKSYRRLALKYHPDKHATASESAKSEASLKFQQVGFAYAVLSDE
# KRRRRWDLTGKTDEGFDLAPGEDGWEAYFEQMFDRVTRGKLDEMKKEYQCMYDNCL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g198
###
# start gene g199
Scaffold_1	AUGUSTUS	gene	968234	968626	0.74	+	.	g199
Scaffold_1	AUGUSTUS	transcript	968234	968626	0.74	+	.	g199.t1
Scaffold_1	AUGUSTUS	start_codon	968234	968236	.	+	0	transcript_id "g199.t1"; gene_id "g199";
Scaffold_1	AUGUSTUS	CDS	968234	968626	0.74	+	0	transcript_id "g199.t1"; gene_id "g199";
Scaffold_1	AUGUSTUS	stop_codon	968624	968626	.	+	0	transcript_id "g199.t1"; gene_id "g199";
# protein sequence = [MEVVKTGKRKGKGKGKGKDDREEKGEEDVSALQALILKKKQKNTDSFFDSLAAKYAEPAVKTKGKGKKRAKPVDDEEL
# EESPKNVQKKAAPPPPDIDDAEFEKLQQKLFGDKAKDSSQSGGKKGKGRKAK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g199
###
# start gene g200
Scaffold_1	AUGUSTUS	gene	968778	969197	0.81	-	.	g200
Scaffold_1	AUGUSTUS	transcript	968778	969197	0.81	-	.	g200.t1
Scaffold_1	AUGUSTUS	stop_codon	968778	968780	.	-	0	transcript_id "g200.t1"; gene_id "g200";
Scaffold_1	AUGUSTUS	CDS	968778	969197	0.81	-	0	transcript_id "g200.t1"; gene_id "g200";
Scaffold_1	AUGUSTUS	start_codon	969195	969197	.	-	0	transcript_id "g200.t1"; gene_id "g200";
# protein sequence = [MAPLPSTPPKKKDTNKTFSESPFAPHYQKTGAIVVEPFVAPVPASSPWTPVKTPRKWNPDEEDVFGAGWSERTPAHTT
# QDDSDEEESEKKTTTGDAFEVAGQRRDFRREHQRARCNYSCPSKFRNRLCKIPLGFHNWSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g200
###
# start gene g201
Scaffold_1	AUGUSTUS	gene	969461	970082	0.4	-	.	g201
Scaffold_1	AUGUSTUS	transcript	969461	970082	0.4	-	.	g201.t1
Scaffold_1	AUGUSTUS	stop_codon	969461	969463	.	-	0	transcript_id "g201.t1"; gene_id "g201";
Scaffold_1	AUGUSTUS	CDS	969461	969905	0.68	-	1	transcript_id "g201.t1"; gene_id "g201";
Scaffold_1	AUGUSTUS	CDS	970009	970082	0.48	-	0	transcript_id "g201.t1"; gene_id "g201";
Scaffold_1	AUGUSTUS	start_codon	970080	970082	.	-	0	transcript_id "g201.t1"; gene_id "g201";
# protein sequence = [MTTKKKPLYTLVSGREKSPISGEPFTGYDNYLRDAFFYVQDQPAYQLDDIDRVDTEARQKAKHRINVNDPIISTVLES
# LRRFFSNTPEHNIALTGVLSTLAIHPDRSLAGWLTFASNDSTPSNNDDIDAGLDANSDGDDRSIDFVLRKNSPTTIAFCRRLAWTRNRVPSCML]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g201
###
# start gene g202
Scaffold_1	AUGUSTUS	gene	970433	971407	0.74	-	.	g202
Scaffold_1	AUGUSTUS	transcript	970433	971407	0.74	-	.	g202.t1
Scaffold_1	AUGUSTUS	stop_codon	970433	970435	.	-	0	transcript_id "g202.t1"; gene_id "g202";
Scaffold_1	AUGUSTUS	CDS	970433	971407	0.74	-	0	transcript_id "g202.t1"; gene_id "g202";
Scaffold_1	AUGUSTUS	start_codon	971405	971407	.	-	0	transcript_id "g202.t1"; gene_id "g202";
# protein sequence = [MIFFHDKHWYRSEPLFSLEEQDEDEEEEDEEESIANAVAEPHRPSSPTPSQTTVTSMPVSSVATKKPEYEFLLFNYLL
# RFGHREGQIGEFARAGLLLLMDVAMSPGEPVHRLTGEETSSEATADPITDAALALAEYILDGDFSEVLGAGLGAVYSMLPSKLEFRPPTNADRSQETG
# MVIGSMWLETEDEKEVLEVFRTKSWAMGVEDANSPDFKSRLDHFLKMLEFIQDVLRRNIIQEDVDASSLVGTAIVNSILDAVRRIFLENVLYPTILEC
# SDADGSAVAVSYIDIMIRTLQDGQLADLWSTSSLVRITRKLDHVLALNPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g202
###
# start gene g203
Scaffold_1	AUGUSTUS	gene	973415	974889	0.32	+	.	g203
Scaffold_1	AUGUSTUS	transcript	973415	974889	0.32	+	.	g203.t1
Scaffold_1	AUGUSTUS	start_codon	973415	973417	.	+	0	transcript_id "g203.t1"; gene_id "g203";
Scaffold_1	AUGUSTUS	CDS	973415	973570	0.41	+	0	transcript_id "g203.t1"; gene_id "g203";
Scaffold_1	AUGUSTUS	CDS	973645	974128	0.81	+	0	transcript_id "g203.t1"; gene_id "g203";
Scaffold_1	AUGUSTUS	CDS	974216	974889	0.95	+	2	transcript_id "g203.t1"; gene_id "g203";
Scaffold_1	AUGUSTUS	stop_codon	974887	974889	.	+	0	transcript_id "g203.t1"; gene_id "g203";
# protein sequence = [MRGVLEEELRKQRLKQSSPDDNSHDISTSPHVRQISVPAITLEHQGPLRAQLNRISGLQRNITQCLDSSAQALELERE
# LRAEVEEYSRSLAEENSRLQDKIRDLQKAERQNDTAVPEIKPALDDVSDALKDTTKRQESLTHAAVLFEPHIPHHDLCGDVQNISVDVRNVTLSPVVD
# GRSDEFQARDETALKARHRELLFNQQFRVSSTKVRTCLAPPTITGDLPGMSQSVMGNTSPSALPRRIVTPVNHGHNIKSSSATAPARYSRPPLLGTSN
# PLAAEAQIPTKRDSIVLKPLHLVSSVEVTPKRLTLYAPSRPMSVVEPSPTFPPAPPSTPKKDQTTQGKPNYWFRNSSTASADYPCTPDSSSSTLVASS
# PAPASVDKGKSNVIANTLLRKPSLDSKLKATTTLFVSSSFYQIRLEFLADSGRSLTCTGIVKNTN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g203
###
# start gene g204
Scaffold_1	AUGUSTUS	gene	976066	977004	0.63	+	.	g204
Scaffold_1	AUGUSTUS	transcript	976066	977004	0.63	+	.	g204.t1
Scaffold_1	AUGUSTUS	start_codon	976066	976068	.	+	0	transcript_id "g204.t1"; gene_id "g204";
Scaffold_1	AUGUSTUS	CDS	976066	976351	0.73	+	0	transcript_id "g204.t1"; gene_id "g204";
Scaffold_1	AUGUSTUS	CDS	976406	977004	0.76	+	2	transcript_id "g204.t1"; gene_id "g204";
Scaffold_1	AUGUSTUS	stop_codon	977002	977004	.	+	0	transcript_id "g204.t1"; gene_id "g204";
# protein sequence = [MKYCCLFFSRGCCPYGWECEYLHTLPDPSTALPDSSKDCFARDKFADYRDDMGGVGSFNRQNRTLYVGRIKETGTGLE
# TEEVVRRHFKEFGEIEHDDSETGWAVKVLQYRSVAFVTYKSEFHAQFAKEAMACQSLDNDEILNVRWATEDPNPVSKVNEKRRLEDMGQAVIREKMDP
# RVVDAMRTIRALEDGDVLDEDGNLLENGPMDADKEDDEGSDRGAKRRKLDVDDRVSISPPPQQELPKLTGLLSADTMDSLKYFSEIRKRNGIQPSTAV
# RITKPSAGLGLGDYGSDDED]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g204
###
# start gene g205
Scaffold_1	AUGUSTUS	gene	977377	978727	0.11	-	.	g205
Scaffold_1	AUGUSTUS	transcript	977377	978727	0.11	-	.	g205.t1
Scaffold_1	AUGUSTUS	stop_codon	977377	977379	.	-	0	transcript_id "g205.t1"; gene_id "g205";
Scaffold_1	AUGUSTUS	CDS	977377	977987	0.5	-	2	transcript_id "g205.t1"; gene_id "g205";
Scaffold_1	AUGUSTUS	CDS	978445	978727	0.24	-	0	transcript_id "g205.t1"; gene_id "g205";
Scaffold_1	AUGUSTUS	start_codon	978725	978727	.	-	0	transcript_id "g205.t1"; gene_id "g205";
# protein sequence = [MDLDPPSSPVNNSDEDIIQPKSSARKTSAAALPRAHITISSDEGNTVEELNDDQEESVPGSESESESESEEDNRDSDV
# DVIGDSIGIESMPVPSTREAVRVDTTVQEVQEVPGNQSITSLSLENELDSDDDAAVNVRMSPATPVPNTPTPAMSPPILDLSSPSLASITFSPFRGRS
# VTFAEEAPPSTLDSRYPPPPPANDPLGPAAQRPYLPATSDDGKIVIQYSCRSGGPYLYDLLGLLPLDEFGVLSWLVLDREAEIFENEDISDEWKVMHA
# LWGRWIMMNRYRVLKMRNEVTSY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g205
###
# start gene g206
Scaffold_1	AUGUSTUS	gene	982407	983377	0.37	-	.	g206
Scaffold_1	AUGUSTUS	transcript	982407	983377	0.37	-	.	g206.t1
Scaffold_1	AUGUSTUS	stop_codon	982407	982409	.	-	0	transcript_id "g206.t1"; gene_id "g206";
Scaffold_1	AUGUSTUS	CDS	982407	983007	0.8	-	1	transcript_id "g206.t1"; gene_id "g206";
Scaffold_1	AUGUSTUS	CDS	983217	983377	0.38	-	0	transcript_id "g206.t1"; gene_id "g206";
Scaffold_1	AUGUSTUS	start_codon	983375	983377	.	-	0	transcript_id "g206.t1"; gene_id "g206";
# protein sequence = [MSRRKFKFAISMQRFSKFNKEEQENAEFLLRAYPDLQIAYLDEEPGPKGSEARLNILGEFEEYSVSSQSPYAQWGHKE
# FKKAPVAIVGTREYIFSENIGVLGDIAAGKEQTFGTMTARALAWIGGKLHYGHPDFLNATFMNTRGGVSKAQKGLHLNEDIFAGMNAFGRGGRIKHSE
# YYQCGKGRDLGFGTILNFQTKIGTGMGEQMLSREYYYLGTQLPIDRFLTFYYGHPGFHINNILVIYSIQIFMLTCTS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g206
###
# start gene g207
Scaffold_1	AUGUSTUS	gene	987881	988819	0.79	+	.	g207
Scaffold_1	AUGUSTUS	transcript	987881	988819	0.79	+	.	g207.t1
Scaffold_1	AUGUSTUS	start_codon	987881	987883	.	+	0	transcript_id "g207.t1"; gene_id "g207";
Scaffold_1	AUGUSTUS	CDS	987881	988819	0.79	+	0	transcript_id "g207.t1"; gene_id "g207";
Scaffold_1	AUGUSTUS	stop_codon	988817	988819	.	+	0	transcript_id "g207.t1"; gene_id "g207";
# protein sequence = [MREQRRERSSLPSSSRRAIWSEFDNSDRSKKKRRLTNTETTTTQSPSGHFLLMLYRTPPPWHHAEPLAPTAMHHQKSN
# RPQTSRPADVTNAATVNRSRVKLQMVADLQFSVGTAARNRRLGDPMANFDGVKSSYDESTRLRSKYATTTVQPILRGKNPFRRSNTEATVQSTLSEGC
# STDPVLVDSSSKEVREQTHTLSIATAQSKQKTPTYPRPFLKPISSVRVPELPPEEMRKLKKSMVKQPPSDFISRKSLPIGTDIRRPTADALSYRKRNP
# DGDSKMMQLPKDGKSFRSGMGTNAERKMVFDWKSWGST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g207
###
# start gene g208
Scaffold_1	AUGUSTUS	gene	999623	1000516	0.41	+	.	g208
Scaffold_1	AUGUSTUS	transcript	999623	1000516	0.41	+	.	g208.t1
Scaffold_1	AUGUSTUS	start_codon	999623	999625	.	+	0	transcript_id "g208.t1"; gene_id "g208";
Scaffold_1	AUGUSTUS	CDS	999623	1000516	0.41	+	0	transcript_id "g208.t1"; gene_id "g208";
Scaffold_1	AUGUSTUS	stop_codon	1000514	1000516	.	+	0	transcript_id "g208.t1"; gene_id "g208";
# protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT
# RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR
# GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD
# LLGIKLESLIPRELTKNNSKWLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g208
###
# start gene g209
Scaffold_1	AUGUSTUS	gene	1000600	1001148	0.24	+	.	g209
Scaffold_1	AUGUSTUS	transcript	1000600	1001148	0.24	+	.	g209.t1
Scaffold_1	AUGUSTUS	start_codon	1000600	1000602	.	+	0	transcript_id "g209.t1"; gene_id "g209";
Scaffold_1	AUGUSTUS	CDS	1000600	1001148	0.24	+	0	transcript_id "g209.t1"; gene_id "g209";
Scaffold_1	AUGUSTUS	stop_codon	1001146	1001148	.	+	0	transcript_id "g209.t1"; gene_id "g209";
# protein sequence = [MTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMP
# EGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQD
# SSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g209
###
# start gene g210
Scaffold_1	AUGUSTUS	gene	1001178	1002581	0.82	+	.	g210
Scaffold_1	AUGUSTUS	transcript	1001178	1002581	0.82	+	.	g210.t1
Scaffold_1	AUGUSTUS	start_codon	1001178	1001180	.	+	0	transcript_id "g210.t1"; gene_id "g210";
Scaffold_1	AUGUSTUS	CDS	1001178	1002581	0.82	+	0	transcript_id "g210.t1"; gene_id "g210";
Scaffold_1	AUGUSTUS	stop_codon	1002579	1002581	.	+	0	transcript_id "g210.t1"; gene_id "g210";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA
# ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID
# DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP
# FKFGEVTVYLQLHVQKKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGET]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g210
###
# start gene g211
Scaffold_1	AUGUSTUS	gene	1004484	1006948	0.49	+	.	g211
Scaffold_1	AUGUSTUS	transcript	1004484	1006948	0.49	+	.	g211.t1
Scaffold_1	AUGUSTUS	start_codon	1004484	1004486	.	+	0	transcript_id "g211.t1"; gene_id "g211";
Scaffold_1	AUGUSTUS	CDS	1004484	1005414	0.53	+	0	transcript_id "g211.t1"; gene_id "g211";
Scaffold_1	AUGUSTUS	CDS	1005666	1006948	0.86	+	2	transcript_id "g211.t1"; gene_id "g211";
Scaffold_1	AUGUSTUS	stop_codon	1006946	1006948	.	+	0	transcript_id "g211.t1"; gene_id "g211";
# protein sequence = [MPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL
# RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP
# NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD
# IELDVQEALDEERSYEIRRNHMLESKDAHVKSSVGILVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLK
# APPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGI
# RISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQ
# ALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFR
# VLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g211
###
# start gene g212
Scaffold_1	AUGUSTUS	gene	1007205	1007770	0.56	-	.	g212
Scaffold_1	AUGUSTUS	transcript	1007205	1007770	0.56	-	.	g212.t1
Scaffold_1	AUGUSTUS	stop_codon	1007205	1007207	.	-	0	transcript_id "g212.t1"; gene_id "g212";
Scaffold_1	AUGUSTUS	CDS	1007205	1007421	0.88	-	1	transcript_id "g212.t1"; gene_id "g212";
Scaffold_1	AUGUSTUS	CDS	1007481	1007631	1	-	2	transcript_id "g212.t1"; gene_id "g212";
Scaffold_1	AUGUSTUS	CDS	1007713	1007770	0.64	-	0	transcript_id "g212.t1"; gene_id "g212";
Scaffold_1	AUGUSTUS	start_codon	1007768	1007770	.	-	0	transcript_id "g212.t1"; gene_id "g212";
# protein sequence = [MFLLVSARFIATDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANCILKSRQDS
# GSDSSASDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g212
###
# start gene g213
Scaffold_1	AUGUSTUS	gene	1009678	1010335	0.26	-	.	g213
Scaffold_1	AUGUSTUS	transcript	1009678	1010335	0.26	-	.	g213.t1
Scaffold_1	AUGUSTUS	stop_codon	1009678	1009680	.	-	0	transcript_id "g213.t1"; gene_id "g213";
Scaffold_1	AUGUSTUS	CDS	1009678	1010225	0.68	-	2	transcript_id "g213.t1"; gene_id "g213";
Scaffold_1	AUGUSTUS	CDS	1010287	1010335	0.26	-	0	transcript_id "g213.t1"; gene_id "g213";
Scaffold_1	AUGUSTUS	start_codon	1010333	1010335	.	-	0	transcript_id "g213.t1"; gene_id "g213";
# protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTTRELFLRSILDLQNAGEDPVVVLEALKAAEPNRRAIN
# LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLCSIHSGESTAHIDKHGHLVEASPPPDSATEALEGLKEVERGSADEGASSPVGGSVPMELDLP
# TIESLAERTLSPEKGAESAQIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g213
###
# start gene g214
Scaffold_1	AUGUSTUS	gene	1018520	1019158	0.57	+	.	g214
Scaffold_1	AUGUSTUS	transcript	1018520	1019158	0.57	+	.	g214.t1
Scaffold_1	AUGUSTUS	start_codon	1018520	1018522	.	+	0	transcript_id "g214.t1"; gene_id "g214";
Scaffold_1	AUGUSTUS	CDS	1018520	1019158	0.57	+	0	transcript_id "g214.t1"; gene_id "g214";
Scaffold_1	AUGUSTUS	stop_codon	1019156	1019158	.	+	0	transcript_id "g214.t1"; gene_id "g214";
# protein sequence = [MSPFELTYGYLPLFNIPVGQRSGIPAVETAYGYSEKPDRTGAALHLGKKQQKEGYERGKRKAHQFKVGDFVWLSAEDI
# NLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPISLDRIHPVFHVDKLYPWKGNTINGEIPPPPEPVYLEDEDEPEYEVEEILDSRVRWKRLEYLVKW
# KGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g214
###
# start gene g215
Scaffold_1	AUGUSTUS	gene	1022374	1022973	0.48	-	.	g215
Scaffold_1	AUGUSTUS	transcript	1022374	1022973	0.48	-	.	g215.t1
Scaffold_1	AUGUSTUS	stop_codon	1022374	1022376	.	-	0	transcript_id "g215.t1"; gene_id "g215";
Scaffold_1	AUGUSTUS	CDS	1022374	1022683	0.48	-	1	transcript_id "g215.t1"; gene_id "g215";
Scaffold_1	AUGUSTUS	CDS	1022810	1022973	0.54	-	0	transcript_id "g215.t1"; gene_id "g215";
Scaffold_1	AUGUSTUS	start_codon	1022971	1022973	.	-	0	transcript_id "g215.t1"; gene_id "g215";
# protein sequence = [MSSPNSDEPTLPPPTTPVQNGQQYSQQDSGNQQYANYYIPPKAILECKEDWELEANAGPPTMGGQDQHEIGHARPRPR
# PRMNPVDFTLPDSFGAPFQPNTASGYQPPPDPRPLSSDTFPSPSELAASAGNGQQGATKQKKKKARMAKRLRITELQSP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g215
###
# start gene g216
Scaffold_1	AUGUSTUS	gene	1026913	1027971	0.42	+	.	g216
Scaffold_1	AUGUSTUS	transcript	1026913	1027971	0.42	+	.	g216.t1
Scaffold_1	AUGUSTUS	start_codon	1026913	1026915	.	+	0	transcript_id "g216.t1"; gene_id "g216";
Scaffold_1	AUGUSTUS	CDS	1026913	1026917	0.88	+	0	transcript_id "g216.t1"; gene_id "g216";
Scaffold_1	AUGUSTUS	CDS	1027029	1027407	0.96	+	1	transcript_id "g216.t1"; gene_id "g216";
Scaffold_1	AUGUSTUS	CDS	1027477	1027971	0.48	+	0	transcript_id "g216.t1"; gene_id "g216";
Scaffold_1	AUGUSTUS	stop_codon	1027969	1027971	.	+	0	transcript_id "g216.t1"; gene_id "g216";
# protein sequence = [MPFPQANVPPEPALATVNDLGSAAASKGKAHKVKLAPNVTWSPLPTQLKVNDAEDRIFIREFILRFSGIPGMALTRNQ
# LEELEFIAGTHDLSDDENDYVDWVSETCVKSLVISLIGVLAAEEDSSATLVMKKAIQDVRNSGANLTKIWTALSSLRAALGRPEEVSVGKLQAEEPSD
# DDDESSEDRIILEYPDPLPAPANHEHNVRSTRFAVADISLVVHSAQMIPVILGLIDAVMECHAIRVELDNGTKEGRKRFRESREVIKLENESWKSLEE
# SREPNVTVGTLSNSCVKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g216
###
# start gene g217
Scaffold_1	AUGUSTUS	gene	1031477	1031797	0.33	-	.	g217
Scaffold_1	AUGUSTUS	transcript	1031477	1031797	0.33	-	.	g217.t1
Scaffold_1	AUGUSTUS	stop_codon	1031477	1031479	.	-	0	transcript_id "g217.t1"; gene_id "g217";
Scaffold_1	AUGUSTUS	CDS	1031477	1031797	0.33	-	0	transcript_id "g217.t1"; gene_id "g217";
Scaffold_1	AUGUSTUS	start_codon	1031795	1031797	.	-	0	transcript_id "g217.t1"; gene_id "g217";
# protein sequence = [MGPSMDLVLRRHTNPDPELLKQAMRRPKLKKTDVEKGLGKKRKNLDVDEMGDLRGRVHVGKQDLSRLQTRKMKGLKAG
# AFEDGGDDGAGDSGSDDDKASKKKRKLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g217
###
# start gene g218
Scaffold_1	AUGUSTUS	gene	1032162	1032591	0.48	-	.	g218
Scaffold_1	AUGUSTUS	transcript	1032162	1032591	0.48	-	.	g218.t1
Scaffold_1	AUGUSTUS	stop_codon	1032162	1032164	.	-	0	transcript_id "g218.t1"; gene_id "g218";
Scaffold_1	AUGUSTUS	CDS	1032162	1032431	0.85	-	0	transcript_id "g218.t1"; gene_id "g218";
Scaffold_1	AUGUSTUS	CDS	1032490	1032591	0.53	-	0	transcript_id "g218.t1"; gene_id "g218";
Scaffold_1	AUGUSTUS	start_codon	1032589	1032591	.	-	0	transcript_id "g218.t1"; gene_id "g218";
# protein sequence = [MEARQPKEVEDARIAIFVKGTKTGEVLNGVMKDMMALKRPDAISFSKKNVIHPLDAQNTASGSSSMSSLEFWSSKNDA
# SMFVIGQTSKKRPNDLTFVRMFDGKVLDIVEAGVENYVSMESVPV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g218
###
# start gene g219
Scaffold_1	AUGUSTUS	gene	1033055	1034326	0.25	+	.	g219
Scaffold_1	AUGUSTUS	transcript	1033055	1034326	0.25	+	.	g219.t1
Scaffold_1	AUGUSTUS	start_codon	1033055	1033057	.	+	0	transcript_id "g219.t1"; gene_id "g219";
Scaffold_1	AUGUSTUS	CDS	1033055	1033099	0.4	+	0	transcript_id "g219.t1"; gene_id "g219";
Scaffold_1	AUGUSTUS	CDS	1033169	1033307	0.43	+	0	transcript_id "g219.t1"; gene_id "g219";
Scaffold_1	AUGUSTUS	CDS	1033383	1034326	0.35	+	2	transcript_id "g219.t1"; gene_id "g219";
Scaffold_1	AUGUSTUS	stop_codon	1034324	1034326	.	+	0	transcript_id "g219.t1"; gene_id "g219";
# protein sequence = [MLAQRKSRYFLDGQRLSLIDSFEIEVFISGFATSRRSADVISRSQRAFLKLAKGKGELLTSSTTGVLLEPRTLSHSED
# LLKSVKLPPRPEDISEDYEVQLLERKFQSLNGISEDADSLHSPVYSQSSSRASSVNDLTLHDNTPESSYLGTVVKNTAADELRKLHANLESRLQPFWS
# SVVPNRTVRLRLYTSPNHISTPSNSSVSMDNGPVSIQDVVTAPDGSFQARFTVGWTDLANHPGAEHIAFGDPAEEHELLVAAELLPLPSPISSVASSA
# ASSTTDFSSSSRPSKNNTTRSYQSNSPYDSSVTLPSIPPTTLRIPLTYSPVRVISDIDDTIKYSNVTGGARAVFHNVFVKELKDLVIPGMGSGMKRCG
# RRG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g219
###
# start gene g220
Scaffold_1	AUGUSTUS	gene	1049786	1050373	0.8	-	.	g220
Scaffold_1	AUGUSTUS	transcript	1049786	1050373	0.8	-	.	g220.t1
Scaffold_1	AUGUSTUS	stop_codon	1049786	1049788	.	-	0	transcript_id "g220.t1"; gene_id "g220";
Scaffold_1	AUGUSTUS	CDS	1049786	1050373	0.8	-	0	transcript_id "g220.t1"; gene_id "g220";
Scaffold_1	AUGUSTUS	start_codon	1050371	1050373	.	-	0	transcript_id "g220.t1"; gene_id "g220";
# protein sequence = [MRNIEKQLDKASKLGFGRKRRTSKADRQARVAAAHAARRKQRLPPSPSKADNEEERKQPSHPLSKADSDEDKSKEKGN
# FEKLVAETAELERTVDNLRKKSRYWKAKTMELRGKRRGWKRYEKERGGGAEEEEGSRGRGERNEQKIEDLEMELEREKKLHKIEIAEHEATCVELEET
# YNNLRLQFDPIFERLRPFL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g220
###
# start gene g221
Scaffold_1	AUGUSTUS	gene	1061136	1061453	0.29	+	.	g221
Scaffold_1	AUGUSTUS	transcript	1061136	1061453	0.29	+	.	g221.t1
Scaffold_1	AUGUSTUS	start_codon	1061136	1061138	.	+	0	transcript_id "g221.t1"; gene_id "g221";
Scaffold_1	AUGUSTUS	CDS	1061136	1061453	0.29	+	0	transcript_id "g221.t1"; gene_id "g221";
Scaffold_1	AUGUSTUS	stop_codon	1061451	1061453	.	+	0	transcript_id "g221.t1"; gene_id "g221";
# protein sequence = [MDTFYFRVLLGYMAAKEIIGNYNTKTYDEIMKALELAKAGKTNAAVAEEEPGDDVSSSLPSGGGSTQPAHDSLGTNSQ
# GGGATNLPPRISVLSMLNARVNTLPNH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g221
###
# start gene g222
Scaffold_1	AUGUSTUS	gene	1067116	1069414	0.48	-	.	g222
Scaffold_1	AUGUSTUS	transcript	1067116	1069414	0.48	-	.	g222.t1
Scaffold_1	AUGUSTUS	stop_codon	1067116	1067118	.	-	0	transcript_id "g222.t1"; gene_id "g222";
Scaffold_1	AUGUSTUS	CDS	1067116	1067164	0.48	-	1	transcript_id "g222.t1"; gene_id "g222";
Scaffold_1	AUGUSTUS	CDS	1067247	1069414	0.48	-	0	transcript_id "g222.t1"; gene_id "g222";
Scaffold_1	AUGUSTUS	start_codon	1069412	1069414	.	-	0	transcript_id "g222.t1"; gene_id "g222";
# protein sequence = [MLQETRIQPNSTIRSPTGFTAHALNRRRSADNIENPWGGVATLVRDGLESRVRVDLSSPDILAVQVNGIVLFNTYIIP
# ESSRTDWTQWADLHPWDALAQSIHLATTLDIPFVISGDINARTGTSIPYQEHAIRTSSDSVVSTRGRRLLELCSELRLTIMNGCSAIPGTHSSSTSFQ
# HRHSMDGTPTTYSSVIDYVLASPLASFFISELAVSTETKWSDHAYLSWDLLVPGPELTRLPPTQHPRPHIMIPIISEIDHLQQQLLHSQKLTHPQRLL
# KLYGHSSTSSSSFPLKVFTDSSCLRNNTAAACAGLGIYIGPNHHLNLSARILGPQRNNRAELYAILVTIQRTSAHRQLEIYTDSSYAIQSIVYNAPEN
# AQCGWDCPNGDLLNTLSQWISARTATIVFTHVRAHRGIIQNELADQLAKAGACLPLPHEGSELDFISCPIPSPHLPQLLSNIPKVSTSLPDPRSLAPP
# PQLVHTPSAVCHRGRTHRRELEDTNLSRLQSAAAAGGAAFWKFYKSLSNSDKPLPRVTLEQLTNCFIPRMNPPDPRTTSFDPQILQQETNRANAIPDP
# SPPSAFPSFNSVICENDIATIKSYLKRTTHSDSTGADLITYSIIQDIDNDRLASFFDRAFQLKEFPTSWLVSLIVAIPKPGKDSVDPNNYRAVALESC
# ILKFASLLLHLKLSQALEEAHILPASQNGFRAGYRTNNNVFILRTLIEKAKSLGDPLSPANTLTGSVPSTAR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g222
###
# start gene g223
Scaffold_1	AUGUSTUS	gene	1070107	1071063	1	-	.	g223
Scaffold_1	AUGUSTUS	transcript	1070107	1071063	1	-	.	g223.t1
Scaffold_1	AUGUSTUS	stop_codon	1070107	1070109	.	-	0	transcript_id "g223.t1"; gene_id "g223";
Scaffold_1	AUGUSTUS	CDS	1070107	1071063	1	-	0	transcript_id "g223.t1"; gene_id "g223";
Scaffold_1	AUGUSTUS	start_codon	1071061	1071063	.	-	0	transcript_id "g223.t1"; gene_id "g223";
# protein sequence = [MANNDSGEYPVDFEDEYFSEVDLGNLENQPSQEADQFGLDNRTAEWMDPTEVATTDPNSLPPTAIVSAPNSLDSRFRD
# LGRELRARLYTVSSHQQTSNRSADNFAAAGGVVTTSSPTRLQVPSRRGHKLGSTSKPRKSRNSETALQPITYPQSSLLDQGSSKETKGQQMHRLESNI
# VRLETLINRRVEDIQTSTASAASSLREQMLQDIQQETSRGADRLASTQASHHLQLKNLIHQELHLLEDQLKSLISSSIPLEAMNDLLATMENLFSGTP
# SFSAPSVTSPLSSPLLLSHLLLLNPPSLLPRYSIASQTLPYQDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g223
###
# start gene g224
Scaffold_1	AUGUSTUS	gene	1072231	1072791	0.66	-	.	g224
Scaffold_1	AUGUSTUS	transcript	1072231	1072791	0.66	-	.	g224.t1
Scaffold_1	AUGUSTUS	stop_codon	1072231	1072233	.	-	0	transcript_id "g224.t1"; gene_id "g224";
Scaffold_1	AUGUSTUS	CDS	1072231	1072791	0.66	-	0	transcript_id "g224.t1"; gene_id "g224";
Scaffold_1	AUGUSTUS	start_codon	1072789	1072791	.	-	0	transcript_id "g224.t1"; gene_id "g224";
# protein sequence = [MTTIAAPGTQHTVGTVIHTVPQRRKKGPGISAAYQQLQITPDCDKFNDWSHTPPPPYAHDLGYNEPGTTLVDFLKSIK
# NLQSALHDCANPNLDITVVIDSPVSYILAVLDYLYSKGMLIAYDKPSIKDLLDTISLLAKIPGPSRLSWGFLESKSKTNKQRWLKFPNIHSGKTLLCF
# LVFPIVLGWR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g224
###
# start gene g225
Scaffold_1	AUGUSTUS	gene	1087886	1088608	1	+	.	g225
Scaffold_1	AUGUSTUS	transcript	1087886	1088608	1	+	.	g225.t1
Scaffold_1	AUGUSTUS	start_codon	1087886	1087888	.	+	0	transcript_id "g225.t1"; gene_id "g225";
Scaffold_1	AUGUSTUS	CDS	1087886	1088608	1	+	0	transcript_id "g225.t1"; gene_id "g225";
Scaffold_1	AUGUSTUS	stop_codon	1088606	1088608	.	+	0	transcript_id "g225.t1"; gene_id "g225";
# protein sequence = [MAFHRLDSYDDSAHNYYPSHDDSDDIADEYEYGPSSSTEGGYSGYASTDYLGSSSASVPRYQPGQHLAPIHTGETLQF
# DEHSTLYTQSNPSSTLSYAQNSQSHNNSVSEEYFGYQPEYAAASNHSYASHSYTSAGSAYSSTTGLRSVPPPRSRSPTPAGDDEDYYVVGNDSVHYTG
# GLHDPEKADNYNNYNNYSSYDSRYAYDSLPTPTEPITPVETRHFGPAQVVESRVAQYEETSAVD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g225
###
# start gene g226
Scaffold_1	AUGUSTUS	gene	1092576	1093236	0.57	-	.	g226
Scaffold_1	AUGUSTUS	transcript	1092576	1093236	0.57	-	.	g226.t1
Scaffold_1	AUGUSTUS	stop_codon	1092576	1092578	.	-	0	transcript_id "g226.t1"; gene_id "g226";
Scaffold_1	AUGUSTUS	CDS	1092576	1093106	1	-	0	transcript_id "g226.t1"; gene_id "g226";
Scaffold_1	AUGUSTUS	CDS	1093222	1093236	0.57	-	0	transcript_id "g226.t1"; gene_id "g226";
Scaffold_1	AUGUSTUS	start_codon	1093234	1093236	.	-	0	transcript_id "g226.t1"; gene_id "g226";
# protein sequence = [MLSASPDRQAAASLDTPPVTDLDTSSSLFDSDTDFGSSAFADSDAESVVSQPGIVAAHNNLSDIDELGSQSDDMSPEL
# DTDTWSVIGDSDADGELSEAEHSVERQFTSMSMRVGSEDPERTLEAISPRNLRQTGPSDRWPVQRSTSSPSRSRVRTAPRRLVLRNSPPAIKETKTLY
# AYLYS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g226
###
# start gene g227
Scaffold_1	AUGUSTUS	gene	1094124	1094936	0.85	-	.	g227
Scaffold_1	AUGUSTUS	transcript	1094124	1094936	0.85	-	.	g227.t1
Scaffold_1	AUGUSTUS	stop_codon	1094124	1094126	.	-	0	transcript_id "g227.t1"; gene_id "g227";
Scaffold_1	AUGUSTUS	CDS	1094124	1094936	0.85	-	0	transcript_id "g227.t1"; gene_id "g227";
Scaffold_1	AUGUSTUS	start_codon	1094934	1094936	.	-	0	transcript_id "g227.t1"; gene_id "g227";
# protein sequence = [MGVLHTAARHGLPDIATDVLRVLNLTGVPLQERHFAPLIEAFCRAGQVKEAFMTIDIMQETTPPLPSTLLPILEHVKK
# NTDTFDSTWALMDEIHQERPLQVSSLNIIIGAAVALGDLQRAVGAYKSFPDYNVKADRNTFHLLLEGAVAARHQPLGARILQDMKEADIALESRTYEL
# MIELAITQDTYEEAFEYLEEMKGAGFKPPATTYKSLVKKCAINGDPRYTIALEEMEEMGYEKDPEFLRKAKDVFSKESTGMMFIEEAENTTVAR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g227
###
# start gene g228
Scaffold_1	AUGUSTUS	gene	1096696	1098502	0.17	+	.	g228
Scaffold_1	AUGUSTUS	transcript	1096696	1098502	0.17	+	.	g228.t1
Scaffold_1	AUGUSTUS	start_codon	1096696	1096698	.	+	0	transcript_id "g228.t1"; gene_id "g228";
Scaffold_1	AUGUSTUS	CDS	1096696	1097227	0.28	+	0	transcript_id "g228.t1"; gene_id "g228";
Scaffold_1	AUGUSTUS	CDS	1097281	1097532	0.25	+	2	transcript_id "g228.t1"; gene_id "g228";
Scaffold_1	AUGUSTUS	CDS	1097688	1098502	0.28	+	2	transcript_id "g228.t1"; gene_id "g228";
Scaffold_1	AUGUSTUS	stop_codon	1098500	1098502	.	+	0	transcript_id "g228.t1"; gene_id "g228";
# protein sequence = [MSSSFFFLPRLLQDFDEDRPAPAHGQHQARIDDITLPPTDTFEPLDFDNDNFDLGPSDGIGSQDFLDLGVDFGDAPIQ
# SEKGADESMSVDGSVGVGRDAASHRDSIGDQFMDLDGNFDLLSRRSRTRELSEHPFGADMALDMPEFGDIDLGDLGIGFDPIPMDIDKTPGQTRSSSR
# ASSPLSSVPATPPPDVGITENAEATPTVSKLKRKIKEKKQIIDMVTELKDGPGAKIGRGRDVQNNRDLSDILTEPHFLPRSAVVMRPSPGGKGPNKRQ
# RLDNAAEDEEIEVGRRADSIAPASDILGRGSMGPDALEFGDQSGIIDDFQLDIPQFDPVNVDLDRRSKSAAPSVRSRMSTPLWKELYLKREMRTTPIQ
# LALSAFDSQTQTQVTGTEKGVQPVDSYSRNTVKAISVIRKELRPTEGDAEEKVLSFRKMADKVGIIYIVRFFPLTVFSLGISTCCCFVFLRIARPSTR
# DCIAVNQPTPFENIEVRAKDKLWDVQHHAPSRMTSVAPSVAPSTAPSRAPSVARSLASSLGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g228
###
# start gene g229
Scaffold_1	AUGUSTUS	gene	1102023	1102406	0.74	-	.	g229
Scaffold_1	AUGUSTUS	transcript	1102023	1102406	0.74	-	.	g229.t1
Scaffold_1	AUGUSTUS	stop_codon	1102023	1102025	.	-	0	transcript_id "g229.t1"; gene_id "g229";
Scaffold_1	AUGUSTUS	CDS	1102023	1102406	0.74	-	0	transcript_id "g229.t1"; gene_id "g229";
Scaffold_1	AUGUSTUS	start_codon	1102404	1102406	.	-	0	transcript_id "g229.t1"; gene_id "g229";
# protein sequence = [MNGNTAFILITITNCLSRLQHESVGRMAGLTTEQLLAIRLAPPFFASQGVNLTSILGADLVAAMTFTDWITKNVHVPD
# DVFNALKTFLNDSQLVEATATAAGYSFISRFVVALNVDAKMDVPVPVPT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g229
###
# start gene g230
Scaffold_1	AUGUSTUS	gene	1103607	1104029	0.53	-	.	g230
Scaffold_1	AUGUSTUS	transcript	1103607	1104029	0.53	-	.	g230.t1
Scaffold_1	AUGUSTUS	stop_codon	1103607	1103609	.	-	0	transcript_id "g230.t1"; gene_id "g230";
Scaffold_1	AUGUSTUS	CDS	1103607	1104029	0.53	-	0	transcript_id "g230.t1"; gene_id "g230";
Scaffold_1	AUGUSTUS	start_codon	1104027	1104029	.	-	0	transcript_id "g230.t1"; gene_id "g230";
# protein sequence = [MPQARNHTGCVFPTPLNRFAQNNSGVFRQVISSNCDAAVNYNQGCGVASTTPNSYGSGFNNNGGGWIVTWRSSNAISH
# WFWPRNAPNVPNEIRQSESDCDPITPGDNWGTPDSTFVWSQCDYNPHFDPHQIIFDLTLCVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g230
###
# start gene g231
Scaffold_1	AUGUSTUS	gene	1105943	1106575	0.88	+	.	g231
Scaffold_1	AUGUSTUS	transcript	1105943	1106575	0.88	+	.	g231.t1
Scaffold_1	AUGUSTUS	start_codon	1105943	1105945	.	+	0	transcript_id "g231.t1"; gene_id "g231";
Scaffold_1	AUGUSTUS	CDS	1105943	1106575	0.88	+	0	transcript_id "g231.t1"; gene_id "g231";
Scaffold_1	AUGUSTUS	stop_codon	1106573	1106575	.	+	0	transcript_id "g231.t1"; gene_id "g231";
# protein sequence = [MSVRARIVGRQASAVSVDGSVTDLPAVTPGVQTTTNSDAVSVDGPVTMLPPESPGLQPASVTVTSDLFTLSTFGIGLP
# TPAATNPSTATSSIDGGAIAGGVVAAVVVAVIAVALLLRYRNKRSSRHWRNRIKGGAFGPSHNRSGWQNLDIKSDAVNGDSGFQAGRSNRVLDDHKSP
# ITSPVTAKFSTPLMTYPPGASHLPNEKELESMRI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g231
###
# start gene g232
Scaffold_1	AUGUSTUS	gene	1107073	1107495	0.76	+	.	g232
Scaffold_1	AUGUSTUS	transcript	1107073	1107495	0.76	+	.	g232.t1
Scaffold_1	AUGUSTUS	start_codon	1107073	1107075	.	+	0	transcript_id "g232.t1"; gene_id "g232";
Scaffold_1	AUGUSTUS	CDS	1107073	1107495	0.76	+	0	transcript_id "g232.t1"; gene_id "g232";
Scaffold_1	AUGUSTUS	stop_codon	1107493	1107495	.	+	0	transcript_id "g232.t1"; gene_id "g232";
# protein sequence = [MAPEILDGIFPAPENDMQDFVQSNYVNEVKPDTDTIMEQVIGPVDVSDVLLTMGMTDVIVNEVDMLYYGDLAIGTPGQ
# GLTFDVDTGSADLWVPSPWCGNSKNHYDGSQSSTYVDQDRRFAVSYVSCIRSVNGISLTLHK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g232
###
# start gene g233
Scaffold_1	AUGUSTUS	gene	1114355	1114888	0.77	-	.	g233
Scaffold_1	AUGUSTUS	transcript	1114355	1114888	0.77	-	.	g233.t1
Scaffold_1	AUGUSTUS	stop_codon	1114355	1114357	.	-	0	transcript_id "g233.t1"; gene_id "g233";
Scaffold_1	AUGUSTUS	CDS	1114355	1114888	0.77	-	0	transcript_id "g233.t1"; gene_id "g233";
Scaffold_1	AUGUSTUS	start_codon	1114886	1114888	.	-	0	transcript_id "g233.t1"; gene_id "g233";
# protein sequence = [MTATAIDVDRPRDIVVDEMSEVKMAPVSMSGVKPTHRVSNGADNHGTSAMPSQTLTLPQSSNSKIPQPHLSNRLRDHH
# STPPSTQLLPEDETDGVTSGAVQPPGSTGEPLIRSITHDSDEDTDGTHFTEDQGEDLQQSLLSEEQAEEERLIRNGGSGIPIGPVSTRSEGLLPIHSL
# C]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g233
###
# start gene g234
Scaffold_1	AUGUSTUS	gene	1116329	1116658	0.84	-	.	g234
Scaffold_1	AUGUSTUS	transcript	1116329	1116658	0.84	-	.	g234.t1
Scaffold_1	AUGUSTUS	stop_codon	1116329	1116331	.	-	0	transcript_id "g234.t1"; gene_id "g234";
Scaffold_1	AUGUSTUS	CDS	1116329	1116658	0.84	-	0	transcript_id "g234.t1"; gene_id "g234";
Scaffold_1	AUGUSTUS	start_codon	1116656	1116658	.	-	0	transcript_id "g234.t1"; gene_id "g234";
# protein sequence = [MTTSKTIPFPLYPVPLLQPPVDFLLLTGTARAEAGLEVEADEDLEAKAEDLISLGEEAMTVDAELGEHEAQRFQLGVG
# QPKPDILPTDDLLHQPKQVQRPRAENGTPTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g234
###
# start gene g235
Scaffold_1	AUGUSTUS	gene	1117869	1118246	0.76	-	.	g235
Scaffold_1	AUGUSTUS	transcript	1117869	1118246	0.76	-	.	g235.t1
Scaffold_1	AUGUSTUS	stop_codon	1117869	1117871	.	-	0	transcript_id "g235.t1"; gene_id "g235";
Scaffold_1	AUGUSTUS	CDS	1117869	1118246	0.76	-	0	transcript_id "g235.t1"; gene_id "g235";
Scaffold_1	AUGUSTUS	start_codon	1118244	1118246	.	-	0	transcript_id "g235.t1"; gene_id "g235";
# protein sequence = [MFGFDMIANGMRGESLDEVAMTDEELEVFGLDWEGLRDETLLRSLRRNYCNEGSGSWLGQQGPPPELNRVVVDPPSGL
# FTPEQIAHMDEQLLGLGRGPQIEDVVHLWTTALAIARSISSNDPTLF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g235
###
# start gene g236
Scaffold_1	AUGUSTUS	gene	1122897	1123346	0.51	-	.	g236
Scaffold_1	AUGUSTUS	transcript	1122897	1123346	0.51	-	.	g236.t1
Scaffold_1	AUGUSTUS	stop_codon	1122897	1122899	.	-	0	transcript_id "g236.t1"; gene_id "g236";
Scaffold_1	AUGUSTUS	CDS	1122897	1123346	0.51	-	0	transcript_id "g236.t1"; gene_id "g236";
Scaffold_1	AUGUSTUS	start_codon	1123344	1123346	.	-	0	transcript_id "g236.t1"; gene_id "g236";
# protein sequence = [MSEQDILAIILLPDNPQPIAAKIPSIPSDEYGNPSTTAVHDLLKRKHYKLGLDYLFPVVVTKFVNLTNAETKFVSRMH
# VFGWGDPELPLHNDVCEAENCSRGEGEAYWRVPILAICVSEDGKAQSAKVEDAALLMTFFQRCVSSIFCYS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g236
###
# start gene g237
Scaffold_1	AUGUSTUS	gene	1128849	1129507	0.36	+	.	g237
Scaffold_1	AUGUSTUS	transcript	1128849	1129507	0.36	+	.	g237.t1
Scaffold_1	AUGUSTUS	start_codon	1128849	1128851	.	+	0	transcript_id "g237.t1"; gene_id "g237";
Scaffold_1	AUGUSTUS	CDS	1128849	1128897	0.36	+	0	transcript_id "g237.t1"; gene_id "g237";
Scaffold_1	AUGUSTUS	CDS	1128960	1129507	0.89	+	2	transcript_id "g237.t1"; gene_id "g237";
Scaffold_1	AUGUSTUS	stop_codon	1129505	1129507	.	+	0	transcript_id "g237.t1"; gene_id "g237";
# protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTARELFLRSILDLQNAGEDPIVVLEALKTAEPNRRAIT
# LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIQSGESTVHIDKHGHLVEASPPPDSATEALEGLKEVKRGSADEGASSPVGGSVPMELDLP
# TIESLAERTLSPEKGAESAQTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g237
###
# start gene g238
Scaffold_1	AUGUSTUS	gene	1133195	1134076	0.38	+	.	g238
Scaffold_1	AUGUSTUS	transcript	1133195	1134076	0.38	+	.	g238.t1
Scaffold_1	AUGUSTUS	start_codon	1133195	1133197	.	+	0	transcript_id "g238.t1"; gene_id "g238";
Scaffold_1	AUGUSTUS	CDS	1133195	1134076	0.38	+	0	transcript_id "g238.t1"; gene_id "g238";
Scaffold_1	AUGUSTUS	stop_codon	1134074	1134076	.	+	0	transcript_id "g238.t1"; gene_id "g238";
# protein sequence = [MREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPE
# GGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPPSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRG
# ELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIMLGKRT
# SALPQLVISLVQHSPTSTR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g238
###
# start gene g239
Scaffold_1	AUGUSTUS	gene	1138581	1139900	1	+	.	g239
Scaffold_1	AUGUSTUS	transcript	1138581	1139900	1	+	.	g239.t1
Scaffold_1	AUGUSTUS	start_codon	1138581	1138583	.	+	0	transcript_id "g239.t1"; gene_id "g239";
Scaffold_1	AUGUSTUS	CDS	1138581	1139900	1	+	0	transcript_id "g239.t1"; gene_id "g239";
Scaffold_1	AUGUSTUS	stop_codon	1139898	1139900	.	+	0	transcript_id "g239.t1"; gene_id "g239";
# protein sequence = [MHNPVIDWKELCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQRPPEAPQPPPEVPQ
# QTPEAPLRAPRTRVKLEEVKDEEYEASQPGPHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSR
# DTERSSSWPGAKQKVRWRKKRREHGPYPDLPTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLR
# EGTPAYFLHISPRRRSPLLKKCSGRVIAAQRVQQPKDPESGDPSSEQGGVVKELDRRSKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIK
# IETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g239
###
# start gene g240
Scaffold_1	AUGUSTUS	gene	1141643	1142317	0.48	+	.	g240
Scaffold_1	AUGUSTUS	transcript	1141643	1142317	0.48	+	.	g240.t1
Scaffold_1	AUGUSTUS	start_codon	1141643	1141645	.	+	0	transcript_id "g240.t1"; gene_id "g240";
Scaffold_1	AUGUSTUS	CDS	1141643	1142317	0.48	+	0	transcript_id "g240.t1"; gene_id "g240";
Scaffold_1	AUGUSTUS	stop_codon	1142315	1142317	.	+	0	transcript_id "g240.t1"; gene_id "g240";
# protein sequence = [MPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNN
# TPNTTTGVSPFFANKGYHPKLSITLEQVQEAEVNEYASNLKELRIEVANKVYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTV
# LSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPQSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g240
###
# start gene g241
Scaffold_1	AUGUSTUS	gene	1142743	1144909	0.15	-	.	g241
Scaffold_1	AUGUSTUS	transcript	1142743	1144909	0.15	-	.	g241.t1
Scaffold_1	AUGUSTUS	stop_codon	1142743	1142745	.	-	0	transcript_id "g241.t1"; gene_id "g241";
Scaffold_1	AUGUSTUS	CDS	1142743	1144071	0.51	-	0	transcript_id "g241.t1"; gene_id "g241";
Scaffold_1	AUGUSTUS	CDS	1144127	1144909	0.17	-	0	transcript_id "g241.t1"; gene_id "g241";
Scaffold_1	AUGUSTUS	start_codon	1144907	1144909	.	-	0	transcript_id "g241.t1"; gene_id "g241";
# protein sequence = [MLDEQDAVDADQQELQQFLTLQRDEAAVAAKRKRNRSPMPVAGPSSKKIRSDAPKTDAPKKRSRRKSPAVEVNVEPFR
# RVRLVVPPVRSVAPTSLPVPPPASPSLMGVLNRDLPMQGPSDLVRLADAAEVHPGLVQQAGSSSPARTPIKGTGQDLLSSTMPPILRPALVPRNPASH
# PYRAENQRLAARVRLLETQLADSQRENSSLTSALRDTSHALESRQREVEQLRSSSQEFLQRQEEYRHIIDQFNTLDRALSGPSDQSLLERFQKVEEEL
# RITRRIGTTTGKLSTSSRRISELTTALLYQHGITDEGNALSTRQRARLEELQEEVHRTRGRAAFVERMIKEYPDEGYYEVVLPPLSQLEGDLVKVRAD
# LRRVATLAHRLYRSDPATVLHHHNRYIGAIIEAVVAFLRRALETEDPDIMEHNIRLALDYMQTARGVHGDLHIRSISSIQWFFNNAVDQDEGLYTLML
# ENSRFDSDRPFLTAAQHAGFTSPPPDSLEPPLHRRMLSLSTALPHRGGAGRWDDLVPAIPSDDQLTQDWEQLMLQYMHHITDTPLPVPDPPVPMSSTG
# PVPESSDETNVEQSLEAPIVQVSSPSGGSHPPVPLFLSEQESPTSPSPPPRSPVPPLLFGSVASLSIDLTGDDDELYETEEAYASRIDVAMEGTELAV
# GQGIVKESRCSIPFVVLVPFPFCTSVKYYACLIFCFC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g241
###
# start gene g242
Scaffold_1	AUGUSTUS	gene	1156130	1156510	1	-	.	g242
Scaffold_1	AUGUSTUS	transcript	1156130	1156510	1	-	.	g242.t1
Scaffold_1	AUGUSTUS	stop_codon	1156130	1156132	.	-	0	transcript_id "g242.t1"; gene_id "g242";
Scaffold_1	AUGUSTUS	CDS	1156130	1156510	1	-	0	transcript_id "g242.t1"; gene_id "g242";
Scaffold_1	AUGUSTUS	start_codon	1156508	1156510	.	-	0	transcript_id "g242.t1"; gene_id "g242";
# protein sequence = [MQIKLQSYEDSNENIDHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKV
# GAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYCDDTRK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g242
###
# start gene g243
Scaffold_1	AUGUSTUS	gene	1157446	1158219	0.97	-	.	g243
Scaffold_1	AUGUSTUS	transcript	1157446	1158219	0.97	-	.	g243.t1
Scaffold_1	AUGUSTUS	stop_codon	1157446	1157448	.	-	0	transcript_id "g243.t1"; gene_id "g243";
Scaffold_1	AUGUSTUS	CDS	1157446	1158219	0.97	-	0	transcript_id "g243.t1"; gene_id "g243";
Scaffold_1	AUGUSTUS	start_codon	1158217	1158219	.	-	0	transcript_id "g243.t1"; gene_id "g243";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA
# ALSPAIRKIIMRKIHNRRVRPRTKTDNYVSTLSEDGETEILDKPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPWVK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g243
###
# start gene g244
Scaffold_1	AUGUSTUS	gene	1158249	1161237	0.31	-	.	g244
Scaffold_1	AUGUSTUS	transcript	1158249	1161237	0.31	-	.	g244.t1
Scaffold_1	AUGUSTUS	stop_codon	1158249	1158251	.	-	0	transcript_id "g244.t1"; gene_id "g244";
Scaffold_1	AUGUSTUS	CDS	1158249	1160218	0.62	-	2	transcript_id "g244.t1"; gene_id "g244";
Scaffold_1	AUGUSTUS	CDS	1161222	1161237	0.38	-	0	transcript_id "g244.t1"; gene_id "g244";
Scaffold_1	AUGUSTUS	start_codon	1161235	1161237	.	-	0	transcript_id "g244.t1"; gene_id "g244";
# protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI
# SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS
# AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL
# VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD
# NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ
# SHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLR
# DNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g244
###
# start gene g245
Scaffold_1	AUGUSTUS	gene	1168317	1169483	0.88	-	.	g245
Scaffold_1	AUGUSTUS	transcript	1168317	1169483	0.88	-	.	g245.t1
Scaffold_1	AUGUSTUS	stop_codon	1168317	1168319	.	-	0	transcript_id "g245.t1"; gene_id "g245";
Scaffold_1	AUGUSTUS	CDS	1168317	1169483	0.88	-	0	transcript_id "g245.t1"; gene_id "g245";
Scaffold_1	AUGUSTUS	start_codon	1169481	1169483	.	-	0	transcript_id "g245.t1"; gene_id "g245";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g245
###
# start gene g246
Scaffold_1	AUGUSTUS	gene	1177518	1177977	0.49	+	.	g246
Scaffold_1	AUGUSTUS	transcript	1177518	1177977	0.49	+	.	g246.t1
Scaffold_1	AUGUSTUS	start_codon	1177518	1177520	.	+	0	transcript_id "g246.t1"; gene_id "g246";
Scaffold_1	AUGUSTUS	CDS	1177518	1177580	0.49	+	0	transcript_id "g246.t1"; gene_id "g246";
Scaffold_1	AUGUSTUS	CDS	1177618	1177977	1	+	0	transcript_id "g246.t1"; gene_id "g246";
Scaffold_1	AUGUSTUS	stop_codon	1177975	1177977	.	+	0	transcript_id "g246.t1"; gene_id "g246";
# protein sequence = [MSSADAEPSPTTFISSDHELDNGVDDPPPSPGAESVSTGAASSDDGDSDEDEDEGAEENERVDENGAIVIDDDDDDDE
# RGGTSNDIQEPSITIKDEPSSSNAAPALLNESNNAPKPNSETVNKAENHLLANLHSDYEAKI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g246
###
# start gene g247
Scaffold_1	AUGUSTUS	gene	1180587	1181912	0.95	-	.	g247
Scaffold_1	AUGUSTUS	transcript	1180587	1181912	0.95	-	.	g247.t1
Scaffold_1	AUGUSTUS	stop_codon	1180587	1180589	.	-	0	transcript_id "g247.t1"; gene_id "g247";
Scaffold_1	AUGUSTUS	CDS	1180587	1181912	0.95	-	0	transcript_id "g247.t1"; gene_id "g247";
Scaffold_1	AUGUSTUS	start_codon	1181910	1181912	.	-	0	transcript_id "g247.t1"; gene_id "g247";
# protein sequence = [MVAEDFRLPQGLYEAYGEPGIKPFEGLSGCKPTAKHAVRMLELPEFIHSYLVSGGERPFAFWPPVDSEAFCLSPIPSI
# ERELLVALLNEYPATIDRGTVANKQDLSLRVIFVHVNSLRLAPSQGNIRDLPNLSGYRAGNDVRFIAYGSSDIVNPRFPDIMEEIWHIGMRQLMVSIA
# IADTDILGGITTFTASALLSDPLGVNERILQIEEHEFWVCYILPAVIGMAVSVAYSGREHLIQKRIACDALEHGVHRTEAQSVMMVVDEDGVDEIPCT
# CDGFAYEWLLDAIDEEFVSVIGAPPLHSSDPNLGGHGAIIHPGVPRDGRPRGKEEWKQLSDTLQHSSSSTAFKNTAPPPQEFPPFSVEAQYNDPFASW
# ILQLFDSDVRSRSQTLDFCVQEFKRICGTMPQEEWENVIKKEITEELGRMQISRGFREELRRFRRCHWK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g247
###
# start gene g248
Scaffold_1	AUGUSTUS	gene	1182145	1182480	0.99	-	.	g248
Scaffold_1	AUGUSTUS	transcript	1182145	1182480	0.99	-	.	g248.t1
Scaffold_1	AUGUSTUS	stop_codon	1182145	1182147	.	-	0	transcript_id "g248.t1"; gene_id "g248";
Scaffold_1	AUGUSTUS	CDS	1182145	1182480	0.99	-	0	transcript_id "g248.t1"; gene_id "g248";
Scaffold_1	AUGUSTUS	start_codon	1182478	1182480	.	-	0	transcript_id "g248.t1"; gene_id "g248";
# protein sequence = [MINVDDNNEAQTISIEGMLLPSDPSAGQIALQQGVMPLKVAMSYNDSKLLMKSRSFYRLEDLNGIVAACNPVQEWGWL
# DAETEQGARNLGKVADFLSHEKLVNTFQSFCNI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g248
###
# start gene g249
Scaffold_1	AUGUSTUS	gene	1183155	1183688	0.59	-	.	g249
Scaffold_1	AUGUSTUS	transcript	1183155	1183688	0.59	-	.	g249.t1
Scaffold_1	AUGUSTUS	stop_codon	1183155	1183157	.	-	0	transcript_id "g249.t1"; gene_id "g249";
Scaffold_1	AUGUSTUS	CDS	1183155	1183688	0.59	-	0	transcript_id "g249.t1"; gene_id "g249";
Scaffold_1	AUGUSTUS	start_codon	1183686	1183688	.	-	0	transcript_id "g249.t1"; gene_id "g249";
# protein sequence = [MSGNYVIRQSTFSSQQASAVDDPAFLFTPEKSATQKLSRQSPEEKEAESLSHTSPVPSSSMPTISAQAEAKKKASLPR
# LPPVRAASGLSTEKSTSFPILPALKAHNPALQPKLSIQTKLRTDSPVSAGGISTKQRLAQAALQMTTPTEKVAEASRPLPPQKASSLSGMNFKRIVDP
# P]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g249
###
# start gene g250
Scaffold_1	AUGUSTUS	gene	1186372	1187156	0.5	+	.	g250
Scaffold_1	AUGUSTUS	transcript	1186372	1187156	0.5	+	.	g250.t1
Scaffold_1	AUGUSTUS	start_codon	1186372	1186374	.	+	0	transcript_id "g250.t1"; gene_id "g250";
Scaffold_1	AUGUSTUS	CDS	1186372	1186665	0.5	+	0	transcript_id "g250.t1"; gene_id "g250";
Scaffold_1	AUGUSTUS	CDS	1186738	1186759	0.6	+	0	transcript_id "g250.t1"; gene_id "g250";
Scaffold_1	AUGUSTUS	CDS	1186822	1187156	0.6	+	2	transcript_id "g250.t1"; gene_id "g250";
Scaffold_1	AUGUSTUS	stop_codon	1187154	1187156	.	+	0	transcript_id "g250.t1"; gene_id "g250";
# protein sequence = [MPSTPNPAGLLITGIVTYTDGSTSPIVSDTTWRTSEGGLPSGFQDLSFDDSTWAPAVTEGGNGVAPWGTVALAGIDPI
# SFDTAQWIWTNEASIGLYPLTQTTSTPLENVQGPQVVFAVYAENTNTVPNPAGLLAAIQLNSQDGYCADCVSTSSIVTSVAWKAFPGAVPSGFEQQGF
# DDSSWPAAVEEGANGVEPWGTIAVPTAVTTGGSPLPGAPA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g250
###
# start gene g251
Scaffold_1	AUGUSTUS	gene	1188611	1189943	0.09	+	.	g251
Scaffold_1	AUGUSTUS	transcript	1188611	1189943	0.09	+	.	g251.t1
Scaffold_1	AUGUSTUS	start_codon	1188611	1188613	.	+	0	transcript_id "g251.t1"; gene_id "g251";
Scaffold_1	AUGUSTUS	CDS	1188611	1188638	0.45	+	0	transcript_id "g251.t1"; gene_id "g251";
Scaffold_1	AUGUSTUS	CDS	1188798	1189195	0.39	+	2	transcript_id "g251.t1"; gene_id "g251";
Scaffold_1	AUGUSTUS	CDS	1189302	1189943	1	+	0	transcript_id "g251.t1"; gene_id "g251";
Scaffold_1	AUGUSTUS	stop_codon	1189941	1189943	.	+	0	transcript_id "g251.t1"; gene_id "g251";
# protein sequence = [MFKLMQLARCQRRSNDTTQCLNTRASDGLAKRATPALSFDASQWIWTPELSGGNAPVGSRGLRKTFVPPQGKTPAFLT
# IAYAVDNTAILYVNGQEISTQDGWQIADTSCINLADCGCAVIIAVNATNVSNAPNPAGLLVTGIYLGTCSHGGGNGVAPWGTVALAGSDPISFDTAQW
# IWTNEASIGLYPPGARAFRYTSTLPGGQSSGSATIIIDTDNEYSLYVNGVFVGTGTDFNTAQKYTVENVQGPQVIFAVYAENTATVPNPAGLLAAIQL
# NSQDGYCADCISTSSIVTSVAWKAFPGAVPSGFEQQGFDDSSWPAAVEEGANGVAPWGTIAVPTTVTTGALIARRSKPDQS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g251
###
# start gene g252
Scaffold_1	AUGUSTUS	gene	1197041	1197475	1	+	.	g252
Scaffold_1	AUGUSTUS	transcript	1197041	1197475	1	+	.	g252.t1
Scaffold_1	AUGUSTUS	start_codon	1197041	1197043	.	+	0	transcript_id "g252.t1"; gene_id "g252";
Scaffold_1	AUGUSTUS	CDS	1197041	1197475	1	+	0	transcript_id "g252.t1"; gene_id "g252";
Scaffold_1	AUGUSTUS	stop_codon	1197473	1197475	.	+	0	transcript_id "g252.t1"; gene_id "g252";
# protein sequence = [MPKPPPPSPAAKHSKATASTRARGKAKATNLPNPTNTNSSSSSSTSRSARLGTQDTITIEDSDNEDEHQSRTRSKAGS
# KRKRGAGTNSLDADSATTEESLDLDDDDEIEFAEARRSHKRSTRATPAVRGRHVDDSDVIVIDDED]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g252
###
# start gene g253
Scaffold_1	AUGUSTUS	gene	1197919	1198593	0.46	-	.	g253
Scaffold_1	AUGUSTUS	transcript	1197919	1198593	0.46	-	.	g253.t1
Scaffold_1	AUGUSTUS	stop_codon	1197919	1197921	.	-	0	transcript_id "g253.t1"; gene_id "g253";
Scaffold_1	AUGUSTUS	CDS	1197919	1198206	0.81	-	0	transcript_id "g253.t1"; gene_id "g253";
Scaffold_1	AUGUSTUS	CDS	1198281	1198512	0.52	-	1	transcript_id "g253.t1"; gene_id "g253";
Scaffold_1	AUGUSTUS	CDS	1198580	1198593	0.54	-	0	transcript_id "g253.t1"; gene_id "g253";
Scaffold_1	AUGUSTUS	start_codon	1198591	1198593	.	-	0	transcript_id "g253.t1"; gene_id "g253";
# protein sequence = [MFLRDYQLAAVNSGVVDSTCSNLQPGASLCLGYEGEDCTSTYTVVAQDTCDSIYDAYGINATLLYGNNPQIDSACDNI
# YVGEVLCVASTIAAPPAGSASVNTAIPSTATAAASATPTTSSSAISITVASSSVALPVVTTSTFTSFSATSSTFTSVAASSSSSSDDGDDDDLPYCDE
# L]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g253
###
# start gene g254
Scaffold_1	AUGUSTUS	gene	1218446	1219306	0.78	+	.	g254
Scaffold_1	AUGUSTUS	transcript	1218446	1219306	0.78	+	.	g254.t1
Scaffold_1	AUGUSTUS	start_codon	1218446	1218448	.	+	0	transcript_id "g254.t1"; gene_id "g254";
Scaffold_1	AUGUSTUS	CDS	1218446	1219306	0.78	+	0	transcript_id "g254.t1"; gene_id "g254";
Scaffold_1	AUGUSTUS	stop_codon	1219304	1219306	.	+	0	transcript_id "g254.t1"; gene_id "g254";
# protein sequence = [MSTGAELDPSTYKCSGCSHQFSRASYFIQHLEKTSKPQCMAAHEDLKKTIHRSRFMPQKTPPTYHSPELSKISPSAPL
# VPPLDTEHDLYVTTPQSVSDFYGHDYSNEDFPGFNEDYNGMGGDIDNDSEDEEQLPPELEDAWELPRVPASSAEHNVDVDAIPTLLTERSLLRDLPSH
# RDGIHVESFGGQAGAPVKGRNSRNPVLYSSRDGFLQYRSHIPHKGKNPWSPFASQMDWEVAKWAKHGKLDRLLSATCLLLTVYVLYCHLPFAMTKLLN
# STGIQSIRTFIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g254
###
# start gene g255
Scaffold_1	AUGUSTUS	gene	1227498	1228319	0.68	+	.	g255
Scaffold_1	AUGUSTUS	transcript	1227498	1228319	0.68	+	.	g255.t1
Scaffold_1	AUGUSTUS	start_codon	1227498	1227500	.	+	0	transcript_id "g255.t1"; gene_id "g255";
Scaffold_1	AUGUSTUS	CDS	1227498	1228319	0.68	+	0	transcript_id "g255.t1"; gene_id "g255";
Scaffold_1	AUGUSTUS	stop_codon	1228317	1228319	.	+	0	transcript_id "g255.t1"; gene_id "g255";
# protein sequence = [MTKTFFVNLALVFNDCPKYFTDQRKVNYTLSYLSVSAKEWFVPDILDPDLDSLPAWTSSFKALVSELQDNFGVYDAQG
# EAEDSLGNLKIKETENIWKYNIRFNTLAASTNWDSAALKWAYGRGLAEYIKDGMARLPKPATLTNYRQEVLRIDNRYWKREETRKREAGKPFVARNPK
# KGSSDFKTGATNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSLNSGQSSGQRPAFNHPGADGKVLPSEKERRMKNNLCLFCSGKHQIADCNK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g255
###
# start gene g256
Scaffold_1	AUGUSTUS	gene	1236628	1236951	0.52	+	.	g256
Scaffold_1	AUGUSTUS	transcript	1236628	1236951	0.52	+	.	g256.t1
Scaffold_1	AUGUSTUS	start_codon	1236628	1236630	.	+	0	transcript_id "g256.t1"; gene_id "g256";
Scaffold_1	AUGUSTUS	CDS	1236628	1236951	0.52	+	0	transcript_id "g256.t1"; gene_id "g256";
Scaffold_1	AUGUSTUS	stop_codon	1236949	1236951	.	+	0	transcript_id "g256.t1"; gene_id "g256";
# protein sequence = [MTTADPIRPSSISSPIMRPMRGSRIDVFYGTGAYAASTASTREKEASEPQLPSLSSLDSAFQLQEYISLVIRKDVHDV
# DRIISIPSIPGKEDGKGVDENCWIYEQLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g256
###
# start gene g257
Scaffold_1	AUGUSTUS	gene	1236994	1238890	0.72	+	.	g257
Scaffold_1	AUGUSTUS	transcript	1236994	1238890	0.72	+	.	g257.t1
Scaffold_1	AUGUSTUS	start_codon	1236994	1236996	.	+	0	transcript_id "g257.t1"; gene_id "g257";
Scaffold_1	AUGUSTUS	CDS	1236994	1238200	0.73	+	0	transcript_id "g257.t1"; gene_id "g257";
Scaffold_1	AUGUSTUS	CDS	1238355	1238890	0.96	+	2	transcript_id "g257.t1"; gene_id "g257";
Scaffold_1	AUGUSTUS	stop_codon	1238888	1238890	.	+	0	transcript_id "g257.t1"; gene_id "g257";
# protein sequence = [MFNRRLAQDLTHPLITALQVECTRRTCPEMKAGEWLYLCVAHGNESTSHSSSSSENGSGGPGGGMMMEQCCAIDYILH
# TIDSATALLNSPRAFPSRLSIPVPSVRHFSSLARRLGRVFAHAYFHHRDLFEQAEAESSLYRRFEEMVGRWGLVPREFLVIPSLGKENDLSKLDDDSR
# KREEPRLEAAAVNFDDHLGFEDDEDGHFNDKVKPVSILLDNSAVGTGPTVTRITPPLEAGAGGDFSRSKSSSPGNTSGKKFGRNRTGTMVFSEASALV
# DELSKSPGGRAQVELAEASAQLANSQSTSAGESKTSVAVAPTESSKSSEIAELPTSSESQNTAASSEPSSESSQSHSPSPPFETDSSLPKEVENDPPH
# EATVPAPEEQEVMTQAVEAESPEEAQEKSTREGDGKDAAVPLSNDMVKKDAGEGEEVATETSAEEETKEEAEEKESEANAQETQENEDNEVKTSSEET
# PARSSHESASPTSESTEFSESPQSSEPTEEPVQEPVEEDVESKKIEEASTGEIATTAPEAEATVTGSAETGNITEGESDRTEVSEKEEPETVTEKAEV
# EKVENDNESKDA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g257
###
# start gene g258
Scaffold_1	AUGUSTUS	gene	1242944	1243306	0.62	+	.	g258
Scaffold_1	AUGUSTUS	transcript	1242944	1243306	0.62	+	.	g258.t1
Scaffold_1	AUGUSTUS	start_codon	1242944	1242946	.	+	0	transcript_id "g258.t1"; gene_id "g258";
Scaffold_1	AUGUSTUS	CDS	1242944	1243306	0.62	+	0	transcript_id "g258.t1"; gene_id "g258";
Scaffold_1	AUGUSTUS	stop_codon	1243304	1243306	.	+	0	transcript_id "g258.t1"; gene_id "g258";
# protein sequence = [MASFGQFLGGTLGLGVAEPVFSSELAKYLLKYAPDAPATIVKESPTAIYTEISPSLIPGVVQAYSQSLRIVFVVGVPV
# AGLALFTAMFIKNTRIVKTAPPPSSSVPASETEGKGKDIEKA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g258
###
# start gene g259
Scaffold_1	AUGUSTUS	gene	1248459	1249052	0.54	-	.	g259
Scaffold_1	AUGUSTUS	transcript	1248459	1249052	0.54	-	.	g259.t1
Scaffold_1	AUGUSTUS	stop_codon	1248459	1248461	.	-	0	transcript_id "g259.t1"; gene_id "g259";
Scaffold_1	AUGUSTUS	CDS	1248459	1249052	0.54	-	0	transcript_id "g259.t1"; gene_id "g259";
Scaffold_1	AUGUSTUS	start_codon	1249050	1249052	.	-	0	transcript_id "g259.t1"; gene_id "g259";
# protein sequence = [MQEEEMQDILQQVGKLEQLDQVNETLITALQESMNEAGTRAGEGNEQTPIIVDLDDAPVPTRALAPASAPASGSGSGS
# GSGSGSGPGPGPGSGSGSGSGSTVNTIDKENANANVKEGNAKHKDKGKSQPKTGGGVSASHSHSALANPDSSDSNSSDSDSDSSSDSSSSSSSDAGPR
# RRPSKYTIDAYHAGNVRFGVL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g259
###
# start gene g260
Scaffold_1	AUGUSTUS	gene	1252415	1253968	0.3	-	.	g260
Scaffold_1	AUGUSTUS	transcript	1252415	1253968	0.3	-	.	g260.t1
Scaffold_1	AUGUSTUS	stop_codon	1252415	1252417	.	-	0	transcript_id "g260.t1"; gene_id "g260";
Scaffold_1	AUGUSTUS	CDS	1252415	1253968	0.3	-	0	transcript_id "g260.t1"; gene_id "g260";
Scaffold_1	AUGUSTUS	start_codon	1253966	1253968	.	-	0	transcript_id "g260.t1"; gene_id "g260";
# protein sequence = [MKRIRTARKTTTTFSTRRVKRTREEKRKGQSPSTAILVPSSDDDDDALPIAGKLNGPGPAPAEGPRSAPAPASAPASA
# PRQAPAPAPGPTAGRTTIHEIFEITDSEEEKEKGVDSLTKTTPKPLSLPPPLPPTLPLSLQRAPAPPPLDPTHLPISEPTIISSDSEPEPNHHPNPTP
# TPHPHSYSEPHPQIHPHPQLPRARPSSPTNDEDTDNDREWLKSFADAFNASGEANFGTARRRRSKDGADTGAGVGAGAGAKKPKPNLKPKPTPKSNLN
# PTSKPTPNPNPKSKLPHSPPLRTSPFTPLPGSKAYAYSYSHRRSHPSLNPSLNPSLNPSLGSSLGSLNPLVQKSHPNPNPTKPNKINIKINNKTPCES
# SFLPSPSITPPTLVQSTGVETPSPNPSPSPPSSQSPSSQSPSSPSSPSSPSSPSSRSSSPSSSPSNPTPIPNSNPNSNPNSNSNPNSKTPHPPTKKQK
# ALALLALLGTPRVTGGSGSGSGSGSGSKSRSQGLGQGESQSRVAEES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g260
###
# start gene g261
Scaffold_1	AUGUSTUS	gene	1257272	1258693	0.09	-	.	g261
Scaffold_1	AUGUSTUS	transcript	1257272	1258693	0.09	-	.	g261.t1
Scaffold_1	AUGUSTUS	stop_codon	1257272	1257274	.	-	0	transcript_id "g261.t1"; gene_id "g261";
Scaffold_1	AUGUSTUS	CDS	1257272	1257441	0.88	-	2	transcript_id "g261.t1"; gene_id "g261";
Scaffold_1	AUGUSTUS	CDS	1257586	1257609	0.68	-	2	transcript_id "g261.t1"; gene_id "g261";
Scaffold_1	AUGUSTUS	CDS	1257685	1257799	0.68	-	0	transcript_id "g261.t1"; gene_id "g261";
Scaffold_1	AUGUSTUS	CDS	1258073	1258693	0.2	-	0	transcript_id "g261.t1"; gene_id "g261";
Scaffold_1	AUGUSTUS	start_codon	1258691	1258693	.	-	0	transcript_id "g261.t1"; gene_id "g261";
# protein sequence = [MNGLSVKSGLFSHALPLAPATHSASSLLVGVQPQKLGSKQARCESYSLPFSSAYQHPQQVRSIEQADSIRIVPEVHRG
# KGEIVPLIKKDAKDVSSYTFNYQRDTYSVAKCSSDSVTFIKLPYPSSGNPSLSSFLKPQGPKFGLSSQTAEQLKELYGLNEFNIPIPSFTELFSEHAT
# APFFVFQACLDFNKSMTIPSNKIPDLLCRTMPLHHKPVDAKSKDKETKETKEAHSHEETTVPADILLLHVDELDRGVADGVPEPSLKTPDNGCLGVVL
# RTGFGTAQGQLVRHVTQTHRSFSLPTNPTISRSAP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g261
###
# start gene g262
Scaffold_1	AUGUSTUS	gene	1261709	1262575	1	-	.	g262
Scaffold_1	AUGUSTUS	transcript	1261709	1262575	1	-	.	g262.t1
Scaffold_1	AUGUSTUS	stop_codon	1261709	1261711	.	-	0	transcript_id "g262.t1"; gene_id "g262";
Scaffold_1	AUGUSTUS	CDS	1261709	1262575	1	-	0	transcript_id "g262.t1"; gene_id "g262";
Scaffold_1	AUGUSTUS	start_codon	1262573	1262575	.	-	0	transcript_id "g262.t1"; gene_id "g262";
# protein sequence = [MLFQSLVPFVAIALALVANSAPAIDPIFARGNALGYSHIFDARTPSSTRPGLADIYRRRQSNAQKRKKQAARLRNAAN
# AANTQKLKPIGATSPPTETHHVSLTEAKLAPHPDGVPGEPHKPEAGAKAVPNPAAPHPDPVKEAEEKKKEEENKHNPNIPTPGEPHTEVKAGEVPRPS
# TPAPPEQPAPPKTKEEEEKEAKEKADREAKEKAANEHPTEPAADAAPKPGKTDALISGLNAVTALANTANTFGSALHPGGASTGMGGEDAPGGNSMGG
# MGGMGGMGGMGGMK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g262
###
# start gene g263
Scaffold_1	AUGUSTUS	gene	1265059	1267160	0.75	+	.	g263
Scaffold_1	AUGUSTUS	transcript	1265059	1267160	0.75	+	.	g263.t1
Scaffold_1	AUGUSTUS	start_codon	1265059	1265061	.	+	0	transcript_id "g263.t1"; gene_id "g263";
Scaffold_1	AUGUSTUS	CDS	1265059	1265067	0.76	+	0	transcript_id "g263.t1"; gene_id "g263";
Scaffold_1	AUGUSTUS	CDS	1265129	1265256	0.85	+	0	transcript_id "g263.t1"; gene_id "g263";
Scaffold_1	AUGUSTUS	CDS	1265306	1267160	0.99	+	1	transcript_id "g263.t1"; gene_id "g263";
Scaffold_1	AUGUSTUS	stop_codon	1267158	1267160	.	+	0	transcript_id "g263.t1"; gene_id "g263";
# protein sequence = [MKLLGIDARRTLETLNSSSASSGDPFPEVFLSDHRDLQTRFDLVIHVDLSTAKPRSPNYHETLDSGSASNATLSSISS
# VLTQALGDRVRVIAILHPTPNTRPLSQAHPSTSHIIHIGLIYNPVHAWRQVDHGPNPASDPDPVAVEQFREFWGDKAELRRFKDGSIVESVVWDVKTI
# DEKTLIPRRIVAFVLKRHFGIGEEGVRGWQEGFDGVLRLPESVSRFYVGENGLGVGVGFKAALGAFDGVVKAIKVLSSDEGGNDALPLSVMNISPTSE
# FLRYTSVFSPVPLPDSIASVLSMNTRYLNPIEFVIEFERSSRWPDDLRAVQKVKLAFLEKIARGLMGRVPGLRAAVIVGDAAGTDDMNDVARLEIVTE
# EGWAFVGRIWHDREAVLLDRIINNTASTLPHVTRKDKSQSQRQGKDYHTAIQARESYTRLYIHAPMHHRAIAKLCHHFPAFAGTVRIAKRWFAAHWLL
# GGADGGGGYVSEEAVELLCAKFFVKEGWEAEMDRDIEEEEKDAEKIEQRKMVVPGSKERGFASLIQFIKEWNWDEQGEGIFVPLYESSSILGLKQPKA
# VSSMSTGVWKIRTAMDEEGCIWTMFGPDAIIARRVRALAQATWGCLKGMEMNGMSGGGSVLVSKFILVFQYVSKLALMIRPYSIIPPMTTMLSST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g263
###
# start gene g264
Scaffold_1	AUGUSTUS	gene	1268635	1269123	0.38	+	.	g264
Scaffold_1	AUGUSTUS	transcript	1268635	1269123	0.38	+	.	g264.t1
Scaffold_1	AUGUSTUS	start_codon	1268635	1268637	.	+	0	transcript_id "g264.t1"; gene_id "g264";
Scaffold_1	AUGUSTUS	CDS	1268635	1269123	0.38	+	0	transcript_id "g264.t1"; gene_id "g264";
Scaffold_1	AUGUSTUS	stop_codon	1269121	1269123	.	+	0	transcript_id "g264.t1"; gene_id "g264";
# protein sequence = [MAGELGARVWVVREIRVGRGAGGTRFVADEPFISNHLALLDNSEAMPPSVLGNMHIYDIFKPRPVMTRAQTEIGVSMH
# PNNSTSSIFPTSTLDQLDNAIGGFGSGAKHYHKSKKERKQKGKKYHLNYEPPGGPRFTSASNVDENVDAQHAGTQVRFVNLLRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g264
###
# start gene g265
Scaffold_1	AUGUSTUS	gene	1275921	1276696	0.83	+	.	g265
Scaffold_1	AUGUSTUS	transcript	1275921	1276696	0.83	+	.	g265.t1
Scaffold_1	AUGUSTUS	start_codon	1275921	1275923	.	+	0	transcript_id "g265.t1"; gene_id "g265";
Scaffold_1	AUGUSTUS	CDS	1275921	1276056	0.84	+	0	transcript_id "g265.t1"; gene_id "g265";
Scaffold_1	AUGUSTUS	CDS	1276248	1276696	0.99	+	2	transcript_id "g265.t1"; gene_id "g265";
Scaffold_1	AUGUSTUS	stop_codon	1276694	1276696	.	+	0	transcript_id "g265.t1"; gene_id "g265";
# protein sequence = [MPSRTQAQSRANSKENTFFTTAQSFTPFSESISAIGQPHRCNRGFAIARCTGKQPQCHVTSQSPRDPPPHFNLDAGDH
# NDQDPPVDPNNPGADNNNPDNDNLDDDSGSLLHGEPGEPGDPSGPGGPGGPCTPISPDIPNKQRAMLELLSGFKGSIETLGTIETLGTILAALGQPSD
# SSESKSKVKEPMTRLNFG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g265
###
# start gene g266
Scaffold_1	AUGUSTUS	gene	1294087	1294371	0.41	-	.	g266
Scaffold_1	AUGUSTUS	transcript	1294087	1294371	0.41	-	.	g266.t1
Scaffold_1	AUGUSTUS	stop_codon	1294087	1294089	.	-	0	transcript_id "g266.t1"; gene_id "g266";
Scaffold_1	AUGUSTUS	CDS	1294087	1294371	0.41	-	0	transcript_id "g266.t1"; gene_id "g266";
Scaffold_1	AUGUSTUS	start_codon	1294369	1294371	.	-	0	transcript_id "g266.t1"; gene_id "g266";
# protein sequence = [MPWEKAEELQRRERAVILKETLVEKKARRVKMDVEIEASARLVEIHREAMLSAKKKLKELNFGKQLIEEREEHLALEE
# QELIRSATMNDEQDVY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g266
###
# start gene g267
Scaffold_1	AUGUSTUS	gene	1301394	1301780	0.67	+	.	g267
Scaffold_1	AUGUSTUS	transcript	1301394	1301780	0.67	+	.	g267.t1
Scaffold_1	AUGUSTUS	start_codon	1301394	1301396	.	+	0	transcript_id "g267.t1"; gene_id "g267";
Scaffold_1	AUGUSTUS	CDS	1301394	1301780	0.67	+	0	transcript_id "g267.t1"; gene_id "g267";
Scaffold_1	AUGUSTUS	stop_codon	1301778	1301780	.	+	0	transcript_id "g267.t1"; gene_id "g267";
# protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEFR
# GPLQWNLGWDHHNGGLPPWVTPNLPVVPWEVSHTPLPGEREDLPLDRYRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g267
###
# start gene g268
Scaffold_1	AUGUSTUS	gene	1311753	1312355	0.57	+	.	g268
Scaffold_1	AUGUSTUS	transcript	1311753	1312355	0.57	+	.	g268.t1
Scaffold_1	AUGUSTUS	start_codon	1311753	1311755	.	+	0	transcript_id "g268.t1"; gene_id "g268";
Scaffold_1	AUGUSTUS	CDS	1311753	1312355	0.57	+	0	transcript_id "g268.t1"; gene_id "g268";
Scaffold_1	AUGUSTUS	stop_codon	1312353	1312355	.	+	0	transcript_id "g268.t1"; gene_id "g268";
# protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE
# LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQRPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG
# PHKLFPSDKDLGPDDPILMGSTNG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g268
###
# start gene g269
Scaffold_1	AUGUSTUS	gene	1316189	1317097	0.54	-	.	g269
Scaffold_1	AUGUSTUS	transcript	1316189	1317097	0.54	-	.	g269.t1
Scaffold_1	AUGUSTUS	stop_codon	1316189	1316191	.	-	0	transcript_id "g269.t1"; gene_id "g269";
Scaffold_1	AUGUSTUS	CDS	1316189	1317097	0.54	-	0	transcript_id "g269.t1"; gene_id "g269";
Scaffold_1	AUGUSTUS	start_codon	1317095	1317097	.	-	0	transcript_id "g269.t1"; gene_id "g269";
# protein sequence = [MRTSAVSLPSLIAFIVAILPPSFIITIVILGAIIEAVIAFLRRGLDSDDLDVTVHNFRLALDYVQAARGVHGDMYMRS
# ISSIQWFFNNAVDEDEGLYRMILEHSRFDSDSPFLTAAHHAGFVPPPDDSVEPPLHRRMLALSTALPHSDGVGRWEDIVPALPSIDQLTADWEQMMLQ
# YIHHITDTPLSRIDTQGPMSSVEPANESLPEALVRQSPETPAALESTSSVRPHPQVPLFLPEQGSLTSPSPTPPPLFGSVANLVIDLTGDDDELYETE
# EVGAGRFSVTREVIDLAASQDVVKDESL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g269
###
# start gene g270
Scaffold_1	AUGUSTUS	gene	1322639	1323025	0.61	+	.	g270
Scaffold_1	AUGUSTUS	transcript	1322639	1323025	0.61	+	.	g270.t1
Scaffold_1	AUGUSTUS	start_codon	1322639	1322641	.	+	0	transcript_id "g270.t1"; gene_id "g270";
Scaffold_1	AUGUSTUS	CDS	1322639	1323025	0.61	+	0	transcript_id "g270.t1"; gene_id "g270";
Scaffold_1	AUGUSTUS	stop_codon	1323023	1323025	.	+	0	transcript_id "g270.t1"; gene_id "g270";
# protein sequence = [MKLFTLPIPIDESESDSDSNSDVDKANQPNSPRLEHTPGPDIPVTEDESDEQPIAIRRPVRTRKPPGEWWKTKHPHLV
# FLPIMMTLMILMTTTTGMQNLQHQPLPKWNLEIIESNAQFRSIQVGGGYE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g270
###
# start gene g271
Scaffold_1	AUGUSTUS	gene	1332833	1333485	0.39	+	.	g271
Scaffold_1	AUGUSTUS	transcript	1332833	1333485	0.39	+	.	g271.t1
Scaffold_1	AUGUSTUS	start_codon	1332833	1332835	.	+	0	transcript_id "g271.t1"; gene_id "g271";
Scaffold_1	AUGUSTUS	CDS	1332833	1332850	0.93	+	0	transcript_id "g271.t1"; gene_id "g271";
Scaffold_1	AUGUSTUS	CDS	1333003	1333006	0.98	+	0	transcript_id "g271.t1"; gene_id "g271";
Scaffold_1	AUGUSTUS	CDS	1333073	1333485	0.41	+	2	transcript_id "g271.t1"; gene_id "g271";
Scaffold_1	AUGUSTUS	stop_codon	1333483	1333485	.	+	0	transcript_id "g271.t1"; gene_id "g271";
# protein sequence = [MTRVNILVITRSDEALCNVCRKCSITTVCSTEFAYNNAPNASTGITLFFANKGYHPNITVRPEVDMKSDLARDFIVNL
# DELHVFLREEILLAQSHYKEQADRKRISHPEFPIGSKVFVLAKHIRSTHPTEKFSEKYLGPFKVIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g271
###
# start gene g272
Scaffold_1	AUGUSTUS	gene	1334901	1337605	0.21	+	.	g272
Scaffold_1	AUGUSTUS	transcript	1334901	1337605	0.21	+	.	g272.t1
Scaffold_1	AUGUSTUS	start_codon	1334901	1334903	.	+	0	transcript_id "g272.t1"; gene_id "g272";
Scaffold_1	AUGUSTUS	CDS	1334901	1335585	0.46	+	0	transcript_id "g272.t1"; gene_id "g272";
Scaffold_1	AUGUSTUS	CDS	1335675	1337605	0.27	+	2	transcript_id "g272.t1"; gene_id "g272";
Scaffold_1	AUGUSTUS	stop_codon	1337603	1337605	.	+	0	transcript_id "g272.t1"; gene_id "g272";
# protein sequence = [MAPERSTSPDPLASYDISPTAPQIALDKAQIASDKPLQRSQTLPSTSSTQISLDKGKGRAQPAQSTSYIASRPSPELR
# SVRIRPRTLQERLQVIPEAGTAPQVTGSEHREASIALSTHSHHSSHQIPLQDRISAAPTPPDALEQVRLTAEALGQVVEQYRNNELSPNDAFRALRSL
# TDDPTVVRDFIGQIQEIQRDHLRASRERVAAVKAARVAAAAASKSRISEDHLSEADQMEQDAHQDRSNSLQQALLKLVGQTQSSSSPGTSSGLPPSLL
# EAAPHLSALTSSDILSPTVSETWKLRMLFTVDSHVDTTVSLLSAQPFTDPYLSPCSKLIVKDRYVDFEKIHASITSYTSIFDDSTTFGSEYKLVKKEH
# SIRSLPVTSEAQWLRVFDAWLAPVLKIYPHRQSELSAYKASIMEFFQGAHQIPLLPLEWTGRRARKLLTLPLTLEMQKTSDFCCLRNFSVLENVPAPL
# LALLLLQSARILLVSFGMKGNALPHVQIAASMASVVSVESPTKQLTPNPAMRSLSTVDQRVKTALAGPRSLAGTKRAAPESNSGSSNSIPRFRRGYLW
# STSSSSSEIIPPSIQSTYTAPPLPSPPEHLLNNPQIQSTLKAMAPYIKVETPFNVDRLENLLASHPNQPFVASVMRSLREGFWPFYEAEWEVESKQKL
# DNYVSEPQDFAALRAHRDQEVAAGRWSEALPEDFVLLPGMKVSPMFVVWQKGKPRVVMDHTGSGLNDNIPKAEGKVKYDDMHTFGQVLNDILKEHPDE
# ELILFKSDVSKAFLNLPGHPLWQLCQVVEVDGRYHIVRRLVFGTRTSPRCWCSLSSLMCWFGSEKLGIIGLHVIWMISMAGTLRGICYCSMINSALRD
# RSSSLYSGI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g272
###
# start gene g273
Scaffold_1	AUGUSTUS	gene	1340504	1342000	0.17	+	.	g273
Scaffold_1	AUGUSTUS	transcript	1340504	1342000	0.17	+	.	g273.t1
Scaffold_1	AUGUSTUS	start_codon	1340504	1340506	.	+	0	transcript_id "g273.t1"; gene_id "g273";
Scaffold_1	AUGUSTUS	CDS	1340504	1341137	0.6	+	0	transcript_id "g273.t1"; gene_id "g273";
Scaffold_1	AUGUSTUS	CDS	1341271	1341549	0.27	+	2	transcript_id "g273.t1"; gene_id "g273";
Scaffold_1	AUGUSTUS	CDS	1341663	1342000	0.43	+	2	transcript_id "g273.t1"; gene_id "g273";
Scaffold_1	AUGUSTUS	stop_codon	1341998	1342000	.	+	0	transcript_id "g273.t1"; gene_id "g273";
# protein sequence = [MEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYGDVSKLSKNKMVEGFKLE
# SSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFKRFKAWAEKVTGLKVKIL
# RHDKGGEYISKEFEKFLQDEGMKYNVQLEIDLTKWTVPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWN
# PVTKKVIISERADFDERYMYASKSPDKPTLHSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDELPIAIRRPARNRKPPGEWWKTKPSSSRVPAPN
# DDSDDSNDDYYGDAELASISTQQVEPRNYREAMHSSEAFKWEEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g273
###
# start gene g274
Scaffold_1	AUGUSTUS	gene	1342805	1343320	0.66	+	.	g274
Scaffold_1	AUGUSTUS	transcript	1342805	1343320	0.66	+	.	g274.t1
Scaffold_1	AUGUSTUS	start_codon	1342805	1342807	.	+	0	transcript_id "g274.t1"; gene_id "g274";
Scaffold_1	AUGUSTUS	CDS	1342805	1343320	0.66	+	0	transcript_id "g274.t1"; gene_id "g274";
Scaffold_1	AUGUSTUS	stop_codon	1343318	1343320	.	+	0	transcript_id "g274.t1"; gene_id "g274";
# protein sequence = [MINIPYMSAVGSLLFLAMILRADIAFATGVLTRFNSNPGPAHWLAVKHLLRYLKGTIDYELELGPDPTAPDLITAISD
# ADLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIVLSSPSLVIKSHLLPLSMSTTNPPFKLLKIRNITDE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g274
###
# start gene g275
Scaffold_1	AUGUSTUS	gene	1347446	1347910	0.46	+	.	g275
Scaffold_1	AUGUSTUS	transcript	1347446	1347910	0.46	+	.	g275.t1
Scaffold_1	AUGUSTUS	start_codon	1347446	1347448	.	+	0	transcript_id "g275.t1"; gene_id "g275";
Scaffold_1	AUGUSTUS	CDS	1347446	1347463	0.61	+	0	transcript_id "g275.t1"; gene_id "g275";
Scaffold_1	AUGUSTUS	CDS	1347616	1347619	0.47	+	0	transcript_id "g275.t1"; gene_id "g275";
Scaffold_1	AUGUSTUS	CDS	1347686	1347717	0.47	+	2	transcript_id "g275.t1"; gene_id "g275";
Scaffold_1	AUGUSTUS	CDS	1347758	1347910	0.5	+	0	transcript_id "g275.t1"; gene_id "g275";
Scaffold_1	AUGUSTUS	stop_codon	1347908	1347910	.	+	0	transcript_id "g275.t1"; gene_id "g275";
# protein sequence = [MTRVNILMITRSDEALCNNYMLGFNPDTLMRCKWYYAKIPSTKAKEDSKSLRSVVWMATVTICKVLIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g275
###
# start gene g276
Scaffold_1	AUGUSTUS	gene	1364853	1365110	0.26	-	.	g276
Scaffold_1	AUGUSTUS	transcript	1364853	1365110	0.26	-	.	g276.t1
Scaffold_1	AUGUSTUS	stop_codon	1364853	1364855	.	-	0	transcript_id "g276.t1"; gene_id "g276";
Scaffold_1	AUGUSTUS	CDS	1364853	1365110	0.26	-	0	transcript_id "g276.t1"; gene_id "g276";
Scaffold_1	AUGUSTUS	start_codon	1365108	1365110	.	-	0	transcript_id "g276.t1"; gene_id "g276";
# protein sequence = [MINVPYMSAMILCADIAFATSVLTCFNSNPRPAYWLAVKHLLHYLKGTINYKLELGPDPTALDLITAISDADLGGNKD
# NGKSTTG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g276
###
# start gene g277
Scaffold_1	AUGUSTUS	gene	1368387	1369046	0.65	-	.	g277
Scaffold_1	AUGUSTUS	transcript	1368387	1369046	0.65	-	.	g277.t1
Scaffold_1	AUGUSTUS	stop_codon	1368387	1368389	.	-	0	transcript_id "g277.t1"; gene_id "g277";
Scaffold_1	AUGUSTUS	CDS	1368387	1369046	0.65	-	0	transcript_id "g277.t1"; gene_id "g277";
Scaffold_1	AUGUSTUS	start_codon	1369044	1369046	.	-	0	transcript_id "g277.t1"; gene_id "g277";
# protein sequence = [MPPRTRAQSRANSKENTFFTTAQLFAPFSEFISAIGQPRCHNRSFSLATVPMSTLPETMEENQQFEYCTLYTGDGQPV
# QVLTPCRGQPPVVAPAQGRSITQIESPILQAIGHRTGKQPQCRATSQSPRDPPPHFDLDTGDHDDQDPPVDPNDPGADNVNLDDDSSGLPCGEPSEPS
# GPSGPGGPSGPRTPIPPDIPTSNILCWNCSQASRVLSKPSVPY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g277
###
# start gene g278
Scaffold_1	AUGUSTUS	gene	1374945	1375493	0.65	-	.	g278
Scaffold_1	AUGUSTUS	transcript	1374945	1375493	0.65	-	.	g278.t1
Scaffold_1	AUGUSTUS	stop_codon	1374945	1374947	.	-	0	transcript_id "g278.t1"; gene_id "g278";
Scaffold_1	AUGUSTUS	CDS	1374945	1375493	0.65	-	0	transcript_id "g278.t1"; gene_id "g278";
Scaffold_1	AUGUSTUS	start_codon	1375491	1375493	.	-	0	transcript_id "g278.t1"; gene_id "g278";
# protein sequence = [MESQQSQMNNGNNGGFLDEEDRAVIKLHSAALASPHKAASTIIHFLTSRSGKTKTTKNSNEAEYRAIFDALIQDCLSV
# WCWPEWPSASILLSVAVKGMVRSLEEENRDKNSTPGDKDKDSPSDNSVGKSMALDHLGVIAARVRSLVQKVQSQEKEYKEGSHLLPSNREGTARARSR
# SNHCAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g278
###
# start gene g279
Scaffold_1	AUGUSTUS	gene	1375789	1378264	0.44	-	.	g279
Scaffold_1	AUGUSTUS	transcript	1375789	1378264	0.44	-	.	g279.t1
Scaffold_1	AUGUSTUS	stop_codon	1375789	1375791	.	-	0	transcript_id "g279.t1"; gene_id "g279";
Scaffold_1	AUGUSTUS	CDS	1375789	1378060	0.57	-	1	transcript_id "g279.t1"; gene_id "g279";
Scaffold_1	AUGUSTUS	CDS	1378119	1378264	0.44	-	0	transcript_id "g279.t1"; gene_id "g279";
Scaffold_1	AUGUSTUS	start_codon	1378262	1378264	.	-	0	transcript_id "g279.t1"; gene_id "g279";
# protein sequence = [MAHSEYANEIQYLRSNQAQGNQGIVSRDSGYWERARDQAVALLNEQAGGSYPYPPPSQWTTPHTTLPNLFSPYHTPDI
# AGVVLSNGYPTPPALPSIPPLASSYTSSLAGALGPTMLPQNQQRQQLPQHPQHNLHLLSSGALPQHPTHQQYTPAESASFFNDILSRKSNQILQNPVN
# QPGPFVAESRNLQNDHPSPMKKRKVGMFVEVSSPRKKSNLGNIGIDNHDASQIPSTPSKLRQKLASSSAPSIFPKTPSSTHSLALSVPMTPSTTGLLT
# PQSARASSLLSTNSLKRKTLTLDSIESLPALQKPFITPTTGGRTKKAGLHHANTSDFELEDDEDELNLTSSPLKPLLYDSALKSKHKAGRDGHLTHDR
# DERSPLDKLISLIQEIFEAEDGLPADPDATDLSQGGVFNPDSQDPSKPQLSARIIRKLTMHFGQIRGARGAGKGVHSSPTKGRGSRNGKLNDIGCDVL
# GRLLRIIARSVKIGGEADPFGLLSGTRGDSLMSTHKTPKKKQSGTPVGKGGLDVVESEEKLETLGTLAVERGQSKEPKTPKKDKWKGKSSAGCSIEQP
# SAVDLDVLIRKLTQSRDGVLAAESIIALLGGESVKSSKGGEMLSKQLYSEEIILDCFDVVKSALEGGIYPFVEACSGVGSGLLMYLVNGATTSASGQS
# SSPYSNRPPSTSTQSTSAKAEASRHLLSEIFAALSATLPRISVLVGGAGTVKDNEIPMSDAVVIKAVYVGIGPFFVSSDEGSHTLKQERDRDEDNRGK
# GKAKIRGKKVLGGSLLTATFGKSAMRGLRMDALGLIRSVSE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g279
###
# start gene g280
Scaffold_1	AUGUSTUS	gene	1381196	1382765	0.38	-	.	g280
Scaffold_1	AUGUSTUS	transcript	1381196	1382765	0.38	-	.	g280.t1
Scaffold_1	AUGUSTUS	stop_codon	1381196	1381198	.	-	0	transcript_id "g280.t1"; gene_id "g280";
Scaffold_1	AUGUSTUS	CDS	1381196	1381789	0.69	-	0	transcript_id "g280.t1"; gene_id "g280";
Scaffold_1	AUGUSTUS	CDS	1382169	1382765	0.4	-	0	transcript_id "g280.t1"; gene_id "g280";
Scaffold_1	AUGUSTUS	start_codon	1382763	1382765	.	-	0	transcript_id "g280.t1"; gene_id "g280";
# protein sequence = [MTPSDSPEPKKSRPALDVDPSNWEIKSEDAKVQLPSIFTTFEDDNTLRPPANEFRRASLPTLTSDRIRHSPYPPPSLR
# QSYAPTTQSSLAAYTFPPSNPADDDKNRSKVSTDLSYSITAGYDSYPTPGLSTSSNYGSPSDFNPGAYPDADSNWHSSPSGIVRPNSTPGQLSAPAVK
# YDESLRHASFSAPTQAHMFAVRLLCSSNPRHAIQARRRILAPARPSTNPTTTAPFPPTGRSTSLSGLLDPLGRRASLPATTPDSLNLYHPMSLPSMPG
# GHSSDYIGSGRIHGLPQPRPHHHQMPGGNLDYPSTGGRNMNIYPNSMQQSYMNSSVPMSAPPSLSGNPFSTQGGNQSMYSNSAGYLHSPRLPALGQDQ
# PHYFSDGTPPNNGSAPGSGYGTPQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g280
###
# start gene g281
Scaffold_1	AUGUSTUS	gene	1385753	1386826	0.36	-	.	g281
Scaffold_1	AUGUSTUS	transcript	1385753	1386826	0.36	-	.	g281.t1
Scaffold_1	AUGUSTUS	stop_codon	1385753	1385755	.	-	0	transcript_id "g281.t1"; gene_id "g281";
Scaffold_1	AUGUSTUS	CDS	1385753	1386826	0.36	-	0	transcript_id "g281.t1"; gene_id "g281";
Scaffold_1	AUGUSTUS	start_codon	1386824	1386826	.	-	0	transcript_id "g281.t1"; gene_id "g281";
# protein sequence = [MHDMAPSAPSSSSSRLSPLDNDLKRYVSSSTTSSGTTLTTSSVPSYVKHSGPAHIRTIAPSEVPPLDRLGNMMFDRVM
# MKWVKSSAPLDEDHSLLEEISEDPFGDIESLKDDSGPTVEDSTAALEEHVDLNHSELSLVEELSEIDDTEEMELTSFETDHPNSRLVHAMSDFITNDG
# AETSDSENDTVAHEPFNPIEYDSECEEDEQTNEQSRAQDDKEEDDDANGLIIAAPSMIPAISRSPGTPDRPISSPSSMRSAMKTPASVLKDVSVARYR
# TPQRKSKHRRSVSFSDGKRDGPIRGLNKNAEFDDVPGGSRIGFVPSVRSRRIANMLVALEDSGKCHVICRPYFQPKILILRYR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g281
###
# start gene g282
Scaffold_1	AUGUSTUS	gene	1387231	1388199	1	-	.	g282
Scaffold_1	AUGUSTUS	transcript	1387231	1388199	1	-	.	g282.t1
Scaffold_1	AUGUSTUS	stop_codon	1387231	1387233	.	-	0	transcript_id "g282.t1"; gene_id "g282";
Scaffold_1	AUGUSTUS	CDS	1387231	1388199	1	-	0	transcript_id "g282.t1"; gene_id "g282";
Scaffold_1	AUGUSTUS	start_codon	1388197	1388199	.	-	0	transcript_id "g282.t1"; gene_id "g282";
# protein sequence = [MFNVSGTSRPAWQTEELEDEWIEAEAEGGEYEDEDQFNGTRSISFTAPLSTQIHTITNTSSPVSSPEPMGTFLVHQSI
# PSVPLLPKTPGRNKKANIKDFFSPMPLERMFEPPSPPQPSSPQRPPRSPGEDKIDEIMETDIPNMVSFDGRKPSVGCQFTFSAPRDVFLNLDNRPQAE
# STPGNPTVRTTNAPPSTDPPLRLFQFQYDTYTRDHLSAMVDSIAINPALGSGATNSPASLDQGLSRVSEATGISSLNSHLRSAKRVKLSPKSDFLGNG
# NSPRPKLLGKDYVGESRSLMQQIKQARDFSTISTVASAQERDTSDMGA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g282
###
# start gene g283
Scaffold_1	AUGUSTUS	gene	1392167	1392622	0.25	+	.	g283
Scaffold_1	AUGUSTUS	transcript	1392167	1392622	0.25	+	.	g283.t1
Scaffold_1	AUGUSTUS	start_codon	1392167	1392169	.	+	0	transcript_id "g283.t1"; gene_id "g283";
Scaffold_1	AUGUSTUS	CDS	1392167	1392622	0.25	+	0	transcript_id "g283.t1"; gene_id "g283";
Scaffold_1	AUGUSTUS	stop_codon	1392620	1392622	.	+	0	transcript_id "g283.t1"; gene_id "g283";
# protein sequence = [MVHQHGLSFNLKPFSSQDIPIIARDATFLISLAAEEFIKRLCQAGQKAAEKERRTTVQHKDLGEHRLLESISMLFPTN
# NLDPATVVRRADEFMFLDGSSSSQKIHLHSHGPNIHFNSRNYFTQPTRTSETSSKSSGSQWHSVTSWFWANAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g283
###
# start gene g284
Scaffold_1	AUGUSTUS	gene	1395000	1395371	0.52	+	.	g284
Scaffold_1	AUGUSTUS	transcript	1395000	1395371	0.52	+	.	g284.t1
Scaffold_1	AUGUSTUS	start_codon	1395000	1395002	.	+	0	transcript_id "g284.t1"; gene_id "g284";
Scaffold_1	AUGUSTUS	CDS	1395000	1395371	0.52	+	0	transcript_id "g284.t1"; gene_id "g284";
Scaffold_1	AUGUSTUS	stop_codon	1395369	1395371	.	+	0	transcript_id "g284.t1"; gene_id "g284";
# protein sequence = [MNLQGSPANHGLNEIDSQIQASALKAARNSMLLPSDIHFHRTMDAEFSKDLDIFSSRILSVANQVLALMGTADISTKG
# QSKLETEDDVVDNFHSIVVDTMDRMMEKTVRNIPYQVEKSYTSWH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g284
###
# start gene g285
Scaffold_1	AUGUSTUS	gene	1396423	1397157	0.31	+	.	g285
Scaffold_1	AUGUSTUS	transcript	1396423	1397157	0.31	+	.	g285.t1
Scaffold_1	AUGUSTUS	start_codon	1396423	1396425	.	+	0	transcript_id "g285.t1"; gene_id "g285";
Scaffold_1	AUGUSTUS	CDS	1396423	1397157	0.31	+	0	transcript_id "g285.t1"; gene_id "g285";
Scaffold_1	AUGUSTUS	stop_codon	1397155	1397157	.	+	0	transcript_id "g285.t1"; gene_id "g285";
# protein sequence = [MLDYARSDTHFLLYIYDNLRNALLDRAVSPSEDNLEIEGTSYPQAQALLRQVLAKSEVTASRVYEKECYDMERGSGGN
# GWDTLAKKWNKIHLYVNSPSSKQKDIYRSIHMWRDEVAREEDESVRHVSISLVRNINETFELRYILPNHYLIQLAEHPPADMAAMLKIFHFVPPVLKR
# RAKELLNIIREVIERYDTSGEAKSLQDVVVLEAPPDAMVVEQQSSPIPTESLWTLGKWCAIHRYARLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g285
###
# start gene g286
Scaffold_1	AUGUSTUS	gene	1403198	1403644	0.14	+	.	g286
Scaffold_1	AUGUSTUS	transcript	1403198	1403644	0.14	+	.	g286.t1
Scaffold_1	AUGUSTUS	start_codon	1403198	1403200	.	+	0	transcript_id "g286.t1"; gene_id "g286";
Scaffold_1	AUGUSTUS	CDS	1403198	1403644	0.14	+	0	transcript_id "g286.t1"; gene_id "g286";
Scaffold_1	AUGUSTUS	stop_codon	1403642	1403644	.	+	0	transcript_id "g286.t1"; gene_id "g286";
# protein sequence = [MGIVLLDHSTSDILFLLKGADTVMAPLVQRNDWLEEETGNMGREGLRTLVVARKKVGKEVWAAFESEYAVASTSVGGA
# GGGSGDATTDGAVSRAEAQAQVIAKYLEKDMELLGLTGVEDRLQDEVRSTLELMRNAGVKVWMLTGDKVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g286
###
# start gene g287
Scaffold_1	AUGUSTUS	gene	1405868	1406938	0.89	+	.	g287
Scaffold_1	AUGUSTUS	transcript	1405868	1406938	0.89	+	.	g287.t1
Scaffold_1	AUGUSTUS	start_codon	1405868	1405870	.	+	0	transcript_id "g287.t1"; gene_id "g287";
Scaffold_1	AUGUSTUS	CDS	1405868	1406938	0.89	+	0	transcript_id "g287.t1"; gene_id "g287";
Scaffold_1	AUGUSTUS	stop_codon	1406936	1406938	.	+	0	transcript_id "g287.t1"; gene_id "g287";
# protein sequence = [MGQSQSDSNDSRNRRVQTSPLSADILSAGDSTDGRRFLAQPQLTPSGKTTVRSSGLTRRRKAVQRRLSSIVKPKLEPE
# ATSSRARVNEGRQLAQTDIPEASGHRSAWRRSVRFVKSRRWNKASDHKKDDGRERISISDSNATLPISISSPQSSSSNSTVSIPACGSDSVTTSQPPE
# TSVPNSDTAILGSADIPTILTPALSVPPLSGEESSSDPLAVHTESIAALSSPQAAGEMETTDQFAVATAENPIVVASNANSGPTSENVTVLLEPNSTS
# TATATVPVSPARPQFPPSGTLVVVQGVVHTSDVQMPTETSAPLLSQTQNHNPNPTAHHCGSSANHGRFQNGPKGTQLCFIRT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g287
###
# start gene g288
Scaffold_1	AUGUSTUS	gene	1407919	1408569	0.94	+	.	g288
Scaffold_1	AUGUSTUS	transcript	1407919	1408569	0.94	+	.	g288.t1
Scaffold_1	AUGUSTUS	start_codon	1407919	1407921	.	+	0	transcript_id "g288.t1"; gene_id "g288";
Scaffold_1	AUGUSTUS	CDS	1407919	1408569	0.94	+	0	transcript_id "g288.t1"; gene_id "g288";
Scaffold_1	AUGUSTUS	stop_codon	1408567	1408569	.	+	0	transcript_id "g288.t1"; gene_id "g288";
# protein sequence = [MYLLGGDGRTTREHGEPAILETDNSVTSRDERLPRPLREPEPEDDTAEDSIPSLHDVSDSDDDTESNNSQGSSLDSFA
# SVSPADEAAQHPFNVSESPNDPSIPRPRINYWRLHRFPPIPAARAHAAADNVAQNMRSGLGGLTRAATLASTPTSRSVTSTPAGEDSGTGATPSLSRD
# SVVQDSPNTGSANVVVPVIIVGLQSEVLFGRRSQLLPQGI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g288
###
# start gene g289
Scaffold_1	AUGUSTUS	gene	1410549	1412263	0.95	-	.	g289
Scaffold_1	AUGUSTUS	transcript	1410549	1412263	0.95	-	.	g289.t1
Scaffold_1	AUGUSTUS	stop_codon	1410549	1410551	.	-	0	transcript_id "g289.t1"; gene_id "g289";
Scaffold_1	AUGUSTUS	CDS	1410549	1410992	1	-	0	transcript_id "g289.t1"; gene_id "g289";
Scaffold_1	AUGUSTUS	CDS	1411040	1412263	0.95	-	0	transcript_id "g289.t1"; gene_id "g289";
Scaffold_1	AUGUSTUS	start_codon	1412261	1412263	.	-	0	transcript_id "g289.t1"; gene_id "g289";
# protein sequence = [MGFSITQARTALASTDSGQNVQAALDILISNGAIGPGEDYGDEAGSFSGRNNSQNQRTPSPQEEPKPRLRRDRQIIQE
# RQRERNTSSPSELGGLQADKILAQASEIGFSLFNRANAAWKEGKERVQKVYEEKVAATAEGSTSRRGSGRSTPLAMATKPKWMQDNEGLPDTMIDHTK
# KEARPVEKPSFSTHTEVVDLFSDTSSPESSTSQLTSQPSTLSVGSSNGVYVSKFRHAKPKVSDTTSGSASLSPHPITLVSAPESTIALSQESKASGAH
# FYKLGDFPAADTAYTRAIEALPAGHALLIPLYNNRALVRLKVGDVQGVIADTKKVEELIGGVGTVREELRKGDLGKIPVKGSKQGSGDDVVINMPDAL
# IKAWKRRAEAMEGREKWEDAGKDWEKVASAEWAGKAQGGSSHHTPKFKPSPPIRPPSHQVPSIPSQALNALRAANEAAEVEDSHRYRLKDGVDARLQS
# WKGGKENNIRALLASLDTVLWPELGVQKLSMAELLNKGQVKVKYMKCIAKVHPDKLNEGNSTLEQRMIAAGVFGALNEAWNAFKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g289
###
# start gene g290
Scaffold_1	AUGUSTUS	gene	1412404	1413204	0.98	-	.	g290
Scaffold_1	AUGUSTUS	transcript	1412404	1413204	0.98	-	.	g290.t1
Scaffold_1	AUGUSTUS	stop_codon	1412404	1412406	.	-	0	transcript_id "g290.t1"; gene_id "g290";
Scaffold_1	AUGUSTUS	CDS	1412404	1413204	0.98	-	0	transcript_id "g290.t1"; gene_id "g290";
Scaffold_1	AUGUSTUS	start_codon	1413202	1413204	.	-	0	transcript_id "g290.t1"; gene_id "g290";
# protein sequence = [MSDSFADLWNSAVPSKPTPQPQKLGSLSSQSNPPYPRQTQNDLFAQLASRGSSVSNSRSATPPSAIPASSHKGFAKPS
# SQNSNGDAFSGLFGAGSSLASNRSTANMTIAERAALVEKERLERSIQQRQVPNPTHSTAWDGLDSLGSKTFATSPTNSHLPLDHDWTLTAPSVLKSVV
# LPPVLKPEDDWGLANLANTSAPATTSKPSHSGAVWDLDEFSTLDSTSRGLGPGKWDGVTANDGPDDILGDLSRPIEAIQRENMKTVVVMS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g290
###
# start gene g291
Scaffold_1	AUGUSTUS	gene	1415446	1416195	0.98	+	.	g291
Scaffold_1	AUGUSTUS	transcript	1415446	1416195	0.98	+	.	g291.t1
Scaffold_1	AUGUSTUS	start_codon	1415446	1415448	.	+	0	transcript_id "g291.t1"; gene_id "g291";
Scaffold_1	AUGUSTUS	CDS	1415446	1416195	0.98	+	0	transcript_id "g291.t1"; gene_id "g291";
Scaffold_1	AUGUSTUS	stop_codon	1416193	1416195	.	+	0	transcript_id "g291.t1"; gene_id "g291";
# protein sequence = [MPINRLKPKNPPLPNNGDAIPILDKLRYDDVHAKAFQQVFGKTCVCKDLTVAAAYVKSHGINTITLDGDKVDRKGALT
# GGFHDIRRSRIEAIKAVTSWRTKYEEDTKKSKETKTAIVEYDQKITQLAGKMSVLSAQQNQIREARERLLAEGVMLTKEKEKLSGRLGKLEIDVQELE
# AELASLQTKHTGYEAELKTPMMQSLSAEEQKLIETLGVEVEQKRRELVELAKAKTSVSILYGSPCTALNFDFV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g291
###
# start gene g292
Scaffold_1	AUGUSTUS	gene	1419752	1420078	0.6	-	.	g292
Scaffold_1	AUGUSTUS	transcript	1419752	1420078	0.6	-	.	g292.t1
Scaffold_1	AUGUSTUS	stop_codon	1419752	1419754	.	-	0	transcript_id "g292.t1"; gene_id "g292";
Scaffold_1	AUGUSTUS	CDS	1419752	1420078	0.6	-	0	transcript_id "g292.t1"; gene_id "g292";
Scaffold_1	AUGUSTUS	start_codon	1420076	1420078	.	-	0	transcript_id "g292.t1"; gene_id "g292";
# protein sequence = [MKDNPHAEWEMSHTAVLERLKGENQALLKRLIDIEAVLKEAGAAASQASETKSDVSVSTLVPRESLDIAVKDKEDLED
# VLKQKEKRLLRLQQVIYPFKYFHNRIKHMQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g292
###
# start gene g293
Scaffold_1	AUGUSTUS	gene	1420655	1421984	0.65	-	.	g293
Scaffold_1	AUGUSTUS	transcript	1420655	1421984	0.65	-	.	g293.t1
Scaffold_1	AUGUSTUS	stop_codon	1420655	1420657	.	-	0	transcript_id "g293.t1"; gene_id "g293";
Scaffold_1	AUGUSTUS	CDS	1420655	1421789	1	-	1	transcript_id "g293.t1"; gene_id "g293";
Scaffold_1	AUGUSTUS	CDS	1421887	1421984	0.65	-	0	transcript_id "g293.t1"; gene_id "g293";
Scaffold_1	AUGUSTUS	start_codon	1421982	1421984	.	-	0	transcript_id "g293.t1"; gene_id "g293";
# protein sequence = [MSTTSNSSSLFTSSSTSKSHSNNISASTSGSSSDVESYPDSSLPNTKRHLRTTINNNLNAAAVERKLAILQTNCAELE
# KKVREKDQRLDLLEKDRRWLNDRETEEREAREREGKEAREREVKLKNELAAAKISLSNLEVSHAELQDAHSKLERSRNHEVSLLKTQLEETQKQAMFL
# EARVEEEKNAAKIAASNIASASSSTPSLSQSTSSIPDTDNRLLTAELKRQATYLRQLESTNTRLNADVVVLKSDNAILRDRNATVEVLKEEKRGLESR
# LKMKEVEVEKLVREVVRRDHRSSSSKRSSLPLNPSTLATHLGLDQDDVDASVGVNDSLKDLPHPTVKEISELAALRLEHAALLDQHGTTLSELAALRG
# EKEALLQQTSSRGNLAVPEVHSQNIIVRIDDYLLHIRH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g293
###
# start gene g294
Scaffold_1	AUGUSTUS	gene	1427055	1429595	0.24	+	.	g294
Scaffold_1	AUGUSTUS	transcript	1427055	1429595	0.24	+	.	g294.t1
Scaffold_1	AUGUSTUS	start_codon	1427055	1427057	.	+	0	transcript_id "g294.t1"; gene_id "g294";
Scaffold_1	AUGUSTUS	CDS	1427055	1427215	0.67	+	0	transcript_id "g294.t1"; gene_id "g294";
Scaffold_1	AUGUSTUS	CDS	1427361	1427944	0.74	+	1	transcript_id "g294.t1"; gene_id "g294";
Scaffold_1	AUGUSTUS	CDS	1428039	1428221	0.4	+	2	transcript_id "g294.t1"; gene_id "g294";
Scaffold_1	AUGUSTUS	CDS	1428526	1429595	0.87	+	2	transcript_id "g294.t1"; gene_id "g294";
Scaffold_1	AUGUSTUS	stop_codon	1429593	1429595	.	+	0	transcript_id "g294.t1"; gene_id "g294";
# protein sequence = [MKPLLPLIYFSALLFSLLVSPVDAVHSSTEHSFARRSMSHAKRRTVLGSSSSSFGVGDLLGATSTTTSSSPTSASSAP
# TASTSTAGSSPAPVASSSSSSDSSSSSSSSSSTNVNSVSPSSSSSSTSSSASSSASPTSSSSSSTSSSTSSTVFSNSLPTTSVLDATSTTAVPSTSVV
# SATSSDSGLLPSILSSLLPSVTLPSTTTSAAESDSTTAASTSPVDSDPTIAASTTSAADSDTATSTASTTDPASTTGATDTDSVVTSPTASSTTVLSA
# TSTTDPGLLSSVLSSLLPSVTLFPSTVSSVADTSSIALPQPSTSGDTTTATSGSLSLSLPVSIPTISATTSDSALPSSIISSLSSVSTSTTDTSPNSL
# STTVSGSQSSFSASTIDSASITSSTDSASDTTTTGSASIFSTTGSASVSSTTGSASISSTTGSVSVSSTTGSDSASVTSSTGSASILSSTGSASVTAN
# STSIPASVSQSSFSVSGSTTVSLSASSTVTISFPSGSVSSTATVNGTTTVVSTSVTTALTVVSVPSDLSFVLTQTTLEVASVSSSATSQTLSNPDQAT
# TTFSQTTLSASAPLATAALPSSLPYRILPQDQLASNEDLSGYTLVSLLFDLQLNWPFVVSSPDSSSQLFAYMPVILQNSLGLTGLSLLRFKNSNINA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g294
###
# start gene g295
Scaffold_1	AUGUSTUS	gene	1429691	1430170	0.88	+	.	g295
Scaffold_1	AUGUSTUS	transcript	1429691	1430170	0.88	+	.	g295.t1
Scaffold_1	AUGUSTUS	start_codon	1429691	1429693	.	+	0	transcript_id "g295.t1"; gene_id "g295";
Scaffold_1	AUGUSTUS	CDS	1429691	1430170	0.88	+	0	transcript_id "g295.t1"; gene_id "g295";
Scaffold_1	AUGUSTUS	stop_codon	1430168	1430170	.	+	0	transcript_id "g295.t1"; gene_id "g295";
# protein sequence = [MYLVYIPSSSVSNLQDQIKAQQSAFYTGVDNSVAQQLASLVNSGWNLLSIAAPDDSGSTGSSSSDSDTGASSSDNKSK
# EDAIIGVTASLGGIAICVLGFLIYRSYKRRKELAHRRLSEPTGTAGYRPEGREFDQDSVGGQRRRSFYFAEDSLRDIKVTE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g295
###
# start gene g296
Scaffold_1	AUGUSTUS	gene	1431340	1431804	0.77	+	.	g296
Scaffold_1	AUGUSTUS	transcript	1431340	1431804	0.77	+	.	g296.t1
Scaffold_1	AUGUSTUS	start_codon	1431340	1431342	.	+	0	transcript_id "g296.t1"; gene_id "g296";
Scaffold_1	AUGUSTUS	CDS	1431340	1431804	0.77	+	0	transcript_id "g296.t1"; gene_id "g296";
Scaffold_1	AUGUSTUS	stop_codon	1431802	1431804	.	+	0	transcript_id "g296.t1"; gene_id "g296";
# protein sequence = [MLNLSECILIFRSKFWDAHNIRLKSCHLSHRRGILSILGLSDSPDLTRNHVQKAFLQWDADAFEEKAAESGMCAFVSR
# TFEEWDRHPQGLALKNVPPVIVTKIADAPKRQISFLSSYEHPLQNVKVLDVSRVLAGPVAGRTLAGQTYAFYTGFI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g296
###
# start gene g297
Scaffold_1	AUGUSTUS	gene	1432847	1434443	0.91	-	.	g297
Scaffold_1	AUGUSTUS	transcript	1432847	1434443	0.91	-	.	g297.t1
Scaffold_1	AUGUSTUS	stop_codon	1432847	1432849	.	-	0	transcript_id "g297.t1"; gene_id "g297";
Scaffold_1	AUGUSTUS	CDS	1432847	1433717	0.97	-	1	transcript_id "g297.t1"; gene_id "g297";
Scaffold_1	AUGUSTUS	CDS	1433780	1433921	0.91	-	2	transcript_id "g297.t1"; gene_id "g297";
Scaffold_1	AUGUSTUS	CDS	1434011	1434443	0.96	-	0	transcript_id "g297.t1"; gene_id "g297";
Scaffold_1	AUGUSTUS	start_codon	1434441	1434443	.	-	0	transcript_id "g297.t1"; gene_id "g297";
# protein sequence = [MQTSLGNDRTAHIIESLHAILKPFLLRRLKSDVETSLPPKKEYVLYAPLSITQREAYDKVLDGTLRAYLMQSKEENKG
# ADELLPEVDGPRKLRTQTNKGRPSYLVEEDDDVYFKNLETGENERQQAEREADLTQLRETHRKDLALMQLRKVCSHPFLFDWPVDPTTLQPILNDELV
# AASGKMMVLDRLLTELGKFHAVNTSSTIMAHSLPSQDWARELKGWIICRIDGSSSPVERREQMSAFQTGGDSPGAPHLFLLSTRAGGLGINLVAADTV
# IFYDQDWVCSHSSILLSISERPSKNPQMDAQAQDRAHRIGQTKPVLIYRLVSAHTIETKIMQRATEKRQLEALVIAKGHSFWVLSLMAFSYSFLGKFR
# MPSAAAQRGGKSETIAEMAASLLRLEGEKIDVVPNTNEGKANVLTDEDLDSLLDRSPEVFTDRGKGWTSANPPGKSVVESSKKAAFAVYDAPADEGND
# ALAMMLGEDDS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g297
###
# start gene g298
Scaffold_1	AUGUSTUS	gene	1443349	1444041	0.91	+	.	g298
Scaffold_1	AUGUSTUS	transcript	1443349	1444041	0.91	+	.	g298.t1
Scaffold_1	AUGUSTUS	start_codon	1443349	1443351	.	+	0	transcript_id "g298.t1"; gene_id "g298";
Scaffold_1	AUGUSTUS	CDS	1443349	1444041	0.91	+	0	transcript_id "g298.t1"; gene_id "g298";
Scaffold_1	AUGUSTUS	stop_codon	1444039	1444041	.	+	0	transcript_id "g298.t1"; gene_id "g298";
# protein sequence = [MPPVPPAISLLIFGFALPVALLDVDEPNFGVTNGGNGHGLAHYQATRHPVAVKLGTITPEGNADIYCYLCDDSKLDPS
# LSNHLAIFGINLSAQTKTELSVTEMQIEHNLKYDFSLTNEDGKALEPIHGKGLTGLRNLGNSCYMASVLQTIFALPEFKERYYALESARAQDHAEICP
# EPLPADCVECQMRKIADGLLSGRYTNPALPISMLHPMLELLILVGSSPHLNSGC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g298
###
# start gene g299
Scaffold_1	AUGUSTUS	gene	1450139	1451224	0.68	-	.	g299
Scaffold_1	AUGUSTUS	transcript	1450139	1451224	0.68	-	.	g299.t1
Scaffold_1	AUGUSTUS	stop_codon	1450139	1450141	.	-	0	transcript_id "g299.t1"; gene_id "g299";
Scaffold_1	AUGUSTUS	CDS	1450139	1451224	0.68	-	0	transcript_id "g299.t1"; gene_id "g299";
Scaffold_1	AUGUSTUS	start_codon	1451222	1451224	.	-	0	transcript_id "g299.t1"; gene_id "g299";
# protein sequence = [MSNKSTIAFIDRPKDAPRPDLFPVTLVWQDEQTLLLAWADFIKVARVRTRETGFMVEVIKVFQLDSMIAGIMPHPMPI
# AIASAPGSRPQSIVSTTSSSRSNNTNGLLKPNSSQPNNPPPLTSFLLLTFSPPETALLDLDVLLTSDTDRTKQAKALSERPELRIISRGGEELAADAL
# SVSGYQAWTCGDYKLAGPISADAELARTLDPASAKSPTVNLTDWYVVLSPRDLILVRPRDEHDHVAWLVERERYGEALEALEVIEHSLGSSKKNEEGD
# SANGFSEKVVNGVKLTSVDVGQKLAESLISEGESVSFIDYLFTHFYHRTLGSFPKAAELLPKICVRDPKRWEDWIFVFAEKRQLQVC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g299
###
# start gene g300
Scaffold_1	AUGUSTUS	gene	1451717	1452028	0.73	-	.	g300
Scaffold_1	AUGUSTUS	transcript	1451717	1452028	0.73	-	.	g300.t1
Scaffold_1	AUGUSTUS	stop_codon	1451717	1451719	.	-	0	transcript_id "g300.t1"; gene_id "g300";
Scaffold_1	AUGUSTUS	CDS	1451717	1452028	0.73	-	0	transcript_id "g300.t1"; gene_id "g300";
Scaffold_1	AUGUSTUS	start_codon	1452026	1452028	.	-	0	transcript_id "g300.t1"; gene_id "g300";
# protein sequence = [MSTTADTEVNTTREEADSSVTHVDGQEHEVVNSETEKDVSSSEESVEELQDDSEGVEQDSDEEEEEEEEEEGEEEEPA
# LKYERIGGATCTAEEGLSLRAGYIE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g300
###
# start gene g301
Scaffold_1	AUGUSTUS	gene	1452298	1452999	0.58	-	.	g301
Scaffold_1	AUGUSTUS	transcript	1452298	1452999	0.58	-	.	g301.t1
Scaffold_1	AUGUSTUS	stop_codon	1452298	1452300	.	-	0	transcript_id "g301.t1"; gene_id "g301";
Scaffold_1	AUGUSTUS	CDS	1452298	1452999	0.58	-	0	transcript_id "g301.t1"; gene_id "g301";
Scaffold_1	AUGUSTUS	start_codon	1452997	1452999	.	-	0	transcript_id "g301.t1"; gene_id "g301";
# protein sequence = [MTTQAAASGLSASSSPFFSTPPPPLPSHSKALSESLPPPRSDYPTPPPSESPCESPTRIPTFNYYGNSLNKLLASHLD
# DLPPNAPSVLYEPQARSIGKMKMKTHSLPATLANMMEVEVEEGITFGSLESGPSIEVQSEEGQGSNGITLVASAEEDIIMRDNVSESGSTVSVNVVNR
# SKQGRESSRNALAEGVMDPDAKVESELCPEEVGVQNEEFTDDEDYVLNHYDLVYPSD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g301
###
# start gene g302
Scaffold_1	AUGUSTUS	gene	1460159	1462485	0.38	-	.	g302
Scaffold_1	AUGUSTUS	transcript	1460159	1462485	0.38	-	.	g302.t1
Scaffold_1	AUGUSTUS	stop_codon	1460159	1460161	.	-	0	transcript_id "g302.t1"; gene_id "g302";
Scaffold_1	AUGUSTUS	CDS	1460159	1460449	0.58	-	0	transcript_id "g302.t1"; gene_id "g302";
Scaffold_1	AUGUSTUS	CDS	1460560	1462485	0.38	-	0	transcript_id "g302.t1"; gene_id "g302";
Scaffold_1	AUGUSTUS	start_codon	1462483	1462485	.	-	0	transcript_id "g302.t1"; gene_id "g302";
# protein sequence = [MSRPSSTMKFLQLSPRQQKNLNNTLTHSSLRHPFSDPRPNLQRSSTLRRHQTGGRWVSEDMSVASSHRTDGEADEDYE
# DVPNPQGRRQTLRTGGSADSALTVGVGRSLVGEGLKAAGLKGGGAVGRRGDIFDENTPLREKVIRDRERAQRLERIERSISRTGIRSQSRLGWEHEND
# EDEGHFSNIRSRGNGSDIRTRAGTVVGPRASTSMAIRDREREGVGGEPEPRTAPPHLRSYKSSYDLVLSQEALSRHEIDLGRETAQDREDRAPSSLNR
# HVPSPFGSTRRSIPNLLSNDGEVSHLNIPRSNHNRLLHDSLHMFETHVTRLPSTSSATTSDLLRNAQNIAGAAEKLNLMTRVAMTKALDAQINAEVDG
# GTSDEAADIWRTVGADYRDQMRVSDELVRSVTDFLLGVGRAVKDMTGGGDSHGRSVSLDEVGGRLTRNSLGSDGGSTGSGRRSEESRRSWGDDVKRLS
# TGPKRSESALSGRPSSVLNARDHETPISLRSRQSNESTNVSRAQESGRGNLVTFDSQETLHAVAFDPSPTPASRAQLNRNQERPGATLDRARTLPPLS
# IPKPLAQLPSESLTRRQTQTPASSTRHRPTTGSNTVRGPFPLSSPNIPTTALTPHTVSNSQRQDFPYFVLIQARQRQRKRTQSNSSASGAESAERVSR
# VTRTESGSETERGPARTIGRQGDRSRMSLDGSRTLNGNVHPADRSAATSILPISKPRERRKTVVDMWPRAGS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g302
###
# start gene g303
Scaffold_1	AUGUSTUS	gene	1462741	1463373	0.95	-	.	g303
Scaffold_1	AUGUSTUS	transcript	1462741	1463373	0.95	-	.	g303.t1
Scaffold_1	AUGUSTUS	stop_codon	1462741	1462743	.	-	0	transcript_id "g303.t1"; gene_id "g303";
Scaffold_1	AUGUSTUS	CDS	1462741	1463373	0.95	-	0	transcript_id "g303.t1"; gene_id "g303";
Scaffold_1	AUGUSTUS	start_codon	1463371	1463373	.	-	0	transcript_id "g303.t1"; gene_id "g303";
# protein sequence = [MINASNLKAFHAAFTDDPPNDDDDDDNNYNGNGEDDTARLNRRHSLKSVSVNENTMAIQRALTLKERTRLTIDKLSSY
# SRNTPSPSAHTRSSDSSSSTSRHRFLEQHHSGSETERELIDSDARPSTPKLHRTRLVSAPASPGKALLSIKQSNSTSSSSSESPARSRKRVSMAASDF
# AEVTSEEGCVHPMNIKFLKHPDDFLMLHKLRLRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g303
###
# start gene g304
Scaffold_1	AUGUSTUS	gene	1466233	1467132	0.98	+	.	g304
Scaffold_1	AUGUSTUS	transcript	1466233	1467132	0.98	+	.	g304.t1
Scaffold_1	AUGUSTUS	start_codon	1466233	1466235	.	+	0	transcript_id "g304.t1"; gene_id "g304";
Scaffold_1	AUGUSTUS	CDS	1466233	1467132	0.98	+	0	transcript_id "g304.t1"; gene_id "g304";
Scaffold_1	AUGUSTUS	stop_codon	1467130	1467132	.	+	0	transcript_id "g304.t1"; gene_id "g304";
# protein sequence = [MESEVQNFEESILFFADAFQIHGPGSRRASPVTLNSDSAVDSEAATPSLTPGSSATSSRASSFAFDSSRRPSFVGRLS
# SALMMSTVPEADIVDQYDPDFEDPCMVEDHLSAVEDQWIEKSKIHQLEAWQIEAAAVDRSVRILPGVKKMIDSIPAGRYAVATSGAKTYGSYGSFVKR
# RIFDSNYFLFVFIAYGCMTRVGIIPPPVTITADDKRLKAGKPAPDPFLLAASCLGYDPKKCVVFEDSPSGIRAGVASGATVIAVCTSHERSKIENCGA
# HFVVENMEKVKCELVDEQLHFTILQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g304
###
# start gene g305
Scaffold_1	AUGUSTUS	gene	1477416	1477799	0.81	+	.	g305
Scaffold_1	AUGUSTUS	transcript	1477416	1477799	0.81	+	.	g305.t1
Scaffold_1	AUGUSTUS	start_codon	1477416	1477418	.	+	0	transcript_id "g305.t1"; gene_id "g305";
Scaffold_1	AUGUSTUS	CDS	1477416	1477799	0.81	+	0	transcript_id "g305.t1"; gene_id "g305";
Scaffold_1	AUGUSTUS	stop_codon	1477797	1477799	.	+	0	transcript_id "g305.t1"; gene_id "g305";
# protein sequence = [MSTPSVKLSLDNRWKPKLHSAQAHFHSASQEDFELDESAPFRAIRSESSGNRLDEDLSRIRLNSVEEVEERTEDLEKA
# MDGKPETWGEPFKVEWLCTDRLPFFSNPSSSKSLESRSRGQGFERRNRN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g305
###
# start gene g306
Scaffold_1	AUGUSTUS	gene	1478543	1478860	0.87	-	.	g306
Scaffold_1	AUGUSTUS	transcript	1478543	1478860	0.87	-	.	g306.t1
Scaffold_1	AUGUSTUS	stop_codon	1478543	1478545	.	-	0	transcript_id "g306.t1"; gene_id "g306";
Scaffold_1	AUGUSTUS	CDS	1478543	1478860	0.87	-	0	transcript_id "g306.t1"; gene_id "g306";
Scaffold_1	AUGUSTUS	start_codon	1478858	1478860	.	-	0	transcript_id "g306.t1"; gene_id "g306";
# protein sequence = [MLITTDWLDPSDDHIMNTSAEALLKWAEDEAKRRGLFSPFIYMNYASGSEAVMVRSTDGQTLKKMIQVKKMYDPQGDL
# DKLWHGGFKLPQTEEHGPVTNYDRSEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g306
###
# start gene g307
Scaffold_1	AUGUSTUS	gene	1478892	1479452	0.38	-	.	g307
Scaffold_1	AUGUSTUS	transcript	1478892	1479452	0.38	-	.	g307.t1
Scaffold_1	AUGUSTUS	stop_codon	1478892	1478894	.	-	0	transcript_id "g307.t1"; gene_id "g307";
Scaffold_1	AUGUSTUS	CDS	1478892	1479452	0.38	-	0	transcript_id "g307.t1"; gene_id "g307";
Scaffold_1	AUGUSTUS	start_codon	1479450	1479452	.	-	0	transcript_id "g307.t1"; gene_id "g307";
# protein sequence = [MFTFSQGPVWGGSQFFAIKDAPNLLERLVTFTEKLAEDPKGFFGLSLAWNPEAKDYIIWTLQTYLKPEAYPALWSGFE
# SLTPLVDMMGIKNLTDITEEFQEADPGKHGRSRWLTMTYKANAQFHLDLYARGVELFEPYHGHAGVHWAVSVQPVPARLASAGIENGGNPTCLKESEG
# NLWGQYPQKT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g307
###
# start gene g308
Scaffold_1	AUGUSTUS	gene	1481322	1481633	0.52	-	.	g308
Scaffold_1	AUGUSTUS	transcript	1481322	1481633	0.52	-	.	g308.t1
Scaffold_1	AUGUSTUS	stop_codon	1481322	1481324	.	-	0	transcript_id "g308.t1"; gene_id "g308";
Scaffold_1	AUGUSTUS	CDS	1481322	1481633	0.52	-	0	transcript_id "g308.t1"; gene_id "g308";
Scaffold_1	AUGUSTUS	start_codon	1481631	1481633	.	-	0	transcript_id "g308.t1"; gene_id "g308";
# protein sequence = [MVVTKPHNSAASLSKPFKAPSMNGRGSLAIAAPMKVISSSSSRSSEQCQPQNGPPSRGAKNGEARLELEKDSIFGAEL
# GSDSSVTSSQDMAKNSDGELCHLIF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g308
###
# start gene g309
Scaffold_1	AUGUSTUS	gene	1487134	1487583	0.64	-	.	g309
Scaffold_1	AUGUSTUS	transcript	1487134	1487583	0.64	-	.	g309.t1
Scaffold_1	AUGUSTUS	stop_codon	1487134	1487136	.	-	0	transcript_id "g309.t1"; gene_id "g309";
Scaffold_1	AUGUSTUS	CDS	1487134	1487583	0.64	-	0	transcript_id "g309.t1"; gene_id "g309";
Scaffold_1	AUGUSTUS	start_codon	1487581	1487583	.	-	0	transcript_id "g309.t1"; gene_id "g309";
# protein sequence = [MIQVTVVSSSAAHLDDIGMPQEHTWDVEKFVELHLIKRKVLSLMHSASGPLQAKLHEISSDLEDAAASHLPQANESVK
# MARGDEVNTARKQHGPKKRLNQSDDEENGVAPRKKPKMREEDQDQDDDNSSVGSAIFVKRVAPKKRNHLPQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g309
###
# start gene g310
Scaffold_1	AUGUSTUS	gene	1488699	1490124	0.75	+	.	g310
Scaffold_1	AUGUSTUS	transcript	1488699	1490124	0.75	+	.	g310.t1
Scaffold_1	AUGUSTUS	start_codon	1488699	1488701	.	+	0	transcript_id "g310.t1"; gene_id "g310";
Scaffold_1	AUGUSTUS	CDS	1488699	1489345	0.88	+	0	transcript_id "g310.t1"; gene_id "g310";
Scaffold_1	AUGUSTUS	CDS	1489422	1490124	0.85	+	1	transcript_id "g310.t1"; gene_id "g310";
Scaffold_1	AUGUSTUS	stop_codon	1490122	1490124	.	+	0	transcript_id "g310.t1"; gene_id "g310";
# protein sequence = [MPNQTIGNAGIPFLTMSSTKSKSDRKSALKNVAPALATNKRSQIKEAPSVVEKEEDEIDLETDESEGSEDDGGIDDEG
# IERLMKALGDDGLDEFEQAQLEAALGDPEDESEEEDGEDANTEEENSDQDEEVEEVENDGTEGGEEDDQFIQLEDVEAIVDDAVPFQKVEINNEIALA
# RIRESLQLDPSIPWTETLAVSYPHTIDVDVNDDLNRELAFASHAHQIATKSYPNFPWTRPSDYFAEMVKSDVHMERIRQRLLDEKAGIKKSEEKRKER
# EGKKFGKQVQIEKLKDRERGKKEMEERLKGLKRSELAKISPTDVYSYFHSPERKDILDNPDGNDDAFDVAVEDAISDRPAKRGRGGPAGGSRLSRQGR
# DKKFGFGGAGRRSKQNTSASTDDFDSRSRKGSGGGGRGGRGTRGGGRGGRGGGGGRGGGRGGSKRLGKSKRMDARSK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g310
###
# start gene g311
Scaffold_1	AUGUSTUS	gene	1491108	1491902	0.21	-	.	g311
Scaffold_1	AUGUSTUS	transcript	1491108	1491902	0.21	-	.	g311.t1
Scaffold_1	AUGUSTUS	stop_codon	1491108	1491110	.	-	0	transcript_id "g311.t1"; gene_id "g311";
Scaffold_1	AUGUSTUS	CDS	1491108	1491902	0.21	-	0	transcript_id "g311.t1"; gene_id "g311";
Scaffold_1	AUGUSTUS	start_codon	1491900	1491902	.	-	0	transcript_id "g311.t1"; gene_id "g311";
# protein sequence = [MFLGRMVFFRLHESPRYLVHAGRPQEALESLQMISKFNGSDLSLALEDVDDQKPQTPSSPRDCDNSEQHGEDSVPFLP
# HKSLDGAGDDADSQHANSNEDLRKTGDTIFDAGITHYSSTGESSTPLGAHVFATPTVEYALPPSLTREISDLANAKFDANSEPDGPTPTVDQSSHVTV
# DVDSVPRHRPLTHARRRSHRLSRRASSIYERKVCRMLPHWLRRPIWAWWDRVMLVLAPEWLSTTLLVWAAWWAMSLGVLVVDPYKTQQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g311
###
# start gene g312
Scaffold_1	AUGUSTUS	gene	1494277	1496066	0.37	-	.	g312
Scaffold_1	AUGUSTUS	transcript	1494277	1496066	0.37	-	.	g312.t1
Scaffold_1	AUGUSTUS	stop_codon	1494277	1494279	.	-	0	transcript_id "g312.t1"; gene_id "g312";
Scaffold_1	AUGUSTUS	CDS	1494277	1495032	0.72	-	0	transcript_id "g312.t1"; gene_id "g312";
Scaffold_1	AUGUSTUS	CDS	1495110	1495652	0.41	-	0	transcript_id "g312.t1"; gene_id "g312";
Scaffold_1	AUGUSTUS	CDS	1496037	1496066	0.53	-	0	transcript_id "g312.t1"; gene_id "g312";
Scaffold_1	AUGUSTUS	start_codon	1496064	1496066	.	-	0	transcript_id "g312.t1"; gene_id "g312";
# protein sequence = [MLVPITTGSSSRPRRSSSHSRHSSRSISAHLILTNERLTQANARNIALETQKEELLVRFVALAKDKASVEADLRTTQE
# SLQLYQAQLDLAQKEVNRATDVVRKVDQARVQAENEVARLRSRVRQLETEKSTRRGWEEGWDIGFQEGIERAQAETSLMDRFVPRRRRSSTRMRDGET
# DDGGGEADDSTASSSLISTRNRKPFIPEDDSYVVSPVSSGAQPAQQSPLLSRTRQRARSIASRLRSRSPPSSEPHPSRPQSRSSRAQTYVSSTNQSQT
# SSPEVIHPLPIPRPPSSLSHHSLVPPDNYIPTMTPTDHFIPMPPPHELSNPVPSATQAPSEPDTVREQFANQRELGRNSWRSRAASTGSRASTRISEY
# DLVSPPTRERAEAPQPPPNFDVDRGSSPTGDTGSRRMVEEWRDIVTTPPPNRGEPDGESRPEPEVGHTSF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g312
###
# start gene g313
Scaffold_1	AUGUSTUS	gene	1496615	1497100	0.57	+	.	g313
Scaffold_1	AUGUSTUS	transcript	1496615	1497100	0.57	+	.	g313.t1
Scaffold_1	AUGUSTUS	start_codon	1496615	1496617	.	+	0	transcript_id "g313.t1"; gene_id "g313";
Scaffold_1	AUGUSTUS	CDS	1496615	1497100	0.57	+	0	transcript_id "g313.t1"; gene_id "g313";
Scaffold_1	AUGUSTUS	stop_codon	1497098	1497100	.	+	0	transcript_id "g313.t1"; gene_id "g313";
# protein sequence = [MATPIRKKRNFKALQLTTAPAPQIADTAAQPIPTRQAPPASGKKRPPPMTLKAPKLPPSTTSATIEDGNLLTVQSSST
# SAPNTAVTPSAKRNTYHTTLSNTSILDSNAEVKYDLRNEDLKDLQELGQGNGGSVKKVEHTPTGHNNGEKGSYLQRDFKQIFH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g313
###
# start gene g314
Scaffold_1	AUGUSTUS	gene	1499607	1501357	0.22	-	.	g314
Scaffold_1	AUGUSTUS	transcript	1499607	1501357	0.22	-	.	g314.t1
Scaffold_1	AUGUSTUS	stop_codon	1499607	1499609	.	-	0	transcript_id "g314.t1"; gene_id "g314";
Scaffold_1	AUGUSTUS	CDS	1499607	1500468	1	-	1	transcript_id "g314.t1"; gene_id "g314";
Scaffold_1	AUGUSTUS	CDS	1501080	1501357	0.22	-	0	transcript_id "g314.t1"; gene_id "g314";
Scaffold_1	AUGUSTUS	start_codon	1501355	1501357	.	-	0	transcript_id "g314.t1"; gene_id "g314";
# protein sequence = [MIDPSEVSVLSDFHFESAEGKSTSGFIGAQTPRSSFTSAIPASLATDPATLGAHEETLQIQTAHFTDTYGQFLLELGI
# NDLPPLFNIVHIYSHREEFYSTEIDFVASPKGYNFQDAQAISPYLEHPKKGPTSQFCSELAGRLKCYVFAGYPERLTDEEAPLSKEESTSEAGNSQTV
# GANSAVLYGPNGEWVGHYRKTNLFVTDKSWAKPGELDIHLWGGVHLLYDFSIGTGFATFLLPSPLRTLSFGICNDLNVSDSDIWTPEDGPYEIADYAL
# SQNANILVLLNAWLDSGKEEFEDTDWDTLNYWAARLRPLWVNNLAGPNTSKIVEEDNENANGKEMIVVVCNRTGEENGNSLFLVLVDIFITVHRRKDI
# RRLLRNI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g314
###
# start gene g315
Scaffold_1	AUGUSTUS	gene	1502901	1503605	0.65	-	.	g315
Scaffold_1	AUGUSTUS	transcript	1502901	1503605	0.65	-	.	g315.t1
Scaffold_1	AUGUSTUS	stop_codon	1502901	1502903	.	-	0	transcript_id "g315.t1"; gene_id "g315";
Scaffold_1	AUGUSTUS	CDS	1502901	1503605	0.65	-	0	transcript_id "g315.t1"; gene_id "g315";
Scaffold_1	AUGUSTUS	start_codon	1503603	1503605	.	-	0	transcript_id "g315.t1"; gene_id "g315";
# protein sequence = [MGDESSLTLGNPSSQLFGSSPSDTNMSGEDSSSDDDDVNEETFKKITLGHSNVRHFGKSSNMRFIHDIITNATKNNQP
# LDFTQHDLYLARFKRPEYWGLDMVSNMLRAFIFDLIMAQWKFQPEIAAPIYTFPEIDLLWDLLRIYFTEVAPYFPLLHRPTFEKAVINGRHLLDHSFG
# ALLLAVCAVAARDSQDPRILKQDTKITAGWQWFSQIRLVRPNFVEPTSIHELQLYCVG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g315
###
# start gene g316
Scaffold_1	AUGUSTUS	gene	1511692	1512150	0.51	+	.	g316
Scaffold_1	AUGUSTUS	transcript	1511692	1512150	0.51	+	.	g316.t1
Scaffold_1	AUGUSTUS	start_codon	1511692	1511694	.	+	0	transcript_id "g316.t1"; gene_id "g316";
Scaffold_1	AUGUSTUS	CDS	1511692	1511703	0.51	+	0	transcript_id "g316.t1"; gene_id "g316";
Scaffold_1	AUGUSTUS	CDS	1511761	1512150	0.65	+	0	transcript_id "g316.t1"; gene_id "g316";
Scaffold_1	AUGUSTUS	stop_codon	1512148	1512150	.	+	0	transcript_id "g316.t1"; gene_id "g316";
# protein sequence = [MLETDIWIAVTPQVHETIVIDLSSEGEDEELEENPHQELESHNAQVKELETELIRAKKKASQKLPSLTEQLNYADSRL
# ESFMQHGHRVDHTNDTHSQLVEFEEKKQLKQENERLHKEITGKPKIPMLSLSLFF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g316
###
# start gene g317
Scaffold_1	AUGUSTUS	gene	1512949	1514172	0.8	-	.	g317
Scaffold_1	AUGUSTUS	transcript	1512949	1514172	0.8	-	.	g317.t1
Scaffold_1	AUGUSTUS	stop_codon	1512949	1512951	.	-	0	transcript_id "g317.t1"; gene_id "g317";
Scaffold_1	AUGUSTUS	CDS	1512949	1514172	0.8	-	0	transcript_id "g317.t1"; gene_id "g317";
Scaffold_1	AUGUSTUS	start_codon	1514170	1514172	.	-	0	transcript_id "g317.t1"; gene_id "g317";
# protein sequence = [MDYKFGGKYLLEQEIANGGCGTVFLGTHHIAGKQVAIKLEPATEGRQSMRRSKSQPELQSKSKKQTIDPYPGLSPLTL
# ESQIYKRLMGAPGVPFLLHSGKSGPYNVLVMDLLGPSLEDLSRRCGRRFSLKTTCMLAVQCLDRLEYVHSRGVLHRDVKPANFVMSRTTPSIVNIIDF
# GLAKRYRQPLNGEHIPYSQHPDALHGVGTSLYASLNTHFGVETGRRDDLESLAYMLIGFVRGGLPWRKVRATVDPPPNWPSKEWNPITQTWNLIREEK
# VKAEVALLSTSKDRRQHNHAPTSSSDPATLLAGLPEEFGVLYRYARTLQFTDLPDYEGLRQLFRGLAEREGFLDADGEYDGVWDWHGVDIPAPLASSS
# ASAVHGQGRFCEACNKRAAEAAGVGSLGKRRKEWV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g317
###
# start gene g318
Scaffold_1	AUGUSTUS	gene	1515854	1516300	0.52	+	.	g318
Scaffold_1	AUGUSTUS	transcript	1515854	1516300	0.52	+	.	g318.t1
Scaffold_1	AUGUSTUS	start_codon	1515854	1515856	.	+	0	transcript_id "g318.t1"; gene_id "g318";
Scaffold_1	AUGUSTUS	CDS	1515854	1516300	0.52	+	0	transcript_id "g318.t1"; gene_id "g318";
Scaffold_1	AUGUSTUS	stop_codon	1516298	1516300	.	+	0	transcript_id "g318.t1"; gene_id "g318";
# protein sequence = [MFQSLQKCLELRDKYMTKSRQRLGDNPRDYDGDFMGLNDECAGVSGVRPDANFAANQPPPWSPERWAIYPPPPPPHWH
# WTDMQQVISSDGRRSPEGEFNFKECHIPEGDSKEFAIDDTGVYQVYDNAAKSLFILSPVCSWRQLTFSLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g318
###
# start gene g319
Scaffold_1	AUGUSTUS	gene	1518212	1519333	0.22	+	.	g319
Scaffold_1	AUGUSTUS	transcript	1518212	1519333	0.22	+	.	g319.t1
Scaffold_1	AUGUSTUS	start_codon	1518212	1518214	.	+	0	transcript_id "g319.t1"; gene_id "g319";
Scaffold_1	AUGUSTUS	CDS	1518212	1518306	0.29	+	0	transcript_id "g319.t1"; gene_id "g319";
Scaffold_1	AUGUSTUS	CDS	1519114	1519333	0.58	+	1	transcript_id "g319.t1"; gene_id "g319";
Scaffold_1	AUGUSTUS	stop_codon	1519331	1519333	.	+	0	transcript_id "g319.t1"; gene_id "g319";
# protein sequence = [MPQSSLAELARNSVIQSGFEMEIKRHWLGQQXTKPLPKIKPLTKWEQFAKAKGIQGKSKEKREKKVWDEERQEWINRW
# GKDAKNKQVEEQWITEVPMNAGEFSE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g319
###
# start gene g320
Scaffold_1	AUGUSTUS	gene	1519665	1520021	0.49	+	.	g320
Scaffold_1	AUGUSTUS	transcript	1519665	1520021	0.49	+	.	g320.t1
Scaffold_1	AUGUSTUS	start_codon	1519665	1519667	.	+	0	transcript_id "g320.t1"; gene_id "g320";
Scaffold_1	AUGUSTUS	CDS	1519665	1520021	0.49	+	0	transcript_id "g320.t1"; gene_id "g320";
Scaffold_1	AUGUSTUS	stop_codon	1520019	1520021	.	+	0	transcript_id "g320.t1"; gene_id "g320";
# protein sequence = [MDIPVQFDPTEGSVSAESKAALDLLSKMNSDARKTRMTEAQRPSKKSRTSRKYMFTDVSGCIDTDHADGGNEVEDPEG
# KVLNVRKAVRFASKGRGGAALGREREKAGKLGKSGKGKRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g320
###
# start gene g321
Scaffold_1	AUGUSTUS	gene	1520666	1521502	0.71	+	.	g321
Scaffold_1	AUGUSTUS	transcript	1520666	1521502	0.71	+	.	g321.t1
Scaffold_1	AUGUSTUS	start_codon	1520666	1520668	.	+	0	transcript_id "g321.t1"; gene_id "g321";
Scaffold_1	AUGUSTUS	CDS	1520666	1521502	0.71	+	0	transcript_id "g321.t1"; gene_id "g321";
Scaffold_1	AUGUSTUS	stop_codon	1521500	1521502	.	+	0	transcript_id "g321.t1"; gene_id "g321";
# protein sequence = [MIHSSKVPEAALRGRMFESSVSRLAEWWSQDFFEVTDEGHIRNITFDTMKQKLIKFVPGFAEQFGDAVAPPEAERDNS
# RSRLKYKGKGKEKEKQPPSTTPLIDSSDLDLLEDILDNSIETIKSPKSLMKHALMQSGSRDTSAQLFTALCRALAIPARLVVSLQSVPWKAAVGREAK
# KYPKKTSHVSKGKVEVVVNEGNAAPAVSSPMKGGQGHRRDDQPVDKKGKAKAKEEAKPAVKLRKSKSKGNVLGSAQSTSASNKPKKPKHDGKTFFVRS
# VHSN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g321
###
# start gene g322
Scaffold_1	AUGUSTUS	gene	1521974	1522537	0.46	+	.	g322
Scaffold_1	AUGUSTUS	transcript	1521974	1522537	0.46	+	.	g322.t1
Scaffold_1	AUGUSTUS	start_codon	1521974	1521976	.	+	0	transcript_id "g322.t1"; gene_id "g322";
Scaffold_1	AUGUSTUS	CDS	1521974	1522537	0.46	+	0	transcript_id "g322.t1"; gene_id "g322";
Scaffold_1	AUGUSTUS	stop_codon	1522535	1522537	.	+	0	transcript_id "g322.t1"; gene_id "g322";
# protein sequence = [MPTSIIGFKDHPLYVLPRHLKQNETIYPPPAPALGAGFDSSMPLDPSGSRSHTPELGKFRGEPVYPRSSVVPLKTPEN
# WLRSEGRSMKEGAAPMKYVKLRASTIGRRREIEMIKEGMKDIQEKTKGANGVIGIHVDELVDEERAGTSGNADTGGEIMQGLYARNQTELYVPDPVVD
# VSKASDISSYY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g322
###
# start gene g323
Scaffold_1	AUGUSTUS	gene	1534406	1534990	0.97	-	.	g323
Scaffold_1	AUGUSTUS	transcript	1534406	1534990	0.97	-	.	g323.t1
Scaffold_1	AUGUSTUS	stop_codon	1534406	1534408	.	-	0	transcript_id "g323.t1"; gene_id "g323";
Scaffold_1	AUGUSTUS	CDS	1534406	1534990	0.97	-	0	transcript_id "g323.t1"; gene_id "g323";
Scaffold_1	AUGUSTUS	start_codon	1534988	1534990	.	-	0	transcript_id "g323.t1"; gene_id "g323";
# protein sequence = [MAQAEVQSQSQGHGYPHTAHLYSTRYSTHHVFQPAYALSQQPQHLQPVMPHTQSQENAHVQTTFASLLNSLTREQSEA
# STIVSGVSSAPPTTSSTSSTPFVVSVPTTPASDKGPTSAQSYENNEDSSNEGIDENHKEGGEDNAGCAEEMQIDPKLVERVVNPALAGSQQNQYYESD
# QQQQAQVKLDQRGNPETS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g323
###
# start gene g324
Scaffold_1	AUGUSTUS	gene	1546356	1548075	0.34	+	.	g324
Scaffold_1	AUGUSTUS	transcript	1546356	1548075	0.34	+	.	g324.t1
Scaffold_1	AUGUSTUS	start_codon	1546356	1546358	.	+	0	transcript_id "g324.t1"; gene_id "g324";
Scaffold_1	AUGUSTUS	CDS	1546356	1546371	0.43	+	0	transcript_id "g324.t1"; gene_id "g324";
Scaffold_1	AUGUSTUS	CDS	1547375	1548075	0.68	+	2	transcript_id "g324.t1"; gene_id "g324";
Scaffold_1	AUGUSTUS	stop_codon	1548073	1548075	.	+	0	transcript_id "g324.t1"; gene_id "g324";
# protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI
# SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS
# AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQASLIR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g324
###
# start gene g325
Scaffold_1	AUGUSTUS	gene	1548117	1548671	0.72	+	.	g325
Scaffold_1	AUGUSTUS	transcript	1548117	1548671	0.72	+	.	g325.t1
Scaffold_1	AUGUSTUS	start_codon	1548117	1548119	.	+	0	transcript_id "g325.t1"; gene_id "g325";
Scaffold_1	AUGUSTUS	CDS	1548117	1548671	0.72	+	0	transcript_id "g325.t1"; gene_id "g325";
Scaffold_1	AUGUSTUS	stop_codon	1548669	1548671	.	+	0	transcript_id "g325.t1"; gene_id "g325";
# protein sequence = [MFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNMRVRLFLAPMTPEVRRGVLET
# VVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIK
# LESLIQGN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g325
###
# start gene g326
Scaffold_1	AUGUSTUS	gene	1549011	1549331	0.4	+	.	g326
Scaffold_1	AUGUSTUS	transcript	1549011	1549331	0.4	+	.	g326.t1
Scaffold_1	AUGUSTUS	start_codon	1549011	1549013	.	+	0	transcript_id "g326.t1"; gene_id "g326";
Scaffold_1	AUGUSTUS	CDS	1549011	1549331	0.4	+	0	transcript_id "g326.t1"; gene_id "g326";
Scaffold_1	AUGUSTUS	stop_codon	1549329	1549331	.	+	0	transcript_id "g326.t1"; gene_id "g326";
# protein sequence = [MPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEE
# LSDRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g326
###
# start gene g327
Scaffold_1	AUGUSTUS	gene	1550081	1550524	0.65	+	.	g327
Scaffold_1	AUGUSTUS	transcript	1550081	1550524	0.65	+	.	g327.t1
Scaffold_1	AUGUSTUS	start_codon	1550081	1550083	.	+	0	transcript_id "g327.t1"; gene_id "g327";
Scaffold_1	AUGUSTUS	CDS	1550081	1550524	0.65	+	0	transcript_id "g327.t1"; gene_id "g327";
Scaffold_1	AUGUSTUS	stop_codon	1550522	1550524	.	+	0	transcript_id "g327.t1"; gene_id "g327";
# protein sequence = [MFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDE
# EIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVYGVLTTTRTE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g327
###
# start gene g328
Scaffold_1	AUGUSTUS	gene	1551271	1551693	0.84	+	.	g328
Scaffold_1	AUGUSTUS	transcript	1551271	1551693	0.84	+	.	g328.t1
Scaffold_1	AUGUSTUS	start_codon	1551271	1551273	.	+	0	transcript_id "g328.t1"; gene_id "g328";
Scaffold_1	AUGUSTUS	CDS	1551271	1551693	0.84	+	0	transcript_id "g328.t1"; gene_id "g328";
Scaffold_1	AUGUSTUS	stop_codon	1551691	1551693	.	+	0	transcript_id "g328.t1"; gene_id "g328";
# protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP
# VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g328
###
# start gene g329
Scaffold_1	AUGUSTUS	gene	1555699	1556764	0.2	+	.	g329
Scaffold_1	AUGUSTUS	transcript	1555699	1556764	0.2	+	.	g329.t1
Scaffold_1	AUGUSTUS	start_codon	1555699	1555701	.	+	0	transcript_id "g329.t1"; gene_id "g329";
Scaffold_1	AUGUSTUS	CDS	1555699	1555755	0.22	+	0	transcript_id "g329.t1"; gene_id "g329";
Scaffold_1	AUGUSTUS	CDS	1555823	1556764	0.9	+	0	transcript_id "g329.t1"; gene_id "g329";
Scaffold_1	AUGUSTUS	stop_codon	1556762	1556764	.	+	0	transcript_id "g329.t1"; gene_id "g329";
# protein sequence = [MDFIEQLPMSNGYTAILVVLSFFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERV
# NQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRK
# RISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPIVLNLLHLQLKLMVKRSTTLP
# KSSTPSWTEGINVVLYVTIWWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g329
###
# start gene g330
Scaffold_1	AUGUSTUS	gene	1561880	1562593	0.32	+	.	g330
Scaffold_1	AUGUSTUS	transcript	1561880	1562593	0.32	+	.	g330.t1
Scaffold_1	AUGUSTUS	start_codon	1561880	1561882	.	+	0	transcript_id "g330.t1"; gene_id "g330";
Scaffold_1	AUGUSTUS	CDS	1561880	1562090	0.43	+	0	transcript_id "g330.t1"; gene_id "g330";
Scaffold_1	AUGUSTUS	CDS	1562154	1562593	0.68	+	2	transcript_id "g330.t1"; gene_id "g330";
Scaffold_1	AUGUSTUS	stop_codon	1562591	1562593	.	+	0	transcript_id "g330.t1"; gene_id "g330";
# protein sequence = [MMRSVPSKDLDVFASLRGKVSPVVASKISTLSPPLEIKSSTSVPKAPVAPPRLIRRNRELESLKADASTFFSSPRSTR
# SRDSDNELLSGFPSAVSASRASSSTKVSTDRKEPKPKTTVKVVEDSKASKPTSSAMVYKRVRLPSRSRKIAPTTAKGKSRQVVVSDDDSASNEVESED
# EEEDEDEEEDSAPPPKRLKTTSSLPGKTLFFFLFDFINSI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g330
###
# start gene g331
Scaffold_1	AUGUSTUS	gene	1566623	1567738	0.28	-	.	g331
Scaffold_1	AUGUSTUS	transcript	1566623	1567738	0.28	-	.	g331.t1
Scaffold_1	AUGUSTUS	stop_codon	1566623	1566625	.	-	0	transcript_id "g331.t1"; gene_id "g331";
Scaffold_1	AUGUSTUS	CDS	1566623	1567738	0.28	-	0	transcript_id "g331.t1"; gene_id "g331";
Scaffold_1	AUGUSTUS	start_codon	1567736	1567738	.	-	0	transcript_id "g331.t1"; gene_id "g331";
# protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE
# VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDI
# VESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIR
# RTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMSPENDYIFDAIPHLRLSDTDSDENSVRERINN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g331
###
# start gene g332
Scaffold_1	AUGUSTUS	gene	1568019	1569461	0.32	-	.	g332
Scaffold_1	AUGUSTUS	transcript	1568019	1569461	0.32	-	.	g332.t1
Scaffold_1	AUGUSTUS	stop_codon	1568019	1568021	.	-	0	transcript_id "g332.t1"; gene_id "g332";
Scaffold_1	AUGUSTUS	CDS	1568019	1569461	0.32	-	0	transcript_id "g332.t1"; gene_id "g332";
Scaffold_1	AUGUSTUS	start_codon	1569459	1569461	.	-	0	transcript_id "g332.t1"; gene_id "g332";
# protein sequence = [MTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRF
# VWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSN
# VPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHV
# YGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEP
# YQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGK
# YLSNPSDESW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g332
###
# start gene g333
Scaffold_1	AUGUSTUS	gene	1570482	1570886	0.97	-	.	g333
Scaffold_1	AUGUSTUS	transcript	1570482	1570886	0.97	-	.	g333.t1
Scaffold_1	AUGUSTUS	stop_codon	1570482	1570484	.	-	0	transcript_id "g333.t1"; gene_id "g333";
Scaffold_1	AUGUSTUS	CDS	1570482	1570886	0.97	-	0	transcript_id "g333.t1"; gene_id "g333";
Scaffold_1	AUGUSTUS	start_codon	1570884	1570886	.	-	0	transcript_id "g333.t1"; gene_id "g333";
# protein sequence = [MDTNDVNKKRSLRKLSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNEQFNLNPI
# KSFFLQNGRIKPKPAKESSEERRFVEPILQNLVWGRIAINLNPQKPHRINVITKYL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g333
###
# start gene g334
Scaffold_1	AUGUSTUS	gene	1571307	1572388	0.53	-	.	g334
Scaffold_1	AUGUSTUS	transcript	1571307	1572388	0.53	-	.	g334.t1
Scaffold_1	AUGUSTUS	stop_codon	1571307	1571309	.	-	0	transcript_id "g334.t1"; gene_id "g334";
Scaffold_1	AUGUSTUS	CDS	1571307	1571758	0.8	-	2	transcript_id "g334.t1"; gene_id "g334";
Scaffold_1	AUGUSTUS	CDS	1571878	1572388	0.55	-	0	transcript_id "g334.t1"; gene_id "g334";
Scaffold_1	AUGUSTUS	start_codon	1572386	1572388	.	-	0	transcript_id "g334.t1"; gene_id "g334";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLNGETEI
# LDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEI
# NNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g334
###
# start gene g335
Scaffold_1	AUGUSTUS	gene	1572418	1572687	0.65	-	.	g335
Scaffold_1	AUGUSTUS	transcript	1572418	1572687	0.65	-	.	g335.t1
Scaffold_1	AUGUSTUS	stop_codon	1572418	1572420	.	-	0	transcript_id "g335.t1"; gene_id "g335";
Scaffold_1	AUGUSTUS	CDS	1572418	1572687	0.65	-	0	transcript_id "g335.t1"; gene_id "g335";
Scaffold_1	AUGUSTUS	start_codon	1572685	1572687	.	-	0	transcript_id "g335.t1"; gene_id "g335";
# protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR
# VFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g335
###
# start gene g336
Scaffold_1	AUGUSTUS	gene	1573074	1573937	0.86	-	.	g336
Scaffold_1	AUGUSTUS	transcript	1573074	1573937	0.86	-	.	g336.t1
Scaffold_1	AUGUSTUS	stop_codon	1573074	1573076	.	-	0	transcript_id "g336.t1"; gene_id "g336";
Scaffold_1	AUGUSTUS	CDS	1573074	1573937	0.86	-	0	transcript_id "g336.t1"; gene_id "g336";
Scaffold_1	AUGUSTUS	start_codon	1573935	1573937	.	-	0	transcript_id "g336.t1"; gene_id "g336";
# protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT
# RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR
# GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD
# LLGIKLESLIQGN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g336
###
# start gene g337
Scaffold_1	AUGUSTUS	gene	1578787	1579394	0.21	+	.	g337
Scaffold_1	AUGUSTUS	transcript	1578787	1579394	0.21	+	.	g337.t1
Scaffold_1	AUGUSTUS	start_codon	1578787	1578789	.	+	0	transcript_id "g337.t1"; gene_id "g337";
Scaffold_1	AUGUSTUS	CDS	1578787	1578979	0.21	+	0	transcript_id "g337.t1"; gene_id "g337";
Scaffold_1	AUGUSTUS	CDS	1579090	1579394	0.53	+	2	transcript_id "g337.t1"; gene_id "g337";
Scaffold_1	AUGUSTUS	stop_codon	1579392	1579394	.	+	0	transcript_id "g337.t1"; gene_id "g337";
# protein sequence = [MLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDAQEADDIELDVQEA
# LDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMQKMNGLNLLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g337
###
# start gene g338
Scaffold_1	AUGUSTUS	gene	1580414	1580728	0.55	+	.	g338
Scaffold_1	AUGUSTUS	transcript	1580414	1580728	0.55	+	.	g338.t1
Scaffold_1	AUGUSTUS	start_codon	1580414	1580416	.	+	0	transcript_id "g338.t1"; gene_id "g338";
Scaffold_1	AUGUSTUS	CDS	1580414	1580728	0.55	+	0	transcript_id "g338.t1"; gene_id "g338";
Scaffold_1	AUGUSTUS	stop_codon	1580726	1580728	.	+	0	transcript_id "g338.t1"; gene_id "g338";
# protein sequence = [MYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWM
# APENDYIFDAIPHLRLSDTDSDEELS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g338
###
# start gene g339
Scaffold_1	AUGUSTUS	gene	1581003	1581678	0.33	-	.	g339
Scaffold_1	AUGUSTUS	transcript	1581003	1581678	0.33	-	.	g339.t1
Scaffold_1	AUGUSTUS	stop_codon	1581003	1581005	.	-	0	transcript_id "g339.t1"; gene_id "g339";
Scaffold_1	AUGUSTUS	CDS	1581003	1581218	0.62	-	0	transcript_id "g339.t1"; gene_id "g339";
Scaffold_1	AUGUSTUS	CDS	1581277	1581428	0.99	-	2	transcript_id "g339.t1"; gene_id "g339";
Scaffold_1	AUGUSTUS	CDS	1581510	1581678	0.55	-	0	transcript_id "g339.t1"; gene_id "g339";
Scaffold_1	AUGUSTUS	start_codon	1581676	1581678	.	-	0	transcript_id "g339.t1"; gene_id "g339";
# protein sequence = [MFCNHDSFYVVESSQHSYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTP
# PAPLESQSTKFIAATLNFQAAEFEFNANLHLEKSPDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGHV
# SA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g339
###
# start gene g340
Scaffold_1	AUGUSTUS	gene	1583455	1585418	0.09	-	.	g340
Scaffold_1	AUGUSTUS	transcript	1583455	1585418	0.09	-	.	g340.t1
Scaffold_1	AUGUSTUS	stop_codon	1583455	1583457	.	-	0	transcript_id "g340.t1"; gene_id "g340";
Scaffold_1	AUGUSTUS	CDS	1583455	1584008	0.84	-	2	transcript_id "g340.t1"; gene_id "g340";
Scaffold_1	AUGUSTUS	CDS	1584587	1584715	0.17	-	2	transcript_id "g340.t1"; gene_id "g340";
Scaffold_1	AUGUSTUS	CDS	1584772	1585152	0.46	-	2	transcript_id "g340.t1"; gene_id "g340";
Scaffold_1	AUGUSTUS	CDS	1585211	1585418	0.45	-	0	transcript_id "g340.t1"; gene_id "g340";
Scaffold_1	AUGUSTUS	start_codon	1585416	1585418	.	-	0	transcript_id "g340.t1"; gene_id "g340";
# protein sequence = [MRLAPSKDLDVFASLRGKVSPAVTSKINTPSPPLGIKPSTPAPKAPVAPPRLIRRNRELENLKTDASSFLASPRSARS
# KDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRSRKVAPAASKGKARQIVVTDEDSASNEVESEDE
# DEEEDSAPPPKRLKTTSSISASLPRRPVKRVTVPKRASKAATKSAPERFPDSTFQPVLLADAQDLSISLRRAIDLNDQLKQLESLFDSTRDLFLRSIL
# DLQNAGEDPIVVLEALKAAEPNRRAITLNEWTLMATLFRWPSPFNLSGLDFDHRTPGEWIELLRSIHSGESTAHIDEQGHLVESSPPPDSATEAFEGL
# NEVERGSADEGASSQVGGSVPMELDLPTIESLAEQTLSPEKGAEPAQTLES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g340
###
# start gene g341
Scaffold_1	AUGUSTUS	gene	1595072	1595701	0.95	+	.	g341
Scaffold_1	AUGUSTUS	transcript	1595072	1595701	0.95	+	.	g341.t1
Scaffold_1	AUGUSTUS	start_codon	1595072	1595074	.	+	0	transcript_id "g341.t1"; gene_id "g341";
Scaffold_1	AUGUSTUS	CDS	1595072	1595701	0.95	+	0	transcript_id "g341.t1"; gene_id "g341";
Scaffold_1	AUGUSTUS	stop_codon	1595699	1595701	.	+	0	transcript_id "g341.t1"; gene_id "g341";
# protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ
# GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY
# PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g341
###
# start gene g342
Scaffold_1	AUGUSTUS	gene	1597283	1598438	0.21	+	.	g342
Scaffold_1	AUGUSTUS	transcript	1597283	1598438	0.21	+	.	g342.t1
Scaffold_1	AUGUSTUS	start_codon	1597283	1597285	.	+	0	transcript_id "g342.t1"; gene_id "g342";
Scaffold_1	AUGUSTUS	CDS	1597283	1597429	0.21	+	0	transcript_id "g342.t1"; gene_id "g342";
Scaffold_1	AUGUSTUS	CDS	1597533	1598438	0.97	+	0	transcript_id "g342.t1"; gene_id "g342";
Scaffold_1	AUGUSTUS	stop_codon	1598436	1598438	.	+	0	transcript_id "g342.t1"; gene_id "g342";
# protein sequence = [MIQQQARVIETLQEQLREVKKGFTAGEVPTGGPLSKTGNTAGLSGRAPRELGGNPQVEQAGQIPDTPSVDRRRIHEWG
# ARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPPSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQ
# NQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLE
# RMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLPG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g342
###
# start gene g343
Scaffold_1	AUGUSTUS	gene	1602838	1603797	0.65	+	.	g343
Scaffold_1	AUGUSTUS	transcript	1602838	1603797	0.65	+	.	g343.t1
Scaffold_1	AUGUSTUS	start_codon	1602838	1602840	.	+	0	transcript_id "g343.t1"; gene_id "g343";
Scaffold_1	AUGUSTUS	CDS	1602838	1603797	0.65	+	0	transcript_id "g343.t1"; gene_id "g343";
Scaffold_1	AUGUSTUS	stop_codon	1603795	1603797	.	+	0	transcript_id "g343.t1"; gene_id "g343";
# protein sequence = [MPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNN
# TPNTTTGVSPFFANKGYHPKLSITLEQVQEAEVNEYASNLKELHAYLQERIEVANKVYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKW
# TGPYTVLSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGKTEHFVEDILDSKPKKGRPEEVEYLVKWEGYNDEFNSWVGW
# EGMVGSIELLRSWHKHHPRKRQPSRLQWASLEREAREDEEEGSGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g343
###
# start gene g344
Scaffold_1	AUGUSTUS	gene	1604037	1606644	0.6	-	.	g344
Scaffold_1	AUGUSTUS	transcript	1604037	1606644	0.6	-	.	g344.t1
Scaffold_1	AUGUSTUS	stop_codon	1604037	1604039	.	-	0	transcript_id "g344.t1"; gene_id "g344";
Scaffold_1	AUGUSTUS	CDS	1604037	1605168	0.72	-	1	transcript_id "g344.t1"; gene_id "g344";
Scaffold_1	AUGUSTUS	CDS	1605332	1606644	0.61	-	0	transcript_id "g344.t1"; gene_id "g344";
Scaffold_1	AUGUSTUS	start_codon	1606642	1606644	.	-	0	transcript_id "g344.t1"; gene_id "g344";
# protein sequence = [MSAPLRRSSSRTRSPQLPILTTIGEVPSPDLESDGEAEQDQLAFTIEFPSRPQLQLFETVFNTGKPLSGYCQDDPLWP
# LLAEVASPCSNCSKSPAKCKVLPNSPRCTNCSVKKTCSLGKILRYRYFARRCNQDLAYSRRFLELHGTPAHQSTWGIPMVTWRQYDAALHERTSSTST
# LLELNMLDDQDAADVDQQELRDFLALQQEEAAVAAKRKRDLSPLPVAGPSSKKVRSNASKKRPRRRSPVQETAEESPRRVRLVVPPVRSLPVTTSTPL
# PPRAFPSSMEVPDADLSVQGHSNLVRLAAVAGAQSGLVQQPAVSSSIKGTGQDLLSSNMPPVPRPTLVPRALATHPYRAENQRLAARVRLLESQLSDS
# QRENSSLTSALRDTSHALESRQREVEQLRSSSREVREQQVEYRRVLDQFRALDEALPGPPDRVRILLLYQQGVVDESNALATRQRRLVEELQEEVHRA
# RGRAAFVEQMIKEYPDEGYYEVVLPPLSQLEGDLHKAREDLRRVATFAHRLYRSEPATVLHHHYRYLGAIIEAVVAFLRRGLDSDDLDTVVHNFQLGL
# DYMQAARGVHGDMYMRSLSSIQWFFNNAVDEDEGLYRMVLEHSRFDNDGPFLTAAQHAGFAPPPDSSLEPPLHRRMFALSTALPHSDGAGRWDDIVPA
# LPSIDQLTADWEQLMLQYIHHITDTPLPVPDPPVPMSSMGPVPESSGEANVEQSLEAPIVQVSSPSAGSHPPVPLFLSEQESPTSPSPPPCSPVPPLL
# FGSVASLSIDLTGDDDELYETEESYAGRIAVAREGTELAVGQGIVKEESL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g344
###
# start gene g345
Scaffold_1	AUGUSTUS	gene	1611317	1611736	0.48	-	.	g345
Scaffold_1	AUGUSTUS	transcript	1611317	1611736	0.48	-	.	g345.t1
Scaffold_1	AUGUSTUS	stop_codon	1611317	1611319	.	-	0	transcript_id "g345.t1"; gene_id "g345";
Scaffold_1	AUGUSTUS	CDS	1611317	1611736	0.48	-	0	transcript_id "g345.t1"; gene_id "g345";
Scaffold_1	AUGUSTUS	start_codon	1611734	1611736	.	-	0	transcript_id "g345.t1"; gene_id "g345";
# protein sequence = [MQTYMTSCGSQSCSSFDSSAASWFKIQEQGRLTPGGDWAMSLMNTGAPANVTIPSNIAPGNYIIRHELIALQIAQTEG
# GAEFYPACVQLKVGGTGTGTPSEDELVQLPGAYSDTDPGILVDVRFSVFIYVLHWTDLFVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g345
###
# start gene g346
Scaffold_1	AUGUSTUS	gene	1612769	1613176	0.58	-	.	g346
Scaffold_1	AUGUSTUS	transcript	1612769	1613176	0.58	-	.	g346.t1
Scaffold_1	AUGUSTUS	stop_codon	1612769	1612771	.	-	0	transcript_id "g346.t1"; gene_id "g346";
Scaffold_1	AUGUSTUS	CDS	1612769	1613176	0.58	-	0	transcript_id "g346.t1"; gene_id "g346";
Scaffold_1	AUGUSTUS	start_codon	1613174	1613176	.	-	0	transcript_id "g346.t1"; gene_id "g346";
# protein sequence = [MVRADSYNSSQASTQDKNTVGGEWFSSSEISPNHSDVPNSQLWSGSEAGFIILRQHGRKRVRYYKYGAVLGRHAYLKE
# NNKAVKYKKLDDEEYADVQAAGEHEPMTLRMVNEETGGNVPKIFQERLRSGWWKHWI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g346
###
# start gene g347
Scaffold_1	AUGUSTUS	gene	1621758	1622624	0.66	-	.	g347
Scaffold_1	AUGUSTUS	transcript	1621758	1622624	0.66	-	.	g347.t1
Scaffold_1	AUGUSTUS	stop_codon	1621758	1621760	.	-	0	transcript_id "g347.t1"; gene_id "g347";
Scaffold_1	AUGUSTUS	CDS	1621758	1622624	0.66	-	0	transcript_id "g347.t1"; gene_id "g347";
Scaffold_1	AUGUSTUS	start_codon	1622622	1622624	.	-	0	transcript_id "g347.t1"; gene_id "g347";
# protein sequence = [MATLVVSAIRRELGISLSMTDFYREPSVDGVAKLIATDKKGPGSQNAVSIDNGSTGIAGSTIVTNKQGPGPTIFMFPE
# VTGFASVYATAFENIRHKLVVFGDEHWGKSFREGDSIQVLARNLLDQVREFQPNGPYYLAGWSFGGYLAFEIARQMQEVGEDVAILMMFDSYVYHEPL
# RSVEWSDDLQHLLQVHEDKSAWIQQFNRIRTLISRYEAPMEAYMGKSVLVKALKIDKGDEADYPHPEDPYNGWREYIPRIERRSIEASHRMMFDGRNG
# PKMGAIISEIMMSI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g347
###
# start gene g348
Scaffold_1	AUGUSTUS	gene	1623001	1624632	0.79	-	.	g348
Scaffold_1	AUGUSTUS	transcript	1623001	1624632	0.79	-	.	g348.t1
Scaffold_1	AUGUSTUS	stop_codon	1623001	1623003	.	-	0	transcript_id "g348.t1"; gene_id "g348";
Scaffold_1	AUGUSTUS	CDS	1623001	1624632	0.79	-	0	transcript_id "g348.t1"; gene_id "g348";
Scaffold_1	AUGUSTUS	start_codon	1624630	1624632	.	-	0	transcript_id "g348.t1"; gene_id "g348";
# protein sequence = [MANIGAYVVDEALQPVPRGVCGELLLTGSGLARGYLNRPELTTQKFIHLETSHPFGPNRAYRTGDIVRWTAEDKLVFL
# HRKEDGQVKIRGQRLELGEIEQVLKQHPNVMSAAAALVKVHNSDHVVAYAVLKSKNDEGADGRILDLWDDHFNNEDSTYHSLHAENGGQRVVQWYSMF
# DAQPIPSYDMVQWLDDTIDQIAPAHDDQVLEVGVGSGMIALQIAPRVQSFVGTDLSTPSLKTLAAQLSSNGLSSKVSLFATPAHDLGAVAEKYSFSLI
# ILNSVLQYFPSGEYLAQVLAKMVELIDSSGRIFVGDVRSYSLIPLHDLERALANLEGDVTATEIQSNLSHYTEGQTELLVDPAFFFDIERRLPKVVHV
# EIKPKLMSVQNELSRYRYNVVLHVNKQPRLSRASTWFDCASPEWTTEDLRMQLHSSRDDTVGALAIPVASIRRIREVLDSCGNLISKRSVNEIRQEIA
# EDPSAKCSTTADIDRIAKRKVGMSYSTIPYNTALQLPSERFSSVRAHPKMRLLSETSQTLPSTVHHTTLHRTV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g348
###
# start gene g349
Scaffold_1	AUGUSTUS	gene	1654391	1655266	0.85	+	.	g349
Scaffold_1	AUGUSTUS	transcript	1654391	1655266	0.85	+	.	g349.t1
Scaffold_1	AUGUSTUS	start_codon	1654391	1654393	.	+	0	transcript_id "g349.t1"; gene_id "g349";
Scaffold_1	AUGUSTUS	CDS	1654391	1655266	0.85	+	0	transcript_id "g349.t1"; gene_id "g349";
Scaffold_1	AUGUSTUS	stop_codon	1655264	1655266	.	+	0	transcript_id "g349.t1"; gene_id "g349";
# protein sequence = [MSPPLNHNAPLPSPRLPGQSNTIPALHSYLSSQNIPSAGQSHHMYGPSSSHHSSHGGSSWDHPRLDTSGKLGNDRLDS
# SHGRSSSAGSNSMWPGTERSSSRGYAGQSGSPSGSGPNSSTGGGGADSNFNFPTLNSPFFPTPSQMFNSNSGSSASSAGGNSSSTGGGSGGSVFGAGS
# NQLPPPGSLNTSNSRNGYDHRSYAPSPPPLGGASFAQSASRHGLGSSNGLSSGGLNGIGGIGSLGGLGSGGNSGLQRSLPPVQSIPGYSQAGLSGSGG
# GGGDMGDIWSRGTVNGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g349
###
# start gene g350
Scaffold_1	AUGUSTUS	gene	1672753	1673247	0.89	+	.	g350
Scaffold_1	AUGUSTUS	transcript	1672753	1673247	0.89	+	.	g350.t1
Scaffold_1	AUGUSTUS	start_codon	1672753	1672755	.	+	0	transcript_id "g350.t1"; gene_id "g350";
Scaffold_1	AUGUSTUS	CDS	1672753	1673247	0.89	+	0	transcript_id "g350.t1"; gene_id "g350";
Scaffold_1	AUGUSTUS	stop_codon	1673245	1673247	.	+	0	transcript_id "g350.t1"; gene_id "g350";
# protein sequence = [MGSSSSGPSSPTIGPFTPTHPIHPHNAFDLSNIPNSACVPELDMQLQIPNVDFSGNYWPMQSVWQDESNMGMMHNDFD
# LSSIPSIQMGGPKYVDETNTYVASPEAMGLGEYSQEYQQDYSNQYMSEYQQDYVQFGHSQFLEGHQSTESSLLGYDNMMGSPEQSF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g350
###
# start gene g351
Scaffold_1	AUGUSTUS	gene	1690723	1691517	0.47	-	.	g351
Scaffold_1	AUGUSTUS	transcript	1690723	1691517	0.47	-	.	g351.t1
Scaffold_1	AUGUSTUS	stop_codon	1690723	1690725	.	-	0	transcript_id "g351.t1"; gene_id "g351";
Scaffold_1	AUGUSTUS	CDS	1690723	1691517	0.47	-	0	transcript_id "g351.t1"; gene_id "g351";
Scaffold_1	AUGUSTUS	start_codon	1691515	1691517	.	-	0	transcript_id "g351.t1"; gene_id "g351";
# protein sequence = [MGGASKRNFAMFEKLCGQDAFSNVAIVTTRWDQEEEAVAKARLEELKTKPQLYKPILDGGGAIFRHERTRESANAILS
# HLVAKTATSLLIQREMVEESKGISETAAGKELQQEILRQVEKHQQEMDELLEELKNNRETSEFEELEAECKALQEQATHWQEEARKLAETSTPIKPDL
# LNESSPQPLFDTTVTHSVLPSARDDDGFFGASINGKAPNLCDSDRRGARAKLEVAVKYLLDAITTVLHTADSLRREVTASTGSRNYSK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g351
###
# start gene g352
Scaffold_1	AUGUSTUS	gene	1693173	1693856	0.52	+	.	g352
Scaffold_1	AUGUSTUS	transcript	1693173	1693856	0.52	+	.	g352.t1
Scaffold_1	AUGUSTUS	start_codon	1693173	1693175	.	+	0	transcript_id "g352.t1"; gene_id "g352";
Scaffold_1	AUGUSTUS	CDS	1693173	1693856	0.52	+	0	transcript_id "g352.t1"; gene_id "g352";
Scaffold_1	AUGUSTUS	stop_codon	1693854	1693856	.	+	0	transcript_id "g352.t1"; gene_id "g352";
# protein sequence = [MFQNLCGPNAYGNIVVLTTFWDRVSAEEGLMREEQLKSTFFSNIVAGGARFMRHDRTAQSAREVIAHILTLSPTDVRI
# QEEIRVDGKGLEETAAGLVHREEVERVLEKHRQEIASLGKEISSIKQDNETLRRELEEEKEELQQRLARWESEKADLKKGLDDSLKSRERLEDQYKSV
# DKVRSATLEVLQVKLKEEKTSNMVVEQMSEEVTVQKVYKSNQGGRSMYFCA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g352
###
# start gene g353
Scaffold_1	AUGUSTUS	gene	1694156	1695610	0.97	+	.	g353
Scaffold_1	AUGUSTUS	transcript	1694156	1695610	0.97	+	.	g353.t1
Scaffold_1	AUGUSTUS	start_codon	1694156	1694158	.	+	0	transcript_id "g353.t1"; gene_id "g353";
Scaffold_1	AUGUSTUS	CDS	1694156	1695610	0.97	+	0	transcript_id "g353.t1"; gene_id "g353";
Scaffold_1	AUGUSTUS	stop_codon	1695608	1695610	.	+	0	transcript_id "g353.t1"; gene_id "g353";
# protein sequence = [MYFSKNIGLRRDWYTDAAFGQQQFTGTNPTTITLAPRRWIDEFTSTAQAQGRADIISLLTEKAESLYMQDYSDFRSSI
# GISPGEKIVSDGRHGCSSVALFHLEPEGKLHPLGIVLDYKGSIEESVTIFNRRITSNVNGDEYMDWPWRYAKMCVQVSDWLRHEVAIHLVNTHLVEEV
# IIVAAYRSFGPNHIIFRLLEPHWSTTLSLNKAARETLVPSIIIGMTGLTASQTYAFLKAAYDRFDWKGLYVPNDLRTRGFPVKCLDEPKYHNYAYARN
# ISKTWNIIRKFVATVLSKEYAGGDAAVQRDASIGIFCDEVRSRKGGQLTSFPAIETLDELIDFVTMCIHVAAPQHTAVNYLQQYYQTFVPNKPSALHF
# PIPQFLSELCSFTEEDLLSALPLKRPRDWLLMAQVPYLLSFEVPEESTILHYAETTSSSRATPTVIRSAAQVLASDLRAFIDTVIQNSNELDDQQTPY
# LVLDPSRTAISILI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g353
###
# start gene g354
Scaffold_1	AUGUSTUS	gene	1696849	1697712	0.98	+	.	g354
Scaffold_1	AUGUSTUS	transcript	1696849	1697712	0.98	+	.	g354.t1
Scaffold_1	AUGUSTUS	start_codon	1696849	1696851	.	+	0	transcript_id "g354.t1"; gene_id "g354";
Scaffold_1	AUGUSTUS	CDS	1696849	1697712	0.98	+	0	transcript_id "g354.t1"; gene_id "g354";
Scaffold_1	AUGUSTUS	stop_codon	1697710	1697712	.	+	0	transcript_id "g354.t1"; gene_id "g354";
# protein sequence = [MSDPRFGGQSRRSLRIFRELCGAATFKNVVVLTTFWDRVNEEEGLAREEELKSNSNFFKDLVEGGARFMRHDRENSGA
# REVLDHIFTLVPMNVQIQEEIRVEGKTLEETAAGSVHREEIDRMVAKHKKEMEDINSEIATVKKGNDALRKELEEERAELQKKITRWEDEKMDLKKGL
# DNESELRKRLEDEIRTQREKFEKAQQELQAELEKSKKGRDSVAVMEAQRKAREAERAKQEAENTLQRRMSFKHMGHEIARGIPLVPTSLAKPLFGTIG
# RGLDIVDRRRRGK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g354
###
# start gene g355
Scaffold_1	AUGUSTUS	gene	1704795	1705906	0.5	+	.	g355
Scaffold_1	AUGUSTUS	transcript	1704795	1705906	0.5	+	.	g355.t1
Scaffold_1	AUGUSTUS	start_codon	1704795	1704797	.	+	0	transcript_id "g355.t1"; gene_id "g355";
Scaffold_1	AUGUSTUS	CDS	1704795	1704862	0.5	+	0	transcript_id "g355.t1"; gene_id "g355";
Scaffold_1	AUGUSTUS	CDS	1704949	1705906	0.66	+	1	transcript_id "g355.t1"; gene_id "g355";
Scaffold_1	AUGUSTUS	stop_codon	1705904	1705906	.	+	0	transcript_id "g355.t1"; gene_id "g355";
# protein sequence = [MAADFAVDSVQFERQKSQSKYPTLFPADENPQYSTHSGDIQAVVTDGDEVRRLTNKRRAQGDALLSFIDGSLEGYGGR
# GGTKFHSHVLKSKTTSQYVLLSPLIELSLVKNFSSKTPKFSLKPAIFSPASSNVPIAGNQNHDDDCSESSQSSDSENEYHSSSKLRRSSSASLMYEDR
# AEPLSAVRPQTFMDAHLARLDLDAPSTQISPFESSDSNSSDSRPSSLGVPQLLLEAHTYPSHRTSSNNWTSGPSHDGYDLSRSSAIVRLPVSFGRDLS
# RRSGQASHLELLAPGTSILNPRQPSPYTSGSLPDTAPAAHTSNMSLSFASAGRPTSEIPCLPEYKLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g355
###
# start gene g356
Scaffold_1	AUGUSTUS	gene	1705972	1707515	0.43	+	.	g356
Scaffold_1	AUGUSTUS	transcript	1705972	1707515	0.43	+	.	g356.t1
Scaffold_1	AUGUSTUS	start_codon	1705972	1705974	.	+	0	transcript_id "g356.t1"; gene_id "g356";
Scaffold_1	AUGUSTUS	CDS	1705972	1706621	0.43	+	0	transcript_id "g356.t1"; gene_id "g356";
Scaffold_1	AUGUSTUS	CDS	1706777	1707515	0.98	+	1	transcript_id "g356.t1"; gene_id "g356";
Scaffold_1	AUGUSTUS	stop_codon	1707513	1707515	.	+	0	transcript_id "g356.t1"; gene_id "g356";
# protein sequence = [MPAIDPHTSSPPPQWEPPTTLSSSMVNALTNMAPPGDDPVHKRHGMASPRSPTEDLSLTSPVTAPAYSSSCSSLPPPP
# WANGPPQPPPSPSHSPGTAKKRKRTTVETHQNQRVARTRSPTAARTVLESVVADGTSGMDNLTTSSRPVIMYRLRTADMENGMINVVLKEDYMANFLQ
# NKAYLVEEKVKKKEKDRERRMGKKVEEIKETSLDPDRVEELLANARKAELKQEKHRQKIRELEEKVKAAEEYKRQLERQRASVRPTKVQRRTGKVEER
# EKAKKEKIMKEQRTHEAEKTERLQREQEMQELLALKERLFEARALRKHGEEGSALNRLADNPTPASEVITTPTETDALGTSETVNGHPFHRQLHTSAS
# NFTQHGTLTPQSAIPNQSVDTQYRSWEQEQSREQVIHGERIAKEQGTATVPGADSKPAPATSWNHTAVTLPGPAEDIVRQVNDLFKLLYL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g356
###
# start gene g357
Scaffold_1	AUGUSTUS	gene	1708147	1709118	0.79	+	.	g357
Scaffold_1	AUGUSTUS	transcript	1708147	1709118	0.79	+	.	g357.t1
Scaffold_1	AUGUSTUS	start_codon	1708147	1708149	.	+	0	transcript_id "g357.t1"; gene_id "g357";
Scaffold_1	AUGUSTUS	CDS	1708147	1709118	0.79	+	0	transcript_id "g357.t1"; gene_id "g357";
Scaffold_1	AUGUSTUS	stop_codon	1709116	1709118	.	+	0	transcript_id "g357.t1"; gene_id "g357";
# protein sequence = [MELWDKQDFSSFSSPLGRTISPKDGQVDIVTANVAIQGGKNEGFNGSVSSGLSLATFTEQKCVFLHPRVTPQNANALC
# ALSSSNMETSVTENLILDCVSQQGDGEDMNFGQCIIASTSFFVEESFQKFTLAPVLVQSSNACEETRVVKSPEPVQYNSPSSTANPGAQSMSLSQAST
# PTKIHQPRPLYFTSDMFPRTSLLSPFVPPLPLKTKSGDSPSAENPSFISNTDYLPPFRKQRSLPTTITSAMDKAKSSGTKCRPMPRVASFPACQESVV
# IGRPIADSIVSDLRYVTPRLVPYIPSMPVHALTIFYQKRVRCYKISSWP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g357
###
# start gene g358
Scaffold_1	AUGUSTUS	gene	1715888	1716564	0.39	+	.	g358
Scaffold_1	AUGUSTUS	transcript	1715888	1716564	0.39	+	.	g358.t1
Scaffold_1	AUGUSTUS	start_codon	1715888	1715890	.	+	0	transcript_id "g358.t1"; gene_id "g358";
Scaffold_1	AUGUSTUS	CDS	1715888	1716116	0.55	+	0	transcript_id "g358.t1"; gene_id "g358";
Scaffold_1	AUGUSTUS	CDS	1716194	1716564	0.62	+	2	transcript_id "g358.t1"; gene_id "g358";
Scaffold_1	AUGUSTUS	stop_codon	1716562	1716564	.	+	0	transcript_id "g358.t1"; gene_id "g358";
# protein sequence = [MLIGAAGNFMSPISGLSENAFKTVIEIDTVRNILLCIEYLTHPQQLGTYNTVKATIPHVRATKGAYVHVSATLHYRVH
# VSAAKAGVDAISNVVAVEEGPHGVRSNVLAPGFTSGTEGMRVMSGNKTNKTEGFSNPLGRFTEIHDVANVAVFLFSPAACYITGQVLPVDGGAEHLRG
# DFFPYPSSVVDPSSVRKLLKGKM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g358
###
# start gene g359
Scaffold_1	AUGUSTUS	gene	1719699	1720649	0.92	-	.	g359
Scaffold_1	AUGUSTUS	transcript	1719699	1720649	0.92	-	.	g359.t1
Scaffold_1	AUGUSTUS	stop_codon	1719699	1719701	.	-	0	transcript_id "g359.t1"; gene_id "g359";
Scaffold_1	AUGUSTUS	CDS	1719699	1720649	0.92	-	0	transcript_id "g359.t1"; gene_id "g359";
Scaffold_1	AUGUSTUS	start_codon	1720647	1720649	.	-	0	transcript_id "g359.t1"; gene_id "g359";
# protein sequence = [MRKRALVTSATQVQVMATADAEKEHLVGTLNNLLPELSKATDRVAIIKVKFVNGFASPKERLRDIHSSIMKSIEILRL
# VYGDLQSLLRNTEDVMHDSNLHCVLDEGGVALATMSTYRETEDGLRAFCNKVEEYADQVKEEEIQLAKGLRALWNLKDKGERVLQNPGTVKNAALKRM
# LNKISEVLDEVTDALELTRMWVALQWTSWQEDIRIHLAYEVQSNFEQCQEDLERWKALLQGEVQADITWNAARQATATAQEGLKKAWTEVEAVQLRLV
# VDVYEIQSIPAAVEEFGDIIRALLDVRTKILAGFARKQSATF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g359
###
# start gene g360
Scaffold_1	AUGUSTUS	gene	1732422	1732973	0.68	+	.	g360
Scaffold_1	AUGUSTUS	transcript	1732422	1732973	0.68	+	.	g360.t1
Scaffold_1	AUGUSTUS	start_codon	1732422	1732424	.	+	0	transcript_id "g360.t1"; gene_id "g360";
Scaffold_1	AUGUSTUS	CDS	1732422	1732973	0.68	+	0	transcript_id "g360.t1"; gene_id "g360";
Scaffold_1	AUGUSTUS	stop_codon	1732971	1732973	.	+	0	transcript_id "g360.t1"; gene_id "g360";
# protein sequence = [MTPSYQVDDVISYSFSNEDGSFPSLTYSEITPEEQQGISSLVPLLSSSDYLPDHRIGEIHRLQSAYEEYEIITSPEER
# AIVQATFNLLIRRKEEEDEQKRLREHERAMYLEQARLDLLNSCVLEVEAARAAGGHSFFPTQEQSFDYRSHTIECECCDAPSTEGTGEISPLPAFCAI
# FSGTTIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g360
###
# start gene g361
Scaffold_1	AUGUSTUS	gene	1736139	1737371	0.99	-	.	g361
Scaffold_1	AUGUSTUS	transcript	1736139	1737371	0.99	-	.	g361.t1
Scaffold_1	AUGUSTUS	stop_codon	1736139	1736141	.	-	0	transcript_id "g361.t1"; gene_id "g361";
Scaffold_1	AUGUSTUS	CDS	1736139	1737371	0.99	-	0	transcript_id "g361.t1"; gene_id "g361";
Scaffold_1	AUGUSTUS	start_codon	1737369	1737371	.	-	0	transcript_id "g361.t1"; gene_id "g361";
# protein sequence = [MENATGKPQTQCRYLLVFTVTEESGVLYLVPSENGQGKRVVRRQHPRPTSLPMDENFDAYTLETRVPLTETAETINQI
# TRTTSWTPTSPPLDEDFDAWTYTNTAGPVTGTGTIYEEDLNQLDSEDGEQDERRSGERGYDGSESQGGNKHRLRRRSVRRLGRKYSLTLSPSRASRSE
# GFWIRNEYHSTQENGRGTRPHYDPERRSVIHYEVNEMPSPIGNNGWHLDLNRKEVDEQNLGWIPEREGAGQSHWKVTRSHTGASRTRNENGQFQGEGV
# KKKDSTRSDTRRRKDHIHQTISRKGPVANDYEVVDNRVLEDGPERTVTISTWREKVANESRRSEVEMSVYYLNADDYVMDSGIEETRRKEEFRDSMKG
# QSGASRSRKGKGKQRDLLDDGWTRSDVSDYNTLNLAVA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g361
###
# start gene g362
Scaffold_1	AUGUSTUS	gene	1738935	1739240	0.73	+	.	g362
Scaffold_1	AUGUSTUS	transcript	1738935	1739240	0.73	+	.	g362.t1
Scaffold_1	AUGUSTUS	start_codon	1738935	1738937	.	+	0	transcript_id "g362.t1"; gene_id "g362";
Scaffold_1	AUGUSTUS	CDS	1738935	1739240	0.73	+	0	transcript_id "g362.t1"; gene_id "g362";
Scaffold_1	AUGUSTUS	stop_codon	1739238	1739240	.	+	0	transcript_id "g362.t1"; gene_id "g362";
# protein sequence = [MSYHYYHNQCWYVNLDIMWRRIDSWLNHPAYFTPLFTQEVSSTNYDSRVSKAQLKSKIDLMTSDVGIAGTKSLAQIMI
# GVAILDVTDMDLWNSWRLCSWLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g362
###
# start gene g363
Scaffold_1	AUGUSTUS	gene	1742377	1743819	0.93	-	.	g363
Scaffold_1	AUGUSTUS	transcript	1742377	1743819	0.93	-	.	g363.t1
Scaffold_1	AUGUSTUS	stop_codon	1742377	1742379	.	-	0	transcript_id "g363.t1"; gene_id "g363";
Scaffold_1	AUGUSTUS	CDS	1742377	1743819	0.93	-	0	transcript_id "g363.t1"; gene_id "g363";
Scaffold_1	AUGUSTUS	start_codon	1743817	1743819	.	-	0	transcript_id "g363.t1"; gene_id "g363";
# protein sequence = [MILDLNFALILASSSAMDTFPPELLIQMFAIQPPQSIQSPPNYTQVCSRWRSIAYTSPELWTTLIIELLPALKTKADA
# AYLEEALTSWVLRSRKSIDLTVYGPFFREGWDQPSELQKRLYGKVNCKIIVKFSNKWRRLITPYTWDAHNFPHSLKHFAALEELQVAVGTCPLSTSNH
# STFTKAPRLFKLNLDLPMSPSFACLETLIPVTVSDLTLSSDPGVFGVSEGFMRGFLQLEQLQNLTHMDFSRVGWTTPHVLPSTILPHLQELTLGGTIT
# ALGDFLGVLTLPSLRKLSLSTSRFDGNGDHGPVVGPALIDLLKRSYRDKCGLLALSLTWMLARDINSGQAITLEALCHILSAASTITELHIRSEGHTD
# TARLMEILRYDGVSPEKQILPHLKSFSAESLSDLDQGYFLDFIYSRWWPDGSQPVVGVSKLQKLILSGCTLTEKTREQLDICYNEAWEDMAGREPHLG
# SPGVRRLMQR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g363
###
# start gene g364
Scaffold_1	AUGUSTUS	gene	1754624	1755736	0.41	+	.	g364
Scaffold_1	AUGUSTUS	transcript	1754624	1755736	0.41	+	.	g364.t1
Scaffold_1	AUGUSTUS	start_codon	1754624	1754626	.	+	0	transcript_id "g364.t1"; gene_id "g364";
Scaffold_1	AUGUSTUS	CDS	1754624	1755736	0.41	+	0	transcript_id "g364.t1"; gene_id "g364";
Scaffold_1	AUGUSTUS	stop_codon	1755734	1755736	.	+	0	transcript_id "g364.t1"; gene_id "g364";
# protein sequence = [MDAHNLSVVLCPNLVSGASPIRDVQMCAVPGGPALFEQQEQQQQPSSLPSSSSIPSLSISNKATASAEGKTTLGAIIK
# LCIQRYYEVFDEVVDPSEAIVAHPMSEADYAAGYGGGDRYELRDSTPERSRDASAEPSDDELQQHQQRAWKGNAGFQGFPQPGSVIGNGFHERSDFVP
# QSRIDNHKRNSSGFHTNPDDDEDIDDAMLVMPIGPNHGRHTDPNGGGPSTSSSSSSMSPQPHPQHRNTLSNGSRRSKPTRSVHTDYGVPPSSFSSSSL
# AQSASYATYSRGKARSTISIEKGSGSTIGPGKKGSISIGRGTNRKSTGSGVAAIGVTAEGFFAPPSGVEVPPVPPLPGRGIGNGRAIPGEEGETRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g364
###
# start gene g365
Scaffold_1	AUGUSTUS	gene	1762199	1762894	0.37	-	.	g365
Scaffold_1	AUGUSTUS	transcript	1762199	1762894	0.37	-	.	g365.t1
Scaffold_1	AUGUSTUS	stop_codon	1762199	1762201	.	-	0	transcript_id "g365.t1"; gene_id "g365";
Scaffold_1	AUGUSTUS	CDS	1762199	1762894	0.37	-	0	transcript_id "g365.t1"; gene_id "g365";
Scaffold_1	AUGUSTUS	start_codon	1762892	1762894	.	-	0	transcript_id "g365.t1"; gene_id "g365";
# protein sequence = [MKHVRFSSINALYSPVPSTPYVFTTSTSTSSSRSSHSEDSKPSRRRRHVSKLTTHSRSKSLDIPAPITRIHYLLAFSP
# YQLPPIPYHLSTHPSITKSFISADVLSEPATDPPVSSLIITCPHLQWEFTVTPSSRKASCVSVIDVLYALYRGLRIAVHPVEYKALPSPEAVANVNEA
# YYSRCNSILEAQARQEEQSKGIKRVDFLIGRTRFLGLSKKSRRRDDGLVWELNVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g365
###
# start gene g366
Scaffold_1	AUGUSTUS	gene	1776776	1777114	0.71	-	.	g366
Scaffold_1	AUGUSTUS	transcript	1776776	1777114	0.71	-	.	g366.t1
Scaffold_1	AUGUSTUS	stop_codon	1776776	1776778	.	-	0	transcript_id "g366.t1"; gene_id "g366";
Scaffold_1	AUGUSTUS	CDS	1776776	1777114	0.71	-	0	transcript_id "g366.t1"; gene_id "g366";
Scaffold_1	AUGUSTUS	start_codon	1777112	1777114	.	-	0	transcript_id "g366.t1"; gene_id "g366";
# protein sequence = [MVGCLLNDDASELDDPMTTTPTIKLLHLSFGCELPELVKQYLMASAVDDLLQILVQPMSSESDKSIRRTKVDEITMDL
# PITTIADSLPMTFQTGSLNFGKTDVWWWWQPTYL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g366
###
# start gene g367
Scaffold_1	AUGUSTUS	gene	1780180	1780998	0.25	+	.	g367
Scaffold_1	AUGUSTUS	transcript	1780180	1780998	0.25	+	.	g367.t1
Scaffold_1	AUGUSTUS	start_codon	1780180	1780182	.	+	0	transcript_id "g367.t1"; gene_id "g367";
Scaffold_1	AUGUSTUS	CDS	1780180	1780337	0.26	+	0	transcript_id "g367.t1"; gene_id "g367";
Scaffold_1	AUGUSTUS	CDS	1780638	1780998	0.76	+	1	transcript_id "g367.t1"; gene_id "g367";
Scaffold_1	AUGUSTUS	stop_codon	1780996	1780998	.	+	0	transcript_id "g367.t1"; gene_id "g367";
# protein sequence = [MWLSHYVGGTGRRKIIHQGDSKFMMDLTLPLQPMRILYWMGMMEILALVLGSEGCHAVQCDCTDIQNNARFNIISFGP
# GFPFQAPENPDAYFSSPIPTISEDIAGAARPGKWMVKLLRIGISSADRNDYSWIDMDSPQTSSSIIQGIDILMDTGKKQRIALVLNLKLIQEPQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g367
###
# start gene g368
Scaffold_1	AUGUSTUS	gene	1782774	1783946	0.36	-	.	g368
Scaffold_1	AUGUSTUS	transcript	1782774	1783946	0.36	-	.	g368.t1
Scaffold_1	AUGUSTUS	stop_codon	1782774	1782776	.	-	0	transcript_id "g368.t1"; gene_id "g368";
Scaffold_1	AUGUSTUS	CDS	1782774	1783946	0.36	-	0	transcript_id "g368.t1"; gene_id "g368";
Scaffold_1	AUGUSTUS	start_codon	1783944	1783946	.	-	0	transcript_id "g368.t1"; gene_id "g368";
# protein sequence = [MPDLPQELIDRFVDDHSESTEDLKNLSLVGRCWLHRARYHLFRLITLAPQDPKEIREYYAYLRRRVSMPARGGRNHYH
# ALTSSEQRLLHSSLTQNPQPQKQFLSSFSDTLPYVRGLRLESSIRIGGGRKIPPMEYFHRWLGYGNEYAEESLLMRDLVSYDDNFLEKQNERWEAVDL
# PWGHRAGLHELPFRNLRYLHIQWSAFGWISSSPVAEDDGDFPDSVNPDMWPGYQLGKLLKSSADTLNHVSIDEYPGFQLEQYGTPPHGTDALLDILAE
# NAPNLKSLCLGGLMVPRRMSPHPMHDHHIDSPDPVPFFSRDRPAYRTGEEVPPVYSDPIYNDGTTPRQAIRLSLERLYLRGFDSKSTLLIEDVLLNRG
# NPFIQYRISCSIGNAGKF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g368
###
# start gene g369
Scaffold_1	AUGUSTUS	gene	1784395	1785834	1	+	.	g369
Scaffold_1	AUGUSTUS	transcript	1784395	1785834	1	+	.	g369.t1
Scaffold_1	AUGUSTUS	start_codon	1784395	1784397	.	+	0	transcript_id "g369.t1"; gene_id "g369";
Scaffold_1	AUGUSTUS	CDS	1784395	1785834	1	+	0	transcript_id "g369.t1"; gene_id "g369";
Scaffold_1	AUGUSTUS	stop_codon	1785832	1785834	.	+	0	transcript_id "g369.t1"; gene_id "g369";
# protein sequence = [MTRLASFSFDFNKLILQSSSLNQFPPELLTRIFAIYPPQTIQSPLNYTQVCSRWRSVAYSSPELWTTLVIEHPPALET
# ESDATYYEAALTSWVLRCSDLSVDISFLGRYYRGTWDLPSQFQISLYVPICNKLLVDFSNKWRRLKAPYFWSAHFFPSSLKQFAALEELELGVGNCSP
# PKNDHTPFPKTPRLFKLSLNLSRILRFHCIKDFIPETVRDLTVTSASGPIGISGDFAIEFLQPKRLQHLTHMDMSQFGWTTPHVLPSITLPRLQELTL
# DGAITALGDILGVFTLPSLRKLSLSISRFDGDGEHGPVVGPALIALLKRSYHDQCGLVALGLTSMLASDNSNEAISLEALHCILSLASTIKELHICSE
# GYTDTARLMEILRYDRVSPEKQILPLLTTFSVESLINLDQDFLDFVHSRWWPNNSSPRMVGVAKLEKLIVSYCDLTEEIEEQLDACYEGGLEVEVEVE
# SSEQSSILE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g369
###
# start gene g370
Scaffold_1	AUGUSTUS	gene	1786990	1787585	0.84	+	.	g370
Scaffold_1	AUGUSTUS	transcript	1786990	1787585	0.84	+	.	g370.t1
Scaffold_1	AUGUSTUS	start_codon	1786990	1786992	.	+	0	transcript_id "g370.t1"; gene_id "g370";
Scaffold_1	AUGUSTUS	CDS	1786990	1787131	0.84	+	0	transcript_id "g370.t1"; gene_id "g370";
Scaffold_1	AUGUSTUS	CDS	1787194	1787585	0.99	+	2	transcript_id "g370.t1"; gene_id "g370";
Scaffold_1	AUGUSTUS	stop_codon	1787583	1787585	.	+	0	transcript_id "g370.t1"; gene_id "g370";
# protein sequence = [MLNAIVSRVSAADSLVQPTEIDNPMRLVALYKQAAINAKEAGFDGIEVHGEEAISSTSSSIADQISAQTAGVGLLRIA
# RGSGWKYLELLLTFGGPIEWVSSSIQLEGIMIWGKLVGTMFGLSVTYLIENHDRMPLEETLETYNYFITQVDQLGLAYIAIQRYSEFDDPIIEGAQSY
# L]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g370
###
# start gene g371
Scaffold_1	AUGUSTUS	gene	1791547	1792437	0.79	-	.	g371
Scaffold_1	AUGUSTUS	transcript	1791547	1792437	0.79	-	.	g371.t1
Scaffold_1	AUGUSTUS	stop_codon	1791547	1791549	.	-	0	transcript_id "g371.t1"; gene_id "g371";
Scaffold_1	AUGUSTUS	CDS	1791547	1792306	0.79	-	1	transcript_id "g371.t1"; gene_id "g371";
Scaffold_1	AUGUSTUS	CDS	1792400	1792437	0.79	-	0	transcript_id "g371.t1"; gene_id "g371";
Scaffold_1	AUGUSTUS	start_codon	1792435	1792437	.	-	0	transcript_id "g371.t1"; gene_id "g371";
# protein sequence = [MDSLILTKTNLHKYNKGFQTLFFAFHVDLAMQRPADSVIKVAGDAWIKLRFLVPTIASLVILDDNDIPSLQYYSPSTS
# ELQKWVDQTFTVHRKSGSVNLGALRSELGLGKVPSDNGQQTWMHLSISYSNTISSMGLMIHTHHSPFDGTAMKVLANLYLKEFAKGLSGENVTGDLKW
# GAEVDHLLPAAFNVMRPTEPIPIDPSSVEEPSFAHPFYAASRSVIEAFVFNSQVCSYSIDNLAHNQLMILEWLLSQAQERRSWMACYVA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g371
###
# start gene g372
Scaffold_1	AUGUSTUS	gene	1798512	1799698	0.53	+	.	g372
Scaffold_1	AUGUSTUS	transcript	1798512	1799698	0.53	+	.	g372.t1
Scaffold_1	AUGUSTUS	start_codon	1798512	1798514	.	+	0	transcript_id "g372.t1"; gene_id "g372";
Scaffold_1	AUGUSTUS	CDS	1798512	1798944	0.53	+	0	transcript_id "g372.t1"; gene_id "g372";
Scaffold_1	AUGUSTUS	CDS	1799076	1799698	0.53	+	2	transcript_id "g372.t1"; gene_id "g372";
Scaffold_1	AUGUSTUS	stop_codon	1799696	1799698	.	+	0	transcript_id "g372.t1"; gene_id "g372";
# protein sequence = [MVAPTQGRSITQIESPILQAIACYTGKQPQHCATSNSPRDPPPHFNLDAGNHDYQDPPVDPDDPGADSNNPDNDNPDD
# DSSGLPRGGPGDPSGPCTPISPDIPNEQHAMLELLAGFKGSIETLGTILAALNQPSDSSESKSKVKAKEWFVPDIVDLDLDSLPAWTSLFKAPVKELQ
# DNFGIYDAQGKAEDSLSNLKMKETENIWFNTLATSTNWDSAALKWAYGRDLAEHIKDEMAHLPEPVTLTDYHQEVLCIDNRYWKREETKKHEAGMPFI
# AWNPKKGSSDFKAGSTNQQNNIQPLGSSALFTPKPKPFNGGKPNNSGKPQNFLNSGEPAVSAPHSIISVQMGKFFLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g372
###
# start gene g373
Scaffold_1	AUGUSTUS	gene	1800471	1801637	0.82	+	.	g373
Scaffold_1	AUGUSTUS	transcript	1800471	1801637	0.82	+	.	g373.t1
Scaffold_1	AUGUSTUS	start_codon	1800471	1800473	.	+	0	transcript_id "g373.t1"; gene_id "g373";
Scaffold_1	AUGUSTUS	CDS	1800471	1801637	0.82	+	0	transcript_id "g373.t1"; gene_id "g373";
Scaffold_1	AUGUSTUS	stop_codon	1801635	1801637	.	+	0	transcript_id "g373.t1"; gene_id "g373";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g373
###
# start gene g374
Scaffold_1	AUGUSTUS	gene	1806722	1808138	0.24	+	.	g374
Scaffold_1	AUGUSTUS	transcript	1806722	1808138	0.24	+	.	g374.t1
Scaffold_1	AUGUSTUS	start_codon	1806722	1806724	.	+	0	transcript_id "g374.t1"; gene_id "g374";
Scaffold_1	AUGUSTUS	CDS	1806722	1807230	0.24	+	0	transcript_id "g374.t1"; gene_id "g374";
Scaffold_1	AUGUSTUS	CDS	1807283	1808138	0.68	+	1	transcript_id "g374.t1"; gene_id "g374";
Scaffold_1	AUGUSTUS	stop_codon	1808136	1808138	.	+	0	transcript_id "g374.t1"; gene_id "g374";
# protein sequence = [MLVWNPSFFVLFTQRSWPVPPTTPLLLLLSLHYITPGIEYAEFADIFDEIAADTLPEHKPYDLKIDLEEGASLPLSRI
# YLLSEKELVALKDFIDKHLATGAITPSPSPHNTPVLFVPKKDGRLWLCMDFCGLTTSPRRTTTLCCCSWTSSTLQKELKSIPIWTLLTLIIYSYEWKV
# MPFGLTNAPAAFQCFVNDIFSDMLDACVIVYLDDILIYSDTLEEHQEHVKELLQWSRKHRLYTNPDKCEFNMDTVEHLGYILSPDGLTMSKEKVQTIL
# EWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGAPWIWDNDCQEAFENLKIAFTSAPILAHWEPNRPIIVETNASDYAIVAILSIQTVD
# SEIHPLASFPELFTLRSSTTTHTTKSSLPSSKPLKLGVIIWKVLAIRWTLSPITKILSIFLLPRFSPVDRSIGQSISTNSTW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g374
###
# start gene g375
Scaffold_1	AUGUSTUS	gene	1808739	1809221	0.66	+	.	g375
Scaffold_1	AUGUSTUS	transcript	1808739	1809221	0.66	+	.	g375.t1
Scaffold_1	AUGUSTUS	start_codon	1808739	1808741	.	+	0	transcript_id "g375.t1"; gene_id "g375";
Scaffold_1	AUGUSTUS	CDS	1808739	1809221	0.66	+	0	transcript_id "g375.t1"; gene_id "g375";
Scaffold_1	AUGUSTUS	stop_codon	1809219	1809221	.	+	0	transcript_id "g375.t1"; gene_id "g375";
# protein sequence = [MDFIEQLPMSNGYTAILVVVDQSSKQAIFIPTFDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKV
# LSMELHYTSGYHPEANGQTERVNQTLEQYIRIIVPTNKMTGHPYFRSPSLPITTLQCFHWYYSVLLLTKDTIPISPFGPRST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g375
###
# start gene g376
Scaffold_1	AUGUSTUS	gene	1816602	1817531	0.6	-	.	g376
Scaffold_1	AUGUSTUS	transcript	1816602	1817531	0.6	-	.	g376.t1
Scaffold_1	AUGUSTUS	stop_codon	1816602	1816604	.	-	0	transcript_id "g376.t1"; gene_id "g376";
Scaffold_1	AUGUSTUS	CDS	1816602	1817531	0.6	-	0	transcript_id "g376.t1"; gene_id "g376";
Scaffold_1	AUGUSTUS	start_codon	1817529	1817531	.	-	0	transcript_id "g376.t1"; gene_id "g376";
# protein sequence = [MSAMSTERPSSSKLESKKQKSALSRGNTTQAQKPSQAASSTTITVVAGQRLVPIPEQSFGDKPSEDVKTPKGRQPMTR
# EPPPVDPGPTGMTMGPPQWRYASMGYAQTTSSPMGGFAYSPTWGMRGPPPGPVPQLDMESASNAGGRVSSQVATIERIQGENADPLTLQQREKLPERV
# SEQSRALSRRLPTPPAQSLNPPPPRRGSSLSSLLRSPAVNTPNWERTHAIHHSRTNFPVQPLSEMTLWLEDFIRIQECTPEDIALVLQEVLEMMGIKI
# LGNGIEFSDLRVQFLAVGTQLEIDLSGKAVRPGSE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g376
###
# start gene g377
Scaffold_1	AUGUSTUS	gene	1819719	1820318	1	+	.	g377
Scaffold_1	AUGUSTUS	transcript	1819719	1820318	1	+	.	g377.t1
Scaffold_1	AUGUSTUS	start_codon	1819719	1819721	.	+	0	transcript_id "g377.t1"; gene_id "g377";
Scaffold_1	AUGUSTUS	CDS	1819719	1820318	1	+	0	transcript_id "g377.t1"; gene_id "g377";
Scaffold_1	AUGUSTUS	stop_codon	1820316	1820318	.	+	0	transcript_id "g377.t1"; gene_id "g377";
# protein sequence = [MAASTNWDSAALKWAYGRGLAERIKDEMARLPEPAMLADYHQEVLRIDNRYWKREETRKREAGKPFVAWNPKKGSSDF
# KTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNFGQSGGQRPAFNHLGADGKVLPSERERRKKNNLCLFCGGKHQIADCNKRKARESK
# GRAAKVEETPEATIEVVEEESEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g377
###
# start gene g378
Scaffold_1	AUGUSTUS	gene	1822231	1823268	1	+	.	g378
Scaffold_1	AUGUSTUS	transcript	1822231	1823268	1	+	.	g378.t1
Scaffold_1	AUGUSTUS	start_codon	1822231	1822233	.	+	0	transcript_id "g378.t1"; gene_id "g378";
Scaffold_1	AUGUSTUS	CDS	1822231	1823268	1	+	0	transcript_id "g378.t1"; gene_id "g378";
Scaffold_1	AUGUSTUS	stop_codon	1823266	1823268	.	+	0	transcript_id "g378.t1"; gene_id "g378";
# protein sequence = [MNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLK
# EFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPT
# MTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVKQNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQP
# RRQQISATAAPFTLFPNESVQIAASIPTPVAGPATPSPANQDFSTQIGQIRELLDRANAMSPPSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g378
###
# start gene g379
Scaffold_1	AUGUSTUS	gene	1823319	1826828	0.99	+	.	g379
Scaffold_1	AUGUSTUS	transcript	1823319	1826828	0.99	+	.	g379.t1
Scaffold_1	AUGUSTUS	start_codon	1823319	1823321	.	+	0	transcript_id "g379.t1"; gene_id "g379";
Scaffold_1	AUGUSTUS	CDS	1823319	1826828	0.99	+	0	transcript_id "g379.t1"; gene_id "g379";
Scaffold_1	AUGUSTUS	stop_codon	1826826	1826828	.	+	0	transcript_id "g379.t1"; gene_id "g379";
# protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN
# EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA
# SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD
# IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE
# VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ
# QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII
# TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQV
# LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ
# RHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLA
# RLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE
# ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFMSTNYIHGKVTP
# SMAKYQHHQSRCT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g379
###
# start gene g380
Scaffold_1	AUGUSTUS	gene	1827717	1828370	0.87	+	.	g380
Scaffold_1	AUGUSTUS	transcript	1827717	1828370	0.87	+	.	g380.t1
Scaffold_1	AUGUSTUS	start_codon	1827717	1827719	.	+	0	transcript_id "g380.t1"; gene_id "g380";
Scaffold_1	AUGUSTUS	CDS	1827717	1828370	0.87	+	0	transcript_id "g380.t1"; gene_id "g380";
Scaffold_1	AUGUSTUS	stop_codon	1828368	1828370	.	+	0	transcript_id "g380.t1"; gene_id "g380";
# protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFNAENPP
# FGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAI
# SVDVYLHDPTMTGRNSGYPPRIPLILPLLTPTLWTLMQPHQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g380
###
# start gene g381
Scaffold_1	AUGUSTUS	gene	1829158	1831452	0.92	+	.	g381
Scaffold_1	AUGUSTUS	transcript	1829158	1831452	0.92	+	.	g381.t1
Scaffold_1	AUGUSTUS	start_codon	1829158	1829160	.	+	0	transcript_id "g381.t1"; gene_id "g381";
Scaffold_1	AUGUSTUS	CDS	1829158	1831452	0.92	+	0	transcript_id "g381.t1"; gene_id "g381";
Scaffold_1	AUGUSTUS	stop_codon	1831450	1831452	.	+	0	transcript_id "g381.t1"; gene_id "g381";
# protein sequence = [MDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPELEPPAENP
# HIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLP
# AHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRL
# QGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRL
# EKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFD
# TLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSN
# LEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLK
# TVKEHGLQRLANGIAEWEETMGWSTTEVEYTYQQTTTYALRYSVNATTIQLQDTPDYTGHSTWSVPISGGLRCALLWKNTLRDARFVPVRRSSDTHGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g381
###
# start gene g382
Scaffold_1	AUGUSTUS	gene	1853716	1854269	0.37	-	.	g382
Scaffold_1	AUGUSTUS	transcript	1853716	1854269	0.37	-	.	g382.t1
Scaffold_1	AUGUSTUS	stop_codon	1853716	1853718	.	-	0	transcript_id "g382.t1"; gene_id "g382";
Scaffold_1	AUGUSTUS	CDS	1853716	1854170	0.78	-	2	transcript_id "g382.t1"; gene_id "g382";
Scaffold_1	AUGUSTUS	CDS	1854254	1854269	0.38	-	0	transcript_id "g382.t1"; gene_id "g382";
Scaffold_1	AUGUSTUS	start_codon	1854267	1854269	.	-	0	transcript_id "g382.t1"; gene_id "g382";
# protein sequence = [MKYEQVGHYIVDAVGNPDPVEGVNVAKDDALSYPKFSRREYPSVINDLMDPVVTPFVEKCVGISNTLIEIFNDKLGLP
# EGTLAKFHKREEFSSSETRTIKAPANLTPGKLAIGGHTDFGTLTLLVNNLGGLQVLPPGTTEWRYARVSMFDNWDGSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g382
###
# start gene g383
Scaffold_1	AUGUSTUS	gene	1856296	1856766	0.47	+	.	g383
Scaffold_1	AUGUSTUS	transcript	1856296	1856766	0.47	+	.	g383.t1
Scaffold_1	AUGUSTUS	start_codon	1856296	1856298	.	+	0	transcript_id "g383.t1"; gene_id "g383";
Scaffold_1	AUGUSTUS	CDS	1856296	1856766	0.47	+	0	transcript_id "g383.t1"; gene_id "g383";
Scaffold_1	AUGUSTUS	stop_codon	1856764	1856766	.	+	0	transcript_id "g383.t1"; gene_id "g383";
# protein sequence = [MNRGSSSSLSSTPRIPELKAAFDALASGHRINGHLTLTVSTLDELAYQYHVLSGKWMIFANRDTIDALWRDVVQMVCM
# YRKRGTAKVSVNEDDRDNRVICVYVENFADFEEVRGLREDLRTVVGVKKKIPFKMDAYTHMGIYTGNQWGIPPTRWFE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g383
###
# start gene g384
Scaffold_1	AUGUSTUS	gene	1857635	1857928	0.94	-	.	g384
Scaffold_1	AUGUSTUS	transcript	1857635	1857928	0.94	-	.	g384.t1
Scaffold_1	AUGUSTUS	stop_codon	1857635	1857637	.	-	0	transcript_id "g384.t1"; gene_id "g384";
Scaffold_1	AUGUSTUS	CDS	1857635	1857928	0.94	-	0	transcript_id "g384.t1"; gene_id "g384";
Scaffold_1	AUGUSTUS	start_codon	1857926	1857928	.	-	0	transcript_id "g384.t1"; gene_id "g384";
# protein sequence = [MGQLHGVLNPQQPLLNMSKMILREDHPQTLEMIQALTMTLWHLKRKDDALELGQTLPEGLRIFWAKQIPSPTPLPTSI
# ASDLPKEQDWEIIPIEYVE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g384
###
# start gene g385
Scaffold_1	AUGUSTUS	gene	1859445	1859867	0.88	-	.	g385
Scaffold_1	AUGUSTUS	transcript	1859445	1859867	0.88	-	.	g385.t1
Scaffold_1	AUGUSTUS	stop_codon	1859445	1859447	.	-	0	transcript_id "g385.t1"; gene_id "g385";
Scaffold_1	AUGUSTUS	CDS	1859445	1859867	0.88	-	0	transcript_id "g385.t1"; gene_id "g385";
Scaffold_1	AUGUSTUS	start_codon	1859865	1859867	.	-	0	transcript_id "g385.t1"; gene_id "g385";
# protein sequence = [MSTQHCSLSRLTKIYFSKANTEQSIQASYFVIVIDNGIVQAQDWHAGIHWLHSNEESWFIIMDNADDPKIHLAKYLPS
# CGHGNIIITSRNPDLQDVAAQSLEVQNMVPTEGIQLLSEKAVGGPLTADQEKKVAQIAKKLH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g385
###
# start gene g386
Scaffold_1	AUGUSTUS	gene	1861438	1862214	0.88	+	.	g386
Scaffold_1	AUGUSTUS	transcript	1861438	1862214	0.88	+	.	g386.t1
Scaffold_1	AUGUSTUS	start_codon	1861438	1861440	.	+	0	transcript_id "g386.t1"; gene_id "g386";
Scaffold_1	AUGUSTUS	CDS	1861438	1862214	0.88	+	0	transcript_id "g386.t1"; gene_id "g386";
Scaffold_1	AUGUSTUS	stop_codon	1862212	1862214	.	+	0	transcript_id "g386.t1"; gene_id "g386";
# protein sequence = [MTKTSLIVPLLQTSSFSSSTPYVKYLPTIFSPASHVPYMTTTNNWITAYFNEYTASLSNVERFTRYCRPSFRLNYNQL
# QSQSGPDNFVIPTTKWIAVNRGLSSLESTSLPRIPELKAAFDALASVHQTNGHSILTVSKLDNLAIKYNILSGKWLIFTSVNTVDALWQDVVQMVCMY
# RQRGFAKVSVNQEEEVGKMNNSRVICVYVEDFTDLEEVRSLRDDLRTVVGVERKIPFKMDAYSHMGIYKGNKWGISPARWFE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g386
###
# start gene g387
Scaffold_1	AUGUSTUS	gene	1886701	1887246	0.97	+	.	g387
Scaffold_1	AUGUSTUS	transcript	1886701	1887246	0.97	+	.	g387.t1
Scaffold_1	AUGUSTUS	start_codon	1886701	1886703	.	+	0	transcript_id "g387.t1"; gene_id "g387";
Scaffold_1	AUGUSTUS	CDS	1886701	1887246	0.97	+	0	transcript_id "g387.t1"; gene_id "g387";
Scaffold_1	AUGUSTUS	stop_codon	1887244	1887246	.	+	0	transcript_id "g387.t1"; gene_id "g387";
# protein sequence = [MLNFYAVYPCTVYSRIVLLNARVAGRPIEANLTLGIIHAGQKYEHWLLAIGNDQAGSELLSAVVKFDKHGNTLPVEYL
# IAHKSDRRKFTDYNPVPEVTQLGKASFKDEKEKENIIKDILAIEIDVPSNQKGGNCMDFIKSALKLMKDKGNVDESVVGKYDDVYKKRYHDVVKKVFD
# ADLQP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g387
###
# start gene g388
Scaffold_1	AUGUSTUS	gene	1890072	1890485	0.35	-	.	g388
Scaffold_1	AUGUSTUS	transcript	1890072	1890485	0.35	-	.	g388.t1
Scaffold_1	AUGUSTUS	stop_codon	1890072	1890074	.	-	0	transcript_id "g388.t1"; gene_id "g388";
Scaffold_1	AUGUSTUS	CDS	1890072	1890485	0.35	-	0	transcript_id "g388.t1"; gene_id "g388";
Scaffold_1	AUGUSTUS	start_codon	1890483	1890485	.	-	0	transcript_id "g388.t1"; gene_id "g388";
# protein sequence = [MDEIGNEIMNVVGMDISNNSGNLLGGAFHNFQVMLDPPTRSQEQQATPGEGTIAPRLLDVRVDDTPHEIASMYSTAMG
# VKDEYNMNFNENQLFVIPSYPGYMGPGDEHGPQDHDVGNAERVMAALQRRFSRVQTVRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g388
###
# start gene g389
Scaffold_1	AUGUSTUS	gene	1895706	1896005	0.51	-	.	g389
Scaffold_1	AUGUSTUS	transcript	1895706	1896005	0.51	-	.	g389.t1
Scaffold_1	AUGUSTUS	stop_codon	1895706	1895708	.	-	0	transcript_id "g389.t1"; gene_id "g389";
Scaffold_1	AUGUSTUS	CDS	1895706	1896005	0.51	-	0	transcript_id "g389.t1"; gene_id "g389";
Scaffold_1	AUGUSTUS	start_codon	1896003	1896005	.	-	0	transcript_id "g389.t1"; gene_id "g389";
# protein sequence = [MRAMILANIATEADLANGTRGTVTDIVLDDREPVNHEVKDGATPAALPPAIVYFKPDGNTSVRLEGFPVGLLPIVPQS
# NKFVAAVEITRVVPFYGVNSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g389
###
# start gene g390
Scaffold_1	AUGUSTUS	gene	1898159	1899484	0.98	-	.	g390
Scaffold_1	AUGUSTUS	transcript	1898159	1899484	0.98	-	.	g390.t1
Scaffold_1	AUGUSTUS	stop_codon	1898159	1898161	.	-	0	transcript_id "g390.t1"; gene_id "g390";
Scaffold_1	AUGUSTUS	CDS	1898159	1899484	0.98	-	0	transcript_id "g390.t1"; gene_id "g390";
Scaffold_1	AUGUSTUS	start_codon	1899482	1899484	.	-	0	transcript_id "g390.t1"; gene_id "g390";
# protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS
# PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL
# MNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGF
# LGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ
# PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLPADKPDGPSICHGLTFI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g390
###
# start gene g391
Scaffold_1	AUGUSTUS	gene	1900572	1901410	0.38	-	.	g391
Scaffold_1	AUGUSTUS	transcript	1900572	1901410	0.38	-	.	g391.t1
Scaffold_1	AUGUSTUS	stop_codon	1900572	1900574	.	-	0	transcript_id "g391.t1"; gene_id "g391";
Scaffold_1	AUGUSTUS	CDS	1900572	1901098	0.49	-	2	transcript_id "g391.t1"; gene_id "g391";
Scaffold_1	AUGUSTUS	CDS	1901245	1901410	0.38	-	0	transcript_id "g391.t1"; gene_id "g391";
Scaffold_1	AUGUSTUS	start_codon	1901408	1901410	.	-	0	transcript_id "g391.t1"; gene_id "g391";
# protein sequence = [MSTPVPPAPNTPAEDLMAQLILQVANLATAMEERSSSKSSMNKPEVFKGKDGTEAQNPPFGGNWDTFLKEFSQRFEPM
# DPGMEARSKIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIELRERFFTALLPEIRQHLITINIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYP
# PTHTAHTTPADPHAMDIDATHTSNGNTREAFLARIRGRCFGCGAQGHVKQNCPH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g391
###
# start gene g392
Scaffold_1	AUGUSTUS	gene	1902069	1903517	0.95	-	.	g392
Scaffold_1	AUGUSTUS	transcript	1902069	1903517	0.95	-	.	g392.t1
Scaffold_1	AUGUSTUS	stop_codon	1902069	1902071	.	-	0	transcript_id "g392.t1"; gene_id "g392";
Scaffold_1	AUGUSTUS	CDS	1902069	1903517	0.95	-	0	transcript_id "g392.t1"; gene_id "g392";
Scaffold_1	AUGUSTUS	start_codon	1903515	1903517	.	-	0	transcript_id "g392.t1"; gene_id "g392";
# protein sequence = [MDQTLTLDIQERAEGSVSDAEVYEAQQKEGMAQELYAYVAMECAFGAGVFDREYEIDDGVETAGRCSIDDKVDFQQWH
# QQLVDYTATGGLLVENEMVDIGRVTVNPPTVAGVSVVAHGEDDPTAGGVGGNLRKMLNEEQARAHDIVVDHILRTVNGNPPPQLFMLLLGPGGTGKTV
# VINAINETMTKLGVGGWLAKTATTGVAASHFGGKTLHSWAGIKVAAKASDDLIGNASAAVQKRRTANIGLPRYLLCNECSMATKELVGRTSTICSHVA
# TVENKNYSDSYFGGMNVVLCGDFHQFPPVGQPNGALYLPNAPGANSYAVLGRHLFSQFTTVVMLKKQICVKDTRWMELLDRLRIGACNADDMEQLQKL
# RLDVDTNPPVNFAQPGWNSCILITPRNSVRRKWNKAALRRHCKLHATRLYSCPAEDTIGGIPLSNEQLLRIARLDSVIKYAAPIIFLFSLSRRLYLYD
# TSSHHCQTPIDY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g392
###
# start gene g393
Scaffold_1	AUGUSTUS	gene	1906133	1906858	0.62	-	.	g393
Scaffold_1	AUGUSTUS	transcript	1906133	1906858	0.62	-	.	g393.t1
Scaffold_1	AUGUSTUS	stop_codon	1906133	1906135	.	-	0	transcript_id "g393.t1"; gene_id "g393";
Scaffold_1	AUGUSTUS	CDS	1906133	1906858	0.62	-	0	transcript_id "g393.t1"; gene_id "g393";
Scaffold_1	AUGUSTUS	start_codon	1906856	1906858	.	-	0	transcript_id "g393.t1"; gene_id "g393";
# protein sequence = [MCIQSLSGSPAKRPPLSLSNNLWIGDVPFELRILTLCERVLVSRLFSAAYIIKLYPKSQGARGWPKEMLTSAVKGNMS
# SYFLNTEDIVGMIDPGFVPPCPGILTATIGVTFIGPQNIPLKFLPPYLRVRRKRVKDALEWLIRNNPLYLGLKLSAQHLALLPEDGVPPEVLDNLKWI
# DDVRVLDRENGGYVPNLESPENDEDEVASGEGTVGDDVVEVFHPSYGMISDNAQCLLSILTDMRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g393
###
# start gene g394
Scaffold_1	AUGUSTUS	gene	1938178	1939149	0.99	+	.	g394
Scaffold_1	AUGUSTUS	transcript	1938178	1939149	0.99	+	.	g394.t1
Scaffold_1	AUGUSTUS	start_codon	1938178	1938180	.	+	0	transcript_id "g394.t1"; gene_id "g394";
Scaffold_1	AUGUSTUS	CDS	1938178	1939149	0.99	+	0	transcript_id "g394.t1"; gene_id "g394";
Scaffold_1	AUGUSTUS	stop_codon	1939147	1939149	.	+	0	transcript_id "g394.t1"; gene_id "g394";
# protein sequence = [MNGSLDILFASNGDPDFDIDPLSDLDPKHLNAPLDDMGARIELKNALGSQPDVPQTLTSQINFWAWIGSNPLFNGPSS
# TLDHNTPNTNSFDNSIVDQPQNFSLNITTGSLDANAEQDILQTNSSLGSLASTDITSALSASVTPLSAFQTFEADPNAFHNFNPFDNTVIDQPQNFDL
# NVMTGDIPEYNAYSGNGGSVNWGPSAFASDANMSAACNTTVHPTFDSFKDDPSCSNGFNPFDNALVAQPHNCTPSLEVSRGDLDFNSGQSGLANFDTN
# AVPSIFADNSNVSISSYPASGYPSAPLPSTVQADSLSAKRSGSNPSRPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g394
###
# start gene g395
Scaffold_1	AUGUSTUS	gene	1939217	1939546	0.78	+	.	g395
Scaffold_1	AUGUSTUS	transcript	1939217	1939546	0.78	+	.	g395.t1
Scaffold_1	AUGUSTUS	start_codon	1939217	1939219	.	+	0	transcript_id "g395.t1"; gene_id "g395";
Scaffold_1	AUGUSTUS	CDS	1939217	1939546	0.78	+	0	transcript_id "g395.t1"; gene_id "g395";
Scaffold_1	AUGUSTUS	stop_codon	1939544	1939546	.	+	0	transcript_id "g395.t1"; gene_id "g395";
# protein sequence = [MNDTDTSDMNSLGYDAQAPLPYNNLVTDCTHTSPSEASGSGLNSGYTTAQMFQSSYTQPPAQYHDANRGAVSSEQQMI
# YVHPLANQASGSSVYAPFHDHQAQNFAFVEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g395
###
# start gene g396
Scaffold_1	AUGUSTUS	gene	1943880	1944641	0.99	-	.	g396
Scaffold_1	AUGUSTUS	transcript	1943880	1944641	0.99	-	.	g396.t1
Scaffold_1	AUGUSTUS	stop_codon	1943880	1943882	.	-	0	transcript_id "g396.t1"; gene_id "g396";
Scaffold_1	AUGUSTUS	CDS	1943880	1944641	0.99	-	0	transcript_id "g396.t1"; gene_id "g396";
Scaffold_1	AUGUSTUS	start_codon	1944639	1944641	.	-	0	transcript_id "g396.t1"; gene_id "g396";
# protein sequence = [MYPASVVFRLAAWLWPKITARTGGGWKDVLGEDEVFSSFHCFSENDFADDKSTLLRLFVAEKAPGESSIDFRDSYHID
# FKVPTELIQSGFDSRLQPNPTQQKYNFRVMGPFCVCNILAPFVLIWRDGQSSNPTLTLIISSLFQIVTLVFNYKDIDDQSINCRFQNIPQPLVQGSHY
# TVPPSPFRKRRIGGSMSTRWSNVHHPNDFINATIGVSGTSTATTGPSVVGAAMLALEEQDVTEGITDRKGKLRAVQD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g396
###
# start gene g397
Scaffold_1	AUGUSTUS	gene	1947473	1947949	0.81	+	.	g397
Scaffold_1	AUGUSTUS	transcript	1947473	1947949	0.81	+	.	g397.t1
Scaffold_1	AUGUSTUS	start_codon	1947473	1947475	.	+	0	transcript_id "g397.t1"; gene_id "g397";
Scaffold_1	AUGUSTUS	CDS	1947473	1947949	0.81	+	0	transcript_id "g397.t1"; gene_id "g397";
Scaffold_1	AUGUSTUS	stop_codon	1947947	1947949	.	+	0	transcript_id "g397.t1"; gene_id "g397";
# protein sequence = [MTSVFVSSASTSSNSTLSPTTFHILADNTTLISLISAITTNCSSNINTSSSSSNTSNPSPYNASDPNAPQPESAIGYY
# RASSVVLTLNGYNNSAALSSDENATNTPLPTGIDTTLEDCLNQTIGAAVPLIDGARSINTGVGSVALLSMLFVVLQRLVV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g397
###
# start gene g398
Scaffold_1	AUGUSTUS	gene	1957547	1958254	0.99	+	.	g398
Scaffold_1	AUGUSTUS	transcript	1957547	1958254	0.99	+	.	g398.t1
Scaffold_1	AUGUSTUS	start_codon	1957547	1957549	.	+	0	transcript_id "g398.t1"; gene_id "g398";
Scaffold_1	AUGUSTUS	CDS	1957547	1958254	0.99	+	0	transcript_id "g398.t1"; gene_id "g398";
Scaffold_1	AUGUSTUS	stop_codon	1958252	1958254	.	+	0	transcript_id "g398.t1"; gene_id "g398";
# protein sequence = [MSIFRRNSDTPSFTSFTSPVEIQIVTEVEYHEDEQTADSETQIGTHTAIFSHSSKPPHRCSVTVGSRLSSPSFDSCIH
# LERNMALPRSNYDPRRVCLNPFPDLHLDKYKRTVGVYIAGALVRLSRSILPRKIVHLMLQFAIANWTFLDAAVYSAHARVPWGDEPPVHVTFVDWVPG
# ICSLLGYLVVNLIDKDRIKGDEGFGDSRAVWRARLFLFIGFALMAGGLAGSVVRVYPHV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g398
###
# start gene g399
Scaffold_1	AUGUSTUS	gene	1959718	1960534	0.46	-	.	g399
Scaffold_1	AUGUSTUS	transcript	1959718	1960534	0.46	-	.	g399.t1
Scaffold_1	AUGUSTUS	stop_codon	1959718	1959720	.	-	0	transcript_id "g399.t1"; gene_id "g399";
Scaffold_1	AUGUSTUS	CDS	1959718	1959769	0.46	-	1	transcript_id "g399.t1"; gene_id "g399";
Scaffold_1	AUGUSTUS	CDS	1959945	1960534	0.46	-	0	transcript_id "g399.t1"; gene_id "g399";
Scaffold_1	AUGUSTUS	start_codon	1960532	1960534	.	-	0	transcript_id "g399.t1"; gene_id "g399";
# protein sequence = [MQLEGPELPHDDHAWDEFSWEDSTNLAGIDRQFLLAFSPTSFYNNTLTSDESDISIPLPVGNPEQILSKMLDGNLFSP
# FAGTSNSISNANSLVEFQGSLERLYASYLWNINRLCSPFDSLQPYWEYCGQYWDEPYSSADLVLELPLSTGLTIVFWRAIVSVACSVIMCVAGLCDFG
# DSCGSGKEYTTPGSGILKHSPHHFKDGPAGGYLDVDD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g399
###
# start gene g400
Scaffold_1	AUGUSTUS	gene	1961854	1963443	0.38	+	.	g400
Scaffold_1	AUGUSTUS	transcript	1961854	1963443	0.38	+	.	g400.t1
Scaffold_1	AUGUSTUS	start_codon	1961854	1961856	.	+	0	transcript_id "g400.t1"; gene_id "g400";
Scaffold_1	AUGUSTUS	CDS	1961854	1963443	0.38	+	0	transcript_id "g400.t1"; gene_id "g400";
Scaffold_1	AUGUSTUS	stop_codon	1963441	1963443	.	+	0	transcript_id "g400.t1"; gene_id "g400";
# protein sequence = [MLVDSGACWILFQPPLMTNRKTTSKEGPEESKQKSKFSTSSPLPQLLLDQASRLQYLGLLSGPTAALSSKGYIRPPPV
# TRPISRRLCVQSSETRHGSSPWIALRGCYLLKNALPLDDKVIDHLGNYACVSDSPGFMKKLKNAVMKLGPRLKDIQWPSGPDERPFYTPLAQFLNACV
# SVCKEELTNDDRYTKGPFHDLEFIVYDKETQDSVDGASPVKPDLVGGKKFMAFADSDDCKVKSARLYWNPPDKNMSPILLPVEVKDNWIELVCQAATY
# ARCLFSTSPLRQYSLVLGYNHKEGTFRFLIFHRGAYLPLFPLICVTDSHKSLLHVFLSLLSCSHARDAGIAAWCNERQFKLPVDNSDKPDYVDANVDE
# ILHDGNCCRGRVNRVIRISYGVPKDVSTSPLPVATTPLFPVTQLRRSARVANAEAKKGVEAPVISEKSSSNQVDSRTRSETQASNIPDPSTLVITPIA
# VYGPTRDLEDVKQELMILVKPLNPCRGETSHGFIKAAWPKRDPGQVVPQSRKRGCSCVW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g400
###
# start gene g401
Scaffold_1	AUGUSTUS	gene	1966715	1967248	0.88	-	.	g401
Scaffold_1	AUGUSTUS	transcript	1966715	1967248	0.88	-	.	g401.t1
Scaffold_1	AUGUSTUS	stop_codon	1966715	1966717	.	-	0	transcript_id "g401.t1"; gene_id "g401";
Scaffold_1	AUGUSTUS	CDS	1966715	1967248	0.88	-	0	transcript_id "g401.t1"; gene_id "g401";
Scaffold_1	AUGUSTUS	start_codon	1967246	1967248	.	-	0	transcript_id "g401.t1"; gene_id "g401";
# protein sequence = [MGTHTGTHVDAPCHFIQGGKSIDQIPIDVLHGPALLIDLTHKRAHESISWAEDLSPYAEQMQPGVILLLHTGWSRYWA
# KEGQEYFKHPYVEPSVAGKLLEYGIMVIGLDAPNPDVTGSGGHPFHEVFLGGGGYIVENLTNLDKLRSMELMVNLLPINIVGSDGAPVRGVAWDEAEQ
# K]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g401
###
# start gene g402
Scaffold_1	AUGUSTUS	gene	1976126	1978042	0.82	-	.	g402
Scaffold_1	AUGUSTUS	transcript	1976126	1978042	0.82	-	.	g402.t1
Scaffold_1	AUGUSTUS	stop_codon	1976126	1976128	.	-	0	transcript_id "g402.t1"; gene_id "g402";
Scaffold_1	AUGUSTUS	CDS	1976126	1978042	0.82	-	0	transcript_id "g402.t1"; gene_id "g402";
Scaffold_1	AUGUSTUS	start_codon	1978040	1978042	.	-	0	transcript_id "g402.t1"; gene_id "g402";
# protein sequence = [MIDIPGLGVGSAATNLIKEDKRTQVNINVANSLTPDGVLDHVGGIKRHEAQPEVELGTAKASSSTTSTTATITATSVL
# SLLEDVASDPSISTTRTGSLMEKTRKPLSSRKDASLITEEPRDPHARKDTLALGPSPHLSMEEHLAHIQAPARPPPPSNSTETTAAARNGRPSSTGSL
# LRRRSMPTFNVGSPPPPYPSFVLDYPHSQTFAAGPLPPPHPLAQHVRPSPSPHAEEGNERLPAYSNDIFLRAIMPRKVEFVSPGVQAKDRKWRKVVCE
# LEGTVFRVYRCPPEFTGTGKVTDWWERKVGVGDMSVGVGVGGYPSTPAGHGGTATIAGATGSMTAEEKLREQERLRQEKIDGERGGRSMVTQIALPPP
# TNVHLEVSANGAHSSRTRDRPSSRSTSRSVSRSRQDGDESPPQHRSRLVNIFKAPKSHKRTQSEFLNVPDNHPNSGPSTARSSFNISRSPSRPSFGDS
# QESAMNRENSLNSNSNVSNMSATRGMGSTISSSSLSVSIPSSASAISSLISASSNLGTASGLSSAAPTPITSAPSSTFPTNRYPNGVTCPPPNKDDLI
# QSFTLQHAESGLGNDYLKRKNVIRVRMEGEQFLLQARDVTAVVDWIEVGNIKSFLLTSQQLAQNHDAWFS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g402
###
# start gene g403
Scaffold_1	AUGUSTUS	gene	1978096	1979798	0.19	-	.	g403
Scaffold_1	AUGUSTUS	transcript	1978096	1979798	0.19	-	.	g403.t1
Scaffold_1	AUGUSTUS	stop_codon	1978096	1978098	.	-	0	transcript_id "g403.t1"; gene_id "g403";
Scaffold_1	AUGUSTUS	CDS	1978096	1979418	0.3	-	0	transcript_id "g403.t1"; gene_id "g403";
Scaffold_1	AUGUSTUS	CDS	1979493	1979798	0.26	-	0	transcript_id "g403.t1"; gene_id "g403";
Scaffold_1	AUGUSTUS	start_codon	1979796	1979798	.	-	0	transcript_id "g403.t1"; gene_id "g403";
# protein sequence = [MPTTFTRETRSMDLNLHVAQKPYMSQPVLDIRKRFDNEDHDEGDSTASSAQSMHQPSPSRTDFVKPENLRQQQGKVDG
# LPNVNEASQTTSFNSGLPNSNSSTVERQGKQQQERSSIEAQRNEVTDSSSFNKSRRNPELPNTSGSTLSISSSATVTPLSMNSSEKPLPVLIASPKHP
# NSSQPLLSSHSPITSPTSTSVISPLASSQNKLSPITSQSSQRPATSPNTPPTTFISSSYPSRRPSAPHLNTAILTTSSSRRPSAPHLNTPLPGQRFNL
# LTSDNESASARLSPSIIIRQPALPILNLPKLNLSHATTEADDGNLGPLHSRISASEGTGVAGSSAFARRMSGMASGSNGSPVVESRRISVHAQSRRNL
# REMPALPMAGKDQRDNEDDHEDVDGDADSSDDDEDTDVDVEGDGEAEDDDTRSSTESQFHTLPLPPPPPTLPSVLPPVNLTKIDFSFLNFDPKGKQRA
# NDDSGKTPTASLQTPRFGSHNDYFRPNTTALLVVAKIANRILVTGRHGFTLLSRERRLRPFLQGHRKLQNSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g403
###
# start gene g404
Scaffold_1	AUGUSTUS	gene	1982830	1983090	0.96	+	.	g404
Scaffold_1	AUGUSTUS	transcript	1982830	1983090	0.96	+	.	g404.t1
Scaffold_1	AUGUSTUS	start_codon	1982830	1982832	.	+	0	transcript_id "g404.t1"; gene_id "g404";
Scaffold_1	AUGUSTUS	CDS	1982830	1983090	0.96	+	0	transcript_id "g404.t1"; gene_id "g404";
Scaffold_1	AUGUSTUS	stop_codon	1983088	1983090	.	+	0	transcript_id "g404.t1"; gene_id "g404";
# protein sequence = [MLLASKSISKIKPTGKADLIKEAMNYLRVRWELQQTDEEEKNWAEIQKKMKEAEDAATEEAARAVEATGPEGVAAAKV
# LMSMKKKE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g404
###
# start gene g405
Scaffold_1	AUGUSTUS	gene	2002700	2002987	0.62	+	.	g405
Scaffold_1	AUGUSTUS	transcript	2002700	2002987	0.62	+	.	g405.t1
Scaffold_1	AUGUSTUS	start_codon	2002700	2002702	.	+	0	transcript_id "g405.t1"; gene_id "g405";
Scaffold_1	AUGUSTUS	CDS	2002700	2002721	0.62	+	0	transcript_id "g405.t1"; gene_id "g405";
Scaffold_1	AUGUSTUS	CDS	2002836	2002987	0.78	+	2	transcript_id "g405.t1"; gene_id "g405";
Scaffold_1	AUGUSTUS	stop_codon	2002985	2002987	.	+	0	transcript_id "g405.t1"; gene_id "g405";
# protein sequence = [MTRINTAADNDGKDSGDADGVDEHDGDTESDDGIVAIEGFDRSPFDGGGSNEEPAEK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g405
###
# start gene g406
Scaffold_1	AUGUSTUS	gene	2006484	2006963	1	-	.	g406
Scaffold_1	AUGUSTUS	transcript	2006484	2006963	1	-	.	g406.t1
Scaffold_1	AUGUSTUS	stop_codon	2006484	2006486	.	-	0	transcript_id "g406.t1"; gene_id "g406";
Scaffold_1	AUGUSTUS	CDS	2006484	2006963	1	-	0	transcript_id "g406.t1"; gene_id "g406";
Scaffold_1	AUGUSTUS	start_codon	2006961	2006963	.	-	0	transcript_id "g406.t1"; gene_id "g406";
# protein sequence = [MVRTSLDLGVESGTPAHRDEETELENEFRPARYPTDIKEPIASTGGSSYQATSTFPSEYATTPLRLESPTVTSYRLNN
# SHKASMDETRQTESPAYDYRETGTGFRPEKMQTELRYEPQTVSASVSTSYADLDGPSSSRNHHFDHEKLQPLRYSFQNDDA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g406
###
# start gene g407
Scaffold_1	AUGUSTUS	gene	2018056	2018547	1	+	.	g407
Scaffold_1	AUGUSTUS	transcript	2018056	2018547	1	+	.	g407.t1
Scaffold_1	AUGUSTUS	start_codon	2018056	2018058	.	+	0	transcript_id "g407.t1"; gene_id "g407";
Scaffold_1	AUGUSTUS	CDS	2018056	2018547	1	+	0	transcript_id "g407.t1"; gene_id "g407";
Scaffold_1	AUGUSTUS	stop_codon	2018545	2018547	.	+	0	transcript_id "g407.t1"; gene_id "g407";
# protein sequence = [MFNSFFQHSDSFPSLTYKHHALGSLTEGRYLVIESSTKNLALSSNDSSLGTSAATNEKINTPSQRFVIHATDPKIATG
# KSFRISSAASITDATAISNATTPFLNVNLQFGSVNSSAVFNITYQGSGVYNFLESGSNKFLSLGDNGAPVLGSEAESFKIFSISF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g407
###
# start gene g408
Scaffold_1	AUGUSTUS	gene	2024691	2027182	0.3	-	.	g408
Scaffold_1	AUGUSTUS	transcript	2024691	2027182	0.3	-	.	g408.t1
Scaffold_1	AUGUSTUS	stop_codon	2024691	2024693	.	-	0	transcript_id "g408.t1"; gene_id "g408";
Scaffold_1	AUGUSTUS	CDS	2024691	2025613	0.97	-	2	transcript_id "g408.t1"; gene_id "g408";
Scaffold_1	AUGUSTUS	CDS	2025688	2025732	0.3	-	2	transcript_id "g408.t1"; gene_id "g408";
Scaffold_1	AUGUSTUS	CDS	2025853	2027182	0.94	-	0	transcript_id "g408.t1"; gene_id "g408";
Scaffold_1	AUGUSTUS	start_codon	2027180	2027182	.	-	0	transcript_id "g408.t1"; gene_id "g408";
# protein sequence = [MYQEVVDQLRNTQDAKTHQEAQFQEERTELKGEIHRLQADVRESGAETAGERDRADRLERELHQVRAQLESESSARRI
# LETRLQDHTADADQQRVQLEKALADVTGQTRISEVLRSELAQVRSGFADVKALEERNSNKIKTLLEEQEANLRRLGESQARGDNLEEQIRMARKESQE
# VKDALREAAEDKAHLLKAQASEHDRIMRDHIAEADGDRAVLERQFFEVKVQKDHAERQLRDARSQLDVAHADTVGLKEELQRVEHELREANRTESLLR
# GDLKSGKSSQSEYELRLEDSERLIAQILNVALAFRTSHIKAMSIAQAIALSAHPNSFKMGQSSSMADSLFSPGMRQNIILNVDEPPPLDPSDPVMTLD
# ALRAFDHDLFLEAIAKTGSSVRKWQKQCKEYRERAKGKISFRNFAKGDLALFLPTRNSVSKPWAAFNGKSLSRITSITERVVDRDVRDGVKYYMLEVE
# DWTQPVHDKRKVSKKRNSDQKPSLASSTPALPSGPPEPEVEDTFQVAPTTSSHLASRTRSNSSPSNARPSSLSRLLAQASPEVTPQPFPTSENRPNSP
# TSSPPPPPSPQLPKLISSPQVNSPQSPLRPGSRASRLSTTSRFSGGRIAPFGSVSSGSSTNKANPTTALSDQNLVSSPSSAGINIKRNDATFPSPGGS
# PSDMTSTLKKHFRNRTTSYQNSRPTSMHIPKGSPLTNMETTAASSHAPTRTSASYWNSSWFSRKKADTAHPTTLDESSTTGSVRPSDSAASDILKRFP
# F]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g408
###
# start gene g409
Scaffold_1	AUGUSTUS	gene	2039711	2040340	0.97	+	.	g409
Scaffold_1	AUGUSTUS	transcript	2039711	2040340	0.97	+	.	g409.t1
Scaffold_1	AUGUSTUS	start_codon	2039711	2039713	.	+	0	transcript_id "g409.t1"; gene_id "g409";
Scaffold_1	AUGUSTUS	CDS	2039711	2040340	0.97	+	0	transcript_id "g409.t1"; gene_id "g409";
Scaffold_1	AUGUSTUS	stop_codon	2040338	2040340	.	+	0	transcript_id "g409.t1"; gene_id "g409";
# protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ
# GPPPVEPGMGPPQRRFTPWVTPNPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY
# PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g409
###
# start gene g410
Scaffold_1	AUGUSTUS	gene	2044679	2045149	0.56	+	.	g410
Scaffold_1	AUGUSTUS	transcript	2044679	2045149	0.56	+	.	g410.t1
Scaffold_1	AUGUSTUS	start_codon	2044679	2044681	.	+	0	transcript_id "g410.t1"; gene_id "g410";
Scaffold_1	AUGUSTUS	CDS	2044679	2045149	0.56	+	0	transcript_id "g410.t1"; gene_id "g410";
Scaffold_1	AUGUSTUS	stop_codon	2045147	2045149	.	+	0	transcript_id "g410.t1"; gene_id "g410";
# protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE
# LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPTPPEAPQPPPEASQHLQKLNSGSSP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g410
###
# start gene g411
Scaffold_1	AUGUSTUS	gene	2050778	2051296	0.76	-	.	g411
Scaffold_1	AUGUSTUS	transcript	2050778	2051296	0.76	-	.	g411.t1
Scaffold_1	AUGUSTUS	stop_codon	2050778	2050780	.	-	0	transcript_id "g411.t1"; gene_id "g411";
Scaffold_1	AUGUSTUS	CDS	2050778	2051296	0.76	-	0	transcript_id "g411.t1"; gene_id "g411";
Scaffold_1	AUGUSTUS	start_codon	2051294	2051296	.	-	0	transcript_id "g411.t1"; gene_id "g411";
# protein sequence = [MGWSTTKVEYTYQQTTNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEFVPIRRSSDTTRA
# VTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQFTLFLAPAPSQPKALPIFTTERSSVSMVFLFTLNPTADPSLQLNSCDPFSLG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g411
###
# start gene g412
Scaffold_1	AUGUSTUS	gene	2055865	2056431	0.96	-	.	g412
Scaffold_1	AUGUSTUS	transcript	2055865	2056431	0.96	-	.	g412.t1
Scaffold_1	AUGUSTUS	stop_codon	2055865	2055867	.	-	0	transcript_id "g412.t1"; gene_id "g412";
Scaffold_1	AUGUSTUS	CDS	2055865	2056431	0.96	-	0	transcript_id "g412.t1"; gene_id "g412";
Scaffold_1	AUGUSTUS	start_codon	2056429	2056431	.	-	0	transcript_id "g412.t1"; gene_id "g412";
# protein sequence = [MVEEELRIAKKDRDAAAEQLSTSSRKIAELTTTLLYQQGIVDESNALATRQRVRLEELQEEVHRSRGRAAFVEQMIQE
# YPDEGFYEVVLPPLSELEGELVNIRADLRRVATLAHRLYRSDPATVLHHHDRYIGAIIEAVVAFLRRGLDSDDPDVAAHNFRLAWTTCNRREVFMETS
# ICDPSQQSSGSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g412
###
# start gene g413
Scaffold_1	AUGUSTUS	gene	2059055	2059548	0.38	-	.	g413
Scaffold_1	AUGUSTUS	transcript	2059055	2059548	0.38	-	.	g413.t1
Scaffold_1	AUGUSTUS	stop_codon	2059055	2059057	.	-	0	transcript_id "g413.t1"; gene_id "g413";
Scaffold_1	AUGUSTUS	CDS	2059055	2059176	0.81	-	2	transcript_id "g413.t1"; gene_id "g413";
Scaffold_1	AUGUSTUS	CDS	2059235	2059345	0.81	-	2	transcript_id "g413.t1"; gene_id "g413";
Scaffold_1	AUGUSTUS	CDS	2059398	2059548	0.39	-	0	transcript_id "g413.t1"; gene_id "g413";
Scaffold_1	AUGUSTUS	start_codon	2059546	2059548	.	-	0	transcript_id "g413.t1"; gene_id "g413";
# protein sequence = [MAANPIALLAQGPNHQYGRIGLPQNPPQNPPTPAEVIEAVRLANRALRYRDDAAPPTSNEYVSDEAVAACFCYKEAVI
# KSGTGVAGAPLWFQQWNQANFVPLVNDVNNIKDDVNNIKDDVNNIKDNV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g413
###
# start gene g414
Scaffold_1	AUGUSTUS	gene	2060596	2060931	0.45	-	.	g414
Scaffold_1	AUGUSTUS	transcript	2060596	2060931	0.45	-	.	g414.t1
Scaffold_1	AUGUSTUS	stop_codon	2060596	2060598	.	-	0	transcript_id "g414.t1"; gene_id "g414";
Scaffold_1	AUGUSTUS	CDS	2060596	2060931	0.45	-	0	transcript_id "g414.t1"; gene_id "g414";
Scaffold_1	AUGUSTUS	start_codon	2060929	2060931	.	-	0	transcript_id "g414.t1"; gene_id "g414";
# protein sequence = [MGRITVPPAVVFAANGLCVPPVSTSDTPTPEPYSLTNPPPHWDKVKPIASTLHGGSIKKLQAFFRGGWKELPEDERWW
# QEAMGGAVEQQRRQNLQVLDMLRKGMEGAREMR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g414
###
# start gene g415
Scaffold_1	AUGUSTUS	gene	2079074	2080001	0.8	-	.	g415
Scaffold_1	AUGUSTUS	transcript	2079074	2080001	0.8	-	.	g415.t1
Scaffold_1	AUGUSTUS	stop_codon	2079074	2079076	.	-	0	transcript_id "g415.t1"; gene_id "g415";
Scaffold_1	AUGUSTUS	CDS	2079074	2079752	0.8	-	1	transcript_id "g415.t1"; gene_id "g415";
Scaffold_1	AUGUSTUS	CDS	2079832	2080001	0.81	-	0	transcript_id "g415.t1"; gene_id "g415";
Scaffold_1	AUGUSTUS	start_codon	2079999	2080001	.	-	0	transcript_id "g415.t1"; gene_id "g415";
# protein sequence = [MVHSRAVITTLLAVGTASVLAAPVPESFANVLAARGPEDQPPPGAFGQQPPQGPQGHGQEPQGQYLNFQLFSFTPINL
# PISSLCLPGGPPGALSQGPQSPAGSPGFHGPPHLGGQFGIPHSGPEGMRGPGPHPPPGNMFPPGPPGGTQGPPPPHHFKPRDDMPHPPPQGPPGGSGE
# LQSPHPSHFGRRQMPGQQGPQGPPPAGQHPQDPAGGPQGMQQGAPPADRAGPGGPQSAHQPFGRRQSPQGPPQDHIIKQQGEQVGHEGHGGQGTIFSS
# CGPFLELT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g415
###
# start gene g416
Scaffold_1	AUGUSTUS	gene	2084961	2086184	0.72	-	.	g416
Scaffold_1	AUGUSTUS	transcript	2084961	2086184	0.72	-	.	g416.t1
Scaffold_1	AUGUSTUS	stop_codon	2084961	2084963	.	-	0	transcript_id "g416.t1"; gene_id "g416";
Scaffold_1	AUGUSTUS	CDS	2084961	2085428	0.97	-	0	transcript_id "g416.t1"; gene_id "g416";
Scaffold_1	AUGUSTUS	CDS	2085480	2086184	0.74	-	0	transcript_id "g416.t1"; gene_id "g416";
Scaffold_1	AUGUSTUS	start_codon	2086182	2086184	.	-	0	transcript_id "g416.t1"; gene_id "g416";
# protein sequence = [MRELMFRAEVKAKRVKKIKSKVYRRLKRKEKEAVDRNDDGSEEELTEERRLKLEMERARERATLKHKNTGKWAKKMMS
# RGGYGEGGDDDDIRGGRQEIEEMLSRGEKLRRKIQGRGSDDDDSQSESEDDGEDDSGAGVESAFNELRALSKTDADPLESAGKKGKSVFEMKFMKDAM
# ARKQADTSRIVDDFVKEMGGDEGHFSDGEVGSTEDDPDSGVIVSRTGGRVVLQPTAKGSEHPTRTFSVASEETSSSTLKSTDFPTPTPPSPLISTSEK
# HSSRPALSQPFSSNATTSTSASVNPWLVPSSSSGAGKAGPKKTNEIVVDKDSSQTTKSKHKLKKQNKKTEEEKARVKDDAVVEIEMENVFAVPKISKG
# HEEAPATSAVTASKNNIK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g416
###
# start gene g417
Scaffold_1	AUGUSTUS	gene	2086721	2087785	0.5	-	.	g417
Scaffold_1	AUGUSTUS	transcript	2086721	2087785	0.5	-	.	g417.t1
Scaffold_1	AUGUSTUS	stop_codon	2086721	2086723	.	-	0	transcript_id "g417.t1"; gene_id "g417";
Scaffold_1	AUGUSTUS	CDS	2086721	2087323	0.5	-	0	transcript_id "g417.t1"; gene_id "g417";
Scaffold_1	AUGUSTUS	CDS	2087372	2087785	0.5	-	0	transcript_id "g417.t1"; gene_id "g417";
Scaffold_1	AUGUSTUS	start_codon	2087783	2087785	.	-	0	transcript_id "g417.t1"; gene_id "g417";
# protein sequence = [MARSGRTSSNNQSRPTFKNQSFSKRKGSAATAASGYAKRHERKAAKSAGRFEDVYEYAPEKVRRAKIALDLDRDEEMD
# AGPLGNGGADDMEDIRMKARLIGENEEDEKIDSEDDEEIDSDAAFDDDDDERFAGFFTKKVLKKKASKQVSVTFADVDLNEDEDDAEPQESERDNGDA
# DNEDGEESGEDDEFINVLDILDGRGEPLNDEDNDAPPASFRGNFVSSKEGDEGMEDSADEADEEDEKEVDDEDEVDEDDRISISLSEAEDEADGTLDD
# LQTFISSLDPTSSGSRKRKADGEEPEHSRKRRVIKERTEAGVESEFRTQSAGKICSKLPQTLSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g417
###
# start gene g418
Scaffold_1	AUGUSTUS	gene	2088821	2089102	0.72	+	.	g418
Scaffold_1	AUGUSTUS	transcript	2088821	2089102	0.72	+	.	g418.t1
Scaffold_1	AUGUSTUS	start_codon	2088821	2088823	.	+	0	transcript_id "g418.t1"; gene_id "g418";
Scaffold_1	AUGUSTUS	CDS	2088821	2089102	0.72	+	0	transcript_id "g418.t1"; gene_id "g418";
Scaffold_1	AUGUSTUS	stop_codon	2089100	2089102	.	+	0	transcript_id "g418.t1"; gene_id "g418";
# protein sequence = [MSTNSKKGSLIIAGSGIASIRHITLETLSYIENADKVYYIVTDPATEAFIQEKSRGNFADLTIYYDKDKSRYESYVQM
# SEVNVGFLFWIVNEF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g418
###
# start gene g419
Scaffold_1	AUGUSTUS	gene	2089246	2090121	0.56	+	.	g419
Scaffold_1	AUGUSTUS	transcript	2089246	2090121	0.56	+	.	g419.t1
Scaffold_1	AUGUSTUS	start_codon	2089246	2089248	.	+	0	transcript_id "g419.t1"; gene_id "g419";
Scaffold_1	AUGUSTUS	CDS	2089246	2090121	0.56	+	0	transcript_id "g419.t1"; gene_id "g419";
Scaffold_1	AUGUSTUS	stop_codon	2090119	2090121	.	+	0	transcript_id "g419.t1"; gene_id "g419";
# protein sequence = [MLPGISAEDYMFSDLGFDPAIPGCMTQEATSIVIHNKVLDPTIHNIIWQVGSVGVDTMVFDVSGLYNYLQLLSEGLTA
# TQNGLFHLLVDHLEKYFGPNDKVIHYIGAVLPQSVTVKDEFTIAELRKERIIKQITTVSTFYVPPREKAPVVQSLPEVLKSRFTTSIVSPIAYGEFEH
# NAVSRIANHNIPVDHVELRASAAVRKFMIDLALKPDLQDRYKKDPVAVTNAIPELTAEERFALGLGKPGPVSVIMRATKSDLAAGNFPTSETIADSVG
# SDGLNAVTSLTVVVVTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g419
###
# start gene g420
Scaffold_1	AUGUSTUS	gene	2110324	2112551	0.06	+	.	g420
Scaffold_1	AUGUSTUS	transcript	2110324	2112551	0.06	+	.	g420.t1
Scaffold_1	AUGUSTUS	start_codon	2110324	2110326	.	+	0	transcript_id "g420.t1"; gene_id "g420";
Scaffold_1	AUGUSTUS	CDS	2110324	2110987	0.07	+	0	transcript_id "g420.t1"; gene_id "g420";
Scaffold_1	AUGUSTUS	CDS	2111320	2112551	0.22	+	2	transcript_id "g420.t1"; gene_id "g420";
Scaffold_1	AUGUSTUS	stop_codon	2112549	2112551	.	+	0	transcript_id "g420.t1"; gene_id "g420";
# protein sequence = [MVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPP
# RVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGA
# PFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLQGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRS
# GGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNR
# ITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEA
# DEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLHGEKLQGWL
# SRFPGLELAPEAPYKSPLRREREPADVWTSNPKPAATGRFQTGPTGKRDDKGVCSLGGRRKLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g420
###
# start gene g421
Scaffold_1	AUGUSTUS	gene	2114794	2116169	0.75	+	.	g421
Scaffold_1	AUGUSTUS	transcript	2114794	2116169	0.75	+	.	g421.t1
Scaffold_1	AUGUSTUS	start_codon	2114794	2114796	.	+	0	transcript_id "g421.t1"; gene_id "g421";
Scaffold_1	AUGUSTUS	CDS	2114794	2115412	0.75	+	0	transcript_id "g421.t1"; gene_id "g421";
Scaffold_1	AUGUSTUS	CDS	2115499	2116169	0.91	+	2	transcript_id "g421.t1"; gene_id "g421";
Scaffold_1	AUGUSTUS	stop_codon	2116167	2116169	.	+	0	transcript_id "g421.t1"; gene_id "g421";
# protein sequence = [MLRANDSSATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYD
# IKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFT
# KIDLRAGYNNVRVAQGHEWKTAFRTRMLPPHDKVSHVEHVRKVLERLRANHLHAKPEKCAFYVDTVEYLGVIISPLGVSMDPEKVKAVMDWPKPRTVK
# ELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAF
# HARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSDTRSKYTQTITISSTSPLRSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g421
###
# start gene g422
Scaffold_1	AUGUSTUS	gene	2124789	2125130	0.98	+	.	g422
Scaffold_1	AUGUSTUS	transcript	2124789	2125130	0.98	+	.	g422.t1
Scaffold_1	AUGUSTUS	start_codon	2124789	2124791	.	+	0	transcript_id "g422.t1"; gene_id "g422";
Scaffold_1	AUGUSTUS	CDS	2124789	2125130	0.98	+	0	transcript_id "g422.t1"; gene_id "g422";
Scaffold_1	AUGUSTUS	stop_codon	2125128	2125130	.	+	0	transcript_id "g422.t1"; gene_id "g422";
# protein sequence = [MPVLSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGEITSDEVKVRLALEWTSYKTRQALRVF
# DSVKTPNWDQFKKDLKNMFPQSEETKEDLDYCLNN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g422
###
# start gene g423
Scaffold_1	AUGUSTUS	gene	2125337	2125745	0.52	+	.	g423
Scaffold_1	AUGUSTUS	transcript	2125337	2125745	0.52	+	.	g423.t1
Scaffold_1	AUGUSTUS	start_codon	2125337	2125339	.	+	0	transcript_id "g423.t1"; gene_id "g423";
Scaffold_1	AUGUSTUS	CDS	2125337	2125398	0.52	+	0	transcript_id "g423.t1"; gene_id "g423";
Scaffold_1	AUGUSTUS	CDS	2125487	2125745	0.99	+	1	transcript_id "g423.t1"; gene_id "g423";
Scaffold_1	AUGUSTUS	stop_codon	2125743	2125745	.	+	0	transcript_id "g423.t1"; gene_id "g423";
# protein sequence = [MSDRRKEDPFKIDEVMNAAENRGHINLLFAADVPKTDRNYLQALKPKVEDEFKDLLGVKLESLIPRELTEEQQQMVAL
# NKDLMEANMKEIRAVKSLQSHFKEEQTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g423
###
# start gene g424
Scaffold_1	AUGUSTUS	gene	2126294	2127308	0.73	+	.	g424
Scaffold_1	AUGUSTUS	transcript	2126294	2127308	0.73	+	.	g424.t1
Scaffold_1	AUGUSTUS	start_codon	2126294	2126296	.	+	0	transcript_id "g424.t1"; gene_id "g424";
Scaffold_1	AUGUSTUS	CDS	2126294	2126660	0.74	+	0	transcript_id "g424.t1"; gene_id "g424";
Scaffold_1	AUGUSTUS	CDS	2126704	2127308	0.94	+	2	transcript_id "g424.t1"; gene_id "g424";
Scaffold_1	AUGUSTUS	stop_codon	2127306	2127308	.	+	0	transcript_id "g424.t1"; gene_id "g424";
# protein sequence = [MKEQDRSMRNLRSNAVAPGKVRKQNEINLMKTRKLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKK
# PSVTIEDVDESDGEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYHNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKI
# IMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESHNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIV
# ANQSVAYEDHSDQPVVVAINPMDYMLLLLKSIIKMKRLKVYWTKVHKLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g424
###
# start gene g425
Scaffold_1	AUGUSTUS	gene	2129668	2130003	1	-	.	g425
Scaffold_1	AUGUSTUS	transcript	2129668	2130003	1	-	.	g425.t1
Scaffold_1	AUGUSTUS	stop_codon	2129668	2129670	.	-	0	transcript_id "g425.t1"; gene_id "g425";
Scaffold_1	AUGUSTUS	CDS	2129668	2130003	1	-	0	transcript_id "g425.t1"; gene_id "g425";
Scaffold_1	AUGUSTUS	start_codon	2130001	2130003	.	-	0	transcript_id "g425.t1"; gene_id "g425";
# protein sequence = [MDIQARIPSALIAIHNFILEHDQADLDRWILDEQVEDPLPGQRRQQEIDFGSLATSEKISRAEKRRAEIAQDRLANEM
# WENYLSILEEYHKQGGVDAMDVDEDEMEIAPLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g425
###
# start gene g426
Scaffold_1	AUGUSTUS	gene	2131323	2132702	0.97	+	.	g426
Scaffold_1	AUGUSTUS	transcript	2131323	2132702	0.97	+	.	g426.t1
Scaffold_1	AUGUSTUS	start_codon	2131323	2131325	.	+	0	transcript_id "g426.t1"; gene_id "g426";
Scaffold_1	AUGUSTUS	CDS	2131323	2132702	0.97	+	0	transcript_id "g426.t1"; gene_id "g426";
Scaffold_1	AUGUSTUS	stop_codon	2132700	2132702	.	+	0	transcript_id "g426.t1"; gene_id "g426";
# protein sequence = [MFSKKELSEAYVLASREHLKSQDDRAEEIIDCYLNQKTIGDKQVFCVWRDGVLGKLDDQLNNDQFNLNPIKSFFLQNG
# RIKPKPIQRKVQKRRFVEPVLQNFSLGENCNKSESTETTQNQCNNENISETIRDDNWNKPKNSQRTRKRMVRYEVLKRGTESFQRSQPSFEKVRYELR
# QRKKGKAQDSKDKKENVQPDLLNEPPTNKLEERIKLNQQDRSPINLIDETNKQVVNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIER
# HIHGDPLVELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWQPSEAGTFKNESFPPVKVPVIPHEPWVERNIPIP
# PGIFEDVCKIIKSKIDSGIYEPLNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGKILWRNLRFIRWI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g426
###
# start gene g427
Scaffold_1	AUGUSTUS	gene	2133205	2133720	0.5	+	.	g427
Scaffold_1	AUGUSTUS	transcript	2133205	2133720	0.5	+	.	g427.t1
Scaffold_1	AUGUSTUS	start_codon	2133205	2133207	.	+	0	transcript_id "g427.t1"; gene_id "g427";
Scaffold_1	AUGUSTUS	CDS	2133205	2133720	0.5	+	0	transcript_id "g427.t1"; gene_id "g427";
Scaffold_1	AUGUSTUS	stop_codon	2133718	2133720	.	+	0	transcript_id "g427.t1"; gene_id "g427";
# protein sequence = [MFIVNFAKKAAPLTKLTSKVPFEWNEKCDKAMDELKDGIQECPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPSEKK
# KFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTFNPCKRCNSWS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g427
###
# start gene g428
Scaffold_1	AUGUSTUS	gene	2133792	2135462	0.23	+	.	g428
Scaffold_1	AUGUSTUS	transcript	2133792	2135462	0.23	+	.	g428.t1
Scaffold_1	AUGUSTUS	start_codon	2133792	2133794	.	+	0	transcript_id "g428.t1"; gene_id "g428";
Scaffold_1	AUGUSTUS	CDS	2133792	2134035	0.43	+	0	transcript_id "g428.t1"; gene_id "g428";
Scaffold_1	AUGUSTUS	CDS	2134284	2134331	0.49	+	2	transcript_id "g428.t1"; gene_id "g428";
Scaffold_1	AUGUSTUS	CDS	2134630	2135462	0.96	+	2	transcript_id "g428.t1"; gene_id "g428";
Scaffold_1	AUGUSTUS	stop_codon	2135460	2135462	.	+	0	transcript_id "g428.t1"; gene_id "g428";
# protein sequence = [MDGGEPINFIMGDGETEELYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNYMLESKTRHVKFS
# VGILVEKEKRMHMLNSAHDXEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFY
# FLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKD
# WDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDD
# IG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g428
###
# start gene g429
Scaffold_1	AUGUSTUS	gene	2136408	2137186	0.51	-	.	g429
Scaffold_1	AUGUSTUS	transcript	2136408	2137186	0.51	-	.	g429.t1
Scaffold_1	AUGUSTUS	stop_codon	2136408	2136410	.	-	0	transcript_id "g429.t1"; gene_id "g429";
Scaffold_1	AUGUSTUS	CDS	2136408	2136835	0.94	-	2	transcript_id "g429.t1"; gene_id "g429";
Scaffold_1	AUGUSTUS	CDS	2136918	2137042	0.84	-	1	transcript_id "g429.t1"; gene_id "g429";
Scaffold_1	AUGUSTUS	CDS	2137164	2137186	0.51	-	0	transcript_id "g429.t1"; gene_id "g429";
Scaffold_1	AUGUSTUS	start_codon	2137184	2137186	.	-	0	transcript_id "g429.t1"; gene_id "g429";
# protein sequence = [MNSASEDNTPYPTTGSNKGSNKDEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQ
# STKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADKACSILKSHQDSGSDSSGSDASIATAQSIPTTSSEDTVVTPTEIAVPVLKTVERATTPFT
# RGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g429
###
# start gene g430
Scaffold_1	AUGUSTUS	gene	2144142	2144546	1	+	.	g430
Scaffold_1	AUGUSTUS	transcript	2144142	2144546	1	+	.	g430.t1
Scaffold_1	AUGUSTUS	start_codon	2144142	2144144	.	+	0	transcript_id "g430.t1"; gene_id "g430";
Scaffold_1	AUGUSTUS	CDS	2144142	2144546	1	+	0	transcript_id "g430.t1"; gene_id "g430";
Scaffold_1	AUGUSTUS	stop_codon	2144544	2144546	.	+	0	transcript_id "g430.t1"; gene_id "g430";
# protein sequence = [MSEVGESSVSAGSETWDVDDAGQVKFKSKHLKELSFESISRRDWDSILKNMPQALMDYFIPPGECGIHSKLAIEIAQL
# FKRFFCAGTTTQRDLPLRPTTDPKFEEYPTTGYTSRSHKEQNTMFLYSQVPGLNSC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g430
###
# start gene g431
Scaffold_1	AUGUSTUS	gene	2148434	2149096	0.61	-	.	g431
Scaffold_1	AUGUSTUS	transcript	2148434	2149096	0.61	-	.	g431.t1
Scaffold_1	AUGUSTUS	stop_codon	2148434	2148436	.	-	0	transcript_id "g431.t1"; gene_id "g431";
Scaffold_1	AUGUSTUS	CDS	2148434	2149096	0.61	-	0	transcript_id "g431.t1"; gene_id "g431";
Scaffold_1	AUGUSTUS	start_codon	2149094	2149096	.	-	0	transcript_id "g431.t1"; gene_id "g431";
# protein sequence = [MSPSELTYGYLPLFNIPVSQCSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAED
# INLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVK
# WKGYDAGHNSWEPAPNLSRAPKIVRAFHKNIRQRQNLDHRGQWS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g431
###
# start gene g432
Scaffold_1	AUGUSTUS	gene	2151448	2152225	0.3	+	.	g432
Scaffold_1	AUGUSTUS	transcript	2151448	2152225	0.3	+	.	g432.t1
Scaffold_1	AUGUSTUS	start_codon	2151448	2151450	.	+	0	transcript_id "g432.t1"; gene_id "g432";
Scaffold_1	AUGUSTUS	CDS	2151448	2151470	0.34	+	0	transcript_id "g432.t1"; gene_id "g432";
Scaffold_1	AUGUSTUS	CDS	2151592	2151716	0.6	+	1	transcript_id "g432.t1"; gene_id "g432";
Scaffold_1	AUGUSTUS	CDS	2151798	2152225	1	+	2	transcript_id "g432.t1"; gene_id "g432";
Scaffold_1	AUGUSTUS	stop_codon	2152223	2152225	.	+	0	transcript_id "g432.t1"; gene_id "g432";
# protein sequence = [MNSASKDNTPYPTTGSNKGSNKDEKSAVNDVSPRLSKVHGRSDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQ
# STKFIAATLNFQAAEFEFNANLVKTYATCAHIAKVIADEACSILKSRQDSGSDSSGSDASFATAQSIPTTGSEDTVVTPTEIAVPVLKTVERVTPPFT
# RGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g432
###
# start gene g433
Scaffold_1	AUGUSTUS	gene	2152486	2153334	0.67	-	.	g433
Scaffold_1	AUGUSTUS	transcript	2152486	2153334	0.67	-	.	g433.t1
Scaffold_1	AUGUSTUS	stop_codon	2152486	2152488	.	-	0	transcript_id "g433.t1"; gene_id "g433";
Scaffold_1	AUGUSTUS	CDS	2152486	2152797	0.89	-	0	transcript_id "g433.t1"; gene_id "g433";
Scaffold_1	AUGUSTUS	CDS	2152950	2153034	0.77	-	1	transcript_id "g433.t1"; gene_id "g433";
Scaffold_1	AUGUSTUS	CDS	2153123	2153334	0.86	-	0	transcript_id "g433.t1"; gene_id "g433";
Scaffold_1	AUGUSTUS	start_codon	2153332	2153334	.	-	0	transcript_id "g433.t1"; gene_id "g433";
# protein sequence = [MLAWLEEKYEIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVSNTKMWSRLILTRDEL
# IGYRAQALSKHNSFIEKVRRRRTYGCEKRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHKLINLTAEQLDLMVEDEDEYWMTPEND
# YIFNAIPHLRLSDTNSDKELSEEEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g433
###
# start gene g434
Scaffold_1	AUGUSTUS	gene	2154320	2155912	0.81	-	.	g434
Scaffold_1	AUGUSTUS	transcript	2154320	2155912	0.81	-	.	g434.t1
Scaffold_1	AUGUSTUS	stop_codon	2154320	2154322	.	-	0	transcript_id "g434.t1"; gene_id "g434";
Scaffold_1	AUGUSTUS	CDS	2154320	2155912	0.81	-	0	transcript_id "g434.t1"; gene_id "g434";
Scaffold_1	AUGUSTUS	start_codon	2155910	2155912	.	-	0	transcript_id "g434.t1"; gene_id "g434";
# protein sequence = [MTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRF
# VWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSN
# VPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHV
# YGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEP
# YQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKSATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGK
# YLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVERKAYAHVE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g434
###
# start gene g435
Scaffold_1	AUGUSTUS	gene	2156260	2158849	0.47	-	.	g435
Scaffold_1	AUGUSTUS	transcript	2156260	2158849	0.47	-	.	g435.t1
Scaffold_1	AUGUSTUS	stop_codon	2156260	2156262	.	-	0	transcript_id "g435.t1"; gene_id "g435";
Scaffold_1	AUGUSTUS	CDS	2156260	2157010	1	-	1	transcript_id "g435.t1"; gene_id "g435";
Scaffold_1	AUGUSTUS	CDS	2157103	2157343	0.49	-	2	transcript_id "g435.t1"; gene_id "g435";
Scaffold_1	AUGUSTUS	CDS	2157418	2158849	0.9	-	0	transcript_id "g435.t1"; gene_id "g435";
Scaffold_1	AUGUSTUS	start_codon	2158847	2158849	.	-	0	transcript_id "g435.t1"; gene_id "g435";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA
# ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID
# DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP
# FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSK
# GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSES
# TETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIK
# LNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVEKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDK
# NHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGPLKMNSFHL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g435
###
# start gene g436
Scaffold_1	AUGUSTUS	gene	2158879	2160405	0.88	-	.	g436
Scaffold_1	AUGUSTUS	transcript	2158879	2160405	0.88	-	.	g436.t1
Scaffold_1	AUGUSTUS	stop_codon	2158879	2158881	.	-	0	transcript_id "g436.t1"; gene_id "g436";
Scaffold_1	AUGUSTUS	CDS	2158879	2160405	0.88	-	0	transcript_id "g436.t1"; gene_id "g436";
Scaffold_1	AUGUSTUS	start_codon	2160403	2160405	.	-	0	transcript_id "g436.t1"; gene_id "g436";
# protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT
# RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR
# GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD
# LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNG
# TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN
# LAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g436
###
# start gene g437
Scaffold_1	AUGUSTUS	gene	2162850	2163218	0.3	+	.	g437
Scaffold_1	AUGUSTUS	transcript	2162850	2163218	0.3	+	.	g437.t1
Scaffold_1	AUGUSTUS	start_codon	2162850	2162852	.	+	0	transcript_id "g437.t1"; gene_id "g437";
Scaffold_1	AUGUSTUS	CDS	2162850	2163218	0.3	+	0	transcript_id "g437.t1"; gene_id "g437";
Scaffold_1	AUGUSTUS	stop_codon	2163216	2163218	.	+	0	transcript_id "g437.t1"; gene_id "g437";
# protein sequence = [MKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPLNQSNRFERNMTPRSSNGTQWACFLCKLTD
# HFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNIP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g437
###
# start gene g438
Scaffold_1	AUGUSTUS	gene	2165712	2166771	0.66	-	.	g438
Scaffold_1	AUGUSTUS	transcript	2165712	2166771	0.66	-	.	g438.t1
Scaffold_1	AUGUSTUS	stop_codon	2165712	2165714	.	-	0	transcript_id "g438.t1"; gene_id "g438";
Scaffold_1	AUGUSTUS	CDS	2165712	2166088	0.93	-	2	transcript_id "g438.t1"; gene_id "g438";
Scaffold_1	AUGUSTUS	CDS	2166393	2166771	0.66	-	0	transcript_id "g438.t1"; gene_id "g438";
Scaffold_1	AUGUSTUS	start_codon	2166769	2166771	.	-	0	transcript_id "g438.t1"; gene_id "g438";
# protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKTAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFPGSRKA
# LSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEKYLGPFKVIIDLVLCLMSSSSQTTSPHSSGFPRLTAGAGYAESIPESYQ
# SPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPLKPGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g438
###
# start gene g439
Scaffold_1	AUGUSTUS	gene	2173709	2174344	0.42	+	.	g439
Scaffold_1	AUGUSTUS	transcript	2173709	2174344	0.42	+	.	g439.t1
Scaffold_1	AUGUSTUS	start_codon	2173709	2173711	.	+	0	transcript_id "g439.t1"; gene_id "g439";
Scaffold_1	AUGUSTUS	CDS	2173709	2173725	0.48	+	0	transcript_id "g439.t1"; gene_id "g439";
Scaffold_1	AUGUSTUS	CDS	2173894	2174344	0.59	+	1	transcript_id "g439.t1"; gene_id "g439";
Scaffold_1	AUGUSTUS	stop_codon	2174342	2174344	.	+	0	transcript_id "g439.t1"; gene_id "g439";
# protein sequence = [MEIRKQTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDGKVDLSNRRISSFITCYQKDY
# YANQLTRKVNPIKATLPDEFRIERHIHGDLLMELPELSKHPKPFVPTGRYTEERKEMIDRIILKDFCGNKREILCTK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g439
###
# start gene g440
Scaffold_1	AUGUSTUS	gene	2175234	2176118	0.41	+	.	g440
Scaffold_1	AUGUSTUS	transcript	2175234	2176118	0.41	+	.	g440.t1
Scaffold_1	AUGUSTUS	start_codon	2175234	2175236	.	+	0	transcript_id "g440.t1"; gene_id "g440";
Scaffold_1	AUGUSTUS	CDS	2175234	2175465	0.44	+	0	transcript_id "g440.t1"; gene_id "g440";
Scaffold_1	AUGUSTUS	CDS	2175604	2176118	0.78	+	2	transcript_id "g440.t1"; gene_id "g440";
Scaffold_1	AUGUSTUS	stop_codon	2176116	2176118	.	+	0	transcript_id "g440.t1"; gene_id "g440";
# protein sequence = [MFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDLEKRI
# ETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGERKSRINLMNFKD
# QIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQKSVPRST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g440
###
# start gene g441
Scaffold_1	AUGUSTUS	gene	2177342	2177593	0.73	+	.	g441
Scaffold_1	AUGUSTUS	transcript	2177342	2177593	0.73	+	.	g441.t1
Scaffold_1	AUGUSTUS	start_codon	2177342	2177344	.	+	0	transcript_id "g441.t1"; gene_id "g441";
Scaffold_1	AUGUSTUS	CDS	2177342	2177593	0.73	+	0	transcript_id "g441.t1"; gene_id "g441";
Scaffold_1	AUGUSTUS	stop_codon	2177591	2177593	.	+	0	transcript_id "g441.t1"; gene_id "g441";
# protein sequence = [MESTQEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTNSDEELS
# EGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g441
###
# start gene g442
Scaffold_1	AUGUSTUS	gene	2177932	2179134	0.23	-	.	g442
Scaffold_1	AUGUSTUS	transcript	2177932	2179134	0.23	-	.	g442.t1
Scaffold_1	AUGUSTUS	stop_codon	2177932	2177934	.	-	0	transcript_id "g442.t1"; gene_id "g442";
Scaffold_1	AUGUSTUS	CDS	2177932	2178278	0.99	-	2	transcript_id "g442.t1"; gene_id "g442";
Scaffold_1	AUGUSTUS	CDS	2178355	2178490	0.5	-	0	transcript_id "g442.t1"; gene_id "g442";
Scaffold_1	AUGUSTUS	CDS	2178596	2178622	0.3	-	0	transcript_id "g442.t1"; gene_id "g442";
Scaffold_1	AUGUSTUS	CDS	2178716	2178860	0.69	-	1	transcript_id "g442.t1"; gene_id "g442";
Scaffold_1	AUGUSTUS	CDS	2179124	2179134	0.76	-	0	transcript_id "g442.t1"; gene_id "g442";
Scaffold_1	AUGUSTUS	start_codon	2179132	2179134	.	-	0	transcript_id "g442.t1"; gene_id "g442";
# protein sequence = [MISCLSEHFRSGIAPDRARSVHSDHELSTRSDNSRSYQEVQKKATRFASSRDMNSASEDELNRRSTPYPTTGSNKGSN
# KDEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEAC
# SILKSRQDSGSDSSASDASFATAQSIPPLVLRTPSLLLQRCCSSP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g442
###
# start gene g443
Scaffold_1	AUGUSTUS	gene	2189011	2190168	0.97	+	.	g443
Scaffold_1	AUGUSTUS	transcript	2189011	2190168	0.97	+	.	g443.t1
Scaffold_1	AUGUSTUS	start_codon	2189011	2189013	.	+	0	transcript_id "g443.t1"; gene_id "g443";
Scaffold_1	AUGUSTUS	CDS	2189011	2190168	0.97	+	0	transcript_id "g443.t1"; gene_id "g443";
Scaffold_1	AUGUSTUS	stop_codon	2190166	2190168	.	+	0	transcript_id "g443.t1"; gene_id "g443";
# protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVK
# QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPATPSPANQDFSTQIGQIRELLDRAN
# AMSPPSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g443
###
# start gene g444
Scaffold_1	AUGUSTUS	gene	2190866	2192080	0.93	+	.	g444
Scaffold_1	AUGUSTUS	transcript	2190866	2192080	0.93	+	.	g444.t1
Scaffold_1	AUGUSTUS	start_codon	2190866	2190868	.	+	0	transcript_id "g444.t1"; gene_id "g444";
Scaffold_1	AUGUSTUS	CDS	2190866	2192080	0.93	+	0	transcript_id "g444.t1"; gene_id "g444";
Scaffold_1	AUGUSTUS	stop_codon	2192078	2192080	.	+	0	transcript_id "g444.t1"; gene_id "g444";
# protein sequence = [MGESGDIGRTNRGSMVLSRVHYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGA
# PATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGY
# NNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKHDLYLRPEKCEFE
# QQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALW
# APDRPTRIEVDASGFATGGALMQKQDDGQWHP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g444
###
# start gene g445
Scaffold_1	AUGUSTUS	gene	2200614	2203342	0.3	-	.	g445
Scaffold_1	AUGUSTUS	transcript	2200614	2203342	0.3	-	.	g445.t1
Scaffold_1	AUGUSTUS	stop_codon	2200614	2200616	.	-	0	transcript_id "g445.t1"; gene_id "g445";
Scaffold_1	AUGUSTUS	CDS	2200614	2201124	0.87	-	1	transcript_id "g445.t1"; gene_id "g445";
Scaffold_1	AUGUSTUS	CDS	2202166	2202244	0.65	-	2	transcript_id "g445.t1"; gene_id "g445";
Scaffold_1	AUGUSTUS	CDS	2203216	2203342	0.3	-	0	transcript_id "g445.t1"; gene_id "g445";
Scaffold_1	AUGUSTUS	start_codon	2203340	2203342	.	-	0	transcript_id "g445.t1"; gene_id "g445";
# protein sequence = [MSVFRKRFSVLIKEINGQSCTYYKSHMILNVSILVTGSVGDVCAVGVARGSVAFVTDTSNEGRAYAILGSRPSVSGSS
# IRPAIGSTRQQPFGSPRRPSVPSRAIPIRQSSYSSMSDYGTPTSRRFSNVPSIFSHPGVRTPIAVLDAQQLLLRDEEVVPADINENENLEPILESRRA
# STIVPDENEVLHEKPPSLSSQIPILVIIQYGLLALHSTTHDQIFMSYLVTWVMSAFHEVDRA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g445
###
# start gene g446
Scaffold_1	AUGUSTUS	gene	2210270	2210741	0.25	-	.	g446
Scaffold_1	AUGUSTUS	transcript	2210270	2210741	0.25	-	.	g446.t1
Scaffold_1	AUGUSTUS	stop_codon	2210270	2210272	.	-	0	transcript_id "g446.t1"; gene_id "g446";
Scaffold_1	AUGUSTUS	CDS	2210270	2210568	0.82	-	2	transcript_id "g446.t1"; gene_id "g446";
Scaffold_1	AUGUSTUS	CDS	2210636	2210741	0.25	-	0	transcript_id "g446.t1"; gene_id "g446";
Scaffold_1	AUGUSTUS	start_codon	2210739	2210741	.	-	0	transcript_id "g446.t1"; gene_id "g446";
# protein sequence = [MYTASKHAVLGLMRSLDASFVSRGLRITSIHPFFAATSMVPNVIRLQLAGIPLAPVPRIARTILYAATQSDPACSGAA
# FWVPDGGALVFMVSREEFKPGVYDDIDRSSNATSVYVFMLSTSISNNCLTSLISEV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g446
###
# start gene g447
Scaffold_1	AUGUSTUS	gene	2214062	2214865	0.27	+	.	g447
Scaffold_1	AUGUSTUS	transcript	2214062	2214865	0.27	+	.	g447.t1
Scaffold_1	AUGUSTUS	start_codon	2214062	2214064	.	+	0	transcript_id "g447.t1"; gene_id "g447";
Scaffold_1	AUGUSTUS	CDS	2214062	2214077	0.63	+	0	transcript_id "g447.t1"; gene_id "g447";
Scaffold_1	AUGUSTUS	CDS	2214198	2214381	0.43	+	2	transcript_id "g447.t1"; gene_id "g447";
Scaffold_1	AUGUSTUS	CDS	2214435	2214613	0.63	+	1	transcript_id "g447.t1"; gene_id "g447";
Scaffold_1	AUGUSTUS	CDS	2214678	2214865	1	+	2	transcript_id "g447.t1"; gene_id "g447";
Scaffold_1	AUGUSTUS	stop_codon	2214863	2214865	.	+	0	transcript_id "g447.t1"; gene_id "g447";
# protein sequence = [MRKGFKEDEIQEMSIDLGMLDKLKARVQLARKIETTHHKSKKAKHERTWMKETAEAMEIELDSDFASDSDGDNPNKRQ
# RKADQATAAALKAQLKQMLAQPLIARGISAKYITSGSNHIVDELISGEYNEKMLGVGVNDAGSDLGKAKRKKRVPKAEDSKGLAKDVSEVEWMGIDID
# HAMSTNTKFGPF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g447
###
# start gene g448
Scaffold_1	AUGUSTUS	gene	2221530	2222245	0.24	+	.	g448
Scaffold_1	AUGUSTUS	transcript	2221530	2222245	0.24	+	.	g448.t1
Scaffold_1	AUGUSTUS	start_codon	2221530	2221532	.	+	0	transcript_id "g448.t1"; gene_id "g448";
Scaffold_1	AUGUSTUS	CDS	2221530	2221685	0.87	+	0	transcript_id "g448.t1"; gene_id "g448";
Scaffold_1	AUGUSTUS	CDS	2221805	2222245	0.26	+	0	transcript_id "g448.t1"; gene_id "g448";
Scaffold_1	AUGUSTUS	stop_codon	2222243	2222245	.	+	0	transcript_id "g448.t1"; gene_id "g448";
# protein sequence = [MYTQETEVGKKSQNYAASDEESFVGTVDSGQNEQMENAEDSPSSEDDNPNPWAKKPVPLAMATIGKAERNTRAQKNET
# RRQTRSDKHNSTHKNLSDNSWNEEGLFKKRKCMDPMNWGASEPDTDINQHGAIENFRAVRDNAQQQQMPKKKSSKNLNGLSCMKFLKHLLTKSNPASG
# TLWGSTHENLMLSNELRAQVAR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g448
###
# start gene g449
Scaffold_1	AUGUSTUS	gene	2223537	2224499	0.5	+	.	g449
Scaffold_1	AUGUSTUS	transcript	2223537	2224499	0.5	+	.	g449.t1
Scaffold_1	AUGUSTUS	start_codon	2223537	2223539	.	+	0	transcript_id "g449.t1"; gene_id "g449";
Scaffold_1	AUGUSTUS	CDS	2223537	2224499	0.5	+	0	transcript_id "g449.t1"; gene_id "g449";
Scaffold_1	AUGUSTUS	stop_codon	2224497	2224499	.	+	0	transcript_id "g449.t1"; gene_id "g449";
# protein sequence = [MAPTSRKRHTKKRKPTPGIDFALEDLPERHQHIIDTNFLPTKNGGYEHLTSLKRVRNNKILIKPYDGYTHFVTVSDVR
# TCLDFDRILRKRSFRLQMADIPAIYPLLAEHVNSDPLIHPYQLATFNVDTGIVYTQAPPIDRRLFDPFTREDDLRINGLDKLTTEGRGLHRELQKKHW
# TEKHVERKDWKKGYQTKVSMREEASSPGSSHEARDPSGSFVHPSTPRDSTISTASKTASHTDQTHLPHPTHTSFEVSYSPTIISSSPNPSLLIDALAT
# EETPVLTNEPTHNSCTQSFDNDLLDPRVGLRPDRSRYPRRRRSSSN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g449
###
# start gene g450
Scaffold_1	AUGUSTUS	gene	2226583	2226972	0.39	+	.	g450
Scaffold_1	AUGUSTUS	transcript	2226583	2226972	0.39	+	.	g450.t1
Scaffold_1	AUGUSTUS	start_codon	2226583	2226585	.	+	0	transcript_id "g450.t1"; gene_id "g450";
Scaffold_1	AUGUSTUS	CDS	2226583	2226972	0.39	+	0	transcript_id "g450.t1"; gene_id "g450";
Scaffold_1	AUGUSTUS	stop_codon	2226970	2226972	.	+	0	transcript_id "g450.t1"; gene_id "g450";
# protein sequence = [MGHDTVNYVAEHLSTKVQDRLNNAFPKLDPDSVTSVLTEVITTFDDSLLVDLLSGIPSESQLSSLTEDEVPNILGGDH
# RSKVLRSMQGTTVIIALTNPDNEDLWVASLGDSYAGKCNPLILDFFINESG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g450
###
# start gene g451
Scaffold_1	AUGUSTUS	gene	2235737	2236651	0.48	+	.	g451
Scaffold_1	AUGUSTUS	transcript	2235737	2236651	0.48	+	.	g451.t1
Scaffold_1	AUGUSTUS	start_codon	2235737	2235739	.	+	0	transcript_id "g451.t1"; gene_id "g451";
Scaffold_1	AUGUSTUS	CDS	2235737	2236651	0.48	+	0	transcript_id "g451.t1"; gene_id "g451";
Scaffold_1	AUGUSTUS	stop_codon	2236649	2236651	.	+	0	transcript_id "g451.t1"; gene_id "g451";
# protein sequence = [MPAPSGPMKIPSYTVPITTFDAIQTLKLLGPFDYYPGLSHVQLDLTHFVSFYDTTLAPSLIAVRSGKPRLAHRLLGID
# EDDIVRVRKYLEEQIAETPWSSLQPEAVEHGIDWPAYLHSIISLYGKPLEDIWVIINSTWPQSDVQPNNQDTQVKTAFQLIEYTVQRFILYSVSPVGN
# ASDFAWASPVYKECALSHTSSISTTSRTKSEALLRNAVEGTTRELCRALTKMWAMGVHEGLSSLFDSPTSSAHPLVRNAVLDAWKLELGNLIQWLDWN
# VWIRCKPACGEQVNMKARWTLTNLCSISIF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g451
###
# start gene g452
Scaffold_1	AUGUSTUS	gene	2260648	2260941	0.91	+	.	g452
Scaffold_1	AUGUSTUS	transcript	2260648	2260941	0.91	+	.	g452.t1
Scaffold_1	AUGUSTUS	start_codon	2260648	2260650	.	+	0	transcript_id "g452.t1"; gene_id "g452";
Scaffold_1	AUGUSTUS	CDS	2260648	2260941	0.91	+	0	transcript_id "g452.t1"; gene_id "g452";
Scaffold_1	AUGUSTUS	stop_codon	2260939	2260941	.	+	0	transcript_id "g452.t1"; gene_id "g452";
# protein sequence = [MLIEKALRHSKKVGRLHVDEGAFTVVDKVDCDPGRVGSTQLRHDMDLDDLRRWGSAHNSYGIKKEYVEYTHRQRCSAD
# RRDESEEETDEDRADTHDG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g452
###
# start gene g453
Scaffold_1	AUGUSTUS	gene	2272003	2272758	0.8	-	.	g453
Scaffold_1	AUGUSTUS	transcript	2272003	2272758	0.8	-	.	g453.t1
Scaffold_1	AUGUSTUS	stop_codon	2272003	2272005	.	-	0	transcript_id "g453.t1"; gene_id "g453";
Scaffold_1	AUGUSTUS	CDS	2272003	2272758	0.8	-	0	transcript_id "g453.t1"; gene_id "g453";
Scaffold_1	AUGUSTUS	start_codon	2272756	2272758	.	-	0	transcript_id "g453.t1"; gene_id "g453";
# protein sequence = [MGLPRALLMGIFEAGFERPSPIQEAAIPTALSGRDILARAKNGTGKTAAFIIPLLSKINVSKPYIQGIVLVPTRELAL
# QIASVTKMLSKHMGVEVMVTTGGTTLKDDILRLQQPVHVLVGTPGRILDLAGKGVADLGKGCRVFVMDEADKLLSPEFGPVMESLLGYLPKSKEAPEA
# EGSGRQVMLFSATFPMIVKDFKASMTYLLAFQFCLLVHRTNTCKTRTKSTLWMSLLLKVSPNTTPTSKKDKRFIV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g453
###
# start gene g454
Scaffold_1	AUGUSTUS	gene	2273974	2274420	0.61	+	.	g454
Scaffold_1	AUGUSTUS	transcript	2273974	2274420	0.61	+	.	g454.t1
Scaffold_1	AUGUSTUS	start_codon	2273974	2273976	.	+	0	transcript_id "g454.t1"; gene_id "g454";
Scaffold_1	AUGUSTUS	CDS	2273974	2274420	0.61	+	0	transcript_id "g454.t1"; gene_id "g454";
Scaffold_1	AUGUSTUS	stop_codon	2274418	2274420	.	+	0	transcript_id "g454.t1"; gene_id "g454";
# protein sequence = [MKNLRNKPYFPMGSGVPRVGGQMPRPNDASGDPQSSGSNKHARRDTFNARDAGSATSGSEGFPLISSTKTPPESAFAR
# DGSNPSTGPHTGGTTNDNPKNPVRSASSSDLSLSSSSGSPAASNAGPTDPAESVLPYCGHLIRSYGEDLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g454
###
# start gene g455
Scaffold_1	AUGUSTUS	gene	2280618	2281385	1	-	.	g455
Scaffold_1	AUGUSTUS	transcript	2280618	2281385	1	-	.	g455.t1
Scaffold_1	AUGUSTUS	stop_codon	2280618	2280620	.	-	0	transcript_id "g455.t1"; gene_id "g455";
Scaffold_1	AUGUSTUS	CDS	2280618	2281385	1	-	0	transcript_id "g455.t1"; gene_id "g455";
Scaffold_1	AUGUSTUS	start_codon	2281383	2281385	.	-	0	transcript_id "g455.t1"; gene_id "g455";
# protein sequence = [MATLGYAYCVLHDIYFADHNDRDRHIQSSDDHPQCHICDRRFKDRNALRNVSFYLSKIKHLPDRLFYFQHWIVAKHHY
# YCADCDKHFNTAAGLEYHIDEIHVGGDDSDDEDECSDESEHYDGWEDDRGMDRYPDGVPAESQAHKLGVNDDNSWEIWDDLDFEDQEDLMDPSEPSLD
# DYAPNSDDEVDEDDEEHLSHHFECPMCEEKDCGTICTTLCGHIFCAPCIIGAYKYTEACPICDEIGEVSELRRIYISEQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g455
###
# start gene g456
Scaffold_1	AUGUSTUS	gene	2288078	2289032	0.46	+	.	g456
Scaffold_1	AUGUSTUS	transcript	2288078	2289032	0.46	+	.	g456.t1
Scaffold_1	AUGUSTUS	start_codon	2288078	2288080	.	+	0	transcript_id "g456.t1"; gene_id "g456";
Scaffold_1	AUGUSTUS	CDS	2288078	2288470	0.49	+	0	transcript_id "g456.t1"; gene_id "g456";
Scaffold_1	AUGUSTUS	CDS	2288553	2289032	0.61	+	0	transcript_id "g456.t1"; gene_id "g456";
Scaffold_1	AUGUSTUS	stop_codon	2289030	2289032	.	+	0	transcript_id "g456.t1"; gene_id "g456";
# protein sequence = [MPNVYSSMLDDTVTYAKWKPCGNGMPGTMSCGKITVETLEAAKRDLRIFLTNNRKLAASDYALRCLNVWEDPRVSNWI
# DQNREKFSALSFDELFIAVRDRVLEPDWQDSTFRKMRAVCMPDDLSTSASDLAAQLQNTGRLPPLTTNERRLLSENEGCFKCRSFFVKCRTSSTEHEF
# PLPIGNGYKELTVADVTAARKLRGMNPDSNKKPRTAAIASIGVTDDGDDDDVMASIMPSAVLGDGTDSEEEVSCPFRVHHLRWKCHVSGPKSVFPVRV
# NSLIDNVLTLLLFTQT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g456
###
# start gene g457
Scaffold_1	AUGUSTUS	gene	2290196	2291622	0.41	+	.	g457
Scaffold_1	AUGUSTUS	transcript	2290196	2291622	0.41	+	.	g457.t1
Scaffold_1	AUGUSTUS	start_codon	2290196	2290198	.	+	0	transcript_id "g457.t1"; gene_id "g457";
Scaffold_1	AUGUSTUS	CDS	2290196	2290640	0.41	+	0	transcript_id "g457.t1"; gene_id "g457";
Scaffold_1	AUGUSTUS	CDS	2290742	2291622	0.88	+	2	transcript_id "g457.t1"; gene_id "g457";
Scaffold_1	AUGUSTUS	stop_codon	2291620	2291622	.	+	0	transcript_id "g457.t1"; gene_id "g457";
# protein sequence = [MLKRFYSHSASPVYIATQISVICSLNVHFLGHTISADGIAADDKKVDRIMDWPTPKMLKELQAFLGLVRYVAAFLPRL
# AELTEILTALTANVVDKNHLPWEACHQNAFEAVKLLVSSRECLTVIDHDKLDTHKIFVTTDASNCSGAVLTIIRALKKWRVDLLGVPFIIMTDHRTLE
# NFHSQPDLSRRQARWMEFFSQFDCKIVYVKGERNTVADALSRRTDLLDPVKCHPYLDASADAIPTSRHPYAYCADSDDDLDLPILCVLPDSCWSTARM
# LALRDPPDPPSPIATTLEISSDPTLLDDIRNGYTTDAWCKDLPSMASSMPLIRHDKTSKLWYIGNRLIIPRVGHIREELFRLAHDNLGHFGFDKSYAA
# LRECYYWPHMRRDLSKAYIPACDECQRNKSTTQKKAGPLHPLPIPDRRFSSVAMDLLGPYPKMEVPTAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g457
###
# start gene g458
Scaffold_1	AUGUSTUS	gene	2297736	2298805	0.43	-	.	g458
Scaffold_1	AUGUSTUS	transcript	2297736	2298805	0.43	-	.	g458.t1
Scaffold_1	AUGUSTUS	stop_codon	2297736	2297738	.	-	0	transcript_id "g458.t1"; gene_id "g458";
Scaffold_1	AUGUSTUS	CDS	2297736	2298041	0.85	-	0	transcript_id "g458.t1"; gene_id "g458";
Scaffold_1	AUGUSTUS	CDS	2298126	2298366	0.74	-	1	transcript_id "g458.t1"; gene_id "g458";
Scaffold_1	AUGUSTUS	CDS	2298474	2298805	0.51	-	0	transcript_id "g458.t1"; gene_id "g458";
Scaffold_1	AUGUSTUS	start_codon	2298803	2298805	.	-	0	transcript_id "g458.t1"; gene_id "g458";
# protein sequence = [MNQTTNLIKVSSISTYWAETEETEPILDPEGGMSEESDEDIEIEIAPAPAPASRKRKNVTKTWSIEDDNLENLKSEDE
# EAKEKERKSRKKKKGMDQDKKFSSPRKQIGLSNTTATFSEFQDIIYTTLDCKDVRVKPDLSYRLPTASKGSHISLKSEDDWTCCLQDIKNTHLGRPKA
# HQTLPIDVTIVISDQNPSVAKNSKSKSKGKRRGSSVQQMLTVINLDGSDGEYDVDDEEEESGGLLSGDEKKQLDALKAMLKQCQKCGHEIMCKIDVQG
# QHVKLSYNMLRAWVIALV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g458
###
# start gene g459
Scaffold_1	AUGUSTUS	gene	2304483	2305250	0.99	+	.	g459
Scaffold_1	AUGUSTUS	transcript	2304483	2305250	0.99	+	.	g459.t1
Scaffold_1	AUGUSTUS	start_codon	2304483	2304485	.	+	0	transcript_id "g459.t1"; gene_id "g459";
Scaffold_1	AUGUSTUS	CDS	2304483	2304616	0.99	+	0	transcript_id "g459.t1"; gene_id "g459";
Scaffold_1	AUGUSTUS	CDS	2304998	2305250	0.99	+	1	transcript_id "g459.t1"; gene_id "g459";
Scaffold_1	AUGUSTUS	stop_codon	2305248	2305250	.	+	0	transcript_id "g459.t1"; gene_id "g459";
# protein sequence = [MRTSSTVTATTSTHTHSQSFDNDDGSASGPAVVCYKCGTEGHRSSSPGSGARPRDHSTHIGSRDYDNGYHGAHTNLYR
# SRTREDSDRYYVSVDKPQVDSTPNTRFELDGRYYSRVETTTPRNDYDDII]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g459
###
# start gene g460
Scaffold_1	AUGUSTUS	gene	2310048	2310458	0.93	-	.	g460
Scaffold_1	AUGUSTUS	transcript	2310048	2310458	0.93	-	.	g460.t1
Scaffold_1	AUGUSTUS	stop_codon	2310048	2310050	.	-	0	transcript_id "g460.t1"; gene_id "g460";
Scaffold_1	AUGUSTUS	CDS	2310048	2310458	0.93	-	0	transcript_id "g460.t1"; gene_id "g460";
Scaffold_1	AUGUSTUS	start_codon	2310456	2310458	.	-	0	transcript_id "g460.t1"; gene_id "g460";
# protein sequence = [MSDTKNMKEDSTTGATAIYTQASSVHSLHSSTTIHDHQATITDVNVNYISHDHEKVKLDHDQHHHDPSHEALGHGESA
# IPTDKKEEEIENLQDDWEDDPINARNWPSSKKWTSVAIVSTRTSPSYPITDSLMGSFL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g460
###
# start gene g461
Scaffold_1	AUGUSTUS	gene	2312696	2313622	0.91	-	.	g461
Scaffold_1	AUGUSTUS	transcript	2312696	2313622	0.91	-	.	g461.t1
Scaffold_1	AUGUSTUS	stop_codon	2312696	2312698	.	-	0	transcript_id "g461.t1"; gene_id "g461";
Scaffold_1	AUGUSTUS	CDS	2312696	2313622	0.91	-	0	transcript_id "g461.t1"; gene_id "g461";
Scaffold_1	AUGUSTUS	start_codon	2313620	2313622	.	-	0	transcript_id "g461.t1"; gene_id "g461";
# protein sequence = [MAYRGCAPNPHLVSIISTIYPQQANTQYAHPFTEDIALLSLWSMHSTLFNSSIDSSPSKISSSLPPDSFSPSRLILPL
# TPTFTDPDNDENGNKKSNFPFNYAERDILPPGSPPRPPVIPRSRSHTGIHPLLLKIALPHMPGVWYKEDWDDYMGMEVPYVLERVVIGDYGVQGIETL
# LQQHSQSGSRDWWEPIRKTVVSFFQDPSEISPDLIDNSRKKTLTYVHRPNSLVVEDHNALVRALMKMGREKVIEVNLVDAGASDGMNVEKVNADDVEW
# GTRMGAITRSDVSIFPPFFGFLSFFLHIDFRHFA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g461
###
# start gene g462
Scaffold_1	AUGUSTUS	gene	2323082	2324098	0.89	-	.	g462
Scaffold_1	AUGUSTUS	transcript	2323082	2324098	0.89	-	.	g462.t1
Scaffold_1	AUGUSTUS	stop_codon	2323082	2323084	.	-	0	transcript_id "g462.t1"; gene_id "g462";
Scaffold_1	AUGUSTUS	CDS	2323082	2324098	0.89	-	0	transcript_id "g462.t1"; gene_id "g462";
Scaffold_1	AUGUSTUS	start_codon	2324096	2324098	.	-	0	transcript_id "g462.t1"; gene_id "g462";
# protein sequence = [MELSKEITDVPDAQYLTIPGDLNVAPPPYSGRRFSPSMIPQPKAPAHRLFAQEADPLAEAEQIAQSQKDFSSPNSTRN
# FTRRALQSIPATPSEWRTSSTALSLTTPGSIGQTPQHQDDTAAEMLFELLDDAGSISSTATSHTSTTIRPLSIPKKLNRILSVPPRPRQSAMTHGKSL
# SASQDSAAAMRERSYPQHSRQESVTRVPRISLIPEDEAVPPITLTPSRLLSPRNPLIIPPHPITPPPPLPSLPPASTVAPAVFSPSKPRSIRSKVWNA
# REINSRANALVDTQDGSRNIATASSISRSRSNSVPQRTDSQTTRTIYPHTRTVITDDFTSTYAP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g462
###
# start gene g463
Scaffold_1	AUGUSTUS	gene	2324505	2326777	0.15	-	.	g463
Scaffold_1	AUGUSTUS	transcript	2324505	2326777	0.15	-	.	g463.t1
Scaffold_1	AUGUSTUS	stop_codon	2324505	2324507	.	-	0	transcript_id "g463.t1"; gene_id "g463";
Scaffold_1	AUGUSTUS	CDS	2324505	2326166	0.57	-	0	transcript_id "g463.t1"; gene_id "g463";
Scaffold_1	AUGUSTUS	CDS	2326235	2326777	0.16	-	0	transcript_id "g463.t1"; gene_id "g463";
Scaffold_1	AUGUSTUS	start_codon	2326775	2326777	.	-	0	transcript_id "g463.t1"; gene_id "g463";
# protein sequence = [MFGLPFLLQFVLLAFMLLVLTFPGITVGFPTTSTNVTIDDQDPAIFYSAGQWNLSNSYNSLDVKGFHHLSGQSSAFAV
# FNFTGTQRSVMWEHVSGFDSSLLIFAYIYPSLYLDVTGVAIYFLSPLWPYAVGAQLVLDNQPPAFVDLQDYSRSVSLSGGSETVSSAVVWGVENLELG
# NHSLRIFSVGPHFPNFRYSSIDNATVKSPVSSFVGGSSVMPSPTVVEQTSSSTPVSHQSGTSAAIGAVVAVVVVLVIFVLVFLVFRYRKRKAARFPRL
# DIWDGEDHPAENRDQSGSVMESSATHDATVLSMRSRSAERLLQSPTKTSSTLPSASKSTVAVSPRLPLPPINTKQLPALPPPDEETQSALKYTKSILS
# AVSKRFTTPAPIPQSGSTAESTTSSFFPRPIFDEDHRMLSISRQHSLRGTTTPILTGSDALDPAKVSRIGTYPGVTTSKIELQEARRFPAKPITRNLV
# PYPASENVQPPVTVEISREKNQSPPPLPTQPSTTVSPHISSSSVPYSAKRKSLNALTIIPENGGSRGKLDTEEINPSSNRTGKRVSGGKLRMEKERQR
# RRRSKTPVTPQGPRPRPLPSLPASLSVSGYNTPLPSASSGGSSNSEALSSNGSVPTVNSQFSIKATVQGHVVRRRRPLPQTLPEARRSSLLLGSHILV
# PLRSVPRGLSPGLDGVHSRALEISSIIQSQPERLKSAFMRQDQELKTPLSSSDSTCTEDDDDSQTGTS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g463
###
# start gene g464
Scaffold_1	AUGUSTUS	gene	2343461	2344962	0.87	+	.	g464
Scaffold_1	AUGUSTUS	transcript	2343461	2344962	0.87	+	.	g464.t1
Scaffold_1	AUGUSTUS	start_codon	2343461	2343463	.	+	0	transcript_id "g464.t1"; gene_id "g464";
Scaffold_1	AUGUSTUS	CDS	2343461	2343463	0.9	+	0	transcript_id "g464.t1"; gene_id "g464";
Scaffold_1	AUGUSTUS	CDS	2343565	2343709	0.91	+	0	transcript_id "g464.t1"; gene_id "g464";
Scaffold_1	AUGUSTUS	CDS	2343989	2344962	0.93	+	2	transcript_id "g464.t1"; gene_id "g464";
Scaffold_1	AUGUSTUS	stop_codon	2344960	2344962	.	+	0	transcript_id "g464.t1"; gene_id "g464";
# protein sequence = [MYSLGTEASEVGVVDARIYENGMVALTGSLTLLEVKGWEGARPMTLANPNFQRRMAEFDTLNVPSAQGNVKQVEWCGN
# DAIVVTWDSLAVLVGPFADTLQYYYVGSTFAVTETDGVRILGADVCDLIQKVPSSTLSIFRPGSTSPAAILYDAWESFSQRSPKSDESIRSIRPELAT
# AVDGCIDAAGQEWEPYWQRRLLSVSHDCSYNVCLADNLVKAAKFGQGFLDLYDPTDFINMGQTLKVLNAVRFYEIGIPLTYAQYSYTSPTHLISRLTS
# RNMHLLALRISTFLSLKPDVVLKHWASAKIMRTRPVASGTGKDAELDSDDEVCRLIVDKFKQLGDVEVSYAEIAKRAWEVGRTGLATKVKFGFIPLNS
# F]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g464
###
# start gene g465
Scaffold_1	AUGUSTUS	gene	2350276	2352306	0.12	-	.	g465
Scaffold_1	AUGUSTUS	transcript	2350276	2352306	0.12	-	.	g465.t1
Scaffold_1	AUGUSTUS	stop_codon	2350276	2350278	.	-	0	transcript_id "g465.t1"; gene_id "g465";
Scaffold_1	AUGUSTUS	CDS	2350276	2350538	0.78	-	2	transcript_id "g465.t1"; gene_id "g465";
Scaffold_1	AUGUSTUS	CDS	2350756	2351167	0.6	-	0	transcript_id "g465.t1"; gene_id "g465";
Scaffold_1	AUGUSTUS	CDS	2351301	2351581	0.36	-	2	transcript_id "g465.t1"; gene_id "g465";
Scaffold_1	AUGUSTUS	CDS	2352279	2352306	0.71	-	0	transcript_id "g465.t1"; gene_id "g465";
Scaffold_1	AUGUSTUS	start_codon	2352304	2352306	.	-	0	transcript_id "g465.t1"; gene_id "g465";
# protein sequence = [MNISEEEKFYAQSSADGGIIIQVIGELSNNNGPWQKFVQTFFLAEQPNGYFVLNDIFRFLKEDAVEGDSDEVASDSVS
# APEPVAVPAEYPREPSPPPSPPVEVPATPAPVSRTPTPEPTHDVAPTPPPAAAVIAPSPSPTPAPAASATTPAPPAPAAAPVPKTWANLAASQRSGAT
# LLPMTPEVPRRMFPIPQLLPAAVVQTPVKPSGTPSRTPHPAYAAAQSVTTAQCFIKVCDLSLNILDAARRAIILSLPPVAGGEGGVKVDIGGGETLKI
# IVETKKERGDRPASRGRGGPPFAGEGRGASSSDGRGGGFRGSARGSGRGRGAK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g465
###
# start gene g466
Scaffold_1	AUGUSTUS	gene	2358045	2358695	1	+	.	g466
Scaffold_1	AUGUSTUS	transcript	2358045	2358695	1	+	.	g466.t1
Scaffold_1	AUGUSTUS	start_codon	2358045	2358047	.	+	0	transcript_id "g466.t1"; gene_id "g466";
Scaffold_1	AUGUSTUS	CDS	2358045	2358695	1	+	0	transcript_id "g466.t1"; gene_id "g466";
Scaffold_1	AUGUSTUS	stop_codon	2358693	2358695	.	+	0	transcript_id "g466.t1"; gene_id "g466";
# protein sequence = [MEARSGSISGDWEEVQHPGQAPGHPVDSEKGDKDWETVHHPDQAPGHPTKSTAAAHPEPPRTGAKVPKQKPKDPERDN
# SLVSLLSYTWVGIETGRPGDTRVSTYDDMIHHEAIELIGKAAKYKWKLTNYLINPYNPHMYPAATDPHTTEFKFLLQLEYGHGGQGTNYCEGRVEGEP
# KDGCVGIVRIGKGLKSELRNKDGVVVRMSFGFEDSDSESD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g466
###
# start gene g467
Scaffold_1	AUGUSTUS	gene	2362922	2363158	0.45	+	.	g467
Scaffold_1	AUGUSTUS	transcript	2362922	2363158	0.45	+	.	g467.t1
Scaffold_1	AUGUSTUS	start_codon	2362922	2362924	.	+	0	transcript_id "g467.t1"; gene_id "g467";
Scaffold_1	AUGUSTUS	CDS	2362922	2363158	0.45	+	0	transcript_id "g467.t1"; gene_id "g467";
Scaffold_1	AUGUSTUS	stop_codon	2363156	2363158	.	+	0	transcript_id "g467.t1"; gene_id "g467";
# protein sequence = [MIYLTFFTQVESFIPLWEWDVPKKKSKKKKGDKHKDKSSDVEKLKKNGGAFVEEVEDSGNSRPQSRTAKVEEVEDEDD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g467
###
# start gene g468
Scaffold_1	AUGUSTUS	gene	2364626	2366260	0.88	+	.	g468
Scaffold_1	AUGUSTUS	transcript	2364626	2366260	0.88	+	.	g468.t1
Scaffold_1	AUGUSTUS	start_codon	2364626	2364628	.	+	0	transcript_id "g468.t1"; gene_id "g468";
Scaffold_1	AUGUSTUS	CDS	2364626	2366260	0.88	+	0	transcript_id "g468.t1"; gene_id "g468";
Scaffold_1	AUGUSTUS	stop_codon	2366258	2366260	.	+	0	transcript_id "g468.t1"; gene_id "g468";
# protein sequence = [MIQQRKDAIENLYSTLPVVERTLLDAEIEGTPMFSMPTTNIIVDDTNMSDSWEEIPARDISSSSVRMNGVIPTASQDH
# PQINGVVLPTPSASASATAVPIPRESLVPLISATAVPSSFTLTSSTGPGNRENLASSRSVTTRFGGAPILPIAGSSGDSSIAPNSSLEFSGTVDSSGR
# TAHSLNGELTRLTQPSGRKSLPFSSAAFNSPNSALGLSTSGTGFGSTPTLFSSSKRKPNAFYKPPIVNNPPLSNPFSIEDPAPEFGGASRRSTTGSHS
# PERPPSNEKQNRNRGVDQLAVSEGGRQNGDILENEAMAVDEGQGAGLDYPLFVNAGSTSPENNERKSRRSLISASSSANSAGASLRTSQKRPPGAFTD
# EEDEDMIEDIPSHPPPRQTRLRKSNVPYTSTSAATANAHTSASAKSSASASTSARTTKPRGKKPRQTTTSLKSKRRVPGGMSDDDDDDEEDDGDAGQE
# EVEEDQDHVAPLAARRTMRKTRSSVASALSTEEPGPRRRSSRISVAGETGAGGASSKRVTRKSTAGTGGKRKQR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g468
###
# start gene g469
Scaffold_1	AUGUSTUS	gene	2366729	2367514	0.59	-	.	g469
Scaffold_1	AUGUSTUS	transcript	2366729	2367514	0.59	-	.	g469.t1
Scaffold_1	AUGUSTUS	stop_codon	2366729	2366731	.	-	0	transcript_id "g469.t1"; gene_id "g469";
Scaffold_1	AUGUSTUS	CDS	2366729	2367514	0.59	-	0	transcript_id "g469.t1"; gene_id "g469";
Scaffold_1	AUGUSTUS	start_codon	2367512	2367514	.	-	0	transcript_id "g469.t1"; gene_id "g469";
# protein sequence = [MTGAKVAGHRGYYLTNDGIDLNQALISYGLDFLRKKGYKKIQPPFMMNKDWMAKTAQLDQFDEELYKARNIQIFSKML
# FLMVRKVIADDDEKYLIATSEQPISVFHSDEWLEKTQLPIRYAGYSTCFRKEAGSAGRDMWGIFRVHQFEKVEQFIVDDPEKSWETLENMISNSEEFY
# QSLGLRYQVVGIVSSALNLAAAMKYDLEAWFPFQKGYKELVSCSNCTDYRAFNSPEILPMFTDRIFCQSLAIRGPMRSEEQGSNA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g469
###
# start gene g470
Scaffold_1	AUGUSTUS	gene	2373132	2373488	0.55	+	.	g470
Scaffold_1	AUGUSTUS	transcript	2373132	2373488	0.55	+	.	g470.t1
Scaffold_1	AUGUSTUS	start_codon	2373132	2373134	.	+	0	transcript_id "g470.t1"; gene_id "g470";
Scaffold_1	AUGUSTUS	CDS	2373132	2373488	0.55	+	0	transcript_id "g470.t1"; gene_id "g470";
Scaffold_1	AUGUSTUS	stop_codon	2373486	2373488	.	+	0	transcript_id "g470.t1"; gene_id "g470";
# protein sequence = [MQQPAMDSPPIGAAPAHHSKRRQYAAGQTQAYYGSAEEPSMLQPMSQPPQQAGMEPQLFTPGLAAPSFAMQQQGQTQP
# PYYDPNQAQQQPDYINSQQQQPAYGQPNPTLLLINSVKWD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g470
###
# start gene g471
Scaffold_1	AUGUSTUS	gene	2378808	2379410	0.82	-	.	g471
Scaffold_1	AUGUSTUS	transcript	2378808	2379410	0.82	-	.	g471.t1
Scaffold_1	AUGUSTUS	stop_codon	2378808	2378810	.	-	0	transcript_id "g471.t1"; gene_id "g471";
Scaffold_1	AUGUSTUS	CDS	2378808	2379410	0.82	-	0	transcript_id "g471.t1"; gene_id "g471";
Scaffold_1	AUGUSTUS	start_codon	2379408	2379410	.	-	0	transcript_id "g471.t1"; gene_id "g471";
# protein sequence = [MTSLAGAAHIIHRSDNVMDRVDSSADDSALDDGDTPELSEVAISKHLATSIVASGANTNARRLSSVGPDFNYPLDLHT
# FPVSHLSERTRRPSVIRADSGTETIATIASSLKDSVPPTRTQTFESTSAILNQTRPLQYEESPTVTDQVARKQNRRSIIQFAALCWCFALEGWNDGSV
# GPLLPVIQTYYSVRVSASKKMRLI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g471
###
# start gene g472
Scaffold_1	AUGUSTUS	gene	2395254	2395898	0.61	-	.	g472
Scaffold_1	AUGUSTUS	transcript	2395254	2395898	0.61	-	.	g472.t1
Scaffold_1	AUGUSTUS	stop_codon	2395254	2395256	.	-	0	transcript_id "g472.t1"; gene_id "g472";
Scaffold_1	AUGUSTUS	CDS	2395254	2395898	0.61	-	0	transcript_id "g472.t1"; gene_id "g472";
Scaffold_1	AUGUSTUS	start_codon	2395896	2395898	.	-	0	transcript_id "g472.t1"; gene_id "g472";
# protein sequence = [MSSTTMSSRSFTVFVDTPASEETETKPKPTTNTRLSRSLSESSLSLGLSPIYTTDKENLDPLTGERVGSSTALGKKRK
# GSISVLAVKPPLEVKLSKGKDVSASEAQPEAKKRKSSVSSSLSSKSKSKKELKAPGSGKKSAKRSSRRASPMPKLDEEVESDKEQTRVNQALINSKCY
# DLTVKPLADVSEAYEMEGDYTEEREVFQFVKVSLSTST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g472
###
# start gene g473
Scaffold_1	AUGUSTUS	gene	2398161	2399441	0.92	+	.	g473
Scaffold_1	AUGUSTUS	transcript	2398161	2399441	0.92	+	.	g473.t1
Scaffold_1	AUGUSTUS	start_codon	2398161	2398163	.	+	0	transcript_id "g473.t1"; gene_id "g473";
Scaffold_1	AUGUSTUS	CDS	2398161	2399441	0.92	+	0	transcript_id "g473.t1"; gene_id "g473";
Scaffold_1	AUGUSTUS	stop_codon	2399439	2399441	.	+	0	transcript_id "g473.t1"; gene_id "g473";
# protein sequence = [MPRRGIRSDWELFTYVQRIWSLGIILLNLATGRNPWKSASVSDPTFQAYLRDPQNFLPTVLPISPEVNAILARMLEVD
# WRDRMTIPELRVALEDVSTFYSDTVIFEGSMAKCGWESGIEIDSESTKHSLIQSQAAELKSHWSQESFSSDIVFASHSAMDSPWVGYSHFPNDAYAMR
# SDVEPGYQRHSMVEERCELHSRPQTPPSMRSPCVSAESGASYPVTPNSFDLTFGGRAVLPQRKPLIIDTGCVRPPYFRGNSLDSGSVGSSIMQTAVEY
# PSDVYAAETFFGSSMSNIAVVQSVRLGDRGPTEDKEMASPTAWEYSATQVSQSSSMFSSAKNSYTTTNMSFDNRSSAPSPEPIEWSELSSRLKENHPP
# ESQPSFSLLMSNIADVSPPLRSLSPRERISKRSLSDTLYTAQVFSSSFLGAEFW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g473
###
# start gene g474
Scaffold_1	AUGUSTUS	gene	2400151	2400834	0.4	-	.	g474
Scaffold_1	AUGUSTUS	transcript	2400151	2400834	0.4	-	.	g474.t1
Scaffold_1	AUGUSTUS	stop_codon	2400151	2400153	.	-	0	transcript_id "g474.t1"; gene_id "g474";
Scaffold_1	AUGUSTUS	CDS	2400151	2400834	0.4	-	0	transcript_id "g474.t1"; gene_id "g474";
Scaffold_1	AUGUSTUS	start_codon	2400832	2400834	.	-	0	transcript_id "g474.t1"; gene_id "g474";
# protein sequence = [MDSREVLDLNPTATNPFHNRVIVRNHRSIFHEAMALDGFNFDDPNWTPAKSDLADEELQVNESAGLEGYPVEQLMKFV
# LVRRFVVQQTGKGKIDHHQCFTVVGDGNGMVGLGMGTDTEPTHASNKSHIAAIKNMDYVDRFENRTIWTEMSGKFRSTQIKMRPRPMGFGLRCQPILH
# QVLKAAGIKDISAKIWGSRNPIMILQGALQMLQGGHNPLGFGNGIGARGRG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g474
###
# start gene g475
Scaffold_1	AUGUSTUS	gene	2403570	2404691	0.48	+	.	g475
Scaffold_1	AUGUSTUS	transcript	2403570	2404691	0.48	+	.	g475.t1
Scaffold_1	AUGUSTUS	start_codon	2403570	2403572	.	+	0	transcript_id "g475.t1"; gene_id "g475";
Scaffold_1	AUGUSTUS	CDS	2403570	2403591	0.61	+	0	transcript_id "g475.t1"; gene_id "g475";
Scaffold_1	AUGUSTUS	CDS	2403643	2404691	0.69	+	2	transcript_id "g475.t1"; gene_id "g475";
Scaffold_1	AUGUSTUS	stop_codon	2404689	2404691	.	+	0	transcript_id "g475.t1"; gene_id "g475";
# protein sequence = [MDVVSDHTAPHLINNIDSEEKEHIDQPGILNNSDCADPANLTLESKNVELPRFPSVRGESSPDAEDKTSVSPPSSASA
# SILSMPDPLSSSDTTSVQYDTIHISDYTRLLEYESSVSSPSVTGHGIGINAVSLPPQFKNERSNTFAPQRLPESAYRDLSDHDFESESEPESESSFPS
# VTSSFFFSSPASVASHGPGEDSHEDSNEDRESRSLRATQELVIPSLMLPEALNLPSVVHDYPLETPHPPKPSIPHSQAPSASDVLRLLVVAPSDLRRP
# SIMEGDQVPYLSQRVKKDFDDVVSQTNALHLHAARGYQPELHSVVADQDMETVLATVIDAFVKNELFTAVVLTSEISHDGTS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g475
###
# start gene g476
Scaffold_1	AUGUSTUS	gene	2409599	2410530	0.45	+	.	g476
Scaffold_1	AUGUSTUS	transcript	2409599	2410530	0.45	+	.	g476.t1
Scaffold_1	AUGUSTUS	start_codon	2409599	2409601	.	+	0	transcript_id "g476.t1"; gene_id "g476";
Scaffold_1	AUGUSTUS	CDS	2409599	2409604	0.89	+	0	transcript_id "g476.t1"; gene_id "g476";
Scaffold_1	AUGUSTUS	CDS	2409710	2409957	0.53	+	0	transcript_id "g476.t1"; gene_id "g476";
Scaffold_1	AUGUSTUS	CDS	2410023	2410530	0.49	+	1	transcript_id "g476.t1"; gene_id "g476";
Scaffold_1	AUGUSTUS	stop_codon	2410528	2410530	.	+	0	transcript_id "g476.t1"; gene_id "g476";
# protein sequence = [MESKGIVFFGAANPLLNVDIAGLSDSTEFPYILLTPQSEAERVFEESLNDRGVEVIRNTKVIGFGESSKEGLHVYFED
# GSSVIASKIVGLGSQMNVQVRSLAGISFQDPSSNVMYDENPSSASFMLFTLADVVLNIHPSIHIPRDAISWHLNGRIMFCPLELPEKLHHFDAPGSSF
# WRIAIATPPKTATIPPRHPDQVYLQNEIDIRKPWKESIRLYHLHTAATYRVRSAVAETFFKSVGNGKVLLVGDSGQT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g476
###
# start gene g477
Scaffold_1	AUGUSTUS	gene	2411584	2413145	0.3	+	.	g477
Scaffold_1	AUGUSTUS	transcript	2411584	2413145	0.3	+	.	g477.t1
Scaffold_1	AUGUSTUS	start_codon	2411584	2411586	.	+	0	transcript_id "g477.t1"; gene_id "g477";
Scaffold_1	AUGUSTUS	CDS	2411584	2412288	0.33	+	0	transcript_id "g477.t1"; gene_id "g477";
Scaffold_1	AUGUSTUS	CDS	2412390	2413145	0.74	+	0	transcript_id "g477.t1"; gene_id "g477";
Scaffold_1	AUGUSTUS	stop_codon	2413143	2413145	.	+	0	transcript_id "g477.t1"; gene_id "g477";
# protein sequence = [MSGKTSIQHILHSHYRAITDINWHTTERDTVVSTGIDSWVWAWDMREPRKPIFGLCAFSSPGTQVKWNRQNSHILASS
# HADKVLIWDRRKGSLPVATIDAHSSRIYGIDWSQTEPTEIVTCSLDKTIKVWDSKTMTLKTMIRTGYPVWRARSLPFGRGVLSLAQRGETALEMFSLE
# NQGLGPGTSEVPVDSFQGHSDVVKEFVWRKGANNTVFQLITWSKDRTLRFWPVDSDMMRQQPATSVTTESAPRTKSFRNATFPDSSPNTDKLDNNLNP
# NPISAPIGHRSILAEVRAGGPINSAHQAQPRNRQRTTDSFNITLQTAPSPPLQSPDIFGSVTPTQTQSTLTAPAVAGISNIEGTVPDSSLGLPGSANA
# AGISGGGTMSRGAAGGLKSRARVDALSWLSSVKDSSTTAGTATIAIARVSVDEDKINNETDGANGRRSASRDGLDSKDSRYRDESVVQPVGHSLQDEC
# VILLDPLFLSSSELLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g477
###
# start gene g478
Scaffold_1	AUGUSTUS	gene	2413459	2414880	0.4	+	.	g478
Scaffold_1	AUGUSTUS	transcript	2413459	2414880	0.4	+	.	g478.t1
Scaffold_1	AUGUSTUS	start_codon	2413459	2413461	.	+	0	transcript_id "g478.t1"; gene_id "g478";
Scaffold_1	AUGUSTUS	CDS	2413459	2413838	0.4	+	0	transcript_id "g478.t1"; gene_id "g478";
Scaffold_1	AUGUSTUS	CDS	2414004	2414880	0.59	+	1	transcript_id "g478.t1"; gene_id "g478";
Scaffold_1	AUGUSTUS	stop_codon	2414878	2414880	.	+	0	transcript_id "g478.t1"; gene_id "g478";
# protein sequence = [MEYTPLITMKDRAFMLRRLRRIIATLRERQRPCLEACLRFLVFKDESFVEIAEGDSGGATGHASVRRPGLKTRSSGEN
# GEDLGDSDSSEEDIQRMAEMGNHVGKMMRLRCRCCGIIKIWRNKDLSRYEERVDHASFDHDSLNVNTTDGTNADVLGYTEREAFHQSPALISDAVRRL
# SLAARDRDSTNRPGLNVSMANALTLDTIFLTPKVSTVGQSVPDFYSYTYPSSQHAAQTHPSPAQVQAQITRVMTNLLTFPRHRGRRQSNSFRSSAGLN
# YIGEEGKSIEEDAIGTSQRSYSALALMAGSPRRSEVIISNTTGLVGGDKSVAEDYIFLPTTFGEGSNAVDDGSGLFNGKGGVLVQICHSNAAAARLHG
# RYDHERIFRSIGALLATAALSANRGNKSFDESASCLSLVKQLLDRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g478
###
# start gene g479
Scaffold_1	AUGUSTUS	gene	2416888	2417277	0.84	+	.	g479
Scaffold_1	AUGUSTUS	transcript	2416888	2417277	0.84	+	.	g479.t1
Scaffold_1	AUGUSTUS	start_codon	2416888	2416890	.	+	0	transcript_id "g479.t1"; gene_id "g479";
Scaffold_1	AUGUSTUS	CDS	2416888	2417277	0.84	+	0	transcript_id "g479.t1"; gene_id "g479";
Scaffold_1	AUGUSTUS	stop_codon	2417275	2417277	.	+	0	transcript_id "g479.t1"; gene_id "g479";
# protein sequence = [MQTNCSTLSSLEITPALVKPMVINTPITGDTTVLRIAKVKIAPTGKLDHSPQGIFSLANAEPRQINPIGTEAAPMKLA
# KSNTNASGGSPSGALGICEFVVAMKSPLSDGTRAMGLRRSLIERLGSKSIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g479
###
# start gene g480
Scaffold_1	AUGUSTUS	gene	2421797	2422034	0.99	-	.	g480
Scaffold_1	AUGUSTUS	transcript	2421797	2422034	0.99	-	.	g480.t1
Scaffold_1	AUGUSTUS	stop_codon	2421797	2421799	.	-	0	transcript_id "g480.t1"; gene_id "g480";
Scaffold_1	AUGUSTUS	CDS	2421797	2421951	0.99	-	2	transcript_id "g480.t1"; gene_id "g480";
Scaffold_1	AUGUSTUS	CDS	2422025	2422034	1	-	0	transcript_id "g480.t1"; gene_id "g480";
Scaffold_1	AUGUSTUS	start_codon	2422032	2422034	.	-	0	transcript_id "g480.t1"; gene_id "g480";
# protein sequence = [MGAYMVETKGYTLEEIATVFDGKNPSLTSVDILPPGEQQGGEADDSKSREDGVE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g480
###
# start gene g481
Scaffold_1	AUGUSTUS	gene	2434590	2435219	0.99	+	.	g481
Scaffold_1	AUGUSTUS	transcript	2434590	2435219	0.99	+	.	g481.t1
Scaffold_1	AUGUSTUS	start_codon	2434590	2434592	.	+	0	transcript_id "g481.t1"; gene_id "g481";
Scaffold_1	AUGUSTUS	CDS	2434590	2435219	0.99	+	0	transcript_id "g481.t1"; gene_id "g481";
Scaffold_1	AUGUSTUS	stop_codon	2435217	2435219	.	+	0	transcript_id "g481.t1"; gene_id "g481";
# protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ
# GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY
# PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g481
###
# start gene g482
Scaffold_1	AUGUSTUS	gene	2440148	2441128	0.83	+	.	g482
Scaffold_1	AUGUSTUS	transcript	2440148	2441128	0.83	+	.	g482.t1
Scaffold_1	AUGUSTUS	start_codon	2440148	2440150	.	+	0	transcript_id "g482.t1"; gene_id "g482";
Scaffold_1	AUGUSTUS	CDS	2440148	2441128	0.83	+	0	transcript_id "g482.t1"; gene_id "g482";
Scaffold_1	AUGUSTUS	stop_codon	2441126	2441128	.	+	0	transcript_id "g482.t1"; gene_id "g482";
# protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT
# RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR
# GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKIDRNYLQALKPKVEDEFKD
# LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g482
###
# start gene g483
Scaffold_1	AUGUSTUS	gene	2441499	2445897	0.06	+	.	g483
Scaffold_1	AUGUSTUS	transcript	2441499	2445897	0.06	+	.	g483.t1
Scaffold_1	AUGUSTUS	start_codon	2441499	2441501	.	+	0	transcript_id "g483.t1"; gene_id "g483";
Scaffold_1	AUGUSTUS	CDS	2441499	2442577	0.33	+	0	transcript_id "g483.t1"; gene_id "g483";
Scaffold_1	AUGUSTUS	CDS	2442661	2443143	0.36	+	1	transcript_id "g483.t1"; gene_id "g483";
Scaffold_1	AUGUSTUS	CDS	2443240	2443430	0.43	+	1	transcript_id "g483.t1"; gene_id "g483";
Scaffold_1	AUGUSTUS	CDS	2443478	2445897	0.44	+	2	transcript_id "g483.t1"; gene_id "g483";
Scaffold_1	AUGUSTUS	stop_codon	2445895	2445897	.	+	0	transcript_id "g483.t1"; gene_id "g483";
# protein sequence = [MEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKKISTPMKEQDRSMRTLRSNAVA
# PEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIEDVMNLMTKIKYAIEESVQGLKRITTVSTLS
# EDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDSSDHPVVVANQSNGL
# RAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFNLVKLRCTYNYTYRIKRHFNDPNSHKRVTVGT
# YPRGQKGRNIQINTSRYNEPKNVTPDSEKSTGEHDSKGNFSFLDELSSDQGEDEYAISFHFDEKQNIVLDGYKRCEQETFSKKELSEAYVLASREHLK
# SQDDQAEEIIDCYLNQKKIGDKQVFCVWRDGVLGEFDDQLNNEQFNLNPINLGENCDKSESTETAQNQCNNANTSETIRDDNWNKPKNSQRTRKRIVR
# YEILKRGTESFQRSQPTQDSKDKKENVQADVLNEPPTNKLEERIRLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKA
# TLPDEFRIERHIHGDPLLELPELSKYPKPFAPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHE
# PWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYD
# ERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNR
# VIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCD
# KAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVET
# DASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQI
# DPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESL
# GEMSKDERIKFIRLIKKFQVDDQGRLYHRILINLINHN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g483
###
# start gene g484
Scaffold_1	AUGUSTUS	gene	2446068	2446883	0.25	+	.	g484
Scaffold_1	AUGUSTUS	transcript	2446068	2446883	0.25	+	.	g484.t1
Scaffold_1	AUGUSTUS	start_codon	2446068	2446070	.	+	0	transcript_id "g484.t1"; gene_id "g484";
Scaffold_1	AUGUSTUS	CDS	2446068	2446883	0.25	+	0	transcript_id "g484.t1"; gene_id "g484";
Scaffold_1	AUGUSTUS	stop_codon	2446881	2446883	.	+	0	transcript_id "g484.t1"; gene_id "g484";
# protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE
# VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDI
# VESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRLNENIDIQLKIGISNQVNWSRLEILELKRVWIERCIQDIEDLWS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g484
###
# start gene g485
Scaffold_1	AUGUSTUS	gene	2446922	2447179	0.42	+	.	g485
Scaffold_1	AUGUSTUS	transcript	2446922	2447179	0.42	+	.	g485.t1
Scaffold_1	AUGUSTUS	start_codon	2446922	2446924	.	+	0	transcript_id "g485.t1"; gene_id "g485";
Scaffold_1	AUGUSTUS	CDS	2446922	2447179	0.42	+	0	transcript_id "g485.t1"; gene_id "g485";
Scaffold_1	AUGUSTUS	stop_codon	2447177	2447179	.	+	0	transcript_id "g485.t1"; gene_id "g485";
# protein sequence = [MDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEE
# LSEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g485
###
# start gene g486
Scaffold_1	AUGUSTUS	gene	2451177	2451677	0.46	-	.	g486
Scaffold_1	AUGUSTUS	transcript	2451177	2451677	0.46	-	.	g486.t1
Scaffold_1	AUGUSTUS	stop_codon	2451177	2451179	.	-	0	transcript_id "g486.t1"; gene_id "g486";
Scaffold_1	AUGUSTUS	CDS	2451177	2451604	1	-	2	transcript_id "g486.t1"; gene_id "g486";
Scaffold_1	AUGUSTUS	CDS	2451668	2451677	0.46	-	0	transcript_id "g486.t1"; gene_id "g486";
Scaffold_1	AUGUSTUS	start_codon	2451675	2451677	.	-	0	transcript_id "g486.t1"; gene_id "g486";
# protein sequence = [MPPLASPRSARSKDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRS
# RKVAPAASKGKARQIVVTDEDSASNEVESEDEDEEEDSAPPPKRLKTTSSISGKVILHLFRYFINLI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g486
###
# start gene g487
Scaffold_1	AUGUSTUS	gene	2457118	2457621	0.98	+	.	g487
Scaffold_1	AUGUSTUS	transcript	2457118	2457621	0.98	+	.	g487.t1
Scaffold_1	AUGUSTUS	start_codon	2457118	2457120	.	+	0	transcript_id "g487.t1"; gene_id "g487";
Scaffold_1	AUGUSTUS	CDS	2457118	2457621	0.98	+	0	transcript_id "g487.t1"; gene_id "g487";
Scaffold_1	AUGUSTUS	stop_codon	2457619	2457621	.	+	0	transcript_id "g487.t1"; gene_id "g487";
# protein sequence = [MSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKI
# FTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSVFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEVSHVEHVRKVP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g487
###
# start gene g488
Scaffold_1	AUGUSTUS	gene	2460233	2460937	0.57	-	.	g488
Scaffold_1	AUGUSTUS	transcript	2460233	2460937	0.57	-	.	g488.t1
Scaffold_1	AUGUSTUS	stop_codon	2460233	2460235	.	-	0	transcript_id "g488.t1"; gene_id "g488";
Scaffold_1	AUGUSTUS	CDS	2460233	2460937	0.57	-	0	transcript_id "g488.t1"; gene_id "g488";
Scaffold_1	AUGUSTUS	start_codon	2460935	2460937	.	-	0	transcript_id "g488.t1"; gene_id "g488";
# protein sequence = [MITGNRQSLNLGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGDTYQQ
# TTTYALRYSVNAMTSNCRTPRTTRDTRLGQYPFLVAHVRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVA
# QTCMENKFMLFLAPAPSQPKALPISTERSSVSMVFLFTLNPTADPSLQLNSCDPFSLG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g488
###
# start gene g489
Scaffold_1	AUGUSTUS	gene	2463238	2464280	0.39	-	.	g489
Scaffold_1	AUGUSTUS	transcript	2463238	2464280	0.39	-	.	g489.t1
Scaffold_1	AUGUSTUS	stop_codon	2463238	2463240	.	-	0	transcript_id "g489.t1"; gene_id "g489";
Scaffold_1	AUGUSTUS	CDS	2463238	2463919	0.82	-	1	transcript_id "g489.t1"; gene_id "g489";
Scaffold_1	AUGUSTUS	CDS	2464039	2464280	0.39	-	0	transcript_id "g489.t1"; gene_id "g489";
Scaffold_1	AUGUSTUS	start_codon	2464278	2464280	.	-	0	transcript_id "g489.t1"; gene_id "g489";
# protein sequence = [MSTPVPPAPNTSADDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LINQRFEPMDPGMEARSEIKNLRHSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPT
# MTGRNSGYSPTHNAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPHQKPPAVTVDAEDIWKQSVKTSSWDSDETEADASNL
# DANRYPLRYPRHSPVPKIRPRSRPRPQHLLLHP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g489
###
# start gene g490
Scaffold_1	AUGUSTUS	gene	2477294	2477692	0.79	+	.	g490
Scaffold_1	AUGUSTUS	transcript	2477294	2477692	0.79	+	.	g490.t1
Scaffold_1	AUGUSTUS	start_codon	2477294	2477296	.	+	0	transcript_id "g490.t1"; gene_id "g490";
Scaffold_1	AUGUSTUS	CDS	2477294	2477692	0.79	+	0	transcript_id "g490.t1"; gene_id "g490";
Scaffold_1	AUGUSTUS	stop_codon	2477690	2477692	.	+	0	transcript_id "g490.t1"; gene_id "g490";
# protein sequence = [MIGSSFDKYYQTLSIAFSSPPINNPNSFSRGHINLPFAADVSKTDRDYLQVFKPKVEHKFKNLLGIKLESLIPRELTE
# EQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKEMLKE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g490
###
# start gene g491
Scaffold_1	AUGUSTUS	gene	2477987	2478514	1	+	.	g491
Scaffold_1	AUGUSTUS	transcript	2477987	2478514	1	+	.	g491.t1
Scaffold_1	AUGUSTUS	start_codon	2477987	2477989	.	+	0	transcript_id "g491.t1"; gene_id "g491";
Scaffold_1	AUGUSTUS	CDS	2477987	2478514	1	+	0	transcript_id "g491.t1"; gene_id "g491";
Scaffold_1	AUGUSTUS	stop_codon	2478512	2478514	.	+	0	transcript_id "g491.t1"; gene_id "g491";
# protein sequence = [MLKPTNQINSEHRPYDHVQPTTYRPIQNNTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPDIEENIAKKIFNAKVDLS
# TEELAALSPAIRKIIMCKIRNRRVRPRTKANNYVSTLSEDGETEILDDPSSVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g491
###
# start gene g492
Scaffold_1	AUGUSTUS	gene	2478569	2478892	0.82	+	.	g492
Scaffold_1	AUGUSTUS	transcript	2478569	2478892	0.82	+	.	g492.t1
Scaffold_1	AUGUSTUS	start_codon	2478569	2478571	.	+	0	transcript_id "g492.t1"; gene_id "g492";
Scaffold_1	AUGUSTUS	CDS	2478569	2478892	0.82	+	0	transcript_id "g492.t1"; gene_id "g492";
Scaffold_1	AUGUSTUS	stop_codon	2478890	2478892	.	+	0	transcript_id "g492.t1"; gene_id "g492";
# protein sequence = [MVYEDHNDHLVAVANQSNGLRAVTPEINKDEEIESVLDQDSQIVVIDQLIAIGLGITWDLEFTIRMQDASGKLNQTLG
# VARNIPFKFGEVTVYLQLTYRIKLHFKCY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g492
###
# start gene g493
Scaffold_1	AUGUSTUS	gene	2479054	2479482	0.67	+	.	g493
Scaffold_1	AUGUSTUS	transcript	2479054	2479482	0.67	+	.	g493.t1
Scaffold_1	AUGUSTUS	start_codon	2479054	2479056	.	+	0	transcript_id "g493.t1"; gene_id "g493";
Scaffold_1	AUGUSTUS	CDS	2479054	2479482	0.67	+	0	transcript_id "g493.t1"; gene_id "g493";
Scaffold_1	AUGUSTUS	stop_codon	2479480	2479482	.	+	0	transcript_id "g493.t1"; gene_id "g493";
# protein sequence = [MNQRMFHLIMNNRQATEFEKVRYELRQQKKGKAQDSNDKKENVQPDLLNEPPTNKLEEHIKLNQQVKSPINLIDETIK
# QVVNEALGVEKPINLNTEEVFTKYKPVDKKVNPIKAMLPDEFRIERHCHKWRGGVTSGAGKWSD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g493
###
# start gene g494
Scaffold_1	AUGUSTUS	gene	2480770	2481777	0.28	+	.	g494
Scaffold_1	AUGUSTUS	transcript	2480770	2481777	0.28	+	.	g494.t1
Scaffold_1	AUGUSTUS	start_codon	2480770	2480772	.	+	0	transcript_id "g494.t1"; gene_id "g494";
Scaffold_1	AUGUSTUS	CDS	2480770	2481777	0.28	+	0	transcript_id "g494.t1"; gene_id "g494";
Scaffold_1	AUGUSTUS	stop_codon	2481775	2481777	.	+	0	transcript_id "g494.t1"; gene_id "g494";
# protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL
# RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP
# NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKCPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD
# IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTSKNLYKIIRTQKHIDLLRVID]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g494
###
# start gene g495
Scaffold_1	AUGUSTUS	gene	2482357	2483197	0.05	+	.	g495
Scaffold_1	AUGUSTUS	transcript	2482357	2483197	0.05	+	.	g495.t1
Scaffold_1	AUGUSTUS	start_codon	2482357	2482359	.	+	0	transcript_id "g495.t1"; gene_id "g495";
Scaffold_1	AUGUSTUS	CDS	2482357	2482483	0.13	+	0	transcript_id "g495.t1"; gene_id "g495";
Scaffold_1	AUGUSTUS	CDS	2482618	2482898	0.24	+	2	transcript_id "g495.t1"; gene_id "g495";
Scaffold_1	AUGUSTUS	CDS	2482976	2483197	0.53	+	0	transcript_id "g495.t1"; gene_id "g495";
Scaffold_1	AUGUSTUS	stop_codon	2483195	2483197	.	+	0	transcript_id "g495.t1"; gene_id "g495";
# protein sequence = [MLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEK
# VRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMPSEYCHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEY
# WMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g495
###
# start gene g496
Scaffold_1	AUGUSTUS	gene	2487518	2488054	0.72	+	.	g496
Scaffold_1	AUGUSTUS	transcript	2487518	2488054	0.72	+	.	g496.t1
Scaffold_1	AUGUSTUS	start_codon	2487518	2487520	.	+	0	transcript_id "g496.t1"; gene_id "g496";
Scaffold_1	AUGUSTUS	CDS	2487518	2488054	0.72	+	0	transcript_id "g496.t1"; gene_id "g496";
Scaffold_1	AUGUSTUS	stop_codon	2488052	2488054	.	+	0	transcript_id "g496.t1"; gene_id "g496";
# protein sequence = [MLIHWNVKDIEHVHNDPLPIITHQPEDPDSDSESIHVDNNDDGPMRFQWMQEAAHGPNSTTAVSTADNLGRRDMDLHY
# NWHGNSPRSTQIIQDAAHWLAACVKESPNDDAQLLPPAPYASLKGPQHIVFLQVMAYFKKLAQNPEKPTLRVNVDGTTGTGKTYLIWAITHALHQHFS
# PV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g496
###
# start gene g497
Scaffold_1	AUGUSTUS	gene	2492519	2493610	0.48	-	.	g497
Scaffold_1	AUGUSTUS	transcript	2492519	2493610	0.48	-	.	g497.t1
Scaffold_1	AUGUSTUS	stop_codon	2492519	2492521	.	-	0	transcript_id "g497.t1"; gene_id "g497";
Scaffold_1	AUGUSTUS	CDS	2492519	2493610	0.48	-	0	transcript_id "g497.t1"; gene_id "g497";
Scaffold_1	AUGUSTUS	start_codon	2493608	2493610	.	-	0	transcript_id "g497.t1"; gene_id "g497";
# protein sequence = [MDLPIPLMIFLSSSSHLVYILPSLWLPITQDFRHSLAKSSLAAWLKENGVPAIYGVGTRVLTKKIRKKGSTLGQIAGK
# KSRSSCRLETSYQSAAPSRALSPNSRSSWREDYLDIPFSDPIELILLLLLPSLSRVSTKRLVHLCFIPPDVLILDVGMKYNQIRCFTNRGVELKDSTL
# EIRFLSDSEPYDGIFVSNGPEDPTTVKETIARISRATERADRPIFGICLSHQLMAFAAGATTSKMKYENRGHNIPCTDALSGRCYITRQNHGFQVDAD
# TFPSGWKELFGNANNSSNEGIHCVDKPFFSVQFHPESTPGPRDTEFLFDVFIKNIVDHATTTTNSLISISMPGGKKRRKRQAHSESHSQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g497
###
# start gene g498
Scaffold_1	AUGUSTUS	gene	2496563	2497333	1	-	.	g498
Scaffold_1	AUGUSTUS	transcript	2496563	2497333	1	-	.	g498.t1
Scaffold_1	AUGUSTUS	stop_codon	2496563	2496565	.	-	0	transcript_id "g498.t1"; gene_id "g498";
Scaffold_1	AUGUSTUS	CDS	2496563	2497333	1	-	0	transcript_id "g498.t1"; gene_id "g498";
Scaffold_1	AUGUSTUS	start_codon	2497331	2497333	.	-	0	transcript_id "g498.t1"; gene_id "g498";
# protein sequence = [MYTKEDLQAIQCYELQSVKEVEAQKIAQAEEERRQSALIKTPLHPSSEIHDGSAWDPSSRTPTHSSSYTSVTQLSETS
# SAPSSSTVQLPTHWIENPLLYHSLTQDLDIFIQKGDKVQRVYLSWDGCSVIVREGQRSNLTKVGSIIAPSLIQQSFEHVPPHPTRARGLFLVIRGEHV
# GLIGRCVKSRYNPNSPDPDYTLIAFKLTKGSGRGMRWCQEILTDGFIYVPRADLVAIYETSAMKQEGNSLVEKFRDYMPA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g498
###
# start gene g499
Scaffold_1	AUGUSTUS	gene	2499181	2499925	0.51	-	.	g499
Scaffold_1	AUGUSTUS	transcript	2499181	2499925	0.51	-	.	g499.t1
Scaffold_1	AUGUSTUS	stop_codon	2499181	2499183	.	-	0	transcript_id "g499.t1"; gene_id "g499";
Scaffold_1	AUGUSTUS	CDS	2499181	2499828	0.96	-	0	transcript_id "g499.t1"; gene_id "g499";
Scaffold_1	AUGUSTUS	CDS	2499878	2499925	0.51	-	0	transcript_id "g499.t1"; gene_id "g499";
Scaffold_1	AUGUSTUS	start_codon	2499923	2499925	.	-	0	transcript_id "g499.t1"; gene_id "g499";
# protein sequence = [MSSSSPHSSKATGFPEFTSNRRAIVRGYLDDEAQEEEEEEERQDAKDDEENDEDLGLDLAGFIDDSATAQHARSQVPI
# YHHSPPIFSRLIKRYEYEASSSSSSTSSEHAVNFSDSDVGSSNSSSTRECWNVLRAFAVGTITTLPEAEDRLCALIGPAFNFNDWGPKFDAITEPDMD
# IQQALLLIAEFEAIDASKVSPLLNPRFQMRIRAPIACPNSRAIHLLRNLQGTFPF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g499
###
# start gene g500
Scaffold_1	AUGUSTUS	gene	2501465	2502355	0.59	+	.	g500
Scaffold_1	AUGUSTUS	transcript	2501465	2502355	0.59	+	.	g500.t1
Scaffold_1	AUGUSTUS	start_codon	2501465	2501467	.	+	0	transcript_id "g500.t1"; gene_id "g500";
Scaffold_1	AUGUSTUS	CDS	2501465	2502355	0.59	+	0	transcript_id "g500.t1"; gene_id "g500";
Scaffold_1	AUGUSTUS	stop_codon	2502353	2502355	.	+	0	transcript_id "g500.t1"; gene_id "g500";
# protein sequence = [MHQPQPHQLVDLDRLSSPSLTFHNDHHSAPAVMAELPRESYGIPQSRPNTTHTIPPWFPVHIPPPPEQPYPMYYPNPP
# YPYPYPYPLSSEPPRSITPRVKIEYSSIHSTFLATIKDTDSLKDRKSWVKWNEAVWQAIADGFALGHICDEPPLGTPRTEWNTPLLRPVLSSNPTRKE
# LEAKLKWDKNDGWTSSILTARLSDEARNHLPPMIDDRGERRTARQIYIRLKAIYQAAPDRKACLRIQDELMTSQIHGMDIKKFNLKWSSTLTTLRNYG
# YDIPWDTLISKYISKLPSGPLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g500
###
# start gene g501
Scaffold_1	AUGUSTUS	gene	2503143	2504309	0.9	+	.	g501
Scaffold_1	AUGUSTUS	transcript	2503143	2504309	0.9	+	.	g501.t1
Scaffold_1	AUGUSTUS	start_codon	2503143	2503145	.	+	0	transcript_id "g501.t1"; gene_id "g501";
Scaffold_1	AUGUSTUS	CDS	2503143	2504309	0.9	+	0	transcript_id "g501.t1"; gene_id "g501";
Scaffold_1	AUGUSTUS	stop_codon	2504307	2504309	.	+	0	transcript_id "g501.t1"; gene_id "g501";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g501
###
# start gene g502
Scaffold_1	AUGUSTUS	gene	2504360	2506972	0.87	+	.	g502
Scaffold_1	AUGUSTUS	transcript	2504360	2506972	0.87	+	.	g502.t1
Scaffold_1	AUGUSTUS	start_codon	2504360	2504362	.	+	0	transcript_id "g502.t1"; gene_id "g502";
Scaffold_1	AUGUSTUS	CDS	2504360	2506972	0.87	+	0	transcript_id "g502.t1"; gene_id "g502";
Scaffold_1	AUGUSTUS	stop_codon	2506970	2506972	.	+	0	transcript_id "g502.t1"; gene_id "g502";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE
# LEPPAENPHIEVPLEATLEPRESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS
# ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL
# VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM
# VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT
# DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF
# DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE
# AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCQTIQLQDTPDYTGHSTWSVPISGGLRCALLWKNTLRDARFVPVR
# RSSDTHGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g502
###
# start gene g503
Scaffold_1	AUGUSTUS	gene	2510800	2511486	0.35	+	.	g503
Scaffold_1	AUGUSTUS	transcript	2510800	2511486	0.35	+	.	g503.t1
Scaffold_1	AUGUSTUS	start_codon	2510800	2510802	.	+	0	transcript_id "g503.t1"; gene_id "g503";
Scaffold_1	AUGUSTUS	CDS	2510800	2511486	0.35	+	0	transcript_id "g503.t1"; gene_id "g503";
Scaffold_1	AUGUSTUS	stop_codon	2511484	2511486	.	+	0	transcript_id "g503.t1"; gene_id "g503";
# protein sequence = [MGCQCWIQVSEDVRLKFGDKMIEGIFIGYEENRIGWRVRDTQGKDHFSDQVVFNESQFGRLHGPKPSKSTKPTSDSST
# TGMTPIHNPIPPKGSRPQRTIKLTERGKEWRDGIRKRDELIAERRVQNGLQPNHTTQIESDITACSLACRITEDNFSCLDDDTDIFFAALANIPQPLN
# PIPTKSTTTSKPKTFDLKKPPSTRRQMLLQPDATLACSRRQGNYWIIRNGCI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g503
###
# start gene g504
Scaffold_1	AUGUSTUS	gene	2516284	2517071	0.54	+	.	g504
Scaffold_1	AUGUSTUS	transcript	2516284	2517071	0.54	+	.	g504.t1
Scaffold_1	AUGUSTUS	start_codon	2516284	2516286	.	+	0	transcript_id "g504.t1"; gene_id "g504";
Scaffold_1	AUGUSTUS	CDS	2516284	2516503	0.82	+	0	transcript_id "g504.t1"; gene_id "g504";
Scaffold_1	AUGUSTUS	CDS	2516659	2517071	0.65	+	2	transcript_id "g504.t1"; gene_id "g504";
Scaffold_1	AUGUSTUS	stop_codon	2517069	2517071	.	+	0	transcript_id "g504.t1"; gene_id "g504";
# protein sequence = [MPPKTQAQSRANSEENTFFTTAQSFASFSDSISAIGQPRRHNRGFGPATVPITSTLPEAMEEEEQFEYSTLYTESPRD
# LPPHFDLDAGDHDDQDPPVDNDDLDNDSGGLLHGEPGDPSGPGGPRSPISPNIPNEQRAMLELLLGFKVSIETLGTILAALGRPSDNSESKSKVKERQ
# RYSMVQTPENSRRSSSISPWSSMTVPSISPTNGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g504
###
# start gene g505
Scaffold_1	AUGUSTUS	gene	2517918	2519345	0.81	+	.	g505
Scaffold_1	AUGUSTUS	transcript	2517918	2519345	0.81	+	.	g505.t1
Scaffold_1	AUGUSTUS	start_codon	2517918	2517920	.	+	0	transcript_id "g505.t1"; gene_id "g505";
Scaffold_1	AUGUSTUS	CDS	2517918	2518908	0.82	+	0	transcript_id "g505.t1"; gene_id "g505";
Scaffold_1	AUGUSTUS	CDS	2519038	2519345	0.81	+	2	transcript_id "g505.t1"; gene_id "g505";
Scaffold_1	AUGUSTUS	stop_codon	2519343	2519345	.	+	0	transcript_id "g505.t1"; gene_id "g505";
# protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASQNITFRNTSHFGSPQTSVPSATNTVDAKVAV
# PLLEPLPSVLPTILETPPGDSSRTRSRTLRAKPLSSKFPFEPIYSYPMVSQFAAQLETPEVDIALVSAAVFNRACKDASMEPILLRAIYSEVAARAAD
# RSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAINPSSSPHGAPVLFVSKK
# DGKLRHCVDFCSLNHITKKDHYLLPLISDLLDTPKRAKIYTKLDLAHAYHLVRIAEDVCVIVYLDDILIYSDTPEEHREHIKEVLWHLRKHRLYANPD
# KCEFTMDTVEYLGYILSPDGLTMSKEKVQTLMQKQDDGQWHPVAFRSASMQPAETKLRDL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g505
###
# start gene g506
Scaffold_1	AUGUSTUS	gene	2521307	2522041	0.67	+	.	g506
Scaffold_1	AUGUSTUS	transcript	2521307	2522041	0.67	+	.	g506.t1
Scaffold_1	AUGUSTUS	start_codon	2521307	2521309	.	+	0	transcript_id "g506.t1"; gene_id "g506";
Scaffold_1	AUGUSTUS	CDS	2521307	2522041	0.67	+	0	transcript_id "g506.t1"; gene_id "g506";
Scaffold_1	AUGUSTUS	stop_codon	2522039	2522041	.	+	0	transcript_id "g506.t1"; gene_id "g506";
# protein sequence = [MELHYTSGYHPEVDGQTLRVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRAE
# VDMKSDLARDFVVNLDELHAFLQREILLAQSCYKNKLTGKESRTRSSRSAPKYLFLLSTFALLVLLKNSLKNILVLSRSSVDLVLVLRAQAPGLSSPH
# SPGFPRLTAGAGYAESFPNRTQSPPPPIEVDGEEEYNVAEILTPSWTEGINVVLYVITFGGPVTRYRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g506
###
# start gene g507
Scaffold_1	AUGUSTUS	gene	2525383	2525805	1	-	.	g507
Scaffold_1	AUGUSTUS	transcript	2525383	2525805	1	-	.	g507.t1
Scaffold_1	AUGUSTUS	stop_codon	2525383	2525385	.	-	0	transcript_id "g507.t1"; gene_id "g507";
Scaffold_1	AUGUSTUS	CDS	2525383	2525805	1	-	0	transcript_id "g507.t1"; gene_id "g507";
Scaffold_1	AUGUSTUS	start_codon	2525803	2525805	.	-	0	transcript_id "g507.t1"; gene_id "g507";
# protein sequence = [MQQFFRLIHAEEEIDWIHIEICHLLTYICEEERVLGAKAAEVEGENPALVLQIREYWDERARFNDLHWRSLIAIKRLR
# GFNIAHSKDFTVGTPVAAQDALVENADCDPELWDEGEDGNEDDEEILHDCVATVMDLAVNDD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g507
###
# start gene g508
Scaffold_1	AUGUSTUS	gene	2536751	2537425	0.54	+	.	g508
Scaffold_1	AUGUSTUS	transcript	2536751	2537425	0.54	+	.	g508.t1
Scaffold_1	AUGUSTUS	start_codon	2536751	2536753	.	+	0	transcript_id "g508.t1"; gene_id "g508";
Scaffold_1	AUGUSTUS	CDS	2536751	2537425	0.54	+	0	transcript_id "g508.t1"; gene_id "g508";
Scaffold_1	AUGUSTUS	stop_codon	2537423	2537425	.	+	0	transcript_id "g508.t1"; gene_id "g508";
# protein sequence = [MLTTNPGHWALLGPRVVYLYIGCSYLLYFLSFDLVYSTWFSPRTLLASLITPPPKAFLSVAPGDTCYWNQLLTPVLAN
# GRAQENAAGATSDATLPDMQDPCAVSMPTAQCDHSTANLSPSNDADSPLHLPLKKKRSGMGQADKAALACAEKLLLDLEGFLISQNELRAKVAEENNV
# TVARVATLLNQVSARNSTKKASNYNVLVFLKTQELNASKCCPMLAISL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g508
###
# start gene g509
Scaffold_1	AUGUSTUS	gene	2550420	2551346	0.91	-	.	g509
Scaffold_1	AUGUSTUS	transcript	2550420	2551346	0.91	-	.	g509.t1
Scaffold_1	AUGUSTUS	stop_codon	2550420	2550422	.	-	0	transcript_id "g509.t1"; gene_id "g509";
Scaffold_1	AUGUSTUS	CDS	2550420	2551346	0.91	-	0	transcript_id "g509.t1"; gene_id "g509";
Scaffold_1	AUGUSTUS	start_codon	2551344	2551346	.	-	0	transcript_id "g509.t1"; gene_id "g509";
# protein sequence = [MAETGAVLVVTTKGAVDNDRGMTGTPWIWDNDCQEAFENLKIAFTSAPILTHWEPKRPIIVETDASDYAIAAILSIQT
# VDSEIHPLAFLSKTLHAAELNYDTHNKELLTIFEAFKAWRHYLEGSGNPVDVVTDHKNLDYFSTTKILTRRQVRWSEYLHQFNMVICFRPGKLGKKPD
# SITRRWDVYPKEGDIGYAQANPHNFRPIFTNEQLTTSLRATFLEGTMLRASIVMDIEALHQAIILTLPKDLSSVVDLELAKDPSNERWSLGSDRLLHL
# DDRIYVPNHGDLRLQVLRYFHDHPLSDHLARTTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g509
###
# start gene g510
Scaffold_1	AUGUSTUS	gene	2558591	2559932	0.38	+	.	g510
Scaffold_1	AUGUSTUS	transcript	2558591	2559932	0.38	+	.	g510.t1
Scaffold_1	AUGUSTUS	start_codon	2558591	2558593	.	+	0	transcript_id "g510.t1"; gene_id "g510";
Scaffold_1	AUGUSTUS	CDS	2558591	2558724	0.81	+	0	transcript_id "g510.t1"; gene_id "g510";
Scaffold_1	AUGUSTUS	CDS	2558835	2558873	0.44	+	1	transcript_id "g510.t1"; gene_id "g510";
Scaffold_1	AUGUSTUS	CDS	2559005	2559932	0.65	+	1	transcript_id "g510.t1"; gene_id "g510";
Scaffold_1	AUGUSTUS	stop_codon	2559930	2559932	.	+	0	transcript_id "g510.t1"; gene_id "g510";
# protein sequence = [MEHTYDWEIEKPLIKTDHEMISVKYASTLAPNMGKGRWVMPTHILMDKVQKQFCNPCLLLEKRQSTAATNTKVKNQIY
# NETILRHWTTKNREQKPKDLIWRLRPTNGPPGDTDNNDVEKTFKTDSRRMAEMMKRHHEHMQQGEPAINEEIQDQITEQTLNRITTKMSEENHELLRK
# LLTDEDVAKALRLSANYKAPGINGITYEIWRIIQGRYANAQAHGQEASNIIQTLRRIFNDIELNSMAPKTGLSESWLCPLYKKNDRTIMANYRPISLL
# NSDYKIMTKALTMKLATTVPDLINPAQAGFVPGRHIYDQIWLSKLVIDLAEVTEQDGAPIALVAASFFCTTTSLTPDARCDKYHLNSPGKSI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g510
###
# start gene g511
Scaffold_1	AUGUSTUS	gene	2561823	2562083	0.48	+	.	g511
Scaffold_1	AUGUSTUS	transcript	2561823	2562083	0.48	+	.	g511.t1
Scaffold_1	AUGUSTUS	start_codon	2561823	2561825	.	+	0	transcript_id "g511.t1"; gene_id "g511";
Scaffold_1	AUGUSTUS	CDS	2561823	2562083	0.48	+	0	transcript_id "g511.t1"; gene_id "g511";
Scaffold_1	AUGUSTUS	stop_codon	2562081	2562083	.	+	0	transcript_id "g511.t1"; gene_id "g511";
# protein sequence = [MTRLNWVKGHSGIDGNEKADELANEGRLKTEPNDINLEIKPELNTTGIKLSKITQSLAEKGIKQARAKTETYQNKINR
# RETKINLG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g511
###
# start gene g512
Scaffold_1	AUGUSTUS	gene	2567514	2568164	0.84	+	.	g512
Scaffold_1	AUGUSTUS	transcript	2567514	2568164	0.84	+	.	g512.t1
Scaffold_1	AUGUSTUS	start_codon	2567514	2567516	.	+	0	transcript_id "g512.t1"; gene_id "g512";
Scaffold_1	AUGUSTUS	CDS	2567514	2568164	0.84	+	0	transcript_id "g512.t1"; gene_id "g512";
Scaffold_1	AUGUSTUS	stop_codon	2568162	2568164	.	+	0	transcript_id "g512.t1"; gene_id "g512";
# protein sequence = [MSTPAQTTSADELMTQLIKQVANLATAMEECSSSKSSMNKPEVFKGKDSNEARRFRAQFQNWASEQPDLANSQVKLIK
# SALGFFTEGAGDWATPHLLHFSLENPPCEGSWEKFLKEFGQQFESIDPGMEARNAIQSLKQGKGQTVAEFAQKFQDIGSRTEMSDIDLKERFYSALLP
# EIRQNLITVNIGQGAARTLKEAITRAISVDVYLHDPTLTS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g512
###
# start gene g513
Scaffold_1	AUGUSTUS	gene	2573634	2574305	0.71	+	.	g513
Scaffold_1	AUGUSTUS	transcript	2573634	2574305	0.71	+	.	g513.t1
Scaffold_1	AUGUSTUS	start_codon	2573634	2573636	.	+	0	transcript_id "g513.t1"; gene_id "g513";
Scaffold_1	AUGUSTUS	CDS	2573634	2574305	0.71	+	0	transcript_id "g513.t1"; gene_id "g513";
Scaffold_1	AUGUSTUS	stop_codon	2574303	2574305	.	+	0	transcript_id "g513.t1"; gene_id "g513";
# protein sequence = [MESQNATQWRMQPHDIIWITQMALGIHNEVHSVCMEQDTKEGKWYDFSMGEMIWHNPDISNFHIFGIMVYVKHEKEPG
# KLNPQAQEGRWVGIKPESNGYFIYWPDHQTVSTEYNVQFSDKQIRPVEGEDQDLRNLAVTKSEQPIIPVPEEIAKPINPDVTTRKLTKKIQDIINRLG
# ERNQELRHLTASLGKVTGEIIADPTSVAEAMRCPDWPQWWEAMNEKI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g513
###
# start gene g514
Scaffold_1	AUGUSTUS	gene	2582817	2583212	0.96	-	.	g514
Scaffold_1	AUGUSTUS	transcript	2582817	2583212	0.96	-	.	g514.t1
Scaffold_1	AUGUSTUS	stop_codon	2582817	2582819	.	-	0	transcript_id "g514.t1"; gene_id "g514";
Scaffold_1	AUGUSTUS	CDS	2582817	2583212	0.96	-	0	transcript_id "g514.t1"; gene_id "g514";
Scaffold_1	AUGUSTUS	start_codon	2583210	2583212	.	-	0	transcript_id "g514.t1"; gene_id "g514";
# protein sequence = [MTSPEPNSRANHPDKRAEFAEAEIELHSDEEDGEDSEGCEDWEKNIDDDDDSDSGDDDLEVDEEEEIEGNDGDPVGLD
# AAVALLLSINNDSQEVSEILRNVQSEAKVNGPRPCLEKFLDNVSPKTQGIYNR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g514
###
# start gene g515
Scaffold_1	AUGUSTUS	gene	2592435	2592842	0.96	+	.	g515
Scaffold_1	AUGUSTUS	transcript	2592435	2592842	0.96	+	.	g515.t1
Scaffold_1	AUGUSTUS	start_codon	2592435	2592437	.	+	0	transcript_id "g515.t1"; gene_id "g515";
Scaffold_1	AUGUSTUS	CDS	2592435	2592842	0.96	+	0	transcript_id "g515.t1"; gene_id "g515";
Scaffold_1	AUGUSTUS	stop_codon	2592840	2592842	.	+	0	transcript_id "g515.t1"; gene_id "g515";
# protein sequence = [MSTNQVNVPIFPEESKLTGKDSWSRFKAAVELTAQLRGYTGYLDGTIVKPASSLYSSAAGSIYPPVTATPAYSTTPYP
# EEWYMRDRFVAATINLNTVDTTGLGIDLAKSATNIWKDLTEKFERKDEQLIYLADHA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g515
###
# start gene g516
Scaffold_1	AUGUSTUS	gene	2592875	2594116	0.47	+	.	g516
Scaffold_1	AUGUSTUS	transcript	2592875	2594116	0.47	+	.	g516.t1
Scaffold_1	AUGUSTUS	start_codon	2592875	2592877	.	+	0	transcript_id "g516.t1"; gene_id "g516";
Scaffold_1	AUGUSTUS	CDS	2592875	2594116	0.47	+	0	transcript_id "g516.t1"; gene_id "g516";
Scaffold_1	AUGUSTUS	stop_codon	2594114	2594116	.	+	0	transcript_id "g516.t1"; gene_id "g516";
# protein sequence = [MEDHEKKMKNLKKKLTDVGGTLTDAQFRIIILASVPTDWKPETRNVPGKGSDEAFIHLYTVYLECKSKSNEIEQSNKV
# RALIAKEIMAAMPAQSQSTIAATTGTRHERLICSNPPCPSKIGHTLKKCWAKGGGCEGKAPAWWYKKHNQEPPTTANSTSPIETFTLSARTSHSTSTQ
# KLPDSQQNRNSRSILNQTMSQGDKGSSRDLPVSFRKPISFDGCTVFSSNKLFPCHKPVRTYIDSGTSEHCWVDRDDFIVYQAVVNQAGLTAVAGSSFR
# IEGVGTVEFRTRVGGKDKIVKLTGVKHMPLFGHNLISLMTLDHKGLRGDWGGRRINVADRDGIILLTGTGSESTSGTAGGSTGEIRYISEFRPFAREG
# SQYTHLASSSGTRRDSTYSSDVKQEPCRWFKNHVKEGGGHV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g516
###
# start gene g517
Scaffold_1	AUGUSTUS	gene	2595573	2596574	0.43	+	.	g517
Scaffold_1	AUGUSTUS	transcript	2595573	2596574	0.43	+	.	g517.t1
Scaffold_1	AUGUSTUS	start_codon	2595573	2595575	.	+	0	transcript_id "g517.t1"; gene_id "g517";
Scaffold_1	AUGUSTUS	CDS	2595573	2596574	0.43	+	0	transcript_id "g517.t1"; gene_id "g517";
Scaffold_1	AUGUSTUS	stop_codon	2596572	2596574	.	+	0	transcript_id "g517.t1"; gene_id "g517";
# protein sequence = [MEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKSQAKLIKSALGFFTESAGDWATPHLLHFNAEHPP
# FGGDWEEFLKEFVQRFESVDPGMEARSEIKNLKQVKGQTVAEFAQKFKDIGDRTGMSDIDLRERFFTALLPEIRQNLIIVNIAQGLAPTLKEASNEPY
# RGRLHACPTMTGRLWTRSHTYCSTTPADPHAMDIDATHTSNGNTREAFLARARTMLRLWCPRSCQAKLPTPRNHLPLLWTPRTSGSSLPRQVHGTRTR
# PRPTPATSTPADIRYGPTPFSLFPNESVQIASSTPTSALQPYLLLRAPLTRTSPTRLVK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g517
###
# start gene g518
Scaffold_1	AUGUSTUS	gene	2607151	2607880	0.25	-	.	g518
Scaffold_1	AUGUSTUS	transcript	2607151	2607880	0.25	-	.	g518.t1
Scaffold_1	AUGUSTUS	stop_codon	2607151	2607153	.	-	0	transcript_id "g518.t1"; gene_id "g518";
Scaffold_1	AUGUSTUS	CDS	2607151	2607713	0.72	-	2	transcript_id "g518.t1"; gene_id "g518";
Scaffold_1	AUGUSTUS	CDS	2607754	2607880	0.3	-	0	transcript_id "g518.t1"; gene_id "g518";
Scaffold_1	AUGUSTUS	start_codon	2607878	2607880	.	-	0	transcript_id "g518.t1"; gene_id "g518";
# protein sequence = [MDTVEYLGYILSPDGLTMFKEKVQTILEWPVPRKVKDIQSLLVIRCADDSAYPERCSLDLDNDCQEAFENLKIAFTSA
# PILAHWKPNRPIIVETGASDYAIAEILSIQTVDGEIHPLAFLFFEAFKAWRHYLEGSGDLVDVVTDHKNLEYFSTTKILTRRQVHWSEYLHQFNMVIR
# FRPGKLGEKPDSITRRWTSIPKRGISATRKSTLTTSDLSSLMSNSLLLFELPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g518
###
# start gene g519
Scaffold_1	AUGUSTUS	gene	2608243	2609142	0.93	-	.	g519
Scaffold_1	AUGUSTUS	transcript	2608243	2609142	0.93	-	.	g519.t1
Scaffold_1	AUGUSTUS	stop_codon	2608243	2608245	.	-	0	transcript_id "g519.t1"; gene_id "g519";
Scaffold_1	AUGUSTUS	CDS	2608243	2609142	0.93	-	0	transcript_id "g519.t1"; gene_id "g519";
Scaffold_1	AUGUSTUS	start_codon	2609140	2609142	.	-	0	transcript_id "g519.t1"; gene_id "g519";
# protein sequence = [MANITIRFPSGELLLLPFYVTHLDLSCKAVLGYSFLSCYNPLIDWASRNITFYNTSHFDSPQTSVPSATNTVDAKVAV
# PLPELSPSVLPTIQETPSGDSPRSRSRTLQAKPLLSKFPFEPIYSYPMVSQFAAQLETPEVDIALVSAAVFNRACKDASMEPILLRAIHSEVAARAAD
# CSSTTPTVPPLHHSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSRHSAPVLFSPRR
# TGNFGFAWTSAVSTVLPRRTAIPCR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g519
###
# start gene g520
Scaffold_1	AUGUSTUS	gene	2613713	2615041	0.55	-	.	g520
Scaffold_1	AUGUSTUS	transcript	2613713	2615041	0.55	-	.	g520.t1
Scaffold_1	AUGUSTUS	stop_codon	2613713	2613715	.	-	0	transcript_id "g520.t1"; gene_id "g520";
Scaffold_1	AUGUSTUS	CDS	2613713	2614857	0.99	-	2	transcript_id "g520.t1"; gene_id "g520";
Scaffold_1	AUGUSTUS	CDS	2614960	2615041	0.55	-	0	transcript_id "g520.t1"; gene_id "g520";
Scaffold_1	AUGUSTUS	start_codon	2615039	2615041	.	-	0	transcript_id "g520.t1"; gene_id "g520";
# protein sequence = [MEEEQQFEYSTLYTGDGEPVQVLTPRRESPHDPPPHFDLDAGDHDDQDPPVDPDDLCAATTITTIWMTTLAVYRVVSL
# VDLVDPIPQRATCYLELLSGFKGFIETLGTILAALGRPSDSSESKSKVKEPEVFDGSDPQKLKTFFVNVALVFNDRPKYFTDQWKVNYTLSYLSESAK
# EWFVPDILDPDLDALPAWTSSFKLWSWSSRTISRVYDAQGEAKDSLGDLKMKETENIWKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMVCLP
# EPATLADYRQEVLRIDNRYWKREAGKPFIAQNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTLKPKPFSGGKPNNNGKPQNPSNSGQSGSQRPAFNHLG
# ADGKVLPSEKERGMKNNLCLFCGGKHQIADCNKRKA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g520
###
# start gene g521
Scaffold_1	AUGUSTUS	gene	2620206	2620874	0.32	+	.	g521
Scaffold_1	AUGUSTUS	transcript	2620206	2620874	0.32	+	.	g521.t1
Scaffold_1	AUGUSTUS	start_codon	2620206	2620208	.	+	0	transcript_id "g521.t1"; gene_id "g521";
Scaffold_1	AUGUSTUS	CDS	2620206	2620874	0.32	+	0	transcript_id "g521.t1"; gene_id "g521";
Scaffold_1	AUGUSTUS	stop_codon	2620872	2620874	.	+	0	transcript_id "g521.t1"; gene_id "g521";
# protein sequence = [MQSRKKCAFHVNTVEYLGVIISPRGVSMDPEKVKAVMDWLRPRTVKELQAFLGFANFYRRFIDNYLGITKVFTKLLRK
# DSVWNWTPQCSSAFELLKSAFSEAPVLGHYNLDLPVVLECDASDLAIAGILLQLDPETGEIHPIAFHARSMISTELNYDIYDKELLAIVDCFKQWRAY
# CEGSRHQIQVYSDHNNLQYFSTTKQLTARQARWVELLSGYDFVINY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g521
###
# start gene g522
Scaffold_1	AUGUSTUS	gene	2621575	2622564	0.57	+	.	g522
Scaffold_1	AUGUSTUS	transcript	2621575	2622564	0.57	+	.	g522.t1
Scaffold_1	AUGUSTUS	start_codon	2621575	2621577	.	+	0	transcript_id "g522.t1"; gene_id "g522";
Scaffold_1	AUGUSTUS	CDS	2621575	2622564	0.57	+	0	transcript_id "g522.t1"; gene_id "g522";
Scaffold_1	AUGUSTUS	stop_codon	2622562	2622564	.	+	0	transcript_id "g522.t1"; gene_id "g522";
# protein sequence = [MPSDITSDRGSLFVSQFWRELCRVLGIESRLSMAYHPQTDGQMEQANQSVEAYLRIYCSYDQDNWDLLLPIAESVYNN
# TPNTTTSVSPFFANKGYHPKLSITLEQVQGAEVNKYASNLKELHTYLQERIRAANEVYAKYANQKRQDAPDWKEGDHVWLNMENVRTRRAMKKLDHKW
# TSPYSILSKVGSHAYRMDLPGDLPKIHNVFHVDRLRPHFHDKFKQQTSPPPPIFVKGETEHFVEGILDSKPIKGKPKEVEYLVKWEGYDDNFNSWVGW
# RGMAGSLELVKQWHKKHTRKRQLKEPLEPTGKAGKDDEEEVTGPTRRTGSEGRGE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g522
###
# start gene g523
Scaffold_1	AUGUSTUS	gene	2638368	2638742	1	+	.	g523
Scaffold_1	AUGUSTUS	transcript	2638368	2638742	1	+	.	g523.t1
Scaffold_1	AUGUSTUS	start_codon	2638368	2638370	.	+	0	transcript_id "g523.t1"; gene_id "g523";
Scaffold_1	AUGUSTUS	CDS	2638368	2638742	1	+	0	transcript_id "g523.t1"; gene_id "g523";
Scaffold_1	AUGUSTUS	stop_codon	2638740	2638742	.	+	0	transcript_id "g523.t1"; gene_id "g523";
# protein sequence = [MPSAVLDPANSTLHSFPSVTLAELRPRHEGLRSFVRTLGPDPLPDPALSSNLEVFDYSQFNSTNQNPAQIPVSITPRI
# DSPSSSDKDIMTARLNESGNIELSSGKYGPRVKPTATLSPEDLDDL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g523
###
# start gene g524
Scaffold_1	AUGUSTUS	gene	2641612	2643416	0.39	+	.	g524
Scaffold_1	AUGUSTUS	transcript	2641612	2643416	0.39	+	.	g524.t1
Scaffold_1	AUGUSTUS	start_codon	2641612	2641614	.	+	0	transcript_id "g524.t1"; gene_id "g524";
Scaffold_1	AUGUSTUS	CDS	2641612	2642293	0.39	+	0	transcript_id "g524.t1"; gene_id "g524";
Scaffold_1	AUGUSTUS	CDS	2642338	2643416	0.73	+	2	transcript_id "g524.t1"; gene_id "g524";
Scaffold_1	AUGUSTUS	stop_codon	2643414	2643416	.	+	0	transcript_id "g524.t1"; gene_id "g524";
# protein sequence = [MRCSSQSSSSVAPRTVALVVGKYHLTRDDADKDVDWSDGSLSPLPASRGNAVANIKQVSSSDEGDETPVTNKVRMSAM
# PFELPHFVWSACLKSPTSELLHDLLIDDGCPFVLIRSNIVQNLELKQRSLHRPQQMSVAMSEGTPQIFEATHFCKLSLDDLSGGWTSRVVRALIAPFL
# CYPMVLGIPFLAHNFLVTDYASRTVMDKTTGFDLMNPHIPSPPLPSLSPKEQKIVIVELQAYFVDHPLLHHSDPVLPINVAAAVRSRIDHLAALDELQ
# KRGDLLKTRFADVLGDIPHINELPSDITCNISLKDANLMMQSRGYASPRKYREAWSVLIEKHLQAGQIRPSLSQFSSPAFLIPKSDPTALPRWVNDFR
# KLNANTIPDRHPLPRIDSILADCAKGQIWGKMDMTDSFFQSRMSPESVPLVSVQTPLGQYEWLVMPQGLRNVPAVQQHRVTQALHEYIGRFCHVYLND
# IIIWSKDADEHAHHVELILEALRKAKLYCNPKKCLFFQLELDFLGHHISHRGVEAQSSKCEAILHYPAPTSASKVRCFLGMVRFIAGYLTNLAEYTRI
# LTPLTKKECEKMFALMDT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g524
###
# start gene g525
Scaffold_1	AUGUSTUS	gene	2653283	2654204	0.45	+	.	g525
Scaffold_1	AUGUSTUS	transcript	2653283	2654204	0.45	+	.	g525.t1
Scaffold_1	AUGUSTUS	start_codon	2653283	2653285	.	+	0	transcript_id "g525.t1"; gene_id "g525";
Scaffold_1	AUGUSTUS	CDS	2653283	2653568	0.47	+	0	transcript_id "g525.t1"; gene_id "g525";
Scaffold_1	AUGUSTUS	CDS	2653672	2654204	0.85	+	2	transcript_id "g525.t1"; gene_id "g525";
Scaffold_1	AUGUSTUS	stop_codon	2654202	2654204	.	+	0	transcript_id "g525.t1"; gene_id "g525";
# protein sequence = [MLYFSTPIPIIDCCGRIIVVLAGQPGRDYPEELREAFGIMLKEGENAGLSSNAADGPHKCGAFPAYNQGVTMGMGNAH
# PVVLNPRSMTQVLNCLMAAFGLWAPRVYAGYEKVYNTIHSNLELPENFPGVVFTAAAFNFGGEVWTFKHPDSLNWALGWCAIMALGDFDATCSAQIIL
# WELKLVVDFPHTATILLPSAAITHSNTPVAYGDVRTSFTQYAAGAIFCWVENGCRTEEVFEKADPEGHTKMQGDKSTAYIRRLENLSTVDELLAKV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g525
###
# start gene g526
Scaffold_1	AUGUSTUS	gene	2659495	2660844	0.99	+	.	g526
Scaffold_1	AUGUSTUS	transcript	2659495	2660844	0.99	+	.	g526.t1
Scaffold_1	AUGUSTUS	start_codon	2659495	2659497	.	+	0	transcript_id "g526.t1"; gene_id "g526";
Scaffold_1	AUGUSTUS	CDS	2659495	2660844	0.99	+	0	transcript_id "g526.t1"; gene_id "g526";
Scaffold_1	AUGUSTUS	stop_codon	2660842	2660844	.	+	0	transcript_id "g526.t1"; gene_id "g526";
# protein sequence = [MTTKCPVVPTPENLGKPKGIGALEAGTWNHTGGKGPPNGNDEQVMARQTKAEIFAVSQAPEPLPFADPAMFFPAVPVN
# LSLQGAIDIRNGLEEDDDGLSAAILASDLEQVKTLMDAYLKTIPEDEVTAASTITYRLALELTALARVPANEQYSAEKTSFTPDELSAYLIKTDREGY
# LGALYHAAYRLRRLATDIPPETCVFYLHRFTEEVDTFQRHVKTVEAARFQAAKTKILNMVVGSKVGRENTQSSNSSLEQIQFSSDGRSGNLSNSSRIV
# PSSEDVEKDRCSPQVPNRIEPDSLKDEICRDIAMTNHDENEGLSVEDGHKIPDYNYKGPRKFIRHNREGEVVPVGSSRSTEHSQEKDTEGLTVLDEDR
# GPKTVLLSRKVKDCLDDIKLKVHHEVFELAVNTGCAPHSCFRYLNIGTFDTRAQDLHDVWSIWYAVHGEKKRPDGSE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g526
###
# start gene g527
Scaffold_1	AUGUSTUS	gene	2661622	2662897	0.6	+	.	g527
Scaffold_1	AUGUSTUS	transcript	2661622	2662897	0.6	+	.	g527.t1
Scaffold_1	AUGUSTUS	start_codon	2661622	2661624	.	+	0	transcript_id "g527.t1"; gene_id "g527";
Scaffold_1	AUGUSTUS	CDS	2661622	2661760	0.68	+	0	transcript_id "g527.t1"; gene_id "g527";
Scaffold_1	AUGUSTUS	CDS	2661897	2662897	0.62	+	2	transcript_id "g527.t1"; gene_id "g527";
Scaffold_1	AUGUSTUS	stop_codon	2662895	2662897	.	+	0	transcript_id "g527.t1"; gene_id "g527";
# protein sequence = [MPFPQKFESSIGLSECLFINGVQTKDGFVAGVNRITDFSARDLSKIYEKNLSLSDQAALALVSDTEGTVIVKVADSQS
# YRRTMQQGRLDRRKSEQDETEHDTALAALTHIPERCASTATATFPQRSEVAPTGLPSQTTLTRKLMCSPQPPTPVNPHAVSKTVVVLPPPIQKINRAQ
# LHRRTRSQDDEEDQSRPSKKKKGLSSYDNSEQDAQSRVQAANSSAMVIAPTSKPLVSSSTATALGNSQSARVPSSRKLDKDVSGSPRRRKSFCLDDED
# GQDDSALIAQAVDPRMILAPTLEPYAASSSSRYPKRTRVPSNPTLDRKPVFPPQPPTSASQRVLKKVRLLLPPIEQTNSAPLPCIMRSRDGDKDKVGS
# WKKKRLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g527
###
# start gene g528
Scaffold_1	AUGUSTUS	gene	2663742	2666326	0.73	+	.	g528
Scaffold_1	AUGUSTUS	transcript	2663742	2666326	0.73	+	.	g528.t1
Scaffold_1	AUGUSTUS	start_codon	2663742	2663744	.	+	0	transcript_id "g528.t1"; gene_id "g528";
Scaffold_1	AUGUSTUS	CDS	2663742	2665465	0.73	+	0	transcript_id "g528.t1"; gene_id "g528";
Scaffold_1	AUGUSTUS	CDS	2665594	2666326	0.95	+	1	transcript_id "g528.t1"; gene_id "g528";
Scaffold_1	AUGUSTUS	stop_codon	2666324	2666326	.	+	0	transcript_id "g528.t1"; gene_id "g528";
# protein sequence = [MITTRSSPGEEKSSKDRKTEASDPNVPGDPNTSQSRLSDKSSSVLALTAPPTKPARNLEAVAAICEATGGSPELPDSL
# EEDGTPGTSVVVHLDNKETTLNRDGPANISASSGIKPSYPISTVLAHNVASVNRDPDVVQEFIQDAATPYRELIAMKGRSRPDVQTEASDQDLDDSTT
# PKSRSPVVVASSTSSASGAPCKSTADIQAVRGLIELADSLEEDGALSTTMCPDNRVGREETITQYQYGLANISTSSTIIPSYPTPSGTDENSSVDEDQ
# CIFEGSVQACTTEHENHIELCGRSHQDTPTGDPEDLDDCSTSKLRSSVVVASSTSSAPGAPGNSSRDIQAAGGSVELVDSCGIDSTLGNSNLVCSNHN
# IGWKEKRDGPANTSVSSSIEQAYPSSKTLGQNVAVAFSNQSTECEQDRGLGVEEKGESSVCTKDREIHAASGIMIKDTEHEGSGESSELFHGGSLARV
# VGKGEDVKTGTDTNDNCSEELHRNSEGKNIILGTKYNEDSKDEVEREKVVGVGRGKGRTKVENKEEQRSDTRSNRNTPALELTNRRIRAYYQYIVRTY
# DETTFLAPSNLCISQGHPLTATERRNILNRSPAWISQQRKSLRPGQVTETGRLKRWASEDVELWEISEHGEISPKNANETKGRKRPKRYSSGGHQAGN
# THKVEEDVNGEIDVAGVRRSDVCEGENGAVHTRVINEGGGNTKMEGEKVAGVDREKGQTKVGTENEEDHRNDSQDNRNVPPVLELTNPRIHAYYMYIV
# RTHDEPTFLAYRTYSGLNRPPNPDIDDFILELANDLETIWFEVGATLHCWFLLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g528
###
# start gene g529
Scaffold_1	AUGUSTUS	gene	2667984	2668442	0.89	-	.	g529
Scaffold_1	AUGUSTUS	transcript	2667984	2668442	0.89	-	.	g529.t1
Scaffold_1	AUGUSTUS	stop_codon	2667984	2667986	.	-	0	transcript_id "g529.t1"; gene_id "g529";
Scaffold_1	AUGUSTUS	CDS	2667984	2668442	0.89	-	0	transcript_id "g529.t1"; gene_id "g529";
Scaffold_1	AUGUSTUS	start_codon	2668440	2668442	.	-	0	transcript_id "g529.t1"; gene_id "g529";
# protein sequence = [MDNDNDPPATPRSAQRPSSQRMTRDANALVSAELSDSFNDARKGKYGLLNKSPRKSRDHEYPKMPTYANRVDSDRGYK
# TRHKHTLQAAFWKPQRANASGSSAMSKTAACADILSSPSPFTCTPRSISHPTSDVIIISDSEEELSQYHVRGQS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g529
###
# start gene g530
Scaffold_1	AUGUSTUS	gene	2669968	2670363	0.96	-	.	g530
Scaffold_1	AUGUSTUS	transcript	2669968	2670363	0.96	-	.	g530.t1
Scaffold_1	AUGUSTUS	stop_codon	2669968	2669970	.	-	0	transcript_id "g530.t1"; gene_id "g530";
Scaffold_1	AUGUSTUS	CDS	2669968	2670363	0.96	-	0	transcript_id "g530.t1"; gene_id "g530";
Scaffold_1	AUGUSTUS	start_codon	2670361	2670363	.	-	0	transcript_id "g530.t1"; gene_id "g530";
# protein sequence = [MTSPEPNSRANHPDKRAEFAEAEIELHSDEEDGEDSEGCEDWEKNIDDDDDSDSGDDDLEVDEEEEIEGNDGDPVGLD
# AAVALLLSINNDSQEVSEILRNVQSEAKVNGPRPCLEKFLDNVSPKTQGIYNR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g530
###
# start gene g531
Scaffold_1	AUGUSTUS	gene	2688005	2688879	0.49	+	.	g531
Scaffold_1	AUGUSTUS	transcript	2688005	2688879	0.49	+	.	g531.t1
Scaffold_1	AUGUSTUS	start_codon	2688005	2688007	.	+	0	transcript_id "g531.t1"; gene_id "g531";
Scaffold_1	AUGUSTUS	CDS	2688005	2688311	0.49	+	0	transcript_id "g531.t1"; gene_id "g531";
Scaffold_1	AUGUSTUS	CDS	2688365	2688879	0.91	+	2	transcript_id "g531.t1"; gene_id "g531";
Scaffold_1	AUGUSTUS	stop_codon	2688877	2688879	.	+	0	transcript_id "g531.t1"; gene_id "g531";
# protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFTNGLNQWTQVWKPVARSRTSDKVKGRQLQNLLRSSRISEIGLKCLILICRNASSLLYFQRSDNIFIVNIAQGIA
# PTLKEAIKRAISVDVYLHDPTMTSRNTGHAPHTPLTLPLPTLMPWTLMLLTSALGIAGRPSLPVCADNALVVELKAMLSRIACTRRPPPGTVDAEDI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g531
###
# start gene g532
Scaffold_1	AUGUSTUS	gene	2689977	2691302	0.81	+	.	g532
Scaffold_1	AUGUSTUS	transcript	2689977	2691302	0.81	+	.	g532.t1
Scaffold_1	AUGUSTUS	start_codon	2689977	2689979	.	+	0	transcript_id "g532.t1"; gene_id "g532";
Scaffold_1	AUGUSTUS	CDS	2689977	2691302	0.81	+	0	transcript_id "g532.t1"; gene_id "g532";
Scaffold_1	AUGUSTUS	stop_codon	2691300	2691302	.	+	0	transcript_id "g532.t1"; gene_id "g532";
# protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS
# PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL
# MNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGF
# LGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ
# PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDTPTSNSGAQHKTLPVDKPDGPSIYHGLIFI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g532
###
# start gene g533
Scaffold_1	AUGUSTUS	gene	2704481	2705433	0.89	-	.	g533
Scaffold_1	AUGUSTUS	transcript	2704481	2705433	0.89	-	.	g533.t1
Scaffold_1	AUGUSTUS	stop_codon	2704481	2704483	.	-	0	transcript_id "g533.t1"; gene_id "g533";
Scaffold_1	AUGUSTUS	CDS	2704481	2705240	1	-	1	transcript_id "g533.t1"; gene_id "g533";
Scaffold_1	AUGUSTUS	CDS	2705414	2705433	0.89	-	0	transcript_id "g533.t1"; gene_id "g533";
Scaffold_1	AUGUSTUS	start_codon	2705431	2705433	.	-	0	transcript_id "g533.t1"; gene_id "g533";
# protein sequence = [MIYPISVRADHSFRSTSGQGGPKSTQILEFLVTNIESEDVILGLPWLHKVNPDINWRDGQIQIPAKLKVQHHVAIEEI
# PEPKEPNVGGNTEQVLEPNRPESSGLTCPVPRTEPGLETTETGTSLRDEPVFEESGSPLYRLTGSRKRRRAWLRAGFIQEVTEELWCAAGYTYSQQLA
# KAANKDKPQKTFEEMVPEPYRHHAKVFSEKESKRLPEHTPWDHAIDLKPDAPETLRTKIYPMSVNEQKELDRFLEDNLWKGYI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g533
###
# start gene g534
Scaffold_1	AUGUSTUS	gene	2709157	2709486	0.96	-	.	g534
Scaffold_1	AUGUSTUS	transcript	2709157	2709486	0.96	-	.	g534.t1
Scaffold_1	AUGUSTUS	stop_codon	2709157	2709159	.	-	0	transcript_id "g534.t1"; gene_id "g534";
Scaffold_1	AUGUSTUS	CDS	2709157	2709486	0.96	-	0	transcript_id "g534.t1"; gene_id "g534";
Scaffold_1	AUGUSTUS	start_codon	2709484	2709486	.	-	0	transcript_id "g534.t1"; gene_id "g534";
# protein sequence = [MSTSQTITTTNSSTTGPIPPAPADPAIREDEDLEDGDKEGILRWAQERVQPVRVRKAAEAARKEAEEKAARAAAAKKK
# AAQEERARALWAQQQEAEVAKRRRLLADAVI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g534
###
# start gene g535
Scaffold_1	AUGUSTUS	gene	2711364	2713952	0.27	-	.	g535
Scaffold_1	AUGUSTUS	transcript	2711364	2713952	0.27	-	.	g535.t1
Scaffold_1	AUGUSTUS	stop_codon	2711364	2711366	.	-	0	transcript_id "g535.t1"; gene_id "g535";
Scaffold_1	AUGUSTUS	CDS	2711364	2713745	1	-	0	transcript_id "g535.t1"; gene_id "g535";
Scaffold_1	AUGUSTUS	CDS	2713794	2713952	0.27	-	0	transcript_id "g535.t1"; gene_id "g535";
Scaffold_1	AUGUSTUS	start_codon	2713950	2713952	.	-	0	transcript_id "g535.t1"; gene_id "g535";
# protein sequence = [MRAVTEPGFLPLFIFDGPLRPDIKRRKQINKSANKLVTGMQDMIEAFGFEYRTAPGEAEAELAFLNRIGLIDGILSDD
# VDNFLFGAHTVIRNRSSTHAGAKSTIEKAKVYTYTLPHPAFPDLNRENLIFIALCSGGDYGTGLDNCGIKISYGLARAGFGKQLCQAALNHDQNSDQL
# KNFLKHWKSELTQELRTNASGFLPRKSPKLASTIPDSFPEIDVLLAYMRPITSESLGCSKHYDDLLINDGWLKKDPSLPLLAEKCEFYFEWGILQSII
# KRFRTVIFHGVTLRIMRRAHIREQTSDAKSIDLEVIRAHFAAGGYAVEDMDSPCPEFIKDISISRTHESTSKTLEYRVAINPTILVQLAAHGVKGIRR
# PEDKDKWSEFKEVENKSSDEGRTKKKEYLADPMLPLKLWLPAVLVREAVPGLVEAHEEVWKQKEKKAGKIRKGKASSQLTLKTDQVLSSVDSSDDDAS
# CLFIPSRPAHPTTHLQKDHISRIPRSTLPDLSSSNHPSLSSSSVSRHQTLNCSGSSSSNADVPGGDNLLSAIDHIAMQNMNKKDETHKFHRFGSSLPK
# KITPQPFPVSMEISFNEKSDDFGDPFNTDYVHSPPGPPQTPSPQKKTRKTNIVSSDSSLSEENTSPRQDKVGVLNKSPRKSKDHRYPKGLDYGNHADG
# KQARKTIYDIPQHSRAALTASPTPMRYTPNISMSTSTSTSTITKAAVPARIPSSTQLLTSFSTHRLPSVSAPKIGPIIIFDSEDEVEEQKSLLPAVVP
# MSTNKTRRSPKPTAATMSDIPKTHFVNKLGGSRTLKTSRKNLSDTADIDLLSLLRPRTEGQDSRSMAAKTMADIIELSDNSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g535
###
# start gene g536
Scaffold_1	AUGUSTUS	gene	2716071	2717507	0.95	+	.	g536
Scaffold_1	AUGUSTUS	transcript	2716071	2717507	0.95	+	.	g536.t1
Scaffold_1	AUGUSTUS	start_codon	2716071	2716073	.	+	0	transcript_id "g536.t1"; gene_id "g536";
Scaffold_1	AUGUSTUS	CDS	2716071	2717507	0.95	+	0	transcript_id "g536.t1"; gene_id "g536";
Scaffold_1	AUGUSTUS	stop_codon	2717505	2717507	.	+	0	transcript_id "g536.t1"; gene_id "g536";
# protein sequence = [MVGPGSFDNPGYVAEHCNNNLSDNEVSSSSLPHSTPPASIPSSMQIISSCLFGNSMSGVKCSMFFSEHPNFSACAELH
# GLEMMGLLSHRQRQNAVIYHILSGHCFLNCHLNTTSACRMFAADFSSETDFFDRVDSMISQSKANALPVAKLKQIMEALNIQEHILPNQPRHQMLNYI
# HRYINRFSAASSECVVRDLPLSVEHIFKDFHRLRFSILLRYCRMHNIEVNVFTATSEELRIQLASHVLSAKCHSNATVFPENVCPSGCCYIARTFHSQ
# TSDFQPGNESISEFRFMLTHLLSNKLSLGTLRSVLQILEVPFKDDDNKCTLRLRLQEFNGSDQYDFQGAVQRKKLCSLRAAWPVLVSESLKKKFIHNF
# QLHTSSQAMNHSVCAACLSQELSSSCHVVTSDSVDLSLLNTPDTRAQPTCPSVVVDSTWLNGDCIPPTFKPVLDQNPYALLDEQGVSFNDLGESCPSL
# CRSCYSAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g536
###
# start gene g537
Scaffold_1	AUGUSTUS	gene	2719060	2719398	1	+	.	g537
Scaffold_1	AUGUSTUS	transcript	2719060	2719398	1	+	.	g537.t1
Scaffold_1	AUGUSTUS	start_codon	2719060	2719062	.	+	0	transcript_id "g537.t1"; gene_id "g537";
Scaffold_1	AUGUSTUS	CDS	2719060	2719398	1	+	0	transcript_id "g537.t1"; gene_id "g537";
Scaffold_1	AUGUSTUS	stop_codon	2719396	2719398	.	+	0	transcript_id "g537.t1"; gene_id "g537";
# protein sequence = [MNSNESLTSGYAMSSDIPGEGPSIVSELDESIIFENVVIADVDANATINELCAAAMRHINCNGGSYVEIPHESGPMNE
# FFNPSLFPMIYPMLFPYGIGGFEDYHRSESVSLK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g537
###
# start gene g538
Scaffold_1	AUGUSTUS	gene	2719859	2723090	0.49	+	.	g538
Scaffold_1	AUGUSTUS	transcript	2719859	2723090	0.49	+	.	g538.t1
Scaffold_1	AUGUSTUS	start_codon	2719859	2719861	.	+	0	transcript_id "g538.t1"; gene_id "g538";
Scaffold_1	AUGUSTUS	CDS	2719859	2721806	0.52	+	0	transcript_id "g538.t1"; gene_id "g538";
Scaffold_1	AUGUSTUS	CDS	2722165	2723090	0.52	+	2	transcript_id "g538.t1"; gene_id "g538";
Scaffold_1	AUGUSTUS	stop_codon	2723088	2723090	.	+	0	transcript_id "g538.t1"; gene_id "g538";
# protein sequence = [MLVAKNPVIAAKFFNIYLKAFIRDLLGYDPNDKELTGGILGVVKGYYGCVEAQGRGTLHCHMMVWLEGGLNPNEIHEK
# AVSDPDSPFCCRLIAFLDDTISNSVPAARSNCPIIPSTGFHPCSVRGMTMSGYHGYDSDSEDVLQQDLRNLVHSCQVHKHTATCYKYCKDSSKPKECR
# FGLDDSNIDFESCFDPDTGELNLRCLDGLVNNFILRAIRCNMDIKFIGSGASAKAVLYYITNYITKSQLKAHVAYAALERAVRRLDEQCPEDSELTIC
# AKKLFQKCAYSMISQQELSAQQVNTYLLDLEDHFTSHKYKNLYWVQIKNLVDNELPSPECQSAHKAFKSVLTTFTDGPVVTTNEALDGNLSSGICDEH
# ESNDALAEDDEEVGIAVGVDGSLVAKASQADDYCYRPVSVEDLCLWEQVAQCKKLHKVWQNVNVIDFVDENEALEDSIEDCDEGSNSKDPVIIPTLNE
# LLEHSSHEHPKFDFGRAHPEYSTHRFIVDSSFNRRVPVPIGPSLPHRDRESDWPKYCRLMLIFFKPWRNAADLRGPYLSWSEAFATFSVTCSDRVEQM
# MDNMQIMHECKDSRDDHFLNRNSAHRLRNSRSYVGAGDEDRLIEDDFLAEHDNEPKILEHLLSIEGTQSQYVAKLRTEALSXQERVLRLIASYMQENK
# PAPLRMFLGGPGGTGKLHVISALKVFFEQQGELRQFCLASYTGVAAQNISGMTLHSALLLSSTMSSHKTNSKSHQDLVALWQGVDYLFIYKVSMLGCR
# FMLKISRALCRAKDNNLPFGGINIIFAGDFAQLAPIREQRLFSFINTARVGTSYGQEIVFGKLLWLSVKTVVLLTQVMRQSGLENEQFVGLLSWLRTG
# VCTLDDYDILNAWIISTVQPNWSDAKWQNTPTIVSDNRIKDMINERSTAAFARRTGKPLYWYYASDTRGGKPVNDISLQSFLENMDSGQTNQRLG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g538
###
# start gene g539
Scaffold_1	AUGUSTUS	gene	2729761	2731276	0.39	-	.	g539
Scaffold_1	AUGUSTUS	transcript	2729761	2731276	0.39	-	.	g539.t1
Scaffold_1	AUGUSTUS	stop_codon	2729761	2729763	.	-	0	transcript_id "g539.t1"; gene_id "g539";
Scaffold_1	AUGUSTUS	CDS	2729761	2729940	0.77	-	0	transcript_id "g539.t1"; gene_id "g539";
Scaffold_1	AUGUSTUS	CDS	2730024	2730420	0.85	-	1	transcript_id "g539.t1"; gene_id "g539";
Scaffold_1	AUGUSTUS	CDS	2730984	2731276	0.53	-	0	transcript_id "g539.t1"; gene_id "g539";
Scaffold_1	AUGUSTUS	start_codon	2731274	2731276	.	-	0	transcript_id "g539.t1"; gene_id "g539";
# protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP
# VQVLTPRRGQPPVVAPARGRGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD
# SAALKWAYGRGLAERIKDEMARLPEPATLADYRQEFFVLTIVIGNARKLESVRLPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNH
# LGADGKSFPPRRKEG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g539
###
# start gene g540
Scaffold_1	AUGUSTUS	gene	2736877	2737654	0.22	+	.	g540
Scaffold_1	AUGUSTUS	transcript	2736877	2737654	0.22	+	.	g540.t1
Scaffold_1	AUGUSTUS	start_codon	2736877	2736879	.	+	0	transcript_id "g540.t1"; gene_id "g540";
Scaffold_1	AUGUSTUS	CDS	2736877	2737050	0.72	+	0	transcript_id "g540.t1"; gene_id "g540";
Scaffold_1	AUGUSTUS	CDS	2737099	2737263	0.28	+	0	transcript_id "g540.t1"; gene_id "g540";
Scaffold_1	AUGUSTUS	CDS	2737379	2737654	0.93	+	0	transcript_id "g540.t1"; gene_id "g540";
Scaffold_1	AUGUSTUS	stop_codon	2737652	2737654	.	+	0	transcript_id "g540.t1"; gene_id "g540";
# protein sequence = [MSKDKTSNNDNSFASPAKRNLKKRNFTSTKNDDSGDPLNNILPDESASKTLAFPTGMMIFAGAEYDHRLMPDFGGPVF
# AMKKAKLIQPQWTNIRNKLIVPWKNYDPLRLGTLVIYHATITSLRVIAESDVIIMPPMPSVSDKKRISAQPIAPSAAASALASIDWCSTATSSSLSGS
# DHTLDGEDPPKEGSEVITDGKQKKARKQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g540
###
# start gene g541
Scaffold_1	AUGUSTUS	gene	2748665	2749546	1	+	.	g541
Scaffold_1	AUGUSTUS	transcript	2748665	2749546	1	+	.	g541.t1
Scaffold_1	AUGUSTUS	start_codon	2748665	2748667	.	+	0	transcript_id "g541.t1"; gene_id "g541";
Scaffold_1	AUGUSTUS	CDS	2748665	2749546	1	+	0	transcript_id "g541.t1"; gene_id "g541";
Scaffold_1	AUGUSTUS	stop_codon	2749544	2749546	.	+	0	transcript_id "g541.t1"; gene_id "g541";
# protein sequence = [MFNFETITFLCLNHNQQVFVITSGSLQQIKLPRLVLLVEGVINNRLPISSWNQPDNLTLKAVQKDHQNSVSGPQGTPI
# SCKEVGDQRSYKDVIATSTSNLSLPEQEQAKSTSVDKNSPIATSVAKDSTNVISTTAEGYKSTGNIDNISESSQSEDDDGQGPWTVVQPRRARSLGNL
# KTIKLRKGIIRPTDLSQDQVNMIKEAEKTLTPAQKESVRKRAEKVKQSAHNEFASPIAGPSYVAKGKFTDNNKDVSDEELDLQFGMKSVMLKSRHQSR
# RMSLVQRIQARIFSPPQAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g541
###
# start gene g542
Scaffold_1	AUGUSTUS	gene	2752142	2752528	1	+	.	g542
Scaffold_1	AUGUSTUS	transcript	2752142	2752528	1	+	.	g542.t1
Scaffold_1	AUGUSTUS	start_codon	2752142	2752144	.	+	0	transcript_id "g542.t1"; gene_id "g542";
Scaffold_1	AUGUSTUS	CDS	2752142	2752528	1	+	0	transcript_id "g542.t1"; gene_id "g542";
Scaffold_1	AUGUSTUS	stop_codon	2752526	2752528	.	+	0	transcript_id "g542.t1"; gene_id "g542";
# protein sequence = [MPDSESSSSSEEESEPLDSSPSSSSNSSSSDRDSDSESESEDSNLDLTNKSSEDTKPRKSKHCKSRSPSRSQKGKHKD
# KKCQQAKWAKAAKRLIKPILLNEYDGSADAEKYHCFVLQYCKEGHVPEDK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g542
###
# start gene g543
Scaffold_1	AUGUSTUS	gene	2752816	2753517	0.38	+	.	g543
Scaffold_1	AUGUSTUS	transcript	2752816	2753517	0.38	+	.	g543.t1
Scaffold_1	AUGUSTUS	start_codon	2752816	2752818	.	+	0	transcript_id "g543.t1"; gene_id "g543";
Scaffold_1	AUGUSTUS	CDS	2752816	2752991	0.38	+	0	transcript_id "g543.t1"; gene_id "g543";
Scaffold_1	AUGUSTUS	CDS	2753061	2753517	0.39	+	1	transcript_id "g543.t1"; gene_id "g543";
Scaffold_1	AUGUSTUS	stop_codon	2753515	2753517	.	+	0	transcript_id "g543.t1"; gene_id "g543";
# protein sequence = [MHYELHHTRLNKEVHTWEKIVQEAELIEMADLENELGVCLKDKSRVNHQDEYLDSRGQHRNNQNERSKNEDSSNLKIN
# HSSSFQKKPGGHKDFAPKVQLSDEKKAQYDAQELYYGCGEKGHSSRNCPQKNTVQSNKKGPPGLQAHAMSYPTRDNEWLAQLAQTTEPAHEMLLNMIS
# LEGWVYLVSIGLRWVWRRRPLGGCQMLVAGCPSR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g543
###
# start gene g544
Scaffold_1	AUGUSTUS	gene	2754371	2755144	0.58	+	.	g544
Scaffold_1	AUGUSTUS	transcript	2754371	2755144	0.58	+	.	g544.t1
Scaffold_1	AUGUSTUS	start_codon	2754371	2754373	.	+	0	transcript_id "g544.t1"; gene_id "g544";
Scaffold_1	AUGUSTUS	CDS	2754371	2755144	0.58	+	0	transcript_id "g544.t1"; gene_id "g544";
Scaffold_1	AUGUSTUS	stop_codon	2755142	2755144	.	+	0	transcript_id "g544.t1"; gene_id "g544";
# protein sequence = [MGSSHAKSRAWGVRETGGRKVHISPTPLKPSKGLRKTSEPGGMGSKEAGGKKWQRSSPATPPPPPPSRGLSDNDSKGS
# NKREHTQSSRNGGKNDEDRAELPTGAPEVPPTHYDPDQPWYYDPRQGWHRKAAPRPSNEGWNTWESNEEKNQITIELKLDIGKIESFAGDDRSAWKTW
# VLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQQLRGSIPVLRTGQNSNGSLVPNSDPSTKQMRQEGGWLG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g544
###
# start gene g545
Scaffold_1	AUGUSTUS	gene	2757226	2758738	0.87	+	.	g545
Scaffold_1	AUGUSTUS	transcript	2757226	2758738	0.87	+	.	g545.t1
Scaffold_1	AUGUSTUS	start_codon	2757226	2757228	.	+	0	transcript_id "g545.t1"; gene_id "g545";
Scaffold_1	AUGUSTUS	CDS	2757226	2757839	0.9	+	0	transcript_id "g545.t1"; gene_id "g545";
Scaffold_1	AUGUSTUS	CDS	2757929	2758337	0.87	+	1	transcript_id "g545.t1"; gene_id "g545";
Scaffold_1	AUGUSTUS	CDS	2758409	2758738	0.99	+	0	transcript_id "g545.t1"; gene_id "g545";
Scaffold_1	AUGUSTUS	stop_codon	2758736	2758738	.	+	0	transcript_id "g545.t1"; gene_id "g545";
# protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDL
# DTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAAL
# GRPSDSSESKSKVKEPEVFDGSDPRKLKTGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFN
# TLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSN
# SGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g545
###
# start gene g546
Scaffold_1	AUGUSTUS	gene	2759070	2759813	0.65	+	.	g546
Scaffold_1	AUGUSTUS	transcript	2759070	2759813	0.65	+	.	g546.t1
Scaffold_1	AUGUSTUS	start_codon	2759070	2759072	.	+	0	transcript_id "g546.t1"; gene_id "g546";
Scaffold_1	AUGUSTUS	CDS	2759070	2759813	0.65	+	0	transcript_id "g546.t1"; gene_id "g546";
Scaffold_1	AUGUSTUS	stop_codon	2759811	2759813	.	+	0	transcript_id "g546.t1"; gene_id "g546";
# protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINPLLQRSLF
# RYRNLRRRFHRQFWRPLLGTHSPRSRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSE
# VAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEALRRLSAVFILCLKRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g546
###
# start gene g547
Scaffold_1	AUGUSTUS	gene	2761170	2762635	0.56	+	.	g547
Scaffold_1	AUGUSTUS	transcript	2761170	2762635	0.56	+	.	g547.t1
Scaffold_1	AUGUSTUS	start_codon	2761170	2761172	.	+	0	transcript_id "g547.t1"; gene_id "g547";
Scaffold_1	AUGUSTUS	CDS	2761170	2761524	0.65	+	0	transcript_id "g547.t1"; gene_id "g547";
Scaffold_1	AUGUSTUS	CDS	2761625	2761948	0.63	+	2	transcript_id "g547.t1"; gene_id "g547";
Scaffold_1	AUGUSTUS	CDS	2762127	2762635	0.91	+	2	transcript_id "g547.t1"; gene_id "g547";
Scaffold_1	AUGUSTUS	stop_codon	2762633	2762635	.	+	0	transcript_id "g547.t1"; gene_id "g547";
# protein sequence = [MDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVLITAIFAFKSSLLSMIIHSSAISARTA
# LSKLYVVNTPGPRSETLFVTTLPLALSVVAISPAVIGLTAFVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALG
# KALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPYFRSPTQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGP
# FKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVA
# ADELHADELVPAFHARYPHKPGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g547
###
# start gene g548
Scaffold_1	AUGUSTUS	gene	2768938	2769321	0.52	-	.	g548
Scaffold_1	AUGUSTUS	transcript	2768938	2769321	0.52	-	.	g548.t1
Scaffold_1	AUGUSTUS	stop_codon	2768938	2768940	.	-	0	transcript_id "g548.t1"; gene_id "g548";
Scaffold_1	AUGUSTUS	CDS	2768938	2769321	0.52	-	0	transcript_id "g548.t1"; gene_id "g548";
Scaffold_1	AUGUSTUS	start_codon	2769319	2769321	.	-	0	transcript_id "g548.t1"; gene_id "g548";
# protein sequence = [MIEAYIREVLGYTASPDRVPPPVEAPSSNAPLPATTFLVADDTRSVLGASIPTPRRTPLLLPGSLLPTSLHSPSAIPS
# SPCVLNVPHEVVDLTMDDAEDLYELQEEFLAWTGGAVTVKQEMTESDIV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g548
###
# start gene g549
Scaffold_1	AUGUSTUS	gene	2772839	2773225	0.68	+	.	g549
Scaffold_1	AUGUSTUS	transcript	2772839	2773225	0.68	+	.	g549.t1
Scaffold_1	AUGUSTUS	start_codon	2772839	2772841	.	+	0	transcript_id "g549.t1"; gene_id "g549";
Scaffold_1	AUGUSTUS	CDS	2772839	2773225	0.68	+	0	transcript_id "g549.t1"; gene_id "g549";
Scaffold_1	AUGUSTUS	stop_codon	2773223	2773225	.	+	0	transcript_id "g549.t1"; gene_id "g549";
# protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEFR
# GPLQWNLGWDHHNGGLPPWVTPNLPVVPWEVSHTPLPGEREDLPLDRYRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g549
###
# start gene g550
Scaffold_1	AUGUSTUS	gene	2778356	2779342	0.96	+	.	g550
Scaffold_1	AUGUSTUS	transcript	2778356	2779342	0.96	+	.	g550.t1
Scaffold_1	AUGUSTUS	start_codon	2778356	2778358	.	+	0	transcript_id "g550.t1"; gene_id "g550";
Scaffold_1	AUGUSTUS	CDS	2778356	2779342	0.96	+	0	transcript_id "g550.t1"; gene_id "g550";
Scaffold_1	AUGUSTUS	stop_codon	2779340	2779342	.	+	0	transcript_id "g550.t1"; gene_id "g550";
# protein sequence = [MGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYP
# DLPTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPRRRSPLLKKCSGRVIA
# APEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLK
# EYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTCDSASTIEPEQDYERRIGTLYP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g550
###
# start gene g551
Scaffold_1	AUGUSTUS	gene	2779677	2780588	0.88	+	.	g551
Scaffold_1	AUGUSTUS	transcript	2779677	2780588	0.88	+	.	g551.t1
Scaffold_1	AUGUSTUS	start_codon	2779677	2779679	.	+	0	transcript_id "g551.t1"; gene_id "g551";
Scaffold_1	AUGUSTUS	CDS	2779677	2780588	0.88	+	0	transcript_id "g551.t1"; gene_id "g551";
Scaffold_1	AUGUSTUS	stop_codon	2780586	2780588	.	+	0	transcript_id "g551.t1"; gene_id "g551";
# protein sequence = [MRFHVDTVEYLGVIISPLGVSMDPEKVKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNW
# TPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRH
# QIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRV
# REAPKDTTIIEALKRIARNEEESFVWEDG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g551
###
# start gene g552
Scaffold_1	AUGUSTUS	gene	2795716	2796530	0.34	-	.	g552
Scaffold_1	AUGUSTUS	transcript	2795716	2796530	0.34	-	.	g552.t1
Scaffold_1	AUGUSTUS	stop_codon	2795716	2795718	.	-	0	transcript_id "g552.t1"; gene_id "g552";
Scaffold_1	AUGUSTUS	CDS	2795716	2796002	0.71	-	2	transcript_id "g552.t1"; gene_id "g552";
Scaffold_1	AUGUSTUS	CDS	2796056	2796530	0.39	-	0	transcript_id "g552.t1"; gene_id "g552";
Scaffold_1	AUGUSTUS	start_codon	2796528	2796530	.	-	0	transcript_id "g552.t1"; gene_id "g552";
# protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE
# VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGLESTWLVNPPNRILTRDE
# LIGYRAQALSKHNSFIEKVRRRVDAKKLQSYEDSNENIDIQLKIGISNQVNWSRLEILELKRVWIERCIQDIEDLWS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g552
###
# start gene g553
Scaffold_1	AUGUSTUS	gene	2796701	2798842	0.68	-	.	g553
Scaffold_1	AUGUSTUS	transcript	2796701	2798842	0.68	-	.	g553.t1
Scaffold_1	AUGUSTUS	stop_codon	2796701	2796703	.	-	0	transcript_id "g553.t1"; gene_id "g553";
Scaffold_1	AUGUSTUS	CDS	2796701	2797080	0.89	-	2	transcript_id "g553.t1"; gene_id "g553";
Scaffold_1	AUGUSTUS	CDS	2797684	2798842	0.73	-	0	transcript_id "g553.t1"; gene_id "g553";
Scaffold_1	AUGUSTUS	start_codon	2798840	2798842	.	-	0	transcript_id "g553.t1"; gene_id "g553";
# protein sequence = [MTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRF
# VWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSN
# VPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHV
# YGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEP
# YQFDDFKDQIDPRVSQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPS
# DESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRILINLINHN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g553
###
# start gene g554
Scaffold_1	AUGUSTUS	gene	2799190	2801225	0.75	-	.	g554
Scaffold_1	AUGUSTUS	transcript	2799190	2801225	0.75	-	.	g554.t1
Scaffold_1	AUGUSTUS	stop_codon	2799190	2799192	.	-	0	transcript_id "g554.t1"; gene_id "g554";
Scaffold_1	AUGUSTUS	CDS	2799190	2800277	0.79	-	2	transcript_id "g554.t1"; gene_id "g554";
Scaffold_1	AUGUSTUS	CDS	2800352	2801225	0.75	-	0	transcript_id "g554.t1"; gene_id "g554";
Scaffold_1	AUGUSTUS	start_codon	2801223	2801225	.	-	0	transcript_id "g554.t1"; gene_id "g554";
# protein sequence = [MRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIV
# ESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLN
# QTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDN
# EKSTGENDSKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKS
# FFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEK
# VRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPD
# EFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGPLKMNSFHL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g554
###
# start gene g555
Scaffold_1	AUGUSTUS	gene	2801812	2804558	0.91	-	.	g555
Scaffold_1	AUGUSTUS	transcript	2801812	2804558	0.91	-	.	g555.t1
Scaffold_1	AUGUSTUS	stop_codon	2801812	2801814	.	-	0	transcript_id "g555.t1"; gene_id "g555";
Scaffold_1	AUGUSTUS	CDS	2801812	2803780	0.96	-	1	transcript_id "g555.t1"; gene_id "g555";
Scaffold_1	AUGUSTUS	CDS	2804542	2804558	0.92	-	0	transcript_id "g555.t1"; gene_id "g555";
Scaffold_1	AUGUSTUS	start_codon	2804556	2804558	.	-	0	transcript_id "g555.t1"; gene_id "g555";
# protein sequence = [MRLYILKTAYFEEFGESRSLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI
# SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS
# AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL
# VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD
# NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ
# SHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLR
# DNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g555
###
# start gene g556
Scaffold_1	AUGUSTUS	gene	2816512	2817525	0.13	-	.	g556
Scaffold_1	AUGUSTUS	transcript	2816512	2817525	0.13	-	.	g556.t1
Scaffold_1	AUGUSTUS	stop_codon	2816512	2816514	.	-	0	transcript_id "g556.t1"; gene_id "g556";
Scaffold_1	AUGUSTUS	CDS	2816512	2817222	0.96	-	0	transcript_id "g556.t1"; gene_id "g556";
Scaffold_1	AUGUSTUS	CDS	2817313	2817525	0.13	-	0	transcript_id "g556.t1"; gene_id "g556";
Scaffold_1	AUGUSTUS	start_codon	2817523	2817525	.	-	0	transcript_id "g556.t1"; gene_id "g556";
# protein sequence = [MDYSELMGPSAPEHDLTPLEEHYATAYSAAELKTFHCDRVRKMPLSGLDPSMLIGFLCRDEKDWVDFRRRVDEAPSWA
# ADSADNMGLESMSDPDEVDTMELEDEDEPSLDVSIQSRSRSASLSLSSVSQHGSAGGARSDRSKSEEIDTEEDPVDPITPGPSAARFDSSVVHVPLPG
# DGHEKETSFDDASDDIEDDWVEPSIPSTPVHSSHGAQSSTDDSAGAVIAPAMKKTRSTSSGASKKKKPKKQIPVPVPKVKLPSTRESFPFPVATEDVS
# AEGPISVSYSSSSSMSGAGDDSVGVGALIRENG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g556
###
# start gene g557
Scaffold_1	AUGUSTUS	gene	2837256	2838143	0.99	-	.	g557
Scaffold_1	AUGUSTUS	transcript	2837256	2838143	0.99	-	.	g557.t1
Scaffold_1	AUGUSTUS	stop_codon	2837256	2837258	.	-	0	transcript_id "g557.t1"; gene_id "g557";
Scaffold_1	AUGUSTUS	CDS	2837256	2838143	0.99	-	0	transcript_id "g557.t1"; gene_id "g557";
Scaffold_1	AUGUSTUS	start_codon	2838141	2838143	.	-	0	transcript_id "g557.t1"; gene_id "g557";
# protein sequence = [MPIATACLQSWFAGAAARDGTSWRLAKGILSSALLSTAAQIERRENAKQLEWEKRVSEIRIVREKLEEELIRFRTVAR
# MNVVKPYTDALDPVDSPISAEDSNHWNYEYNQLPSHRYLFNCYVYQYHLMRFADMLGELLDHVIRLETRPERRHRRVWTPKFHNLASVTVFLEWIKSV
# WTDNDNVGRSASSGAEGEEGEEEDPDRVQHVDRDRRRDVELDELSDETRVGNGVVGDEEDNMYGMGLPYPKRRDPDALPPSNVGELMGRWIYKRIVGL
# TTGNALYAVKAGVLTSKRWPT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g557
###
# start gene g558
Scaffold_1	AUGUSTUS	gene	2840220	2840621	0.88	-	.	g558
Scaffold_1	AUGUSTUS	transcript	2840220	2840621	0.88	-	.	g558.t1
Scaffold_1	AUGUSTUS	stop_codon	2840220	2840222	.	-	0	transcript_id "g558.t1"; gene_id "g558";
Scaffold_1	AUGUSTUS	CDS	2840220	2840621	0.88	-	0	transcript_id "g558.t1"; gene_id "g558";
Scaffold_1	AUGUSTUS	start_codon	2840619	2840621	.	-	0	transcript_id "g558.t1"; gene_id "g558";
# protein sequence = [MTHKIKDLGISVDIRLPQNSKQIDAKDRATLTDLERVTQGSHGCTWMMEALEYLTKASQAKGTEVGLSEKEEEDARYW
# IASKEGELGIASSCGKKIMRPVTAVNSPVHHAIVESPTEMDVDYFSPSSLQALND]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g558
###
# start gene g559
Scaffold_1	AUGUSTUS	gene	2845660	2846007	0.99	+	.	g559
Scaffold_1	AUGUSTUS	transcript	2845660	2846007	0.99	+	.	g559.t1
Scaffold_1	AUGUSTUS	start_codon	2845660	2845662	.	+	0	transcript_id "g559.t1"; gene_id "g559";
Scaffold_1	AUGUSTUS	CDS	2845660	2846007	0.99	+	0	transcript_id "g559.t1"; gene_id "g559";
Scaffold_1	AUGUSTUS	stop_codon	2846005	2846007	.	+	0	transcript_id "g559.t1"; gene_id "g559";
# protein sequence = [MLPPWPPSQFDGHLPHPSQPPPPPPPPPPPPPGPPSPPSSKSNKRKKGTDEEHAHDTSEPGGNSNTSDGDRKKRKRKK
# KSTNTESAPRASTSSGQQEHQQTETPEASTKKSRKER]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g559
###
# start gene g560
Scaffold_1	AUGUSTUS	gene	2847009	2847470	0.57	+	.	g560
Scaffold_1	AUGUSTUS	transcript	2847009	2847470	0.57	+	.	g560.t1
Scaffold_1	AUGUSTUS	start_codon	2847009	2847011	.	+	0	transcript_id "g560.t1"; gene_id "g560";
Scaffold_1	AUGUSTUS	CDS	2847009	2847470	0.57	+	0	transcript_id "g560.t1"; gene_id "g560";
Scaffold_1	AUGUSTUS	stop_codon	2847468	2847470	.	+	0	transcript_id "g560.t1"; gene_id "g560";
# protein sequence = [MPLRNPKVTMLYYETDVYRDECKKYEGRTKNQRRRAPRIPHPEKKETNFIGLPKPSVPLDWFDPDEFNKLPVHIRVRY
# RDSPVVLPLAEQMAGPEDDWKTMGHKGFMKKYGKEVRGQYQIPTKEEMESADVDTDDEMDEDEDDESDGSEMDES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g560
###
# start gene g561
Scaffold_1	AUGUSTUS	gene	2849505	2850203	0.94	-	.	g561
Scaffold_1	AUGUSTUS	transcript	2849505	2850203	0.94	-	.	g561.t1
Scaffold_1	AUGUSTUS	stop_codon	2849505	2849507	.	-	0	transcript_id "g561.t1"; gene_id "g561";
Scaffold_1	AUGUSTUS	CDS	2849505	2850203	0.94	-	0	transcript_id "g561.t1"; gene_id "g561";
Scaffold_1	AUGUSTUS	start_codon	2850201	2850203	.	-	0	transcript_id "g561.t1"; gene_id "g561";
# protein sequence = [MHNPEQLKFWGPLACLSEFPGERLNGEFARISTNNHFNEMELTMVRQFGRKANLNVILNETDYEDDATRDLLEILAPV
# DVYEFARPAIMSSYEVAQFYKKHDDFKREEYNTLLHYLNSTGKEYYTAYPESMLYQSPTLLSILQPVVQRIRDFNFQGKTYSNVASHEAGSHIQYYIP
# GGNGENMTGCIMEIWQLPLEQKLSTFLLVKEHLPLSPSQKVKSPYAWAPCSILQVN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g561
###
# start gene g562
Scaffold_1	AUGUSTUS	gene	2850251	2850634	0.95	-	.	g562
Scaffold_1	AUGUSTUS	transcript	2850251	2850634	0.95	-	.	g562.t1
Scaffold_1	AUGUSTUS	stop_codon	2850251	2850253	.	-	0	transcript_id "g562.t1"; gene_id "g562";
Scaffold_1	AUGUSTUS	CDS	2850251	2850634	0.95	-	0	transcript_id "g562.t1"; gene_id "g562";
Scaffold_1	AUGUSTUS	start_codon	2850632	2850634	.	-	0	transcript_id "g562.t1"; gene_id "g562";
# protein sequence = [MHEEDDSDDPDFKDLDVETLFKLTPQQIAHIRHCISEILLPTWVERPPRNLGEKSHGKLKAHQLLILFTVIFPLIIPE
# LWAFGNETERKLLENFCDLVAATNIIASYSVTPQKQMIMGNTSRVTGIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g562
###
# start gene g563
Scaffold_1	AUGUSTUS	gene	2850670	2851361	0.22	-	.	g563
Scaffold_1	AUGUSTUS	transcript	2850670	2851361	0.22	-	.	g563.t1
Scaffold_1	AUGUSTUS	stop_codon	2850670	2850672	.	-	0	transcript_id "g563.t1"; gene_id "g563";
Scaffold_1	AUGUSTUS	CDS	2850670	2851136	0.39	-	2	transcript_id "g563.t1"; gene_id "g563";
Scaffold_1	AUGUSTUS	CDS	2851214	2851361	0.22	-	0	transcript_id "g563.t1"; gene_id "g563";
Scaffold_1	AUGUSTUS	start_codon	2851359	2851361	.	-	0	transcript_id "g563.t1"; gene_id "g563";
# protein sequence = [MEFDLPGKSMSTSSYPEGARVSARVYPNIADLLGSKKFTGFGSPSATYFLKAQAQAWKNAVTISEKENLFKQNSIRWI
# PQHDIPYFDPVQHVVLGMMHNTLEGHLEFHLRELWGLGRTEKKEKQLAQEETERDRDEEFSVADTEETLSELEDLEEESREWQQSVTGSANDLNDLTM
# DDVDDDNSTSTATPGPRTRSQSLGSYLH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g563
###
# start gene g564
Scaffold_1	AUGUSTUS	gene	2851567	2852419	0.77	-	.	g564
Scaffold_1	AUGUSTUS	transcript	2851567	2852419	0.77	-	.	g564.t1
Scaffold_1	AUGUSTUS	stop_codon	2851567	2851569	.	-	0	transcript_id "g564.t1"; gene_id "g564";
Scaffold_1	AUGUSTUS	CDS	2851567	2852070	0.81	-	0	transcript_id "g564.t1"; gene_id "g564";
Scaffold_1	AUGUSTUS	CDS	2852160	2852182	0.81	-	2	transcript_id "g564.t1"; gene_id "g564";
Scaffold_1	AUGUSTUS	CDS	2852275	2852419	0.94	-	0	transcript_id "g564.t1"; gene_id "g564";
Scaffold_1	AUGUSTUS	start_codon	2852417	2852419	.	-	0	transcript_id "g564.t1"; gene_id "g564";
# protein sequence = [MEVERQQAEIDALASSSANLASHSFSLNSGTNPASASTPPPEIPDLVAAAWLIYMQAADYKIGKQTPKIGIPLDIRTV
# YARLNLDPKIHRLFCCPTCFKMYPLDTSLKKCNYQKSSRAKPCNTDLWSFRHSKKGHKIQIPRCSYTTTSFDSWLQSFLRPSIEKCLYKTFIKTQNPA
# PQERMYDIQDSPFWDSIRHNLNSPHDLIFSVYVDWFNPLGNKQAGEF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g564
###
# start gene g565
Scaffold_1	AUGUSTUS	gene	2853273	2853959	0.98	-	.	g565
Scaffold_1	AUGUSTUS	transcript	2853273	2853959	0.98	-	.	g565.t1
Scaffold_1	AUGUSTUS	stop_codon	2853273	2853275	.	-	0	transcript_id "g565.t1"; gene_id "g565";
Scaffold_1	AUGUSTUS	CDS	2853273	2853959	0.98	-	0	transcript_id "g565.t1"; gene_id "g565";
Scaffold_1	AUGUSTUS	start_codon	2853957	2853959	.	-	0	transcript_id "g565.t1"; gene_id "g565";
# protein sequence = [MHSHNDHHIDRGNVKHFPQSRRSISPLKGLTAFPASSSHTRDYQPHLRTLDHSHLRSEIGPDPAPDTENTETTNIPDE
# SQNLKPDSGPRLFFVSAKTGEGVNNVFEYVAKRVVRRWAWEEKEEEREDSGDFDGYREAERRLQPSNRLKLREHQRQPSDGIGHGSGIMLNRSNGLRG
# ASNGGGLGGRSWSEGMTITLSSLNGVVGSVSSMRGMRGTGETEGSGGGCCST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g565
###
# start gene g566
Scaffold_1	AUGUSTUS	gene	2859094	2859477	0.86	+	.	g566
Scaffold_1	AUGUSTUS	transcript	2859094	2859477	0.86	+	.	g566.t1
Scaffold_1	AUGUSTUS	start_codon	2859094	2859096	.	+	0	transcript_id "g566.t1"; gene_id "g566";
Scaffold_1	AUGUSTUS	CDS	2859094	2859477	0.86	+	0	transcript_id "g566.t1"; gene_id "g566";
Scaffold_1	AUGUSTUS	stop_codon	2859475	2859477	.	+	0	transcript_id "g566.t1"; gene_id "g566";
# protein sequence = [MSSFTFVTRIALLIQAVLLIISIASPVHAVVVPVHHVLRRDNGPHHGDFKGGFNAGHGNGASSSATDDTSSATADSAT
# TATEVAATSTDTAATTASTTSSSGTTYTGGYATYFYQEGVAGMIWVLPP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g566
###
# start gene g567
Scaffold_1	AUGUSTUS	gene	2867295	2868986	0.04	-	.	g567
Scaffold_1	AUGUSTUS	transcript	2867295	2868986	0.04	-	.	g567.t1
Scaffold_1	AUGUSTUS	stop_codon	2867295	2867297	.	-	0	transcript_id "g567.t1"; gene_id "g567";
Scaffold_1	AUGUSTUS	CDS	2867295	2867434	0.23	-	2	transcript_id "g567.t1"; gene_id "g567";
Scaffold_1	AUGUSTUS	CDS	2867534	2867944	0.21	-	2	transcript_id "g567.t1"; gene_id "g567";
Scaffold_1	AUGUSTUS	CDS	2868040	2868304	0.28	-	0	transcript_id "g567.t1"; gene_id "g567";
Scaffold_1	AUGUSTUS	CDS	2868355	2868839	0.6	-	2	transcript_id "g567.t1"; gene_id "g567";
Scaffold_1	AUGUSTUS	CDS	2868902	2868986	0.55	-	0	transcript_id "g567.t1"; gene_id "g567";
Scaffold_1	AUGUSTUS	start_codon	2868984	2868986	.	-	0	transcript_id "g567.t1"; gene_id "g567";
# protein sequence = [MRPSVLIVLVLAAISTAAPLGEVNKRDGEPSATTTSPASKGPPDEGTTTTTTSSSSTSTSTAAGKDPFSNEGSSPVPT
# TSPASKERTSETSKSEPASKSPEPSSSKEPESSSAKPTSHSGTESETSKLESETSSAKPTSHSGTETETSHTSTSSEEPKVTTSVKPTGSESESEHTP
# TTSTKAGEEVRRIRTGTPTTNTESTITPAPDSGPTADPDSLPVTTDKHHDVLTAVKEILTEFINGQWQTIDTYAYPTATDGASNPEETGLPDGSSPEG
# SPDNVNGTSDGTSDQPSTNDENSIGNDKDSNNTLNDATSPRDNDSGSANNSTSSDISSPSNNSTTSDDGSDTDSSSEGTVVDDSSSETGSSDDESSSG
# NSSPDGASDSSSAASSSTTSKKPSTAATGKSDAPSPATQKANHLDTDRKRTRVGLLKSQHRCPILCLQPDLELINQCKPIYVSTEKSQV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g567
###
# start gene g568
Scaffold_1	AUGUSTUS	gene	2875498	2876903	0.27	-	.	g568
Scaffold_1	AUGUSTUS	transcript	2875498	2876903	0.27	-	.	g568.t1
Scaffold_1	AUGUSTUS	stop_codon	2875498	2875500	.	-	0	transcript_id "g568.t1"; gene_id "g568";
Scaffold_1	AUGUSTUS	CDS	2875498	2876845	0.35	-	1	transcript_id "g568.t1"; gene_id "g568";
Scaffold_1	AUGUSTUS	CDS	2876887	2876903	0.27	-	0	transcript_id "g568.t1"; gene_id "g568";
Scaffold_1	AUGUSTUS	start_codon	2876901	2876903	.	-	0	transcript_id "g568.t1"; gene_id "g568";
# protein sequence = [MSPRISTTGTPAASSAPTPRSEPIPAERVLTVSEVTTIFLKSLLQSAEDFLGKRVQGAVITVPSVFTDAQKHALEKAA
# KDAGIIVYQLLEEPAAVAAVTTAEAWGSMLPADRTQLIVDVGSSSLSLSLLALREGLAHIIASTSSTSTGGDAIDSKLITFFANEFTKKTKTPLTVCS
# ETPSTGDARAEAKLRLAIEHTKRTISASPNAATCSVESLKDGVDFTGNINRMRFDMLVRPIYDSVARAIVDLLAEAKVDPHQVDEIVYVGGTTCLPGL
# DEHIGLAGGFSEGVNTPFSMGTVIGGGIGDPTTVLARGCAVQAALIASLSSEGEDEELRKAFEHGSDLVDVKTTSKTLGLVFPDDSGNETGGTWIPLV
# LAETTLPARRTATFDIGLSEESKRFAFELWEVTEGIRVEKILPAKVSPSDAEDEDEEEEEEEIKHKTITKETLLVLRKQRLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g568
###
# start gene g569
Scaffold_1	AUGUSTUS	gene	2880930	2881562	0.91	+	.	g569
Scaffold_1	AUGUSTUS	transcript	2880930	2881562	0.91	+	.	g569.t1
Scaffold_1	AUGUSTUS	start_codon	2880930	2880932	.	+	0	transcript_id "g569.t1"; gene_id "g569";
Scaffold_1	AUGUSTUS	CDS	2880930	2881562	0.91	+	0	transcript_id "g569.t1"; gene_id "g569";
Scaffold_1	AUGUSTUS	stop_codon	2881560	2881562	.	+	0	transcript_id "g569.t1"; gene_id "g569";
# protein sequence = [MHDQTSSPTLSVAFGPLSSNSASSSLSSSSSSDDLSPLFTLSYSPRITTMAKKRSHQDLPHLSIPFKPQTSRASFPHL
# AHGERSAGQDAWTLESPLAVYNSQAGPETPSSASTSTSILISPSTPISPVTSIPTSISTPTSTSTPETPNSLSSPIVGVVDLTRNLKTVSSGPVSHGG
# YSDIYQGELEMTKSDQNSSFNEEAEKIPVSLFLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g569
###
# start gene g570
Scaffold_1	AUGUSTUS	gene	2883593	2884030	0.93	+	.	g570
Scaffold_1	AUGUSTUS	transcript	2883593	2884030	0.93	+	.	g570.t1
Scaffold_1	AUGUSTUS	start_codon	2883593	2883595	.	+	0	transcript_id "g570.t1"; gene_id "g570";
Scaffold_1	AUGUSTUS	CDS	2883593	2884030	0.93	+	0	transcript_id "g570.t1"; gene_id "g570";
Scaffold_1	AUGUSTUS	stop_codon	2884028	2884030	.	+	0	transcript_id "g570.t1"; gene_id "g570";
# protein sequence = [MLPPWPPSQFDGHLPHPSQPPPPPPPPPPPPPGPPSPPSSKSNKRKKGTDEEHAHDTSEPGGNSNTSDGDRKKRKRKK
# KSTNTESAPRASTSSGQQEHQQTETPEASTKKKQKGKVVNEVYRVSRRDLKEDATGGAERLRVCDLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g570
###
# start gene g571
Scaffold_1	AUGUSTUS	gene	2884966	2885331	0.46	+	.	g571
Scaffold_1	AUGUSTUS	transcript	2884966	2885331	0.46	+	.	g571.t1
Scaffold_1	AUGUSTUS	start_codon	2884966	2884968	.	+	0	transcript_id "g571.t1"; gene_id "g571";
Scaffold_1	AUGUSTUS	CDS	2884966	2885331	0.46	+	0	transcript_id "g571.t1"; gene_id "g571";
Scaffold_1	AUGUSTUS	stop_codon	2885329	2885331	.	+	0	transcript_id "g571.t1"; gene_id "g571";
# protein sequence = [MLYYETDVYRDECKKYEGRTKNQRRRAPRIPHPEKKETNFIGLPKPSVPLDWFDPDEFNKLPVHIRVRYRDSPVVLPL
# AEQMAGPEDDWKTMGHKGFMKKYGKEVRASIKSQQRKKWSLRM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g571
###
# start gene g572
Scaffold_1	AUGUSTUS	gene	2887282	2889297	0.41	-	.	g572
Scaffold_1	AUGUSTUS	transcript	2887282	2889297	0.41	-	.	g572.t1
Scaffold_1	AUGUSTUS	stop_codon	2887282	2887284	.	-	0	transcript_id "g572.t1"; gene_id "g572";
Scaffold_1	AUGUSTUS	CDS	2887282	2889297	0.41	-	0	transcript_id "g572.t1"; gene_id "g572";
Scaffold_1	AUGUSTUS	start_codon	2889295	2889297	.	-	0	transcript_id "g572.t1"; gene_id "g572";
# protein sequence = [MEFDLPGKSMPTSSYPEGARVSARVYPNIADLLGSKKFTGFGSPSATYFCTWCTLSKEQVENLDYDSWQLRDGNTVKA
# QAQAWKNAVTISEKENLFKQNSIRWIPQHDIPYFDPVQHVVLGMMHNTLEGHLEFHLRELWGLGRTEKKEKQLAQEETERDRDEEFSVADTEETLSEL
# EDLEEESREWQQSVTGSANDLNDLTMDDVDDDNSTSTATPGPRTRSQSLGSLSSLTSQAIQWDLSSNMHEEDDSDDPDFKDLDVETLFKLTPQQIAHI
# RHCISEILLPTWVERPPRNLGEKSHGKLKAHQLLILFTVIFPLIIPELWAFGNETERKLLENFCDLVAATNIIASYSVTPTEADDYGKYFKSYRNSMR
# ELFPQYHSLPNHHYAMHNPEQLKFWGPLACLSEFPGERLNGEFARISTNNHFNEMELTMVRQFGRKANLNVILNETDYEDDATRDLLEILAPVDVYEF
# AHDPAIMSSYEVAQFYKKHDDFKREEYNTLLHYLNSTGKEYYTAYPESMLYQSPTLLSILQPVVQRIRDFNFQGKTYSNVASHEAGSHIQYYIPGGNG
# ENMTGCIMEIWQLPLEQKLSTFLLVKEHLPLSPSQKVKSPYAWAPCSILQSELVQRNLASYTYLIEPHHIICHLAVYKRPAGTYDIPQETMAIVWSLN
# RGRRK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g572
###
# start gene g573
Scaffold_1	AUGUSTUS	gene	2893176	2894051	0.55	-	.	g573
Scaffold_1	AUGUSTUS	transcript	2893176	2894051	0.55	-	.	g573.t1
Scaffold_1	AUGUSTUS	stop_codon	2893176	2893178	.	-	0	transcript_id "g573.t1"; gene_id "g573";
Scaffold_1	AUGUSTUS	CDS	2893176	2894051	0.55	-	0	transcript_id "g573.t1"; gene_id "g573";
Scaffold_1	AUGUSTUS	start_codon	2894049	2894051	.	-	0	transcript_id "g573.t1"; gene_id "g573";
# protein sequence = [MPIVLADGTPGLLAEGKLGETVEKELPDLSEEVEKYKDDAGIMNAIYRDYSFLLSAYLLEPCHLRFLKGEGYGLGRQR
# LPEVIAKPMVKVSEMYVLYTSLRFLSLPNKPFLFFQRSAGFKPFMEYAGSYALYNYRLADPSLGLTYSNLRLIRAFEQGLNPSSSEAGFVFVHIAMVS
# HSGLLISGAVQALNGALTSDRPRFDAGMKDLLEALKEINRVMDTMWGKSKPNGYNTFRTFIFGITSQSMFPEGVVYEGVSEEPMAFRGESGANDSMVR
# TMEEILHHTFSAPIFFF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g573
###
# start gene g574
Scaffold_1	AUGUSTUS	gene	2903159	2904068	0.2	-	.	g574
Scaffold_1	AUGUSTUS	transcript	2903159	2904068	0.2	-	.	g574.t1
Scaffold_1	AUGUSTUS	stop_codon	2903159	2903161	.	-	0	transcript_id "g574.t1"; gene_id "g574";
Scaffold_1	AUGUSTUS	CDS	2903159	2903411	0.71	-	1	transcript_id "g574.t1"; gene_id "g574";
Scaffold_1	AUGUSTUS	CDS	2903557	2903579	0.34	-	0	transcript_id "g574.t1"; gene_id "g574";
Scaffold_1	AUGUSTUS	CDS	2903663	2903815	0.33	-	0	transcript_id "g574.t1"; gene_id "g574";
Scaffold_1	AUGUSTUS	CDS	2903904	2904068	0.86	-	0	transcript_id "g574.t1"; gene_id "g574";
Scaffold_1	AUGUSTUS	start_codon	2904066	2904068	.	-	0	transcript_id "g574.t1"; gene_id "g574";
# protein sequence = [MYNVNVKNTFGPGVQAIALSQYGSQVGFYGCGFYGYQDTLYANEGTQVYLKGYIEGGIDFIFGREGSAYFGGNTIGVL
# AEGGSITASGRETDDSGSCEFTSFMTFVMSSTRIQSVIFESTTLDVAPNPALWSLWDGEADSIDNVLNADYNTTGPGASDLERASWATELTSASEAAE
# YSISSAVGSDWEDWVDVSYFV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g574
###
# start gene g575
Scaffold_1	AUGUSTUS	gene	2906647	2907009	0.98	-	.	g575
Scaffold_1	AUGUSTUS	transcript	2906647	2907009	0.98	-	.	g575.t1
Scaffold_1	AUGUSTUS	stop_codon	2906647	2906649	.	-	0	transcript_id "g575.t1"; gene_id "g575";
Scaffold_1	AUGUSTUS	CDS	2906647	2907009	0.98	-	0	transcript_id "g575.t1"; gene_id "g575";
Scaffold_1	AUGUSTUS	start_codon	2907007	2907009	.	-	0	transcript_id "g575.t1"; gene_id "g575";
# protein sequence = [MGLWDLANVLKGQQEEKQRATRRRKEKENEGATHRHQPRWFVAETDGDTGERVWMPLRVVTEEDNKKRALEYWVERER
# VWKEMQEVASEKEEEKKEGKAKWRGVEDIFVDEPDEMRKVDY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g575
###
# start gene g576
Scaffold_1	AUGUSTUS	gene	2907943	2910147	0.95	-	.	g576
Scaffold_1	AUGUSTUS	transcript	2907943	2910147	0.95	-	.	g576.t1
Scaffold_1	AUGUSTUS	stop_codon	2907943	2907945	.	-	0	transcript_id "g576.t1"; gene_id "g576";
Scaffold_1	AUGUSTUS	CDS	2907943	2910147	0.95	-	0	transcript_id "g576.t1"; gene_id "g576";
Scaffold_1	AUGUSTUS	start_codon	2910145	2910147	.	-	0	transcript_id "g576.t1"; gene_id "g576";
# protein sequence = [MKANHPVEAARWIGAIGEWKVWSQQQQPQSSPTGQVASSSSSATRTSSSSHSAFTSLTTTATTTTTSLPPPTSTRTSI
# SNSISNSLIGGLSTIRKKRKANFPDNKSSMDLVNPPSDVESLHKNLHGIHSEAESRMSGMSRTSRASKKANSRFGYSDDDDDEDEDPEGEEMEDDIEY
# EEHDEEHDLDNNNGDDNVVSLPLPYSDTYSQQTRLIFDQIEIITTQQSSSSLQSLKNLVSTYISMTASRESHILTNLTSTKQRLSGTRSSLSRTRKSL
# RITKQSLRATKESLRSSEAARKKLEATVKQAKRAQKAWEESMKVVLEEEVGLERQLKRTSRNFNSLKRGSRVLGSGPTSPTAASTTTSGALIGEDELR
# TPTALGYYLDPSVPPEGLSTTSEGDREDREDTDDVEDEDDNLEDDDDEDEFFDAIEANNIPNLVVPAQLQQTAPTSLASSMSSVTTAAYATATPSPSI
# STSTSLTVPDPSSNMFTSSITSTFASSPFASYSPYAYLRASLPIRTERPATSLWSALKNSIGKDLTKISFPVYFNEPTSMLQRMAEDMEFSECCEYKH
# HLSSKNFQAHCSVILFSAPFSSVDIASSTPSPHLRIAYIAAFAMSNYSSTIGRIAKPFNPMLGETFEYVCLGDDFEGERKKGIHEQQEKQGKQGYRYV
# SEQVSHHPPISACWAESLGMVESEDNSDLNGTVKTEGRGGDTTAKSTLKTNSWVRALKFDLRELHMCS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g576
###
# start gene g577
Scaffold_1	AUGUSTUS	gene	2921755	2922327	0.87	+	.	g577
Scaffold_1	AUGUSTUS	transcript	2921755	2922327	0.87	+	.	g577.t1
Scaffold_1	AUGUSTUS	start_codon	2921755	2921757	.	+	0	transcript_id "g577.t1"; gene_id "g577";
Scaffold_1	AUGUSTUS	CDS	2921755	2922327	0.87	+	0	transcript_id "g577.t1"; gene_id "g577";
Scaffold_1	AUGUSTUS	stop_codon	2922325	2922327	.	+	0	transcript_id "g577.t1"; gene_id "g577";
# protein sequence = [MDEDKLTFIILAREGDAFIPDTVNPTDSQVSSLPMVGDVNIFFSGTPLSVSESTNSPPFDDGQEFTAEAEIMIAGNSQ
# LPRSIYDYLKEKSPEPLYRRRGYAQEALRLMFQYVTGCPTSHFTQNPRVEMSQEEETHQVPVKMPHSIPPTSLITRISDKNTPSIKLFERLGFRITKH
# VEVFEEVELRWIAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g577
###
# start gene g578
Scaffold_1	AUGUSTUS	gene	2928124	2929067	0.51	-	.	g578
Scaffold_1	AUGUSTUS	transcript	2928124	2929067	0.51	-	.	g578.t1
Scaffold_1	AUGUSTUS	stop_codon	2928124	2928126	.	-	0	transcript_id "g578.t1"; gene_id "g578";
Scaffold_1	AUGUSTUS	CDS	2928124	2928657	0.95	-	0	transcript_id "g578.t1"; gene_id "g578";
Scaffold_1	AUGUSTUS	CDS	2928798	2929067	0.52	-	0	transcript_id "g578.t1"; gene_id "g578";
Scaffold_1	AUGUSTUS	start_codon	2929065	2929067	.	-	0	transcript_id "g578.t1"; gene_id "g578";
# protein sequence = [MSSNVPIAGSNITAPTPQNTPLTHAPIAAGLSRPTVPDISEDKEEDNDDDDDDADALREQALAMVQGKLAGLIGKSSG
# YLESLPVEVKLSYLALQKPLYERREAIINGSEKPTTEEITAGEQQSLKDDEDYTPVPKENIVPSAIPEFWLTALRNHIGLADLITERDEGALKHLLDI
# RLSYLNENEKEYEGKPGFKITFIFSPNEFFENETLDKSYLYQDEVGYSGDFVYYKAIGTDIKWKEDKDLTKEYEIKKQRNKSSYIYTVYIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g578
###
# start gene g579
Scaffold_1	AUGUSTUS	gene	2934535	2935731	1	-	.	g579
Scaffold_1	AUGUSTUS	transcript	2934535	2935731	1	-	.	g579.t1
Scaffold_1	AUGUSTUS	stop_codon	2934535	2934537	.	-	0	transcript_id "g579.t1"; gene_id "g579";
Scaffold_1	AUGUSTUS	CDS	2934535	2935731	1	-	0	transcript_id "g579.t1"; gene_id "g579";
Scaffold_1	AUGUSTUS	start_codon	2935729	2935731	.	-	0	transcript_id "g579.t1"; gene_id "g579";
# protein sequence = [MPSPPETNEHDLPASASQKQGALATEGLDRPANGTLQTEWTVGEDRGSEDRQGLGGSEETDARRVTPETKTAREGLVI
# DGGHEQDTGLSVEDGRRDGESLTESAENGGTVVESPKKTKKKAGVQAAPKAKAKPARKSEVGGEKGPLDMKQKPRTRGSTASPAARPLASTRSAATID
# HEDSGDEPLTTSLLLSPMSEGLEVTVDSLGNTTMEARVEKEFGIDLDITSVSKVVQVASKLKKMAIAVGGRQMEMRTAFRDETSTLRQDLGKLEERVA
# RAESGRSGSDKAGEVVLRPDLVMLKSRVQNVEKVALKMPTGSEIEGRLAVALKGVKEDFAETCGGIQGEMRALRGIVKNDVKVVSKEARDDGRAVRAE
# LKSEIQRVTAATKESLKEMQVIQRRN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g579
###
# start gene g580
Scaffold_1	AUGUSTUS	gene	2938626	2939740	0.51	-	.	g580
Scaffold_1	AUGUSTUS	transcript	2938626	2939740	0.51	-	.	g580.t1
Scaffold_1	AUGUSTUS	stop_codon	2938626	2938628	.	-	0	transcript_id "g580.t1"; gene_id "g580";
Scaffold_1	AUGUSTUS	CDS	2938626	2938826	0.6	-	0	transcript_id "g580.t1"; gene_id "g580";
Scaffold_1	AUGUSTUS	CDS	2938898	2939207	0.63	-	1	transcript_id "g580.t1"; gene_id "g580";
Scaffold_1	AUGUSTUS	CDS	2939481	2939740	0.89	-	0	transcript_id "g580.t1"; gene_id "g580";
Scaffold_1	AUGUSTUS	start_codon	2939738	2939740	.	-	0	transcript_id "g580.t1"; gene_id "g580";
# protein sequence = [MVHFSNRYVTQSFILVFGFTTNVVQAVLTPKRASCACGFVDDQGHVWREAITTDFTQAAGAIAALGSDWIMASDNEPQ
# SGTAIANIHIPGFFSYESDTQEQDIEFLSSDIDYYQHVYYTDQPGTVDGVVDPNAHKDVEIDGADFTCGFVLFLLTGHYTHLITLPYSAFGEHRFDWL
# QSSTNYYYNSALEANVPTEGSEIILNVWSNGDPAFSKGPPTSNAIATIQNIELYFNSTNFSEAEFNSACSLAGNIAQCSV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g580
###
# start gene g581
Scaffold_1	AUGUSTUS	gene	2941657	2942190	0.54	+	.	g581
Scaffold_1	AUGUSTUS	transcript	2941657	2942190	0.54	+	.	g581.t1
Scaffold_1	AUGUSTUS	start_codon	2941657	2941659	.	+	0	transcript_id "g581.t1"; gene_id "g581";
Scaffold_1	AUGUSTUS	CDS	2941657	2942190	0.54	+	0	transcript_id "g581.t1"; gene_id "g581";
Scaffold_1	AUGUSTUS	stop_codon	2942188	2942190	.	+	0	transcript_id "g581.t1"; gene_id "g581";
# protein sequence = [MRLVSSLVFILGFVLLGSAAPLDSRRPSSHIDITIAFEENPLEGIHTHLTQTYTEAVKEDVRSLVKSIAGRDLGAPKG
# SALLFHWIGTPSPDTAKPVMFDISTKDHGRYRVAMSHRTPMHDVIVTDSSGHPVRTHGDRELPLEFIFTPAKYFDYSLISLPKPIIFGILGCLGNKQE
# Y]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g581
###
# start gene g582
Scaffold_1	AUGUSTUS	gene	2942772	2943206	0.89	+	.	g582
Scaffold_1	AUGUSTUS	transcript	2942772	2943206	0.89	+	.	g582.t1
Scaffold_1	AUGUSTUS	start_codon	2942772	2942774	.	+	0	transcript_id "g582.t1"; gene_id "g582";
Scaffold_1	AUGUSTUS	CDS	2942772	2943206	0.89	+	0	transcript_id "g582.t1"; gene_id "g582";
Scaffold_1	AUGUSTUS	stop_codon	2943204	2943206	.	+	0	transcript_id "g582.t1"; gene_id "g582";
# protein sequence = [MNFNFNFSNAIAVIKVRDQAFEIRAPSSHVDITVTFEGNPEKDNESFSKAYTNAVKKDVRALLKNVAARDLGAPAGEA
# LLFHWVGVPTHDSTKPVMYDVMWNELGPYKVVMSHKTPMKDAIVKNARGGIVRNDGDRELLPYRSE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g582
###
# start gene g583
Scaffold_1	AUGUSTUS	gene	2963591	2965489	0.25	+	.	g583
Scaffold_1	AUGUSTUS	transcript	2963591	2965489	0.25	+	.	g583.t1
Scaffold_1	AUGUSTUS	start_codon	2963591	2963593	.	+	0	transcript_id "g583.t1"; gene_id "g583";
Scaffold_1	AUGUSTUS	CDS	2963591	2963798	0.35	+	0	transcript_id "g583.t1"; gene_id "g583";
Scaffold_1	AUGUSTUS	CDS	2964717	2965489	0.38	+	2	transcript_id "g583.t1"; gene_id "g583";
Scaffold_1	AUGUSTUS	stop_codon	2965487	2965489	.	+	0	transcript_id "g583.t1"; gene_id "g583";
# protein sequence = [MKRTLTNLVGSKPSSRSTSPAPSDPSSSQSGITKEVALKLIPKKKVKGNEASVWGEMEVLKGLDHPNIVPKIFIKRLL
# NPDPTRRPTAAEALKDTWLTTHDPSEEHDLSDGLRDHFDPRSKWRNAIAGARAIHRLASFGRTQSQLSTASDATASSGGWNSGSAGVGPPNTDDEDED
# DGWHPASASEVKLGNGRDSTSGPGDNVNVTVTAPPEEESSSLNGSQSASSIPDDLSSTSHAGVENNFTTHASSGSMINDDDERDSLLTEEPSPLDTES
# SHGDGHREYDPLEQDLQMPGSFDMEGPPLHNGIKEESLNSWGEMLKKLTLRN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g583
###
# start gene g584
Scaffold_1	AUGUSTUS	gene	2968736	2968966	0.57	+	.	g584
Scaffold_1	AUGUSTUS	transcript	2968736	2968966	0.57	+	.	g584.t1
Scaffold_1	AUGUSTUS	start_codon	2968736	2968738	.	+	0	transcript_id "g584.t1"; gene_id "g584";
Scaffold_1	AUGUSTUS	CDS	2968736	2968966	0.57	+	0	transcript_id "g584.t1"; gene_id "g584";
Scaffold_1	AUGUSTUS	stop_codon	2968964	2968966	.	+	0	transcript_id "g584.t1"; gene_id "g584";
# protein sequence = [MTDNNGTIPQGQQSPPQTHDREQQLQTPSGEWDTQHLGGIDDPPSLFQSCMSIVLACPDPLPPRRTSSESSPDLPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g584
###
# start gene g585
Scaffold_1	AUGUSTUS	gene	2971364	2973853	0.59	+	.	g585
Scaffold_1	AUGUSTUS	transcript	2971364	2973853	0.59	+	.	g585.t1
Scaffold_1	AUGUSTUS	start_codon	2971364	2971366	.	+	0	transcript_id "g585.t1"; gene_id "g585";
Scaffold_1	AUGUSTUS	CDS	2971364	2973853	0.59	+	0	transcript_id "g585.t1"; gene_id "g585";
Scaffold_1	AUGUSTUS	stop_codon	2973851	2973853	.	+	0	transcript_id "g585.t1"; gene_id "g585";
# protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNPAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ
# GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERVQGGSTDPLTVRQQEKLPERRVSPAV
# SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEV
# LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL
# YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMR
# HMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKH
# SSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSN
# PSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAPFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTAG
# EVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGARVETPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g585
###
# start gene g586
Scaffold_1	AUGUSTUS	gene	2976952	2977380	0.76	+	.	g586
Scaffold_1	AUGUSTUS	transcript	2976952	2977380	0.76	+	.	g586.t1
Scaffold_1	AUGUSTUS	start_codon	2976952	2976954	.	+	0	transcript_id "g586.t1"; gene_id "g586";
Scaffold_1	AUGUSTUS	CDS	2976952	2977380	0.76	+	0	transcript_id "g586.t1"; gene_id "g586";
Scaffold_1	AUGUSTUS	stop_codon	2977378	2977380	.	+	0	transcript_id "g586.t1"; gene_id "g586";
# protein sequence = [MLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYD
# IKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTCDSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g586
###
# start gene g587
Scaffold_1	AUGUSTUS	gene	2979337	2980083	0.99	+	.	g587
Scaffold_1	AUGUSTUS	transcript	2979337	2980083	0.99	+	.	g587.t1
Scaffold_1	AUGUSTUS	start_codon	2979337	2979339	.	+	0	transcript_id "g587.t1"; gene_id "g587";
Scaffold_1	AUGUSTUS	CDS	2979337	2980083	0.99	+	0	transcript_id "g587.t1"; gene_id "g587";
Scaffold_1	AUGUSTUS	stop_codon	2980081	2980083	.	+	0	transcript_id "g587.t1"; gene_id "g587";
# protein sequence = [MAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQEAEVNEYASNLKELHAYLQERIEVANKVYAKYANQKRQEAP
# DWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTVLSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPTSMTNSNARPPRPPNLHKRETEHFVEDILDSKP
# KKGRPEEVEYLVKWEGYNDEFNSWVGWEGMVGSIELLRSWHKHHPRKRQPSRLQWASLEREAREDEEEGSGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g587
###
# start gene g588
Scaffold_1	AUGUSTUS	gene	2980320	2982927	0.58	-	.	g588
Scaffold_1	AUGUSTUS	transcript	2980320	2982927	0.58	-	.	g588.t1
Scaffold_1	AUGUSTUS	stop_codon	2980320	2980322	.	-	0	transcript_id "g588.t1"; gene_id "g588";
Scaffold_1	AUGUSTUS	CDS	2980320	2981451	0.72	-	1	transcript_id "g588.t1"; gene_id "g588";
Scaffold_1	AUGUSTUS	CDS	2981615	2982927	0.58	-	0	transcript_id "g588.t1"; gene_id "g588";
Scaffold_1	AUGUSTUS	start_codon	2982925	2982927	.	-	0	transcript_id "g588.t1"; gene_id "g588";
# protein sequence = [MSAPLRRSSSRTRSPQLPILTTIGEVPSPDLESDGEAEQDQLAFTIEFPSRPQLQLFETVFNTGKPLSGYCQDDPLWP
# LLAEVASPCSNCSKSPAKCKVLPNSPRCTNCSVKKTCSLGKILRYRYFARRCNQDLAYSRRFLELHGTPAHQSTWGIPMVTWRQYDAALHERTSSTST
# LLELNMLDDQDAADVDQQELRDFLALQQEEAAVAAKRKRDLSPLPVAGPSSKKVRSNASKKRPRRRSPVQETAEESPRRVRLVVPPVRSLPVTTSTPL
# PPRAFPSSMEVPDADLSVQGHSNLVRLAAVAGAQSGLVQQPAVSSSIKGTGQDLLSSNMPPVPRPTLVPRALATHPYRAENQRLAARVRLLESQLSDS
# QRENSSLTSALRDTSHALESRQREVEQLRSSSREVREQQVEYRRVLDQFRALDEALPGPPDRVRILLLYQQGVVDESNALATRQRRLVEELQEEVHRA
# RGRAAFVEQMIKEYPDEGYYEVVLPPLSQLEGDLHKAREDLRRVATFAHRLYRSEPATVLHHHYRYLGAIIEAVVAFLRRGLDSDDLDTVVHNFQLGL
# DYMQAARGVHGDMYMRSLSSIQWFFNNAVDEDEGLYRMVLEHSRFDNDGPFLTAAQHAGFAPPPDSSLEPPLHRRMFALSTALPHSDGAGRWDDIVPA
# LPSIDQLTADWEQLMLQYIHHITDTPLPVPDPPVPMSSMGPVPESSGEANVEQSLEAPIVQVSSPSAGSHPPVPLFLSEQESPTSPSPPPCSPVPPLL
# FGSVASLSIDLTGDDDELYETEESYAGRIAVAREGTELAVGQGIVKEESL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g588
###
# start gene g589
Scaffold_1	AUGUSTUS	gene	2992858	2993286	1	+	.	g589
Scaffold_1	AUGUSTUS	transcript	2992858	2993286	1	+	.	g589.t1
Scaffold_1	AUGUSTUS	start_codon	2992858	2992860	.	+	0	transcript_id "g589.t1"; gene_id "g589";
Scaffold_1	AUGUSTUS	CDS	2992858	2993286	1	+	0	transcript_id "g589.t1"; gene_id "g589";
Scaffold_1	AUGUSTUS	stop_codon	2993284	2993286	.	+	0	transcript_id "g589.t1"; gene_id "g589";
# protein sequence = [MEKSIQTAVVSGLSGLNQNVGRLTESLETISKTQSITSQLLSRLEARLDGERSHSQARSSSHFRSMSTNAGHADDTQA
# EGSNQSPASAKGKERMEVDDDDDYEDYEEAEYADGEDQVEEGNTLKKKRKATKTKRALELQVRD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g589
###
# start gene g590
Scaffold_1	AUGUSTUS	gene	2999983	3000561	1	+	.	g590
Scaffold_1	AUGUSTUS	transcript	2999983	3000561	1	+	.	g590.t1
Scaffold_1	AUGUSTUS	start_codon	2999983	2999985	.	+	0	transcript_id "g590.t1"; gene_id "g590";
Scaffold_1	AUGUSTUS	CDS	2999983	3000561	1	+	0	transcript_id "g590.t1"; gene_id "g590";
Scaffold_1	AUGUSTUS	stop_codon	3000559	3000561	.	+	0	transcript_id "g590.t1"; gene_id "g590";
# protein sequence = [MHETESTHDSDNNEEIPRQVLESHNLNARVKTTLIPVEQDNQQRANSINEPLNDVDSDINYFLDVNSSEDQFKKNEKT
# SAKQENERLRRELKGESITTLGFFIDAINPIELKSQMSARIRRDIAEHTHLNVLNRLLIQTRSEYSQNKLSQSAVNETFDNLSSQLRDLADRRLENMP
# VGFGVHIGLNQNIRDR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g590
###
# start gene g591
Scaffold_1	AUGUSTUS	gene	3005848	3007932	0.4	+	.	g591
Scaffold_1	AUGUSTUS	transcript	3005848	3007932	0.4	+	.	g591.t1
Scaffold_1	AUGUSTUS	start_codon	3005848	3005850	.	+	0	transcript_id "g591.t1"; gene_id "g591";
Scaffold_1	AUGUSTUS	CDS	3005848	3007932	0.4	+	0	transcript_id "g591.t1"; gene_id "g591";
Scaffold_1	AUGUSTUS	stop_codon	3007930	3007932	.	+	0	transcript_id "g591.t1"; gene_id "g591";
# protein sequence = [MGNNLDGFVLDLSLQADWDSLERNIRAFLRACMAINRFGVPENFRLWAFPLQYGYKRSYKGRDEARVAAHRSHQAFIP
# LIASVSFFLHLLYHLENEWGNLVEKRKEDPVFTPNPFWSDRQNKMEKERQGPGPSKWEWKEKLRERTSISTEWLAYFHEIMDIPMVGLFLDVHHSGCM
# SLLSVFLETKMPLVLYWGSINDWTIPSMLPSSIPAPNRALVNHLISQQVPYSPPVPAAPPASVAMSNMAKRRLRLPRLDGGTQPREREGVFEFLKRRE
# IDRLRKIASESIKDRQSRLQREENASRNMPPGRKGARVYYWDLVEGVRVRTAVGRNNYEDIWERYGQRQRHYDSVADEWDICTELDPNDEPSYPDDDD
# DDDDYFILAHSTMGEDTAHNLGTASSLAYLARLLPSSGSDERVVFDEPVDDIVVHRFGFAPDGRSTDRQYSCPEKIWNSTLLLIGCGRPPIPPIRDER
# TASQLCTFLHDLMKAGRLQQAPRALDLISIRPALPFEVDVLPAGTTSYFLILPPAASESEAFFLAFTHAATVMEIARRKWGPGTADIIHYLIQHGFSF
# NTLSPYHPLRGYDPQPQRQFPTLGVRHPGFRPGQDEYRSYEYRRDSFLRSVRGRAAILAGGIIARLARGVVDENDVFEGPTNQAIHGVCVSDPRLQVA
# FWDDQLTSDEEDLICGCYEVWTGEVHFK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g591
###
# start gene g592
Scaffold_1	AUGUSTUS	gene	3011320	3011733	0.56	+	.	g592
Scaffold_1	AUGUSTUS	transcript	3011320	3011733	0.56	+	.	g592.t1
Scaffold_1	AUGUSTUS	start_codon	3011320	3011322	.	+	0	transcript_id "g592.t1"; gene_id "g592";
Scaffold_1	AUGUSTUS	CDS	3011320	3011733	0.56	+	0	transcript_id "g592.t1"; gene_id "g592";
Scaffold_1	AUGUSTUS	stop_codon	3011731	3011733	.	+	0	transcript_id "g592.t1"; gene_id "g592";
# protein sequence = [MCTLVTPVLQLIPEDIQVRSIVGTVYNVSAVIGVMAIILLLLPAAWKEELDIPIAKTLLIKHGISKPRPFLDSILATL
# DTGPLDSFSTSSPAASTANGPDPTSIVLTLVSANSVSSDPPSFTTQYSDGQGIWDRIFG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g592
###
# start gene g593
Scaffold_1	AUGUSTUS	gene	3039377	3040159	0.56	+	.	g593
Scaffold_1	AUGUSTUS	transcript	3039377	3040159	0.56	+	.	g593.t1
Scaffold_1	AUGUSTUS	start_codon	3039377	3039379	.	+	0	transcript_id "g593.t1"; gene_id "g593";
Scaffold_1	AUGUSTUS	CDS	3039377	3040159	0.56	+	0	transcript_id "g593.t1"; gene_id "g593";
Scaffold_1	AUGUSTUS	stop_codon	3040157	3040159	.	+	0	transcript_id "g593.t1"; gene_id "g593";
# protein sequence = [MGSVEEEDRVRVATNAVHPHSYTPRPILSPIEFGQESRIDPDGVSRAGQQMYAEQVFKNPGIAPSHSTTSSTSMLKLA
# STSPSVLSASLFGSSSMNHIPVPSLVSLYSIYPVYPNHPIHANPLVTIGQLQSNLMTPTSDPGLAYFNQISHSNPGNLTSFPSPSPGPPTVASASGLT
# SVSASASASPVLPISTETFQRKMHTYIRNIRDFCDGLEYQLQFNDLRMLQELEEKGNGFLEYVKTCLEREGRLKSDQSQDETGA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g593
###
# start gene g594
Scaffold_1	AUGUSTUS	gene	3041170	3042196	0.34	+	.	g594
Scaffold_1	AUGUSTUS	transcript	3041170	3042196	0.34	+	.	g594.t1
Scaffold_1	AUGUSTUS	start_codon	3041170	3041172	.	+	0	transcript_id "g594.t1"; gene_id "g594";
Scaffold_1	AUGUSTUS	CDS	3041170	3041524	0.34	+	0	transcript_id "g594.t1"; gene_id "g594";
Scaffold_1	AUGUSTUS	CDS	3041613	3042196	0.45	+	2	transcript_id "g594.t1"; gene_id "g594";
Scaffold_1	AUGUSTUS	stop_codon	3042194	3042196	.	+	0	transcript_id "g594.t1"; gene_id "g594";
# protein sequence = [MFHIFITFVVDSYIERIEQRDRIQNLIFEPKPIHTAALHAYLNDLFTSTPEATDALETLRSELRSFGDEILSESISDE
# SMVPLIRSLLSRDLLSAEKTAILKSFLDNKVILSEVASVLSQSKVASCQLLPFISSSRAYMDTEIIQALLFQYIGMKWSITMKNAFREFAESRAWKNE
# IDPLSRKQLIRRQQFGVDVPGSEDAGDGNFSGDLWGQEPTPAKPSTGSNTAAPLVGSIQAQRKTLQLKQFFMTQLPDLMEGTAEYDQEPAVDSGGAQK
# PNPGINAQQVLLRLVSTETYLKKILHGSCTIMRADLEW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g594
###
# start gene g595
Scaffold_1	AUGUSTUS	gene	3043076	3043600	0.98	+	.	g595
Scaffold_1	AUGUSTUS	transcript	3043076	3043600	0.98	+	.	g595.t1
Scaffold_1	AUGUSTUS	start_codon	3043076	3043078	.	+	0	transcript_id "g595.t1"; gene_id "g595";
Scaffold_1	AUGUSTUS	CDS	3043076	3043600	0.98	+	0	transcript_id "g595.t1"; gene_id "g595";
Scaffold_1	AUGUSTUS	stop_codon	3043598	3043600	.	+	0	transcript_id "g595.t1"; gene_id "g595";
# protein sequence = [MVSKRFAVKDIPAGWCYFPVSEGGLEIVNPIMHLLTIRDSLASYPDKQFLDCMDEDKSKYGQAKADWVNGAGTRNEHN
# PKSNFMPFEEYVLGREDRLAYWGDKWKYMQEMALPVSPTSPEGYSSYGKPVIEEWIMALYAHEIKTFFGGLKIVEPTLIPVGMLSVFRTAKVAWDS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g595
###
# start gene g596
Scaffold_1	AUGUSTUS	gene	3045840	3046454	0.87	+	.	g596
Scaffold_1	AUGUSTUS	transcript	3045840	3046454	0.87	+	.	g596.t1
Scaffold_1	AUGUSTUS	start_codon	3045840	3045842	.	+	0	transcript_id "g596.t1"; gene_id "g596";
Scaffold_1	AUGUSTUS	CDS	3045840	3046454	0.87	+	0	transcript_id "g596.t1"; gene_id "g596";
Scaffold_1	AUGUSTUS	stop_codon	3046452	3046454	.	+	0	transcript_id "g596.t1"; gene_id "g596";
# protein sequence = [MQGRRRSSESRRELALLDRQQQGRTSDEGNDGDDESETIFVAGEASDSDSDSGQAQKGQFEREERRITLLRLGEAGSS
# SMNVTPAVTNYREDDEDVLDEGAVLVGRPRDEEEGEEDEGMDEHSGGGLSAKAGIILVRSSPQYLALSTYLQNVVMLILSWQHTSQGIHNIFVVIPQF
# LVTGLSSIIFALVDPAKSVLRGSHPGGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g596
###
# start gene g597
Scaffold_1	AUGUSTUS	gene	3051522	3052289	0.3	+	.	g597
Scaffold_1	AUGUSTUS	transcript	3051522	3052289	0.3	+	.	g597.t1
Scaffold_1	AUGUSTUS	start_codon	3051522	3051524	.	+	0	transcript_id "g597.t1"; gene_id "g597";
Scaffold_1	AUGUSTUS	CDS	3051522	3052289	0.3	+	0	transcript_id "g597.t1"; gene_id "g597";
Scaffold_1	AUGUSTUS	stop_codon	3052287	3052289	.	+	0	transcript_id "g597.t1"; gene_id "g597";
# protein sequence = [MSTPPSQSKNTLTVPPGRQRPHSQPAVSSSTASASQSVLLPITDLNHHMWAQPRTQADLHQLQLGHPNRPYYTALRKN
# MSPPSMPLHTASPSPQSAERPLSPSPSSRLSQTSSPAFQPPYPTSFCDDSHEFSIAEFSQFSPLGATTSTPFRPFGVVPSSPSAHDFSPPSRRSSLAL
# SGFRLPSIKGKFRRNSETAFSKSDEMKIRLALARKVGGETGVGGGDEGYVYRGGMTNVKMHMRRLSRGLKDFVMINQRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g597
###
# start gene g598
Scaffold_1	AUGUSTUS	gene	3052525	3053105	1	-	.	g598
Scaffold_1	AUGUSTUS	transcript	3052525	3053105	1	-	.	g598.t1
Scaffold_1	AUGUSTUS	stop_codon	3052525	3052527	.	-	0	transcript_id "g598.t1"; gene_id "g598";
Scaffold_1	AUGUSTUS	CDS	3052525	3052900	1	-	1	transcript_id "g598.t1"; gene_id "g598";
Scaffold_1	AUGUSTUS	CDS	3052963	3053105	1	-	0	transcript_id "g598.t1"; gene_id "g598";
Scaffold_1	AUGUSTUS	start_codon	3053103	3053105	.	-	0	transcript_id "g598.t1"; gene_id "g598";
# protein sequence = [MSLYFYEPSYQWDRFFDNAFGALASRGNQGQSQALTERSDLPRFIRPKMDLHEDKEKNLVTATFEFPGVKKEEIQLDM
# HNGRLTVSAETKVSEEHEQDGYAVRERSVGKFSRTLQLPQGVKVSLGSHLVVHWKIFTTMFQEEEIKASMENGVLTVTFPKATAEEKPKKITIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g598
###
# start gene g599
Scaffold_1	AUGUSTUS	gene	3054287	3055234	0.77	-	.	g599
Scaffold_1	AUGUSTUS	transcript	3054287	3055234	0.77	-	.	g599.t1
Scaffold_1	AUGUSTUS	stop_codon	3054287	3054289	.	-	0	transcript_id "g599.t1"; gene_id "g599";
Scaffold_1	AUGUSTUS	CDS	3054287	3055234	0.77	-	0	transcript_id "g599.t1"; gene_id "g599";
Scaffold_1	AUGUSTUS	start_codon	3055232	3055234	.	-	0	transcript_id "g599.t1"; gene_id "g599";
# protein sequence = [MERLCSLTIADRPEVSSSVYARIFNQAKNLIDLRFCDTPSRYALYPGFSETTSFVFPALRSLEISSREIVAHRLSFLQ
# CLTAPCLDQLTIRHSGYHLGHCCTDIKAFLQRSNTALSSLTLHQFSDEWGSEVSADLIAILRVLPTITSFRIDSCLFNLDELLEKMVYSSYQGSALLL
# PKLTHFEISYEKDIENWPWKLTEMIFSRADAAEKGEVAETPDWGSTEISRLQKVTLHGLNGPDKDIARISSLLGLGFIYKKKEQDSESKSLLGFADAP
# GEKKEEEDEDKEEGDEEEDEDEDDDDDEENTFNDPYWSSDS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g599
###
# start gene g600
Scaffold_1	AUGUSTUS	gene	3057544	3058488	0.34	-	.	g600
Scaffold_1	AUGUSTUS	transcript	3057544	3058488	0.34	-	.	g600.t1
Scaffold_1	AUGUSTUS	stop_codon	3057544	3057546	.	-	0	transcript_id "g600.t1"; gene_id "g600";
Scaffold_1	AUGUSTUS	CDS	3057544	3057950	0.6	-	2	transcript_id "g600.t1"; gene_id "g600";
Scaffold_1	AUGUSTUS	CDS	3058006	3058256	0.61	-	1	transcript_id "g600.t1"; gene_id "g600";
Scaffold_1	AUGUSTUS	CDS	3058316	3058488	0.34	-	0	transcript_id "g600.t1"; gene_id "g600";
Scaffold_1	AUGUSTUS	start_codon	3058486	3058488	.	-	0	transcript_id "g600.t1"; gene_id "g600";
# protein sequence = [MIVFDISNIRCFNRCTYAREILEKCDSSVLRPRNAVYMAEIGAQESPVVGAHLKNAVKYQKDIDAFVHVIQGALQPVS
# IPVSDTHQSTLGGNSWTPPINSKQNQLVICGQNPQQSREDNLGATAVTRAREVWLLTGLVPVVTTPHSEETTSSPIPRNELDSLLARARDFVKVDSTV
# FDKSIRHTTVKDILTTSFPNRNIRSIPLAVQPHSKAESGFVTWSGSDTVLGDIINDPRFTIASEHRVTQLIVHPSFPGTVAGVLMRDLKTDRDVLVHA
# RV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g600
###
# start gene g601
Scaffold_1	AUGUSTUS	gene	3061144	3061986	0.75	+	.	g601
Scaffold_1	AUGUSTUS	transcript	3061144	3061986	0.75	+	.	g601.t1
Scaffold_1	AUGUSTUS	start_codon	3061144	3061146	.	+	0	transcript_id "g601.t1"; gene_id "g601";
Scaffold_1	AUGUSTUS	CDS	3061144	3061441	0.82	+	0	transcript_id "g601.t1"; gene_id "g601";
Scaffold_1	AUGUSTUS	CDS	3061481	3061610	0.86	+	2	transcript_id "g601.t1"; gene_id "g601";
Scaffold_1	AUGUSTUS	CDS	3061710	3061986	0.81	+	1	transcript_id "g601.t1"; gene_id "g601";
Scaffold_1	AUGUSTUS	stop_codon	3061984	3061986	.	+	0	transcript_id "g601.t1"; gene_id "g601";
# protein sequence = [MKPLYFVTVLTDNNLYLGLPRQSRLGLRQGKNAPPGEIANAKWTRHVLHDFGSLNPRHEGSIHHVICADIDGDGVDEL
# LVACMGSNPPSWERTGVWCYKHIRLMANFALQLWISNLASFPGSSCPMIQPHGLLWVISDRATFCPSVILHASSLITAKRLNDEVVFRVPRPQNTKLA
# DEVAFLDVASRKLSLVVVPPLTQYKIQGGAGLKVLAGRGMLEPSYVIIILIATTSIRM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g601
###
# start gene g602
Scaffold_1	AUGUSTUS	gene	3068747	3069364	0.74	+	.	g602
Scaffold_1	AUGUSTUS	transcript	3068747	3069364	0.74	+	.	g602.t1
Scaffold_1	AUGUSTUS	start_codon	3068747	3068749	.	+	0	transcript_id "g602.t1"; gene_id "g602";
Scaffold_1	AUGUSTUS	CDS	3068747	3069364	0.74	+	0	transcript_id "g602.t1"; gene_id "g602";
Scaffold_1	AUGUSTUS	stop_codon	3069362	3069364	.	+	0	transcript_id "g602.t1"; gene_id "g602";
# protein sequence = [MDRSQIARFWKGTRANEINSGSSVKQDSVGRKFPTFFKGPLKEVESQHLQDIKKQHRIAADIFFWLQSFQSNLSIQRV
# VVQAIHGMFTENQEVELYIHQLKQYSISITQLMWNTVWKLNKKDIDDYKLWPQVTLLWVDYMAKEMSWRKLPITLPDNAWTHAISFNKSMVVRIMIDI
# QQRCNLKVIQDNDWKDTALYQAAQKVTLM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g602
###
# start gene g603
Scaffold_1	AUGUSTUS	gene	3071089	3072699	0.93	-	.	g603
Scaffold_1	AUGUSTUS	transcript	3071089	3072699	0.93	-	.	g603.t1
Scaffold_1	AUGUSTUS	stop_codon	3071089	3071091	.	-	0	transcript_id "g603.t1"; gene_id "g603";
Scaffold_1	AUGUSTUS	CDS	3071089	3072699	0.93	-	0	transcript_id "g603.t1"; gene_id "g603";
Scaffold_1	AUGUSTUS	start_codon	3072697	3072699	.	-	0	transcript_id "g603.t1"; gene_id "g603";
# protein sequence = [MQANYGGTEIPNALDAVFASLPSRLTRPVSIFLLTDGGVWGSLLIQCVTKIESTIASRSSDKSFLRVYTIGIGDGVST
# ETCDRIARAGAGTSTYIVSDNEQYIGKCTRLVRAARTPPIVDIEVTWVTPKENASHDATGQVIDLFDAEVSYDDEECGGVGPLAPILQAPDPVPSFYR
# STRTQVYAIVPDSIAVTKEIKISGRIPVTGASVALTIPVQRFSPFAPFPASPGGIGTGTAFLHTLAAKALIQDREDWEDSGNGPAGKPSVASLKEDIT
# RLGIDYKLTSRYTSLIAVDRRNQNVLGMGYYSAPGAKKPKKNIVAEREGSFIPSFQARSLAHATFSSTPGGIGRAGADTATEALIILARLQNFDGSFD
# ESSSKFDIEGLYSELGVDLGTGTETETEIKSIVDKFVSDTESEKGQVVYITLLAWAFMAVQSKSNAKAGEAFYDVKDKADVWLKENLKGSGAAGSDVD
# VDELKRQFLDKVASLGHGGETYGHGEFDEYVDSDEDDFDFDLSLDLEEEGGFALGGEGVGLVEVVN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g603
###
# start gene g604
Scaffold_1	AUGUSTUS	gene	3073531	3074037	1	-	.	g604
Scaffold_1	AUGUSTUS	transcript	3073531	3074037	1	-	.	g604.t1
Scaffold_1	AUGUSTUS	stop_codon	3073531	3073533	.	-	0	transcript_id "g604.t1"; gene_id "g604";
Scaffold_1	AUGUSTUS	CDS	3073531	3074037	1	-	0	transcript_id "g604.t1"; gene_id "g604";
Scaffold_1	AUGUSTUS	start_codon	3074035	3074037	.	-	0	transcript_id "g604.t1"; gene_id "g604";
# protein sequence = [MTRCETRPPPPCAIPTPPPACPPVALPPVTSPPVARPPVTGPPAANPPGARPPVTNPPGSRPPTTSPPSSNLPLVLRE
# CNIKVWIVDVHSWVTLSQQFQNPSSSVATHVTYTFSMLAGAAIYGFQIVRQDGTKVDGVVKQKDEAQKEMDIAVSEGLTAALGQEVTKDG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g604
###
# start gene g605
Scaffold_1	AUGUSTUS	gene	3080018	3080647	0.98	+	.	g605
Scaffold_1	AUGUSTUS	transcript	3080018	3080647	0.98	+	.	g605.t1
Scaffold_1	AUGUSTUS	start_codon	3080018	3080020	.	+	0	transcript_id "g605.t1"; gene_id "g605";
Scaffold_1	AUGUSTUS	CDS	3080018	3080647	0.98	+	0	transcript_id "g605.t1"; gene_id "g605";
Scaffold_1	AUGUSTUS	stop_codon	3080645	3080647	.	+	0	transcript_id "g605.t1"; gene_id "g605";
# protein sequence = [MSPLASSRLSSICLVLIHLLSFCVIASPLASSSLAAANPSATSTPAHPLTVDPAFLSTPGPVLPAGASSNDINLWYDG
# EDARLYIGSTFFSVNDQMERQVKVSMVPGTNEGIMRKVGTVVFPSADVKSQVFAILQTCGFKSMNPKKPQTARGHYFMSVIKKLVDTSKRNSIPVTGE
# NGNDVKMVLESLLRDNEFLGKTRKKQGNRYTPY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g605
###
# start gene g606
Scaffold_1	AUGUSTUS	gene	3099872	3100969	0.47	+	.	g606
Scaffold_1	AUGUSTUS	transcript	3099872	3100969	0.47	+	.	g606.t1
Scaffold_1	AUGUSTUS	start_codon	3099872	3099874	.	+	0	transcript_id "g606.t1"; gene_id "g606";
Scaffold_1	AUGUSTUS	CDS	3099872	3100330	0.75	+	0	transcript_id "g606.t1"; gene_id "g606";
Scaffold_1	AUGUSTUS	CDS	3100385	3100430	0.47	+	0	transcript_id "g606.t1"; gene_id "g606";
Scaffold_1	AUGUSTUS	CDS	3100554	3100969	0.71	+	2	transcript_id "g606.t1"; gene_id "g606";
Scaffold_1	AUGUSTUS	stop_codon	3100967	3100969	.	+	0	transcript_id "g606.t1"; gene_id "g606";
# protein sequence = [MSVSRTTTTTTRTSSTAGPSRSRPVAPLPADTSVHEEEGLEDEDEDEIIQRAQARVERVRARKVAAAAKKAAEEKAAR
# AAAARERAAQEVQEQALWARQQEEEVVERRRLLAEVATARSQRGTLPSEMSVSPRRPVVEIRREKGKGRAKVPAQPVGGDPDDGDEEKEPLKREGGSS
# EQIAIMESQMAQSLANLRALREANSKSHQYLRQLLRRQEDDHARLIAMETKMVMKGMGEGPATAGLSSRRTERRQLLKRRRIVEESAEEEEEEEEKEV
# EKKEDKVEKDGEGEEEMAPTEAQSEKGKERAE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g606
###
# start gene g607
Scaffold_1	AUGUSTUS	gene	3102081	3104436	0.22	+	.	g607
Scaffold_1	AUGUSTUS	transcript	3102081	3104436	0.22	+	.	g607.t1
Scaffold_1	AUGUSTUS	start_codon	3102081	3102083	.	+	0	transcript_id "g607.t1"; gene_id "g607";
Scaffold_1	AUGUSTUS	CDS	3102081	3102096	0.31	+	0	transcript_id "g607.t1"; gene_id "g607";
Scaffold_1	AUGUSTUS	CDS	3103100	3104436	0.6	+	2	transcript_id "g607.t1"; gene_id "g607";
Scaffold_1	AUGUSTUS	stop_codon	3104434	3104436	.	+	0	transcript_id "g607.t1"; gene_id "g607";
# protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI
# SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS
# AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL
# VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD
# NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQWLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g607
###
# start gene g608
Scaffold_1	AUGUSTUS	gene	3105076	3106529	0.65	+	.	g608
Scaffold_1	AUGUSTUS	transcript	3105076	3106529	0.65	+	.	g608.t1
Scaffold_1	AUGUSTUS	start_codon	3105076	3105078	.	+	0	transcript_id "g608.t1"; gene_id "g608";
Scaffold_1	AUGUSTUS	CDS	3105076	3105820	0.65	+	0	transcript_id "g608.t1"; gene_id "g608";
Scaffold_1	AUGUSTUS	CDS	3105871	3106529	0.84	+	2	transcript_id "g608.t1"; gene_id "g608";
Scaffold_1	AUGUSTUS	stop_codon	3106527	3106529	.	+	0	transcript_id "g608.t1"; gene_id "g608";
# protein sequence = [MKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLK
# KPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD
# LSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQRILQKDIVESFLRDLSIDDERRNIAIVA
# NQSVAYEDHSDHPVVVANQSNGLRAVTPEINKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQ
# LHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g608
###
# start gene g609
Scaffold_1	AUGUSTUS	gene	3107140	3108175	0.32	+	.	g609
Scaffold_1	AUGUSTUS	transcript	3107140	3108175	0.32	+	.	g609.t1
Scaffold_1	AUGUSTUS	start_codon	3107140	3107142	.	+	0	transcript_id "g609.t1"; gene_id "g609";
Scaffold_1	AUGUSTUS	CDS	3107140	3107452	0.32	+	0	transcript_id "g609.t1"; gene_id "g609";
Scaffold_1	AUGUSTUS	CDS	3107553	3108175	0.57	+	2	transcript_id "g609.t1"; gene_id "g609";
Scaffold_1	AUGUSTUS	stop_codon	3108173	3108175	.	+	0	transcript_id "g609.t1"; gene_id "g609";
# protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPILPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC
# VIKKNGKSLRLVHSLEPLNKVTIQHSDQLSKDMTMFQTLYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGY
# ETIPENPGIRRFVWEHFQNMNRVMQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFA
# KKAAPLTKLTSNVPFEWNEKCDKAMDELRMESETVQL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g609
###
# start gene g610
Scaffold_1	AUGUSTUS	gene	3109560	3110030	0.99	+	.	g610
Scaffold_1	AUGUSTUS	transcript	3109560	3110030	0.99	+	.	g610.t1
Scaffold_1	AUGUSTUS	start_codon	3109560	3109562	.	+	0	transcript_id "g610.t1"; gene_id "g610";
Scaffold_1	AUGUSTUS	CDS	3109560	3110030	0.99	+	0	transcript_id "g610.t1"; gene_id "g610";
Scaffold_1	AUGUSTUS	stop_codon	3110028	3110030	.	+	0	transcript_id "g610.t1"; gene_id "g610";
# protein sequence = [MLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDISKWFYFLKIYRVTPRRGLGCSPYFLVTGAEPL
# LPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANNVAELRRFEQKYRHTIKDWDFKTRSISTG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g610
###
# start gene g611
Scaffold_1	AUGUSTUS	gene	3112942	3113292	0.81	+	.	g611
Scaffold_1	AUGUSTUS	transcript	3112942	3113292	0.81	+	.	g611.t1
Scaffold_1	AUGUSTUS	start_codon	3112942	3112944	.	+	0	transcript_id "g611.t1"; gene_id "g611";
Scaffold_1	AUGUSTUS	CDS	3112942	3113292	0.81	+	0	transcript_id "g611.t1"; gene_id "g611";
Scaffold_1	AUGUSTUS	stop_codon	3113290	3113292	.	+	0	transcript_id "g611.t1"; gene_id "g611";
# protein sequence = [MSSKTAHTEKPPAATVDVEDIWKQSAKTNSWDSDETEADASNLDANRYPLRDPRHSPYSQTNPSNRVLDPNICSCTVA
# ATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g611
###
# start gene g612
Scaffold_1	AUGUSTUS	gene	3115035	3115439	0.77	+	.	g612
Scaffold_1	AUGUSTUS	transcript	3115035	3115439	0.77	+	.	g612.t1
Scaffold_1	AUGUSTUS	start_codon	3115035	3115037	.	+	0	transcript_id "g612.t1"; gene_id "g612";
Scaffold_1	AUGUSTUS	CDS	3115035	3115439	0.77	+	0	transcript_id "g612.t1"; gene_id "g612";
Scaffold_1	AUGUSTUS	stop_codon	3115437	3115439	.	+	0	transcript_id "g612.t1"; gene_id "g612";
# protein sequence = [MDTQQQAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREM
# LAIIEALKDWRNFWRDYPSHLTSSLITLTSNFGAQLKTSPAAKLAGLYTFHGLTST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g612
###
# start gene g613
Scaffold_1	AUGUSTUS	gene	3124029	3124301	0.71	-	.	g613
Scaffold_1	AUGUSTUS	transcript	3124029	3124301	0.71	-	.	g613.t1
Scaffold_1	AUGUSTUS	stop_codon	3124029	3124031	.	-	0	transcript_id "g613.t1"; gene_id "g613";
Scaffold_1	AUGUSTUS	CDS	3124029	3124301	0.71	-	0	transcript_id "g613.t1"; gene_id "g613";
Scaffold_1	AUGUSTUS	start_codon	3124299	3124301	.	-	0	transcript_id "g613.t1"; gene_id "g613";
# protein sequence = [MRARNASLVSPPIEVDGEEEYNVAKILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELVPANELASFLCERE
# RKESNGHSNQPI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g613
###
# start gene g614
Scaffold_1	AUGUSTUS	gene	3124426	3125856	0.92	+	.	g614
Scaffold_1	AUGUSTUS	transcript	3124426	3125856	0.92	+	.	g614.t1
Scaffold_1	AUGUSTUS	start_codon	3124426	3124428	.	+	0	transcript_id "g614.t1"; gene_id "g614";
Scaffold_1	AUGUSTUS	CDS	3124426	3125856	0.92	+	0	transcript_id "g614.t1"; gene_id "g614";
Scaffold_1	AUGUSTUS	stop_codon	3125854	3125856	.	+	0	transcript_id "g614.t1"; gene_id "g614";
# protein sequence = [MGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLDRANAMSS
# SSSGFQQGFLKRVPASAAPRVPRNQFVMFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPL
# HKPIDVFNIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTET
# PILELPELEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYR
# DFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVK
# NRYPLP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g614
###
# start gene g615
Scaffold_1	AUGUSTUS	gene	3126002	3128428	0.63	+	.	g615
Scaffold_1	AUGUSTUS	transcript	3126002	3128428	0.63	+	.	g615.t1
Scaffold_1	AUGUSTUS	start_codon	3126002	3126004	.	+	0	transcript_id "g615.t1"; gene_id "g615";
Scaffold_1	AUGUSTUS	CDS	3126002	3128428	0.63	+	0	transcript_id "g615.t1"; gene_id "g615";
Scaffold_1	AUGUSTUS	stop_codon	3128426	3128428	.	+	0	transcript_id "g615.t1"; gene_id "g615";
# protein sequence = [MFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEY
# LGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPT
# RIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYL
# SRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDN
# GLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLIT
# QLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQE
# VEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRK
# AHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEE
# ILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g615
###
# start gene g616
Scaffold_1	AUGUSTUS	gene	3129251	3131547	0.51	-	.	g616
Scaffold_1	AUGUSTUS	transcript	3129251	3131547	0.51	-	.	g616.t1
Scaffold_1	AUGUSTUS	stop_codon	3129251	3129253	.	-	0	transcript_id "g616.t1"; gene_id "g616";
Scaffold_1	AUGUSTUS	CDS	3129251	3130288	0.99	-	0	transcript_id "g616.t1"; gene_id "g616";
Scaffold_1	AUGUSTUS	CDS	3131536	3131547	0.69	-	0	transcript_id "g616.t1"; gene_id "g616";
Scaffold_1	AUGUSTUS	start_codon	3131545	3131547	.	-	0	transcript_id "g616.t1"; gene_id "g616";
# protein sequence = [MTIHIGWLECPLDSFLSLSHKNEASSLPPPHFDLDTGDHDDQDPPVDPDDPGADNDNDNLDDDSGSLPRGEPGDPSGP
# GGPGGPCSPISPDIPNEQCAMLELLLEFKGSIKTLSTVLAALGHPSDSSESKSKVKEPEVFDGSDPQKLKMFFVNLALVFNDCPKYFTDQRKVNYTLS
# YLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNSGVYDTQGEAEDSLGNLKMKEIENIRFNTLAVSAKWDSAALKWAYGRGLAEHIKDEMAH
# LPKLVMLADYCQEVLCIDNRYWKREAGKPFIAWTSKLVLLTSKTTLSHLALRRHSCRSLNLSLEVNLTMVSPRTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g616
###
# start gene g617
Scaffold_1	AUGUSTUS	gene	3133303	3133878	1	+	.	g617
Scaffold_1	AUGUSTUS	transcript	3133303	3133878	1	+	.	g617.t1
Scaffold_1	AUGUSTUS	start_codon	3133303	3133305	.	+	0	transcript_id "g617.t1"; gene_id "g617";
Scaffold_1	AUGUSTUS	CDS	3133303	3133878	1	+	0	transcript_id "g617.t1"; gene_id "g617";
Scaffold_1	AUGUSTUS	stop_codon	3133876	3133878	.	+	0	transcript_id "g617.t1"; gene_id "g617";
# protein sequence = [MSFGSDPESFLEYALSLPDPVGPDPETSDSSDQSSPSDHNSEQESVQSGTNSDPDQSSYDSEFPGPFDYDYLHQSSDF
# DSDHPGPYDLRYLHSYPSSSASDSVESFHSFTSDNSEAPELRPGDDGSGHPHLGPDGRLLDSERERRRVLGLCFYCGGEHMKIDCLKLQARTGQNYDA
# DNSESDVPGSDDGSE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g617
###
# start gene g618
Scaffold_1	AUGUSTUS	gene	3136082	3138041	0.36	+	.	g618
Scaffold_1	AUGUSTUS	transcript	3136082	3138041	0.36	+	.	g618.t1
Scaffold_1	AUGUSTUS	start_codon	3136082	3136084	.	+	0	transcript_id "g618.t1"; gene_id "g618";
Scaffold_1	AUGUSTUS	CDS	3136082	3136289	0.49	+	0	transcript_id "g618.t1"; gene_id "g618";
Scaffold_1	AUGUSTUS	CDS	3136348	3136752	0.72	+	2	transcript_id "g618.t1"; gene_id "g618";
Scaffold_1	AUGUSTUS	CDS	3137494	3138041	0.97	+	2	transcript_id "g618.t1"; gene_id "g618";
Scaffold_1	AUGUSTUS	stop_codon	3138039	3138041	.	+	0	transcript_id "g618.t1"; gene_id "g618";
# protein sequence = [MRMVSSKDLDVFASLRGKESSAVALKATTSSPPLEIQSSTSVSKAFVAPPRLIRRNRELENLKADASSFLASLRSAHS
# KDSDNELLSGFPSAGSAPVASSSTKVSIGKGEPKSKTTVKVVEDSKADRPLPAGMAYKRIRLPPRSRKILRLPQKEKRDKSLSLTRAQTSNEVESEDE
# AEDEDIAPPPKRLKTTSSIFLEFLFFIFHLAISLRRAIDLNDQLKQLESLFDSTRDLFLRSVLDLQNAGEDPIVVLEALKAAEPNRRAISLNEWTLMA
# TLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGASSQVGGSIPMELDLPAIESLAEP
# ALSPEKGAEPAQTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g618
###
# start gene g619
Scaffold_1	AUGUSTUS	gene	3139987	3140509	0.25	+	.	g619
Scaffold_1	AUGUSTUS	transcript	3139987	3140509	0.25	+	.	g619.t1
Scaffold_1	AUGUSTUS	start_codon	3139987	3139989	.	+	0	transcript_id "g619.t1"; gene_id "g619";
Scaffold_1	AUGUSTUS	CDS	3139987	3140005	0.25	+	0	transcript_id "g619.t1"; gene_id "g619";
Scaffold_1	AUGUSTUS	CDS	3140082	3140509	0.99	+	2	transcript_id "g619.t1"; gene_id "g619";
Scaffold_1	AUGUSTUS	stop_codon	3140507	3140509	.	+	0	transcript_id "g619.t1"; gene_id "g619";
# protein sequence = [MFLLTVLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSI
# LKSRQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g619
###
# start gene g620
Scaffold_1	AUGUSTUS	gene	3140959	3143235	0.88	-	.	g620
Scaffold_1	AUGUSTUS	transcript	3140959	3143235	0.88	-	.	g620.t1
Scaffold_1	AUGUSTUS	stop_codon	3140959	3140961	.	-	0	transcript_id "g620.t1"; gene_id "g620";
Scaffold_1	AUGUSTUS	CDS	3140959	3143235	0.88	-	0	transcript_id "g620.t1"; gene_id "g620";
Scaffold_1	AUGUSTUS	start_codon	3143233	3143235	.	-	0	transcript_id "g620.t1"; gene_id "g620";
# protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL
# RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP
# NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD
# IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIEKYLSNPSDESLGEMSKDERIKFIRLIK
# KFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQ
# KVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKI
# ERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVR
# RRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g620
###
# start gene g621
Scaffold_1	AUGUSTUS	gene	3143349	3145825	0.26	-	.	g621
Scaffold_1	AUGUSTUS	transcript	3143349	3145825	0.26	-	.	g621.t1
Scaffold_1	AUGUSTUS	stop_codon	3143349	3143351	.	-	0	transcript_id "g621.t1"; gene_id "g621";
Scaffold_1	AUGUSTUS	CDS	3143349	3144708	0.98	-	1	transcript_id "g621.t1"; gene_id "g621";
Scaffold_1	AUGUSTUS	CDS	3144801	3145041	0.33	-	2	transcript_id "g621.t1"; gene_id "g621";
Scaffold_1	AUGUSTUS	CDS	3145156	3145825	0.46	-	0	transcript_id "g621.t1"; gene_id "g621";
Scaffold_1	AUGUSTUS	start_codon	3145823	3145825	.	-	0	transcript_id "g621.t1"; gene_id "g621";
# protein sequence = [MFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDE
# EIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSE
# ITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDK
# QVFCVWRDGVLGEFDDQLNNEQFNLNPIKSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKV
# RYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDE
# FRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVER
# NIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELD
# QLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKDHQLDMNYQKEVTKLFQKILELDDLFGNISKT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g621
###
# start gene g622
Scaffold_1	AUGUSTUS	gene	3146081	3146545	0.63	-	.	g622
Scaffold_1	AUGUSTUS	transcript	3146081	3146545	0.63	-	.	g622.t1
Scaffold_1	AUGUSTUS	stop_codon	3146081	3146083	.	-	0	transcript_id "g622.t1"; gene_id "g622";
Scaffold_1	AUGUSTUS	CDS	3146081	3146545	0.63	-	0	transcript_id "g622.t1"; gene_id "g622";
Scaffold_1	AUGUSTUS	start_codon	3146543	3146545	.	-	0	transcript_id "g622.t1"; gene_id "g622";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINTNIDHMIMFNLGRIVLFKLIHLRRYQETRRIKLIVMDILQPIKLGMKSRDQV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g622
###
# start gene g623
Scaffold_1	AUGUSTUS	gene	3146575	3149564	0.3	-	.	g623
Scaffold_1	AUGUSTUS	transcript	3146575	3149564	0.3	-	.	g623.t1
Scaffold_1	AUGUSTUS	stop_codon	3146575	3146577	.	-	0	transcript_id "g623.t1"; gene_id "g623";
Scaffold_1	AUGUSTUS	CDS	3146575	3148544	0.5	-	2	transcript_id "g623.t1"; gene_id "g623";
Scaffold_1	AUGUSTUS	CDS	3149549	3149564	0.34	-	0	transcript_id "g623.t1"; gene_id "g623";
Scaffold_1	AUGUSTUS	start_codon	3149562	3149564	.	-	0	transcript_id "g623.t1"; gene_id "g623";
# protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI
# SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS
# AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL
# VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD
# NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ
# SHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLR
# DNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g623
###
# start gene g624
Scaffold_1	AUGUSTUS	gene	3152807	3153986	0.85	+	.	g624
Scaffold_1	AUGUSTUS	transcript	3152807	3153986	0.85	+	.	g624.t1
Scaffold_1	AUGUSTUS	start_codon	3152807	3152809	.	+	0	transcript_id "g624.t1"; gene_id "g624";
Scaffold_1	AUGUSTUS	CDS	3152807	3153028	0.88	+	0	transcript_id "g624.t1"; gene_id "g624";
Scaffold_1	AUGUSTUS	CDS	3153084	3153986	0.95	+	0	transcript_id "g624.t1"; gene_id "g624";
Scaffold_1	AUGUSTUS	stop_codon	3153984	3153986	.	+	0	transcript_id "g624.t1"; gene_id "g624";
# protein sequence = [MEGDLRDAVRERKVAEEKLSSSTRKSSQLTTTLLYQQGRVDESNALATRQRRLVEELQEEVHRARDRAAFVEQMLEGD
# LNKAREDLRRVATLAHRLHCSDPATVLHHHHRYIGAIIEAVVAFLRRGLESEDPDIATHNLHLALDYMQAARGVHGDLYIRSISSIQWFFNNAVDEDE
# GLYRLVLEHSRFDNDSPFLTAAQHAGFAPPPDNSLEPPLHRRMLALSTALPHSDGVGRWDDLVPALPSVDQLTVDWEQLMLRYIHHITDVPLSGTDTQ
# VPMSSVEPGTESLAEVTVEQLPEAPPLFLPEQESPTSPSPPPTSPTLPPPFASLANLTIDLTGDDDDLYETEESRMARVSMSREVVDSVAVQSVVKEE
# PL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g624
###
# start gene g625
Scaffold_1	AUGUSTUS	gene	3154264	3157128	0.65	-	.	g625
Scaffold_1	AUGUSTUS	transcript	3154264	3157128	0.65	-	.	g625.t1
Scaffold_1	AUGUSTUS	stop_codon	3154264	3154266	.	-	0	transcript_id "g625.t1"; gene_id "g625";
Scaffold_1	AUGUSTUS	CDS	3154264	3156671	0.97	-	2	transcript_id "g625.t1"; gene_id "g625";
Scaffold_1	AUGUSTUS	CDS	3156993	3157128	0.65	-	0	transcript_id "g625.t1"; gene_id "g625";
Scaffold_1	AUGUSTUS	start_codon	3157126	3157128	.	-	0	transcript_id "g625.t1"; gene_id "g625";
# protein sequence = [MSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTATLHDEESHVEHVRKVLERLRANHLHAKPEKCAFHV
# DTVEYLGVIISPLGVSMDPEKVKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYN
# PDLPVVLECDASDLAIAGILSQLDPKRGRYILSPSMHVNDLAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQAR
# WAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALKRIARNEEESFVW
# EDGLIKRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLD
# HITQLPATAGPEKYDAILVVVCRLTKQAIYVPCHTTDKAEDFANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQT
# ERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKAYAKYAN
# QKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTILSKVGSRAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFV
# EDILDSKPKKGRPEEVEYLVKWEGYNDEFNSWVGWEGMVGSIELLRSWHKHHPRKRQPSRLQWASLEREAREDEEEDREGRRE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g625
###
# start gene g626
Scaffold_1	AUGUSTUS	gene	3159411	3160646	0.81	-	.	g626
Scaffold_1	AUGUSTUS	transcript	3159411	3160646	0.81	-	.	g626.t1
Scaffold_1	AUGUSTUS	stop_codon	3159411	3159413	.	-	0	transcript_id "g626.t1"; gene_id "g626";
Scaffold_1	AUGUSTUS	CDS	3159411	3160646	0.81	-	0	transcript_id "g626.t1"; gene_id "g626";
Scaffold_1	AUGUSTUS	start_codon	3160644	3160646	.	-	0	transcript_id "g626.t1"; gene_id "g626";
# protein sequence = [MREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPE
# GGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRG
# ELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKD
# KCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKG
# VAPGCLYRLLPEGRNLDPTTSGPECSRSWTELYVRKRRV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g626
###
# start gene g627
Scaffold_1	AUGUSTUS	gene	3162376	3163005	0.98	-	.	g627
Scaffold_1	AUGUSTUS	transcript	3162376	3163005	0.98	-	.	g627.t1
Scaffold_1	AUGUSTUS	stop_codon	3162376	3162378	.	-	0	transcript_id "g627.t1"; gene_id "g627";
Scaffold_1	AUGUSTUS	CDS	3162376	3163005	0.98	-	0	transcript_id "g627.t1"; gene_id "g627";
Scaffold_1	AUGUSTUS	start_codon	3163003	3163005	.	-	0	transcript_id "g627.t1"; gene_id "g627";
# protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ
# GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY
# PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g627
###
# start gene g628
Scaffold_1	AUGUSTUS	gene	3165216	3166202	0.38	+	.	g628
Scaffold_1	AUGUSTUS	transcript	3165216	3166202	0.38	+	.	g628.t1
Scaffold_1	AUGUSTUS	start_codon	3165216	3165218	.	+	0	transcript_id "g628.t1"; gene_id "g628";
Scaffold_1	AUGUSTUS	CDS	3165216	3165266	1	+	0	transcript_id "g628.t1"; gene_id "g628";
Scaffold_1	AUGUSTUS	CDS	3165316	3165601	0.38	+	0	transcript_id "g628.t1"; gene_id "g628";
Scaffold_1	AUGUSTUS	CDS	3165958	3166202	0.93	+	2	transcript_id "g628.t1"; gene_id "g628";
Scaffold_1	AUGUSTUS	stop_codon	3166200	3166202	.	+	0	transcript_id "g628.t1"; gene_id "g628";
# protein sequence = [MDGTPGAVEARWDSVSEAESVRLTSESGKISIQNQLSVYGYRGEMWADITYYHSSATPTSNIMVTQQLQRQAQKQEVR
# GQAPVIDILTTIVRNTHASSANVEMKPCPSSWDAAQEAEKGQNQRFGDTAMEHAYDAGVFNREYEQDPTAILARRCSALDKVQYAEWADQLKDYAANG
# TVVESSDGLDLGSGYNN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g628
###
# start gene g629
Scaffold_1	AUGUSTUS	gene	3170512	3171247	0.34	-	.	g629
Scaffold_1	AUGUSTUS	transcript	3170512	3171247	0.34	-	.	g629.t1
Scaffold_1	AUGUSTUS	stop_codon	3170512	3170514	.	-	0	transcript_id "g629.t1"; gene_id "g629";
Scaffold_1	AUGUSTUS	CDS	3170512	3170905	0.37	-	1	transcript_id "g629.t1"; gene_id "g629";
Scaffold_1	AUGUSTUS	CDS	3171024	3171247	0.34	-	0	transcript_id "g629.t1"; gene_id "g629";
Scaffold_1	AUGUSTUS	start_codon	3171245	3171247	.	-	0	transcript_id "g629.t1"; gene_id "g629";
# protein sequence = [MDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTYDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAIYC
# SYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMRSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFLIGSE
# VFVLAKHIRSTRPTEKFSEKYLGPFKVIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g629
###
# start gene g630
Scaffold_1	AUGUSTUS	gene	3172552	3173241	0.98	-	.	g630
Scaffold_1	AUGUSTUS	transcript	3172552	3173241	0.98	-	.	g630.t1
Scaffold_1	AUGUSTUS	stop_codon	3172552	3172554	.	-	0	transcript_id "g630.t1"; gene_id "g630";
Scaffold_1	AUGUSTUS	CDS	3172552	3173241	0.98	-	0	transcript_id "g630.t1"; gene_id "g630";
Scaffold_1	AUGUSTUS	start_codon	3173239	3173241	.	-	0	transcript_id "g630.t1"; gene_id "g630";
# protein sequence = [MEPILLRAIHSEVAARAADRSSTAPTVPPLHHSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGAFAAPRRIYP
# LSEKELVALKDFIDKQLATGAITPSSSPHSAPAFLMKTANFALRRISVDSIVSPKRIVTHSHSYQIFSTLPKRAKIYTKLDLAHIIISSESLKVTNGK
# PPFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDISDLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g630
###
# start gene g631
Scaffold_1	AUGUSTUS	gene	3178589	3179146	0.73	+	.	g631
Scaffold_1	AUGUSTUS	transcript	3178589	3179146	0.73	+	.	g631.t1
Scaffold_1	AUGUSTUS	start_codon	3178589	3178591	.	+	0	transcript_id "g631.t1"; gene_id "g631";
Scaffold_1	AUGUSTUS	CDS	3178589	3179146	0.73	+	0	transcript_id "g631.t1"; gene_id "g631";
Scaffold_1	AUGUSTUS	stop_codon	3179144	3179146	.	+	0	transcript_id "g631.t1"; gene_id "g631";
# protein sequence = [MKERFKREFTLLRGVYLFVGMIVTITQSELRHVWGEVTEIVIDDRDVVEEEAHDVRLKYGVAQVTVHVSQKIIAANPG
# MNELVIIKPVMVPFKVPHPCETRREIVIERTQLPLVPRYAITEEDTMGQRFNKVVVDTSSGLSRYKSLYQVLTRVTGLGSLVLTSLVQGLGDNCDNVA
# AQDILDVIT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g631
###
# start gene g632
Scaffold_1	AUGUSTUS	gene	3184274	3185960	0.66	+	.	g632
Scaffold_1	AUGUSTUS	transcript	3184274	3185960	0.66	+	.	g632.t1
Scaffold_1	AUGUSTUS	start_codon	3184274	3184276	.	+	0	transcript_id "g632.t1"; gene_id "g632";
Scaffold_1	AUGUSTUS	CDS	3184274	3184543	0.66	+	0	transcript_id "g632.t1"; gene_id "g632";
Scaffold_1	AUGUSTUS	CDS	3184608	3185960	1	+	0	transcript_id "g632.t1"; gene_id "g632";
Scaffold_1	AUGUSTUS	stop_codon	3185958	3185960	.	+	0	transcript_id "g632.t1"; gene_id "g632";
# protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP
# VQVLTPRRGQPPPAVRGNNPNVAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGG
# PRLPSPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSA
# KEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARL
# PEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQR
# PAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g632
###
# start gene g633
Scaffold_1	AUGUSTUS	gene	3188168	3189517	0.74	+	.	g633
Scaffold_1	AUGUSTUS	transcript	3188168	3189517	0.74	+	.	g633.t1
Scaffold_1	AUGUSTUS	start_codon	3188168	3188170	.	+	0	transcript_id "g633.t1"; gene_id "g633";
Scaffold_1	AUGUSTUS	CDS	3188168	3189517	0.74	+	0	transcript_id "g633.t1"; gene_id "g633";
Scaffold_1	AUGUSTUS	stop_codon	3189515	3189517	.	+	0	transcript_id "g633.t1"; gene_id "g633";
# protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIIVPMTRLTRKGASWIWDSSS
# CQEAFENLKIAFTSAPILAHWEPNRPLIVETDAPITPLRAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDI
# VTNHKNLEYFSTTKVLTRQQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASI
# IMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVR
# DYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPLSNGYTAILVVVDRSSKQAIFFQLTTPLLPNN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g633
###
# start gene g634
Scaffold_1	AUGUSTUS	gene	3189674	3190462	0.55	+	.	g634
Scaffold_1	AUGUSTUS	transcript	3189674	3190462	0.55	+	.	g634.t1
Scaffold_1	AUGUSTUS	start_codon	3189674	3189676	.	+	0	transcript_id "g634.t1"; gene_id "g634";
Scaffold_1	AUGUSTUS	CDS	3189674	3190005	0.55	+	0	transcript_id "g634.t1"; gene_id "g634";
Scaffold_1	AUGUSTUS	CDS	3190081	3190462	0.84	+	1	transcript_id "g634.t1"; gene_id "g634";
Scaffold_1	AUGUSTUS	stop_codon	3190460	3190462	.	+	0	transcript_id "g634.t1"; gene_id "g634";
# protein sequence = [MGRPSVSIRLSNSTSGSIVPTNKMTGRLYSRSPRFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVV
# NLDELHVFLREEILLAQSRYKEQADRKRISHPEKISWSFQGHQSTWYFVLRAQAPRLSSPNSPGFPRLTAGAGYAEPVPNRTQSPPPPIEVDGEEEYN
# VAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g634
###
# start gene g635
Scaffold_1	AUGUSTUS	gene	3191455	3191967	0.62	-	.	g635
Scaffold_1	AUGUSTUS	transcript	3191455	3191967	0.62	-	.	g635.t1
Scaffold_1	AUGUSTUS	stop_codon	3191455	3191457	.	-	0	transcript_id "g635.t1"; gene_id "g635";
Scaffold_1	AUGUSTUS	CDS	3191455	3191967	0.62	-	0	transcript_id "g635.t1"; gene_id "g635";
Scaffold_1	AUGUSTUS	start_codon	3191965	3191967	.	-	0	transcript_id "g635.t1"; gene_id "g635";
# protein sequence = [MTTSRTTTTTQPSASTSSRPADPPSPGAPIDEDEDEIIREALARVERVKARKAAEAAKRKAAEEAAAKKAAEEAEKKK
# QAAERAAAARRQAAQDARDRAVRAREQEDEIVERRRKLAEAATARSQGGTSTGDVSASPRRPIVEVSKMKNKGKGKAKAPVRLFRLTLNFLY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g635
###
# start gene g636
Scaffold_1	AUGUSTUS	gene	3199949	3200452	0.99	+	.	g636
Scaffold_1	AUGUSTUS	transcript	3199949	3200452	0.99	+	.	g636.t1
Scaffold_1	AUGUSTUS	start_codon	3199949	3199951	.	+	0	transcript_id "g636.t1"; gene_id "g636";
Scaffold_1	AUGUSTUS	CDS	3199949	3200452	0.99	+	0	transcript_id "g636.t1"; gene_id "g636";
Scaffold_1	AUGUSTUS	stop_codon	3200450	3200452	.	+	0	transcript_id "g636.t1"; gene_id "g636";
# protein sequence = [MSSNRSQHQQQEDWQSDTSAFPVIPPDSTTSSSASTSLTSALPAPLNSSSSAPLDVSSIDGNVSDQAKRHVMDMLAYY
# TGAKEESFGVAIARRLQMRSMNVWATSPGNAQGRIPQRATEAQTIFEIPITKGEYMLESRRLWSTHSNSDMCNPYGTLHGACACYIVDP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g636
###
# start gene g637
Scaffold_1	AUGUSTUS	gene	3204835	3205306	0.61	+	.	g637
Scaffold_1	AUGUSTUS	transcript	3204835	3205306	0.61	+	.	g637.t1
Scaffold_1	AUGUSTUS	start_codon	3204835	3204837	.	+	0	transcript_id "g637.t1"; gene_id "g637";
Scaffold_1	AUGUSTUS	CDS	3204835	3204851	0.61	+	0	transcript_id "g637.t1"; gene_id "g637";
Scaffold_1	AUGUSTUS	CDS	3205021	3205306	0.66	+	1	transcript_id "g637.t1"; gene_id "g637";
Scaffold_1	AUGUSTUS	stop_codon	3205304	3205306	.	+	0	transcript_id "g637.t1"; gene_id "g637";
# protein sequence = [MSLRASHEGLMLDYEQALTRECPVPKSVSSVPNEKAYYNTSAHFLWIGDRTRQLDGGHVEYFRGIKNPIGIKVGPSMQ
# SDELVRLLDSELMIINLYSDHF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g637
###
# start gene g638
Scaffold_1	AUGUSTUS	gene	3209845	3210950	0.42	-	.	g638
Scaffold_1	AUGUSTUS	transcript	3209845	3210950	0.42	-	.	g638.t1
Scaffold_1	AUGUSTUS	stop_codon	3209845	3209847	.	-	0	transcript_id "g638.t1"; gene_id "g638";
Scaffold_1	AUGUSTUS	CDS	3209845	3210551	0.73	-	2	transcript_id "g638.t1"; gene_id "g638";
Scaffold_1	AUGUSTUS	CDS	3210689	3210950	0.42	-	0	transcript_id "g638.t1"; gene_id "g638";
Scaffold_1	AUGUSTUS	start_codon	3210948	3210950	.	-	0	transcript_id "g638.t1"; gene_id "g638";
# protein sequence = [MSKEVKAWAATSPEKTEPISITRRAPDDEDVAIDIKFAGICHSDIHTVRSEWGSTAYPLVVGHEIAGVVNAVGKNVTK
# FQVGDHVGVVPRGGSGFRAACSGEYSIGQGSPVDVCRYHFVFTATPLACRARKEGGHHWIWWSRSYGRQACEVSNFFTILVHETDVPPRISLRALGSE
# VTVFSQTNSKKELGLQLGADNYVATSEPDVFSQLSRKFDLIINTVSANIPLELYLSCLRRDGSLVQVGAPEHPLQISPFSLDAQRVGIHGSMIGGIAE
# TQQMLEFCGEKQIFPEIETIPASYINEAYERVMKSQVKFRFVIDVSTM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g638
###
# start gene g639
Scaffold_1	AUGUSTUS	gene	3212909	3214017	0.85	-	.	g639
Scaffold_1	AUGUSTUS	transcript	3212909	3214017	0.85	-	.	g639.t1
Scaffold_1	AUGUSTUS	stop_codon	3212909	3212911	.	-	0	transcript_id "g639.t1"; gene_id "g639";
Scaffold_1	AUGUSTUS	CDS	3212909	3213365	0.95	-	1	transcript_id "g639.t1"; gene_id "g639";
Scaffold_1	AUGUSTUS	CDS	3213431	3214017	0.85	-	0	transcript_id "g639.t1"; gene_id "g639";
Scaffold_1	AUGUSTUS	start_codon	3214015	3214017	.	-	0	transcript_id "g639.t1"; gene_id "g639";
# protein sequence = [MSKEIKAWGATSPQRTEPMTITRRAPDDEDVAIDIKFAGICHSDIHTARNEWGRTTYPQVVGHEIAGVVNAVGKNVTK
# FKVGDYVGIGCMVNSCRQCANCVDGEEQYCTSGLVLTYNSTDPKDGSITQGGYSQYIVVDQAFVLSVPESIPLDKAAPLMCAGITLYSPLNHWNAGPG
# KRVGIIGFGGLGHMGVKLAKALGSEVTVFSQTNSKKELGLRFGADDYVATSEPDAFSKLGQRFDIIINTVSAKIPLDLYLSCLRRDGTLIQVGAPEDQ
# LQISPSSLYAHRVGVHGSMIGGIAETQKMLDLCGEKQIFPEIETIPASYINEAYERVMKSDVKFRFVIDVSTM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g639
###
# start gene g640
Scaffold_1	AUGUSTUS	gene	3214551	3216108	0.66	+	.	g640
Scaffold_1	AUGUSTUS	transcript	3214551	3216108	0.66	+	.	g640.t1
Scaffold_1	AUGUSTUS	start_codon	3214551	3214553	.	+	0	transcript_id "g640.t1"; gene_id "g640";
Scaffold_1	AUGUSTUS	CDS	3214551	3215024	0.66	+	0	transcript_id "g640.t1"; gene_id "g640";
Scaffold_1	AUGUSTUS	CDS	3215074	3216108	1	+	0	transcript_id "g640.t1"; gene_id "g640";
Scaffold_1	AUGUSTUS	stop_codon	3216106	3216108	.	+	0	transcript_id "g640.t1"; gene_id "g640";
# protein sequence = [MSTFLSIPNNLDTLALSSASSSSISSSTSTSSLFDNSCLFSSSSSQTDISPPTSPLNEDEEEDSPDKRKLLVEYDESW
# ESSCKGRLKTPTLNASNASLPVPQHSQGLLKVESPAAAADEAGYEAEESDGEESVARSILLKNKKKKLVKSKTRSGQGTESLKQEESELSILLSPAMT
# ENIGQNLGLNPLTKPVLRPQFLDLNSPSPIVALPSPRSSSDPIPHLFWDIYPSSSRSSVDAISSPIVNINDRIHRGTALRKTTQKPLGLGLRLPGKSG
# PCSRNSAPSIEIIRPLHSSDQTAKEKGLVGLGLKLPLGSPPASPSDSSSSFKPVSAKRRSLSGLGNGHPSTRNRGPSARVNNGGATSVTTVPSSEATI
# RLVTSTQHGSGSILLPKMSAQVLGQAPGVASGLAAELLDVDTIHQRRTSICLKPLLSSKDHHFTKRHMYPILESPESCTNFTTIPTTSASTIYPALNL
# TSPPSSQLRKLRSFSRSENVGVNTCSNIVIFV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g640
###
# start gene g641
Scaffold_1	AUGUSTUS	gene	3220942	3221601	0.6	-	.	g641
Scaffold_1	AUGUSTUS	transcript	3220942	3221601	0.6	-	.	g641.t1
Scaffold_1	AUGUSTUS	stop_codon	3220942	3220944	.	-	0	transcript_id "g641.t1"; gene_id "g641";
Scaffold_1	AUGUSTUS	CDS	3220942	3221601	0.6	-	0	transcript_id "g641.t1"; gene_id "g641";
Scaffold_1	AUGUSTUS	start_codon	3221599	3221601	.	-	0	transcript_id "g641.t1"; gene_id "g641";
# protein sequence = [MPRQSRSFASSANSSDNESLKENHVNGFNRVKMEKVKQQQTKVKEENARRARARVEEQERGDGLDVDADADTDEEEDF
# DNQGSGSPKGRKRARANTDGDSRPSQFQDGTSCAPRSVTLPRDPKDKCVVLVFHHRRNHSLEIIHISFIPGSIVRIQLRNFVTYDYVEFRPGPYLNMI
# IGPNGTGKSSIACAIALGLNFSPKVRLFKLNPFTLVESVMFPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g641
###
# start gene g642
Scaffold_1	AUGUSTUS	gene	3224755	3225729	0.74	+	.	g642
Scaffold_1	AUGUSTUS	transcript	3224755	3225729	0.74	+	.	g642.t1
Scaffold_1	AUGUSTUS	start_codon	3224755	3224757	.	+	0	transcript_id "g642.t1"; gene_id "g642";
Scaffold_1	AUGUSTUS	CDS	3224755	3225729	0.74	+	0	transcript_id "g642.t1"; gene_id "g642";
Scaffold_1	AUGUSTUS	stop_codon	3225727	3225729	.	+	0	transcript_id "g642.t1"; gene_id "g642";
# protein sequence = [MRRASPTPDLLEAQSHVDVDFKVDSQLRSRTVERRAKKKNKQRKKQRKQQQQAKAGGGQINTTSEGQGVPVTEGNKEA
# APNGGKAEAAQVLPKKPQPASEANGNTHAGPSNSGVSDVKGKEKEKEPGSAAITASSNHEPKPGGLSRVDTGSSISSTSSHSSTSSQTSCSSHGSSSS
# ESSIDPYEHDHMYGTHCDPVPHQPADGVGESKEEEDKEKEKEDKEKEKKKRETEVEKRCWWHIDCGWFRITGCRYIWNRQFSKIIKERIHISRKRRRI
# IGEFGIGEFRIGEFKSGWHTVWGLSFSTHYSNVVHEPPDFAQSTKRDIEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g642
###
# start gene g643
Scaffold_1	AUGUSTUS	gene	3226797	3228039	0.91	+	.	g643
Scaffold_1	AUGUSTUS	transcript	3226797	3228039	0.91	+	.	g643.t1
Scaffold_1	AUGUSTUS	start_codon	3226797	3226799	.	+	0	transcript_id "g643.t1"; gene_id "g643";
Scaffold_1	AUGUSTUS	CDS	3226797	3227573	0.93	+	0	transcript_id "g643.t1"; gene_id "g643";
Scaffold_1	AUGUSTUS	CDS	3227746	3228039	0.98	+	0	transcript_id "g643.t1"; gene_id "g643";
Scaffold_1	AUGUSTUS	stop_codon	3228037	3228039	.	+	0	transcript_id "g643.t1"; gene_id "g643";
# protein sequence = [MNKNSPTSAFATPSTTATTSAFGQPSAFGANNNNSPFGKPPTSVFGTSTFGQPSSTAFGGTPSTTNTSSVFGAPSTTT
# TSAFGQSSTFGSSPAASTTSAFGAPAAASTSAFGQTSTPTSSLIKPAISGGAFAAFANSGPSAFGSGAPSGSGSGGGFAAFANSQPSTFSGTSSTNTG
# GSAFGQPSAFGASSTGNNAFGSNSAPPAAPTSAFGALAPAAPSTTFGAFSQPASTASTSAFGQPASSTSVFGQPAPSTSNPTSSAGGGFGSGGGGAFG
# SSTPLSNTTNTSSNSTDSKPNFDAPHLRKLFRPGKTPYDSQLPPNYLESVLPKAVVEVFKRDRFDWGEGGGVPEWIPPVELR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g643
###
# start gene g644
Scaffold_1	AUGUSTUS	gene	3229654	3230799	1	+	.	g644
Scaffold_1	AUGUSTUS	transcript	3229654	3230799	1	+	.	g644.t1
Scaffold_1	AUGUSTUS	start_codon	3229654	3229656	.	+	0	transcript_id "g644.t1"; gene_id "g644";
Scaffold_1	AUGUSTUS	CDS	3229654	3230799	1	+	0	transcript_id "g644.t1"; gene_id "g644";
Scaffold_1	AUGUSTUS	stop_codon	3230797	3230799	.	+	0	transcript_id "g644.t1"; gene_id "g644";
# protein sequence = [MLIRNTVFPFLTLAISLSVQGAPTGSKPRGNSHIVIARNAAGFLERDAPFDDKTLFLRSGEHSQLEARQQQKGQKSGQ
# QNRSSHNKNVVNSWGKNTDRNRRKKAKQRAKAKLRKAAANANSVHPAVTAKTVATPPHVGALKEPVQAPLTEAEKKLELEKATEKKEEEKKKDGGEAK
# KEEPKHVIPEHKETPAEKKEELNHLQTTEGEAPVPPTGADVTTAATAAVGSLAQLAPMIAQGMAAGGSAGASSAIANDVMGGGASGSPNSGSTSNAGS
# SSTGDGVPPSSTGSSSSSNSSGDTGSSGSDSSTSSNKGEGEKEGKGDEDSGKKEDDGTGDGKGDETGDGSDNGKGDESSNSEDDKKTDSKKKSPDPDS
# GHGSTEEVR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g644
###
# start gene g645
Scaffold_1	AUGUSTUS	gene	3233378	3233680	0.94	-	.	g645
Scaffold_1	AUGUSTUS	transcript	3233378	3233680	0.94	-	.	g645.t1
Scaffold_1	AUGUSTUS	stop_codon	3233378	3233380	.	-	0	transcript_id "g645.t1"; gene_id "g645";
Scaffold_1	AUGUSTUS	CDS	3233378	3233680	0.94	-	0	transcript_id "g645.t1"; gene_id "g645";
Scaffold_1	AUGUSTUS	start_codon	3233678	3233680	.	-	0	transcript_id "g645.t1"; gene_id "g645";
# protein sequence = [MSTHEEEDVQTQVEVDRNPNSPSKYPTTIGYGEDVEKRSTRRELQDVKPVYSPMNTLDSREVVIVDWDGPDDPKNPKK
# PVSVLLVLQYTHSFVLQLAQES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g645
###
# start gene g646
Scaffold_1	AUGUSTUS	gene	3235474	3235791	0.66	-	.	g646
Scaffold_1	AUGUSTUS	transcript	3235474	3235791	0.66	-	.	g646.t1
Scaffold_1	AUGUSTUS	stop_codon	3235474	3235476	.	-	0	transcript_id "g646.t1"; gene_id "g646";
Scaffold_1	AUGUSTUS	CDS	3235474	3235791	0.66	-	0	transcript_id "g646.t1"; gene_id "g646";
Scaffold_1	AUGUSTUS	start_codon	3235789	3235791	.	-	0	transcript_id "g646.t1"; gene_id "g646";
# protein sequence = [MYYDERGLLLNVSRQYRKERKARRLAKLAQDGRTARTKTRSSSDTGKFSGLEEDAIIDDEDGDEESERDHQEEPTKAP
# VRRKDHDIADMYKTMDGSALIAIGSYL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g646
###
# start gene g647
Scaffold_1	AUGUSTUS	gene	3253372	3258431	0.22	-	.	g647
Scaffold_1	AUGUSTUS	transcript	3253372	3258431	0.22	-	.	g647.t1
Scaffold_1	AUGUSTUS	stop_codon	3253372	3253374	.	-	0	transcript_id "g647.t1"; gene_id "g647";
Scaffold_1	AUGUSTUS	CDS	3253372	3254114	0.88	-	2	transcript_id "g647.t1"; gene_id "g647";
Scaffold_1	AUGUSTUS	CDS	3254168	3254319	0.84	-	1	transcript_id "g647.t1"; gene_id "g647";
Scaffold_1	AUGUSTUS	CDS	3255618	3255981	1	-	2	transcript_id "g647.t1"; gene_id "g647";
Scaffold_1	AUGUSTUS	CDS	3256022	3256347	0.42	-	1	transcript_id "g647.t1"; gene_id "g647";
Scaffold_1	AUGUSTUS	CDS	3256397	3256766	0.96	-	2	transcript_id "g647.t1"; gene_id "g647";
Scaffold_1	AUGUSTUS	CDS	3256832	3258431	0.69	-	0	transcript_id "g647.t1"; gene_id "g647";
Scaffold_1	AUGUSTUS	start_codon	3258429	3258431	.	-	0	transcript_id "g647.t1"; gene_id "g647";
# protein sequence = [MDNTACVEMLRGQLPDKAQRKPGGLLSLMNKASSAHKQGKGNSDHRNEDLLQEMQAKFGVHASFVATSGNANRMQFGV
# NHYAGVCMYDVSDFVEKDTDLLDPAFVPLLRNSSESFVAKLFSGPSLAAEKHYKDESIVVQAQVSSRPLRTLTPFVSSNFTGEGERTSEEAQEHLELD
# RGKSYPVTTQINFTLSELFANISKARLWALSCIRPNDSGSPNSFDKRRVKAQIRSLLLSDLASRRSVEYVADFDLAQFCDRYVPTMRGSESERITQCA
# RANGWIEGVDYVVGHRSIWLSYSAWKMVEDTVRAVEKDAKRALGDAGMEMDDDEDISVAPDDGTEYTHEGGGYGYGGVGSQMDGGGLGASNDDLVLRR
# TGTNGTQHRSPNQGPAYNALPAPNSPAQMSTPNAFRGQADDGGWGSEWDKKDESSVTGTGTVPAGSSVKEGDGLVVKDAPDSVEEVPSTRSRRFWLGT
# VWACTWFIPSFLLTHVGRMKRPDVRLAWRERSPFVSSFCFSTASSFSTLSFLAGYFAPTMIMHVYDVSNFVQGQHSDIDGEDSNSDDVLEALAGLDLT
# YYFPVPLVLGCGNLGPTSTMKLSFKNFTETEPTADHSSGEFAQSTTSQLHNSDWYTATFQPVINQYHIGTLVHSWDEIQSYASDEDIEKIWGVYNNNL
# YDLTDYFYTQDQNDNNDAYLFLDSGIETVFKDRSGQDITDSLNTALGKLNETYRQQNLDCLNNVFYIGQTDFRTTARCQAPNITLIVVAAILMSTMVL
# KSSTVLSALQLAPKRTPELQDKFVLCQVPCYTEGEDSLRRTIDSLAALNYDDKRKLIFIICDGNITGSGNDRTTPRIVQDILGVDPKLDPEPLMFKSV
# GEGSRALNYGKVYSGLYEFEGHVVPLFLPVYSFWCMDEFGWGNTRLVIGEGKDKKVIVNDDDKFDESMIPLKKFSEYEAEAWETGSRHSDETGYSKPH
# THPRPTASRTGSPYNYQQGSQAGDYYRDTNLTMNSRSNPNPFTGSQQSLSNLSHHGGQQYAAPQLPYMPFGGGPGSAAGSDYGGRMPMGPVMPMGYQN
# TGSMYGMPMGMGMNMMSPAAMDPRTTMMAGMMTGGSFGGSQSGAFAPPTMPASQEQRPLSTFSMATTVNPFAGPSQNPNPSDDELFAALRSYLGTQDL
# MTVTKKYVLLCPVDDDFYSCVVEPLEKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/6
# CDS introns: 0/5
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g647
###
# start gene g648
Scaffold_1	AUGUSTUS	gene	3261586	3262773	0.3	+	.	g648
Scaffold_1	AUGUSTUS	transcript	3261586	3262773	0.3	+	.	g648.t1
Scaffold_1	AUGUSTUS	start_codon	3261586	3261588	.	+	0	transcript_id "g648.t1"; gene_id "g648";
Scaffold_1	AUGUSTUS	CDS	3261586	3261760	0.72	+	0	transcript_id "g648.t1"; gene_id "g648";
Scaffold_1	AUGUSTUS	CDS	3262085	3262773	0.4	+	2	transcript_id "g648.t1"; gene_id "g648";
Scaffold_1	AUGUSTUS	stop_codon	3262771	3262773	.	+	0	transcript_id "g648.t1"; gene_id "g648";
# protein sequence = [MEDIAGWKASTVFITIDSLKNHEEKGAAGDIYGGRCPTWGEARDIEWRKAEEEPEVLIKWLEQYVVSQDLLVWTKSRV
# MPAPTYDRNSKRWTVTVNKAGQTCTLHPKHVVVATGMLGEPYIPKIEDQEIFEGQIMHSEGFSGGADFTGKRVIVVGTGNSGADIALDLSTHKARSVT
# MIQRSTTVVQPASTIAEQHLQVYPPDVPVEVSDFRAFATPTFRLFEILAETRGLMWDQEKDLIEGLRKAGMNVDMGPYGAGILPLVYLRFGGACSSVP
# WPQHLTNVASCIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g648
###
# start gene g649
Scaffold_1	AUGUSTUS	gene	3269080	3270000	0.97	-	.	g649
Scaffold_1	AUGUSTUS	transcript	3269080	3270000	0.97	-	.	g649.t1
Scaffold_1	AUGUSTUS	stop_codon	3269080	3269082	.	-	0	transcript_id "g649.t1"; gene_id "g649";
Scaffold_1	AUGUSTUS	CDS	3269080	3270000	0.97	-	0	transcript_id "g649.t1"; gene_id "g649";
Scaffold_1	AUGUSTUS	start_codon	3269998	3270000	.	-	0	transcript_id "g649.t1"; gene_id "g649";
# protein sequence = [MLAISEDSLISLEEVHIQDGPSGNPRSLDIQASELRSWTSVGTTSSPFIRVLPPTSVCQQITEYSISNVTYTEVLKVI
# RLFPHLRQLSVQNLSPENDLPGPELPATRLSQLQALHLIQLNLSASSANAFIALLDVIVCPALTHLLVDACGNISGAIQRLKERSNFELQHLIAAEDA
# DAFVKGLSNCLELEEVEIRGAYLYKSITEVLAHLSTITTPTKLNNPSQLPPLPNLRRLHFQLGVLPFVDVVVENLHACVISRLFCAQHTTGLRQLEIC
# ITTPDAQARKILDSPRLKYLHSVGVKIEIIGI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g649
###
# start gene g650
Scaffold_1	AUGUSTUS	gene	3271381	3272751	0.54	-	.	g650
Scaffold_1	AUGUSTUS	transcript	3271381	3272751	0.54	-	.	g650.t1
Scaffold_1	AUGUSTUS	stop_codon	3271381	3271383	.	-	0	transcript_id "g650.t1"; gene_id "g650";
Scaffold_1	AUGUSTUS	CDS	3271381	3272476	0.73	-	1	transcript_id "g650.t1"; gene_id "g650";
Scaffold_1	AUGUSTUS	CDS	3272615	3272751	0.55	-	0	transcript_id "g650.t1"; gene_id "g650";
Scaffold_1	AUGUSTUS	start_codon	3272749	3272751	.	-	0	transcript_id "g650.t1"; gene_id "g650";
# protein sequence = [MRRMPLDVLEVIFRFGAEYFTNPEDFFSSTTHCLDIKSPPWIYARVRSSALPLIVYIDMFSAPASPDLVGFALRLVAA
# HSRRWQSLFLVGGQGIDTKILSGDSLMSLENIQIQESSMEAPRSLDIAASQLRAWSAVGNLLSTSVQITPPTSLCRQITEYSISTVMYTEVHKILPLL
# PNVRKLSVQDILNSNNPPTSELRLPHLREFNIRQQNNPLATFLPTDGLVALLDSISCPALTHLSVSVYGIFGDAFKRFERRSNFKLQHLIAGEGAGIL
# VKGLQNRLALETIEIRGFHFYTSVIEVITHLHVPPALTPVALSMSWSPATSNSHSNISPPVTPFPNLRRFQFQLSLLPFMDIMEKLHACVSSRRSGSA
# APLEILVAARDGQARTMLGHPRLKDLRSMGAKVEITST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g650
###
# start gene g651
Scaffold_1	AUGUSTUS	gene	3275079	3275390	0.55	+	.	g651
Scaffold_1	AUGUSTUS	transcript	3275079	3275390	0.55	+	.	g651.t1
Scaffold_1	AUGUSTUS	start_codon	3275079	3275081	.	+	0	transcript_id "g651.t1"; gene_id "g651";
Scaffold_1	AUGUSTUS	CDS	3275079	3275390	0.55	+	0	transcript_id "g651.t1"; gene_id "g651";
Scaffold_1	AUGUSTUS	stop_codon	3275388	3275390	.	+	0	transcript_id "g651.t1"; gene_id "g651";
# protein sequence = [MVLPEATTAGQFYLDYIIYNPIPTFTLPSPAATIIGSTYSTLSTCTAGTTPYPSSAAVPAIAGGVVGSIAGVVVGMIL
# TFALLRKIRIRFWRKFTGIPAKYKH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g651
###
# start gene g652
Scaffold_1	AUGUSTUS	gene	3279663	3280014	0.78	+	.	g652
Scaffold_1	AUGUSTUS	transcript	3279663	3280014	0.78	+	.	g652.t1
Scaffold_1	AUGUSTUS	start_codon	3279663	3279665	.	+	0	transcript_id "g652.t1"; gene_id "g652";
Scaffold_1	AUGUSTUS	CDS	3279663	3279723	0.86	+	0	transcript_id "g652.t1"; gene_id "g652";
Scaffold_1	AUGUSTUS	CDS	3279806	3280014	0.79	+	2	transcript_id "g652.t1"; gene_id "g652";
Scaffold_1	AUGUSTUS	stop_codon	3280012	3280014	.	+	0	transcript_id "g652.t1"; gene_id "g652";
# protein sequence = [MPHKFEDSAASSKSIKKDMQAIDNAPTGRDLYRSAPVYQDAPDDPPEPMETLKNPGSAGTESQVGAAGATGTLEIVRD
# APVCRDFSVCA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g652
###
# start gene g653
Scaffold_1	AUGUSTUS	gene	3296446	3296781	0.83	+	.	g653
Scaffold_1	AUGUSTUS	transcript	3296446	3296781	0.83	+	.	g653.t1
Scaffold_1	AUGUSTUS	start_codon	3296446	3296448	.	+	0	transcript_id "g653.t1"; gene_id "g653";
Scaffold_1	AUGUSTUS	CDS	3296446	3296781	0.83	+	0	transcript_id "g653.t1"; gene_id "g653";
Scaffold_1	AUGUSTUS	stop_codon	3296779	3296781	.	+	0	transcript_id "g653.t1"; gene_id "g653";
# protein sequence = [MISNPSNSPCTLGAHSWIRRNVQIPVDESSTPYVWGVVDLVPETDFPDFRNWAGIRSDSGSCMIIPRERDMIRIYVQL
# EGQNAIDATKEAADGSKVKMGPEWILDVSKSEA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g653
###
# start gene g654
Scaffold_1	AUGUSTUS	gene	3297465	3297884	0.89	+	.	g654
Scaffold_1	AUGUSTUS	transcript	3297465	3297884	0.89	+	.	g654.t1
Scaffold_1	AUGUSTUS	start_codon	3297465	3297467	.	+	0	transcript_id "g654.t1"; gene_id "g654";
Scaffold_1	AUGUSTUS	CDS	3297465	3297884	0.89	+	0	transcript_id "g654.t1"; gene_id "g654";
Scaffold_1	AUGUSTUS	stop_codon	3297882	3297884	.	+	0	transcript_id "g654.t1"; gene_id "g654";
# protein sequence = [MIQKSTEFSSGIGVHYLPSDIVDIKNQGLASGIVIGKRMPPGTVVRLLDFCPIHIHDLLPSDTRFKILVFAGNASSSA
# QRMRLQQLAVKIGNLRSLLGLDILPGNSSQSGLDVLTILSTKLELALFKELPLKLRSHWSK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g654
###
# start gene g655
Scaffold_1	AUGUSTUS	gene	3316025	3316216	0.61	-	.	g655
Scaffold_1	AUGUSTUS	transcript	3316025	3316216	0.61	-	.	g655.t1
Scaffold_1	AUGUSTUS	stop_codon	3316025	3316027	.	-	0	transcript_id "g655.t1"; gene_id "g655";
Scaffold_1	AUGUSTUS	CDS	3316025	3316216	0.61	-	0	transcript_id "g655.t1"; gene_id "g655";
Scaffold_1	AUGUSTUS	start_codon	3316214	3316216	.	-	0	transcript_id "g655.t1"; gene_id "g655";
# protein sequence = [MFSIVSIEELTIPMDDWKITRNTDSTSSAHSDTGGYRAPLQDLDLDPVGDFSYNVDSHSDPGN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g655
###
# start gene g656
Scaffold_1	AUGUSTUS	gene	3328876	3329166	0.52	-	.	g656
Scaffold_1	AUGUSTUS	transcript	3328876	3329166	0.52	-	.	g656.t1
Scaffold_1	AUGUSTUS	stop_codon	3328876	3328878	.	-	0	transcript_id "g656.t1"; gene_id "g656";
Scaffold_1	AUGUSTUS	CDS	3328876	3329166	0.52	-	0	transcript_id "g656.t1"; gene_id "g656";
Scaffold_1	AUGUSTUS	start_codon	3329164	3329166	.	-	0	transcript_id "g656.t1"; gene_id "g656";
# protein sequence = [MSGQMMVKPTQTHADPVNSVEFVPDEHMIVSGSSNDSIKVRDANSGHVIGEPIHEHTGHVIIVPSSPDGRKFTSASND
# HSVRIWDAQNASLIREQL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g656
###
# start gene g657
Scaffold_1	AUGUSTUS	gene	3334180	3334410	0.41	+	.	g657
Scaffold_1	AUGUSTUS	transcript	3334180	3334410	0.41	+	.	g657.t1
Scaffold_1	AUGUSTUS	start_codon	3334180	3334182	.	+	0	transcript_id "g657.t1"; gene_id "g657";
Scaffold_1	AUGUSTUS	CDS	3334180	3334410	0.41	+	0	transcript_id "g657.t1"; gene_id "g657";
Scaffold_1	AUGUSTUS	stop_codon	3334408	3334410	.	+	0	transcript_id "g657.t1"; gene_id "g657";
# protein sequence = [MGSQVFSDDILGMESDDPIAEMFTKPKKKKKGKVVVIESTSESEDDEDSDSSESEVGGREAKEEEDGEASSEDEDC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g657
###
# start gene g658
Scaffold_1	AUGUSTUS	gene	3335056	3335643	1	+	.	g658
Scaffold_1	AUGUSTUS	transcript	3335056	3335643	1	+	.	g658.t1
Scaffold_1	AUGUSTUS	start_codon	3335056	3335058	.	+	0	transcript_id "g658.t1"; gene_id "g658";
Scaffold_1	AUGUSTUS	CDS	3335056	3335643	1	+	0	transcript_id "g658.t1"; gene_id "g658";
Scaffold_1	AUGUSTUS	stop_codon	3335641	3335643	.	+	0	transcript_id "g658.t1"; gene_id "g658";
# protein sequence = [MDGTPGAGKGRGECRDGSNAFGWQAKQREEDTEDQPKAKETHKQPKIPVNLPGPLTISGSKPAFTYESKAEDPNAATK
# MFQRTLDVVVPDVTVRDLVSLSSDLRKQWIDHTKVQHIPTTTDEPTVQATIRTKESLNLEYSTPVRMIEVMLFGRQKETHSSTTGRKSSSLEPMFAKR
# WASEKSREDGYNGNCEWEP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g658
###
# start gene g659
Scaffold_1	AUGUSTUS	gene	3335779	3337505	0.31	+	.	g659
Scaffold_1	AUGUSTUS	transcript	3335779	3337505	0.31	+	.	g659.t1
Scaffold_1	AUGUSTUS	start_codon	3335779	3335781	.	+	0	transcript_id "g659.t1"; gene_id "g659";
Scaffold_1	AUGUSTUS	CDS	3335779	3336924	0.31	+	0	transcript_id "g659.t1"; gene_id "g659";
Scaffold_1	AUGUSTUS	CDS	3337077	3337505	0.72	+	0	transcript_id "g659.t1"; gene_id "g659";
Scaffold_1	AUGUSTUS	stop_codon	3337503	3337505	.	+	0	transcript_id "g659.t1"; gene_id "g659";
# protein sequence = [METETNVLVTVHDPMGRQRSRTVKTILKDIETPPDNSITPEEVVRMWERVQLDMLTDGEIQHPSNPTSLAAFIFHSNY
# SHNQIHHILAYKRVAQKVQPIPTVMPDYAKVIRRFPEDPLLTLPSLSRNPPQFLPGVRLTEERLKGLGILKNGFLWPEERLLMADVLKKNEMGIAWDE
# TEKGRFREDYFPPLKIPMIAHTPWADRTLPIPPGIRNKVIQLVREKVASGLYEPSNSSYRSQWFVVVKSDGGLRIVHNLKKLNAITVRDSGQPPIIHL
# FIEQCGGRGIYSGIDVIAGFDHGTLHEDSRDPTTFDTPIGTFRLARIPQGWTGSVPVFHGHVAFLLQDETEVSPNFIDDLPVLGPKTRYEKQGGDYEV
# LVENSGIRRFQSCEDSVLASLQSITEVRGFLGTAGVLRVWIKDFARITRPLVDLTKKDVTFIWLPEHQQAMANTKDAVSKCEVLVTIDYLSLLPVIMA
# VDSSYIACGIILSQDNKDGRRHPSRFWSIAWNERKLVTPRPKLSFMASFEPFTQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g659
###
# start gene g660
Scaffold_1	AUGUSTUS	gene	3337544	3337951	0.77	+	.	g660
Scaffold_1	AUGUSTUS	transcript	3337544	3337951	0.77	+	.	g660.t1
Scaffold_1	AUGUSTUS	start_codon	3337544	3337546	.	+	0	transcript_id "g660.t1"; gene_id "g660";
Scaffold_1	AUGUSTUS	CDS	3337544	3337951	0.77	+	0	transcript_id "g660.t1"; gene_id "g660";
Scaffold_1	AUGUSTUS	stop_codon	3337949	3337951	.	+	0	transcript_id "g660.t1"; gene_id "g660";
# protein sequence = [MDASCVKGMINNPDMHPNAAMNRWIAAIQLFDFDLKHVPGKNFLGPDGVSRRRRTVDEGDEREGKADEWVDEILSAGI
# WIAGAWDKEDRLGGIVEYRDTGTSSAFCLMASVEALDNVKIPHSQAAERAPIRYKIT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g660
###
# start gene g661
Scaffold_1	AUGUSTUS	gene	3340253	3341970	0.62	+	.	g661
Scaffold_1	AUGUSTUS	transcript	3340253	3341970	0.62	+	.	g661.t1
Scaffold_1	AUGUSTUS	start_codon	3340253	3340255	.	+	0	transcript_id "g661.t1"; gene_id "g661";
Scaffold_1	AUGUSTUS	CDS	3340253	3340558	0.71	+	0	transcript_id "g661.t1"; gene_id "g661";
Scaffold_1	AUGUSTUS	CDS	3340642	3341000	0.87	+	0	transcript_id "g661.t1"; gene_id "g661";
Scaffold_1	AUGUSTUS	CDS	3341178	3341970	0.85	+	1	transcript_id "g661.t1"; gene_id "g661";
Scaffold_1	AUGUSTUS	stop_codon	3341968	3341970	.	+	0	transcript_id "g661.t1"; gene_id "g661";
# protein sequence = [MPPTPRPALVPRTFTAHPYRAENQRLAARVRELESQLADSQRENSSLTSALRDTSHALESRQREVEQLRSSNREVREQ
# EVEYRGVLDQFRALDEALPGTPGQGDLQDATRERKVAVEKLSTANRKNSHLATTLLHQQGLVDESNLLATRQRRLVEQLQEEVHRVRDRAAFVDQMIK
# EYPDEGYYEVVLPPLSQLEGDLNKAHEDLRRVPPLLIAFTVRIPRPIQWFLNNTVDEDEGFLSHGLGTLRFDNDGPFLTAAQHAGFTPPPSDSLEPPL
# HRRMLALSTPLPHSDGAGRWDDIVPALPSIDQLTADWEQLMLDYIHHITDTPLPGPNPPAPVSAVDPVTEPSQEVVVEQSPEVPVAPVSSSSIGFQPQ
# VPLFLPEQESPTSPSPPPPSPTLPPLFGSVVNLAIDLTGDDDELYETEESRVARVSMTGEVVDLAPGQGIVKEESCSVSPSSCSVLVEPSFFVFVFYL
# KIVAFFLFVLTFFVN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g661
###
# start gene g662
Scaffold_1	AUGUSTUS	gene	3342360	3343082	0.61	-	.	g662
Scaffold_1	AUGUSTUS	transcript	3342360	3343082	0.61	-	.	g662.t1
Scaffold_1	AUGUSTUS	stop_codon	3342360	3342362	.	-	0	transcript_id "g662.t1"; gene_id "g662";
Scaffold_1	AUGUSTUS	CDS	3342360	3343082	0.61	-	0	transcript_id "g662.t1"; gene_id "g662";
Scaffold_1	AUGUSTUS	start_codon	3343080	3343082	.	-	0	transcript_id "g662.t1"; gene_id "g662";
# protein sequence = [MPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNN
# TPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKVYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKW
# TGPYTILSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKLNARPPRPPNLHKRGDGASRNP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g662
###
# start gene g663
Scaffold_1	AUGUSTUS	gene	3346700	3348493	0.38	-	.	g663
Scaffold_1	AUGUSTUS	transcript	3346700	3348493	0.38	-	.	g663.t1
Scaffold_1	AUGUSTUS	stop_codon	3346700	3346702	.	-	0	transcript_id "g663.t1"; gene_id "g663";
Scaffold_1	AUGUSTUS	CDS	3346700	3348172	0.95	-	0	transcript_id "g663.t1"; gene_id "g663";
Scaffold_1	AUGUSTUS	CDS	3348335	3348493	0.39	-	0	transcript_id "g663.t1"; gene_id "g663";
Scaffold_1	AUGUSTUS	start_codon	3348491	3348493	.	-	0	transcript_id "g663.t1"; gene_id "g663";
# protein sequence = [MREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPSSIERSRTTSSQGGQGQREQGGRSGG
# GAPPPPPPPPPPSGGPGDSNSEGSDEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRIT
# IESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADE
# ARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLHGEKVQGWLSR
# FPGLELAPEAPYKSPLRREREPADVWTSNPKPAATGRFQSRPNWKEGRQRASAAWGEGESYDSENREEDEDCCHCRDGGEWTEAVLRAGVTDTGRKWT
# PEERAEKWRRRRQELCMRCGRKEHWAKDCPNPESLERPAEDQGSSERASKADSTRGRGRPTKGEVVRTIQLVL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g663
###
# start gene g664
Scaffold_1	AUGUSTUS	gene	3350258	3350839	1	-	.	g664
Scaffold_1	AUGUSTUS	transcript	3350258	3350839	1	-	.	g664.t1
Scaffold_1	AUGUSTUS	stop_codon	3350258	3350260	.	-	0	transcript_id "g664.t1"; gene_id "g664";
Scaffold_1	AUGUSTUS	CDS	3350258	3350839	1	-	0	transcript_id "g664.t1"; gene_id "g664";
Scaffold_1	AUGUSTUS	start_codon	3350837	3350839	.	-	0	transcript_id "g664.t1"; gene_id "g664";
# protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ
# GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY
# PNNLVIPEVTNTSSTVP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g664
###
# start gene g665
Scaffold_1	AUGUSTUS	gene	3363989	3364402	0.4	+	.	g665
Scaffold_1	AUGUSTUS	transcript	3363989	3364402	0.4	+	.	g665.t1
Scaffold_1	AUGUSTUS	start_codon	3363989	3363991	.	+	0	transcript_id "g665.t1"; gene_id "g665";
Scaffold_1	AUGUSTUS	CDS	3363989	3364402	0.4	+	0	transcript_id "g665.t1"; gene_id "g665";
Scaffold_1	AUGUSTUS	stop_codon	3364400	3364402	.	+	0	transcript_id "g665.t1"; gene_id "g665";
# protein sequence = [MTQADNPPTPYIVCAKKSGRGMSMIRTRSYINNQEDKSLRIVKACLRTKPREDHAANLKADLSLTGSSSSCSSVAIVE
# PMTDGDAASSLSLISSFLSKSSASVLSSCFISSDLTGLGLVAEGLLMALVMSKSKSSGH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g665
###
# start gene g666
Scaffold_1	AUGUSTUS	gene	3368348	3369124	0.4	+	.	g666
Scaffold_1	AUGUSTUS	transcript	3368348	3369124	0.4	+	.	g666.t1
Scaffold_1	AUGUSTUS	start_codon	3368348	3368350	.	+	0	transcript_id "g666.t1"; gene_id "g666";
Scaffold_1	AUGUSTUS	CDS	3368348	3369124	0.4	+	0	transcript_id "g666.t1"; gene_id "g666";
Scaffold_1	AUGUSTUS	stop_codon	3369122	3369124	.	+	0	transcript_id "g666.t1"; gene_id "g666";
# protein sequence = [MPVPDTFDAFVPSNFADLFATAEIPPYIGLTELRELERNVVNKFQPSYLHAQKLCSKMILDHSLRCYYLALAILQSFP
# SKTPSIPQISRDELIERVYLACILHDLGLSSHEEAIAHPTRDMTFEIHGGILAYEHLRAEYAPDLHLNNSQIADVAQSIMLHTVSFQTGMSSAAGMLL
# YVSAFIDVVGYDAAPPNTKERAITYDTVREIEEAFPLDGMSLRFGGQIQEMLDTKPNCLVSHSVSLFLQLCYVTNSCCSQIF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g666
###
# start gene g667
Scaffold_1	AUGUSTUS	gene	3370980	3372225	0.12	-	.	g667
Scaffold_1	AUGUSTUS	transcript	3370980	3372225	0.12	-	.	g667.t1
Scaffold_1	AUGUSTUS	stop_codon	3370980	3370982	.	-	0	transcript_id "g667.t1"; gene_id "g667";
Scaffold_1	AUGUSTUS	CDS	3370980	3371305	0.84	-	2	transcript_id "g667.t1"; gene_id "g667";
Scaffold_1	AUGUSTUS	CDS	3371360	3371391	0.84	-	1	transcript_id "g667.t1"; gene_id "g667";
Scaffold_1	AUGUSTUS	CDS	3371452	3371503	0.56	-	2	transcript_id "g667.t1"; gene_id "g667";
Scaffold_1	AUGUSTUS	CDS	3371582	3371716	0.31	-	2	transcript_id "g667.t1"; gene_id "g667";
Scaffold_1	AUGUSTUS	CDS	3371767	3372014	0.6	-	1	transcript_id "g667.t1"; gene_id "g667";
Scaffold_1	AUGUSTUS	CDS	3372107	3372225	0.97	-	0	transcript_id "g667.t1"; gene_id "g667";
Scaffold_1	AUGUSTUS	start_codon	3372223	3372225	.	-	0	transcript_id "g667.t1"; gene_id "g667";
# protein sequence = [MTSIFTHEFNTPIYKGKTSFNTGLYINGKFVEGSDKNTIDTAALLGALFATDRFVATGKIITKVAEATSKDVDVAVAA
# AHKAFETTWGLNMGGAGRSRLLAKLAQLMEEHQQELAALEALDNGKTFTWAMDVDTTFAIDTIRYYAGWADKIHGQVVEVGVKIDQRRRYYSMELPFA
# YDVVETWSCSRYWKLHCHEEFTPLTAIRMTELIHEAGFPPGTFNLLTGYGNTVGAAISSHMKIDKVAFTGSTLVGRKIMEAAAKSNLKDITLELVAKA
# RTLYLTMQMLIKPSIGQLMGSSKPLVFSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/6
# CDS introns: 0/5
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g667
###
# start gene g668
Scaffold_1	AUGUSTUS	gene	3373528	3373743	0.86	-	.	g668
Scaffold_1	AUGUSTUS	transcript	3373528	3373743	0.86	-	.	g668.t1
Scaffold_1	AUGUSTUS	stop_codon	3373528	3373530	.	-	0	transcript_id "g668.t1"; gene_id "g668";
Scaffold_1	AUGUSTUS	CDS	3373528	3373743	0.86	-	0	transcript_id "g668.t1"; gene_id "g668";
Scaffold_1	AUGUSTUS	start_codon	3373741	3373743	.	-	0	transcript_id "g668.t1"; gene_id "g668";
# protein sequence = [MNLSFQRIMGYIQSGKDQGATVHLGGDRNGTEGYYINPTIFTDTTPDMKIVQEEIFGPVGVVIKFEDDEGI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g668
###
# start gene g669
Scaffold_1	AUGUSTUS	gene	3398468	3398737	0.76	-	.	g669
Scaffold_1	AUGUSTUS	transcript	3398468	3398737	0.76	-	.	g669.t1
Scaffold_1	AUGUSTUS	stop_codon	3398468	3398470	.	-	0	transcript_id "g669.t1"; gene_id "g669";
Scaffold_1	AUGUSTUS	CDS	3398468	3398737	0.76	-	0	transcript_id "g669.t1"; gene_id "g669";
Scaffold_1	AUGUSTUS	start_codon	3398735	3398737	.	-	0	transcript_id "g669.t1"; gene_id "g669";
# protein sequence = [MECLRLGVLTTVKEPASDTSEVFRLCNLHTLCGFNDEELPEEPELPEVAVGVLAEADPEASPDTEVPDASPPANAAIG
# GPGNVYDAEGS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g669
###
# start gene g670
Scaffold_1	AUGUSTUS	gene	3404639	3405805	0.54	+	.	g670
Scaffold_1	AUGUSTUS	transcript	3404639	3405805	0.54	+	.	g670.t1
Scaffold_1	AUGUSTUS	start_codon	3404639	3404641	.	+	0	transcript_id "g670.t1"; gene_id "g670";
Scaffold_1	AUGUSTUS	CDS	3404639	3405805	0.54	+	0	transcript_id "g670.t1"; gene_id "g670";
Scaffold_1	AUGUSTUS	stop_codon	3405803	3405805	.	+	0	transcript_id "g670.t1"; gene_id "g670";
# protein sequence = [MPFGMSLASGPVGTPALYDPNAPVGSRWSNSGFSTSNIARLYHSSAILLPDASVLIAGSNPNVDVNLTTYFPTTYQAE
# IFYPAYFSATTRPIPSGIPTTLSYGGDSFDITVPASSYSGSGNDAADNTTVVVVRPGWTTHGMNMGQRFLQLNNTYTVNSDGSLTLHTAQMPPNPNIF
# QPGPAMVFVVVNGIPSNGTFVIVGSGNVETQATAGASVLPASVLLSGASGSADGSSTSSGDNPTNSSGSTVSHTAVIVGTVVAGIIILGVIGALIGVC
# ASRRRRAAAQKNPNVSSYAMSNTPLGSKTLGAAGYGGGLRSSDSSAFSLQRDFNDSQQWSSSSANLTGDGRLSPYHDAPLYLDDSRGPHGMSMELDPY
# AAQSRMSTSSPHGQGY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g670
###
# start gene g671
Scaffold_1	AUGUSTUS	gene	3406739	3407698	0.3	+	.	g671
Scaffold_1	AUGUSTUS	transcript	3406739	3407698	0.3	+	.	g671.t1
Scaffold_1	AUGUSTUS	start_codon	3406739	3406741	.	+	0	transcript_id "g671.t1"; gene_id "g671";
Scaffold_1	AUGUSTUS	CDS	3406739	3407001	0.32	+	0	transcript_id "g671.t1"; gene_id "g671";
Scaffold_1	AUGUSTUS	CDS	3407065	3407698	0.62	+	1	transcript_id "g671.t1"; gene_id "g671";
Scaffold_1	AUGUSTUS	stop_codon	3407696	3407698	.	+	0	transcript_id "g671.t1"; gene_id "g671";
# protein sequence = [MLSKDYPGGKMIDPIPGVQNQEFYVDKDGTSRVDLSFVEEPLGLSGSEGYGWPQLEFGERIGPDLRYEIKRKLGWGMS
# SSTWLAYDTGVNDYVAIKALTGFSTELRRRGRIWESEALQRVAGSNNHCLHLLNEFTHPGKGSSGDHSCFVTPVYGGDVKMLRAQHKNFPLPLAKRML
# LHTLRGIAHAHSKGLIHTDLKHDNIFFTSPLSRQDIDANLASDPPRRNPPEASLDGIVSSAVTQPLPVPSLDDAMKCEYLIADFGSGTIFCLFYLCFF
# LIPGVPTKLSSLINLRSSKSHQLP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g671
###
# start gene g672
Scaffold_1	AUGUSTUS	gene	3409013	3409312	0.79	+	.	g672
Scaffold_1	AUGUSTUS	transcript	3409013	3409312	0.79	+	.	g672.t1
Scaffold_1	AUGUSTUS	start_codon	3409013	3409015	.	+	0	transcript_id "g672.t1"; gene_id "g672";
Scaffold_1	AUGUSTUS	CDS	3409013	3409312	0.79	+	0	transcript_id "g672.t1"; gene_id "g672";
Scaffold_1	AUGUSTUS	stop_codon	3409310	3409312	.	+	0	transcript_id "g672.t1"; gene_id "g672";
# protein sequence = [MSSKDSLFGAKLDLVPGVQNQHVSVDKDGKNVVDLSFVEEPLGLPGLEGFGWPQLEFGERIGPDLRYEIKRKLGWGMH
# SSTWLAYDTRRVEILFFSKSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g672
###
# start gene g673
Scaffold_1	AUGUSTUS	gene	3410768	3411910	0.94	+	.	g673
Scaffold_1	AUGUSTUS	transcript	3410768	3411910	0.94	+	.	g673.t1
Scaffold_1	AUGUSTUS	start_codon	3410768	3410770	.	+	0	transcript_id "g673.t1"; gene_id "g673";
Scaffold_1	AUGUSTUS	CDS	3410768	3411910	0.94	+	0	transcript_id "g673.t1"; gene_id "g673";
Scaffold_1	AUGUSTUS	stop_codon	3411908	3411910	.	+	0	transcript_id "g673.t1"; gene_id "g673";
# protein sequence = [MDALIAKADATQPLSKKRKRTHPSDSKPGPSQKSDKTSASITKNTSLPTSLRSRTDKSADAPQFKHIANPKLRRSLVK
# TSTHIAQSQALLSDAIDLLPSEETGFVQAEDTMERTWRLSQVDIVKEAGGEAARGRLEMKLDGGPYRVRYTKNGRHMAIAGRTGHVASFDTLTGAVHS
# ELQLGETCSDVVFLQDHSFYAVAQQKYVFIYDRDGVEIHKLKAHVSPTRLEFLPYHWLLASVGTAGYLKYQDTSTGQLVAEHRTALGACSVLAQNPHN
# AVLYLGHQNGCVTLWTPNLPHPAVKVLAHLGPLSSVSIDPSESGRYMATTGKDGSVKVWDCRNWKGAVREWTLRSGGKGDAEVEWSQKGVLAVGSGGV
# STCIRRLQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g673
###
# start gene g674
Scaffold_1	AUGUSTUS	gene	3416461	3417234	0.85	-	.	g674
Scaffold_1	AUGUSTUS	transcript	3416461	3417234	0.85	-	.	g674.t1
Scaffold_1	AUGUSTUS	stop_codon	3416461	3416463	.	-	0	transcript_id "g674.t1"; gene_id "g674";
Scaffold_1	AUGUSTUS	CDS	3416461	3417234	0.85	-	0	transcript_id "g674.t1"; gene_id "g674";
Scaffold_1	AUGUSTUS	start_codon	3417232	3417234	.	-	0	transcript_id "g674.t1"; gene_id "g674";
# protein sequence = [MRLFSFIRCAVALYGLTLEAFYPFDVLPVTVSDEIKETLKAQAKDVNYISAIISLSFLTIFLYLIAVFSVVHGAVRIA
# MYYRPKFRELVEKRMAERALKAQNKKKHSKRAVLRSVMFNLLFSVLLIINDIIFNRPEDASSFKEGVTERFEYLLQGAMSIACVQFLALSCTLIFAVF
# FSAARAIYRGCRQRRVVADEESRLAPTDMAEVEAEGQKTFALEEKLVDLSDGFDVIYEKMETYAAPPAVEAEAIEEPLIKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g674
###
# start gene g675
Scaffold_1	AUGUSTUS	gene	3418715	3419128	0.76	-	.	g675
Scaffold_1	AUGUSTUS	transcript	3418715	3419128	0.76	-	.	g675.t1
Scaffold_1	AUGUSTUS	stop_codon	3418715	3418717	.	-	0	transcript_id "g675.t1"; gene_id "g675";
Scaffold_1	AUGUSTUS	CDS	3418715	3419128	0.76	-	0	transcript_id "g675.t1"; gene_id "g675";
Scaffold_1	AUGUSTUS	start_codon	3419126	3419128	.	-	0	transcript_id "g675.t1"; gene_id "g675";
# protein sequence = [MKTLLLAMISPGKSRGTREGAIRGLIGVGKEAVRKGLVDSGGAKVVGSEVQGHEMGDWVEDEALTKAVLDALRVLHPP
# SDSEMTDSLNLNNEADLQVLARLHEVLGEFFAQKVVGDAAWAKAILGENPNDDLPVMVG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g675
###
# start gene g676
Scaffold_1	AUGUSTUS	gene	3437899	3438575	0.22	+	.	g676
Scaffold_1	AUGUSTUS	transcript	3437899	3438575	0.22	+	.	g676.t1
Scaffold_1	AUGUSTUS	start_codon	3437899	3437901	.	+	0	transcript_id "g676.t1"; gene_id "g676";
Scaffold_1	AUGUSTUS	CDS	3437899	3438067	0.36	+	0	transcript_id "g676.t1"; gene_id "g676";
Scaffold_1	AUGUSTUS	CDS	3438139	3438575	0.58	+	2	transcript_id "g676.t1"; gene_id "g676";
Scaffold_1	AUGUSTUS	stop_codon	3438573	3438575	.	+	0	transcript_id "g676.t1"; gene_id "g676";
# protein sequence = [MSLIREVETHDMQRVLVLTGPAGTAKSSTIRVLSQELKFEIIEWKSSTSESFTNATGLWVSDDTIFTKFRLFLERASQ
# CQSVFSSSSTPNPRKRPLPSSSLSSSNSNPTPIQRLILLEDLPNVLHSNTRSQFHDVIRSLVENQDPNPVPVVIILSDSGMRGEAGDERLASGVWERD
# QDSAVDIRSILPKDVLNGPYVDEIR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g676
###
# start gene g677
Scaffold_1	AUGUSTUS	gene	3443565	3444576	0.98	+	.	g677
Scaffold_1	AUGUSTUS	transcript	3443565	3444576	0.98	+	.	g677.t1
Scaffold_1	AUGUSTUS	start_codon	3443565	3443567	.	+	0	transcript_id "g677.t1"; gene_id "g677";
Scaffold_1	AUGUSTUS	CDS	3443565	3443687	0.98	+	0	transcript_id "g677.t1"; gene_id "g677";
Scaffold_1	AUGUSTUS	CDS	3443753	3443973	1	+	0	transcript_id "g677.t1"; gene_id "g677";
Scaffold_1	AUGUSTUS	CDS	3444081	3444576	1	+	1	transcript_id "g677.t1"; gene_id "g677";
Scaffold_1	AUGUSTUS	stop_codon	3444574	3444576	.	+	0	transcript_id "g677.t1"; gene_id "g677";
# protein sequence = [MSYNNNNNNNNSDFGSNDSYGSNNNSNSESVRAIETPALAVSSGNNSSYGSKNSNSYGSAGNDNSYGSRANNSSDSYG
# SSGNHGSRNSNNSNSYGLAGNNDSYGSKNDNNNDTYGSNNKNSYGSNNTDAYGSSNNDSYGSNNNDSYGSLNNNSHGSNTKDSYAASNNNSYGSNTKD
# SYGGSNNDDSYGSSNNDSYGSSNNNRNNDSNNSSTYGNNDSYGSNSSNSNNQSGNQNQSSTNSYIEKGVAYAAEKAGYNLVCLLLSFPKLYSAETSLS
# GLANG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g677
###
# start gene g678
Scaffold_1	AUGUSTUS	gene	3447725	3448910	0.48	+	.	g678
Scaffold_1	AUGUSTUS	transcript	3447725	3448910	0.48	+	.	g678.t1
Scaffold_1	AUGUSTUS	start_codon	3447725	3447727	.	+	0	transcript_id "g678.t1"; gene_id "g678";
Scaffold_1	AUGUSTUS	CDS	3447725	3448108	0.49	+	0	transcript_id "g678.t1"; gene_id "g678";
Scaffold_1	AUGUSTUS	CDS	3448161	3448205	0.85	+	0	transcript_id "g678.t1"; gene_id "g678";
Scaffold_1	AUGUSTUS	CDS	3448302	3448910	0.98	+	0	transcript_id "g678.t1"; gene_id "g678";
Scaffold_1	AUGUSTUS	stop_codon	3448908	3448910	.	+	0	transcript_id "g678.t1"; gene_id "g678";
# protein sequence = [MPDSPIQQNLPISNADMLIHDEQDDHDGEEISQLSGQLLFQNQMPARATSDTDPFGSSPLPPLTPTPSPIPSLSSPLQ
# SRSDISDERNNLQIVMYNGQQLHLSQGIASHLQNLPPMPPSYHHYSANVSSRPPGPSMQPQIHLQGSTSPNSTPNRNNRGRGRGRSRGHQPENHNQVH
# ENNEEQNHNPHYREQYAPAGPLPLAMQPIQNDGVYNELSLGKMEIKCSNCKAFHWKAEMLTTSRGEEKLFGTCCLSGKVRLPLLEEPPVELLQLFNGE
# DHNSQHFLENIRTYNAAYAFVSLGLKLQPQNDPELPQTGVKQFKIKGELWHSLGSLLPEPGKILSMPNYIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g678
###
# start gene g679
Scaffold_1	AUGUSTUS	gene	3449710	3450330	0.26	+	.	g679
Scaffold_1	AUGUSTUS	transcript	3449710	3450330	0.26	+	.	g679.t1
Scaffold_1	AUGUSTUS	start_codon	3449710	3449712	.	+	0	transcript_id "g679.t1"; gene_id "g679";
Scaffold_1	AUGUSTUS	CDS	3449710	3450330	0.26	+	0	transcript_id "g679.t1"; gene_id "g679";
Scaffold_1	AUGUSTUS	stop_codon	3450328	3450330	.	+	0	transcript_id "g679.t1"; gene_id "g679";
# protein sequence = [MAISRHFGKPDLFMTITANPNASETKDALLQGQQANDRPDLIARVFREKVRLMLKLIDNGSFGKCRGRVHTIEFQKRG
# LPHIHILIFLHPSARLEDSHKIDQLISAQLPDPETQPRLFRLVEKLMIHGPCGALNPSASCMKDGKCSKGFPKSFQEQTTLSENGYTIYARPNNGRFC
# IKKVNGQDIQVDNTWVVPYPPWGLMQSEVI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g679
###
# start gene g680
Scaffold_1	AUGUSTUS	gene	3450408	3451526	0.5	+	.	g680
Scaffold_1	AUGUSTUS	transcript	3450408	3451526	0.5	+	.	g680.t1
Scaffold_1	AUGUSTUS	start_codon	3450408	3450410	.	+	0	transcript_id "g680.t1"; gene_id "g680";
Scaffold_1	AUGUSTUS	CDS	3450408	3451526	0.5	+	0	transcript_id "g680.t1"; gene_id "g680";
Scaffold_1	AUGUSTUS	stop_codon	3451524	3451526	.	+	0	transcript_id "g680.t1"; gene_id "g680";
# protein sequence = [MGIGTNQDEITLYLDSRYVSASEACWRLFHYELHQEKPNVVRLAVHDENGQYITFKPNDPRPVQDIAEAEGRKDSTLL
# GFFKVNKQEKEKAESDPENASTEARSLLYQEFPSKWVWQVDKRRWKIRERNISAIGRMYFVHPGAGNQFYVRLLLTVIRGPTSFADLRTYNGIEYDSF
# KQACLARGLLEDDGEWKDCLEDARHMQTGSSLRSLFATILKDCHPQQPGVLWEQFREYLCDDLHYHLQTSGILHNPTQQQVENYGLYLIDQILFHAGI
# FEGLKLYEGMPLPDYALWNTVLGNRLVAEQMAFDPQEQQQKAAENIAMLNVGQRNAFDKVMNAITSNHPQMFFYMDLLELERPLHIKHSVTCSGVYQR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g680
###
# start gene g681
Scaffold_1	AUGUSTUS	gene	3452178	3452756	0.57	+	.	g681
Scaffold_1	AUGUSTUS	transcript	3452178	3452756	0.57	+	.	g681.t1
Scaffold_1	AUGUSTUS	start_codon	3452178	3452180	.	+	0	transcript_id "g681.t1"; gene_id "g681";
Scaffold_1	AUGUSTUS	CDS	3452178	3452756	0.57	+	0	transcript_id "g681.t1"; gene_id "g681";
Scaffold_1	AUGUSTUS	stop_codon	3452754	3452756	.	+	0	transcript_id "g681.t1"; gene_id "g681";
# protein sequence = [MICLNALAGNMSTYHSADSIGANEGEDNNNEFQYPVEYLNSINGSGLPLAKLELKIGAPIMVLRNLDPSSGICNGTRE
# LRAILTKCTTRVLEARILGGDYSGKLILIPRITLSPSDVDLPFVLKRQFPVRLAFAMSINKSQGQSVKFVGLNLQTPVFTHGQLYVALSRSTTKAGVK
# VLFHEGKFHNAFDASL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g681
###
# start gene g682
Scaffold_1	AUGUSTUS	gene	3460711	3461184	0.93	+	.	g682
Scaffold_1	AUGUSTUS	transcript	3460711	3461184	0.93	+	.	g682.t1
Scaffold_1	AUGUSTUS	start_codon	3460711	3460713	.	+	0	transcript_id "g682.t1"; gene_id "g682";
Scaffold_1	AUGUSTUS	CDS	3460711	3461184	0.93	+	0	transcript_id "g682.t1"; gene_id "g682";
Scaffold_1	AUGUSTUS	stop_codon	3461182	3461184	.	+	0	transcript_id "g682.t1"; gene_id "g682";
# protein sequence = [MSKERPSSSRLESKKQKSAFSRGNMTQAQKSSQAASSTVIMVAAGQCLMSIPEQSFGDEVVSSVRTPEGRQPAVQEPP
# PVEPVMGPTQRRYTSMGYAQSASSPMGGFAYSLPGEREDLPLDRLPQLDMGVLNAGGRVSGQVAAIERIQGESRDPLTV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g682
###
# start gene g683
Scaffold_1	AUGUSTUS	gene	3465669	3466695	0.62	-	.	g683
Scaffold_1	AUGUSTUS	transcript	3465669	3466695	0.62	-	.	g683.t1
Scaffold_1	AUGUSTUS	stop_codon	3465669	3465671	.	-	0	transcript_id "g683.t1"; gene_id "g683";
Scaffold_1	AUGUSTUS	CDS	3465669	3466020	0.99	-	1	transcript_id "g683.t1"; gene_id "g683";
Scaffold_1	AUGUSTUS	CDS	3466124	3466695	0.62	-	0	transcript_id "g683.t1"; gene_id "g683";
Scaffold_1	AUGUSTUS	start_codon	3466693	3466695	.	-	0	transcript_id "g683.t1"; gene_id "g683";
# protein sequence = [MVTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFSGLSVKRSPWNFTIPLDI
# IRKPMGRLSVSIRLSNSTSGSIVPTNRMTGRLYFRSPSSPITTLPMLPLVLLHSSLTKDTTQITVRPEVDMKSDLARDFVVNSMNSTFLREEILLAQS
# RYKEQADRKRISHPDRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYE
# GTDDEFSWVAADELHADELVPAFHARYPLKPGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g683
###
# start gene g684
Scaffold_1	AUGUSTUS	gene	3470553	3471613	0.41	+	.	g684
Scaffold_1	AUGUSTUS	transcript	3470553	3471613	0.41	+	.	g684.t1
Scaffold_1	AUGUSTUS	start_codon	3470553	3470555	.	+	0	transcript_id "g684.t1"; gene_id "g684";
Scaffold_1	AUGUSTUS	CDS	3470553	3470719	0.57	+	0	transcript_id "g684.t1"; gene_id "g684";
Scaffold_1	AUGUSTUS	CDS	3470811	3470977	0.48	+	1	transcript_id "g684.t1"; gene_id "g684";
Scaffold_1	AUGUSTUS	CDS	3471081	3471613	0.49	+	2	transcript_id "g684.t1"; gene_id "g684";
Scaffold_1	AUGUSTUS	stop_codon	3471611	3471613	.	+	0	transcript_id "g684.t1"; gene_id "g684";
# protein sequence = [MITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAENRGHINLPFAADVPKTDRNYLQA
# LKPKVEDEFKDLLGIKIRKFDPRELTENNSKWLPVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEF
# TKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHRED
# DVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g684
###
# start gene g685
Scaffold_1	AUGUSTUS	gene	3471643	3473080	0.35	+	.	g685
Scaffold_1	AUGUSTUS	transcript	3471643	3473080	0.35	+	.	g685.t1
Scaffold_1	AUGUSTUS	start_codon	3471643	3471645	.	+	0	transcript_id "g685.t1"; gene_id "g685";
Scaffold_1	AUGUSTUS	CDS	3471643	3472308	0.43	+	0	transcript_id "g685.t1"; gene_id "g685";
Scaffold_1	AUGUSTUS	CDS	3472355	3473080	0.4	+	0	transcript_id "g685.t1"; gene_id "g685";
Scaffold_1	AUGUSTUS	stop_codon	3473078	3473080	.	+	0	transcript_id "g685.t1"; gene_id "g685";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA
# ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVA
# YEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQ
# NKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g685
###
# start gene g686
Scaffold_1	AUGUSTUS	gene	3473404	3474709	0.8	+	.	g686
Scaffold_1	AUGUSTUS	transcript	3473404	3474709	0.8	+	.	g686.t1
Scaffold_1	AUGUSTUS	start_codon	3473404	3473406	.	+	0	transcript_id "g686.t1"; gene_id "g686";
Scaffold_1	AUGUSTUS	CDS	3473404	3473426	0.8	+	0	transcript_id "g686.t1"; gene_id "g686";
Scaffold_1	AUGUSTUS	CDS	3473482	3474709	0.88	+	1	transcript_id "g686.t1"; gene_id "g686";
Scaffold_1	AUGUSTUS	stop_codon	3474707	3474709	.	+	0	transcript_id "g686.t1"; gene_id "g686";
# protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY
# ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFR
# IERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNI
# PIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQL
# SRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTIFYEMKYHT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g686
###
# start gene g687
Scaffold_1	AUGUSTUS	gene	3481035	3482752	0.21	-	.	g687
Scaffold_1	AUGUSTUS	transcript	3481035	3482752	0.21	-	.	g687.t1
Scaffold_1	AUGUSTUS	stop_codon	3481035	3481037	.	-	0	transcript_id "g687.t1"; gene_id "g687";
Scaffold_1	AUGUSTUS	CDS	3481035	3481882	0.82	-	2	transcript_id "g687.t1"; gene_id "g687";
Scaffold_1	AUGUSTUS	CDS	3482162	3482427	0.36	-	1	transcript_id "g687.t1"; gene_id "g687";
Scaffold_1	AUGUSTUS	CDS	3482595	3482752	0.69	-	0	transcript_id "g687.t1"; gene_id "g687";
Scaffold_1	AUGUSTUS	start_codon	3482750	3482752	.	-	0	transcript_id "g687.t1"; gene_id "g687";
# protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTHSPRTGNPQRRAASESPRDPPPHFD
# LDTGDHDDQDPPVDPDDPGRRTTIDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPLGQPEWFVPDILDPDLDSLPAWTSSFKALVKELQD
# NFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYVKKFFVLTIVIGNARKLESVRLV
# SLLLRNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKH
# QIADCNKRKARESKGRAAEVEETPKQPLRLLKRNRKTSPQLLFPGTKRELR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g687
###
# start gene g688
Scaffold_1	AUGUSTUS	gene	3483458	3483724	0.59	+	.	g688
Scaffold_1	AUGUSTUS	transcript	3483458	3483724	0.59	+	.	g688.t1
Scaffold_1	AUGUSTUS	start_codon	3483458	3483460	.	+	0	transcript_id "g688.t1"; gene_id "g688";
Scaffold_1	AUGUSTUS	CDS	3483458	3483724	0.59	+	0	transcript_id "g688.t1"; gene_id "g688";
Scaffold_1	AUGUSTUS	stop_codon	3483722	3483724	.	+	0	transcript_id "g688.t1"; gene_id "g688";
# protein sequence = [MPEEHIAQVVLEWPPCHDKTEVRAFLGTASQLRMFIATLLGKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL
# RPINLIGMFT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g688
###
# start gene g689
Scaffold_1	AUGUSTUS	gene	3484096	3484778	0.24	+	.	g689
Scaffold_1	AUGUSTUS	transcript	3484096	3484778	0.24	+	.	g689.t1
Scaffold_1	AUGUSTUS	start_codon	3484096	3484098	.	+	0	transcript_id "g689.t1"; gene_id "g689";
Scaffold_1	AUGUSTUS	CDS	3484096	3484195	0.27	+	0	transcript_id "g689.t1"; gene_id "g689";
Scaffold_1	AUGUSTUS	CDS	3484258	3484778	0.83	+	2	transcript_id "g689.t1"; gene_id "g689";
Scaffold_1	AUGUSTUS	stop_codon	3484776	3484778	.	+	0	transcript_id "g689.t1"; gene_id "g689";
# protein sequence = [MANKTSRSNPEDYVDENGGEPINLLWEMGKRKSPQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNCSL
# LLTKNLLQNNPYPEAHRSSEGNRLDELIPLIEKYLSNPSDESLGEMSKDERIKFIRLIKKFKWTTKEGCTIEILINLIKPQISGEKEKRMHMLNSAHD
# CLGHKGVFATNDFCRNDSGGLTYIKTWNGM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g689
###
# start gene g690
Scaffold_1	AUGUSTUS	gene	3487000	3487642	0.82	-	.	g690
Scaffold_1	AUGUSTUS	transcript	3487000	3487642	0.82	-	.	g690.t1
Scaffold_1	AUGUSTUS	stop_codon	3487000	3487002	.	-	0	transcript_id "g690.t1"; gene_id "g690";
Scaffold_1	AUGUSTUS	CDS	3487000	3487209	0.91	-	0	transcript_id "g690.t1"; gene_id "g690";
Scaffold_1	AUGUSTUS	CDS	3487249	3487416	1	-	0	transcript_id "g690.t1"; gene_id "g690";
Scaffold_1	AUGUSTUS	CDS	3487475	3487642	0.9	-	0	transcript_id "g690.t1"; gene_id "g690";
Scaffold_1	AUGUSTUS	start_codon	3487640	3487642	.	-	0	transcript_id "g690.t1"; gene_id "g690";
# protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLEKPVTLRSHVRQVSNLTARQSI
# IDTLCLGHKLFPDIVSDSHFEQHLKFMAFANDAHSFQNTFIRNRLLNRARSVHSDHEASTRADNSRFIRKSKKKATRFASSRDVKREPRSVRFDSDVE
# VNPQI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g690
###
# start gene g691
Scaffold_1	AUGUSTUS	gene	3488657	3489315	0.45	-	.	g691
Scaffold_1	AUGUSTUS	transcript	3488657	3489315	0.45	-	.	g691.t1
Scaffold_1	AUGUSTUS	stop_codon	3488657	3488659	.	-	0	transcript_id "g691.t1"; gene_id "g691";
Scaffold_1	AUGUSTUS	CDS	3488657	3489204	0.95	-	2	transcript_id "g691.t1"; gene_id "g691";
Scaffold_1	AUGUSTUS	CDS	3489267	3489315	0.45	-	0	transcript_id "g691.t1"; gene_id "g691";
Scaffold_1	AUGUSTUS	start_codon	3489313	3489315	.	-	0	transcript_id "g691.t1"; gene_id "g691";
# protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTARELFLRSILDLQNAGEDPIVVLEALKTAEPNRRAIT
# LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIQSGESTVHIDEHGHLVEASPPPDSATEALEGLKEVERGSADEGTSSPVGGSVPMELDLP
# TIESLAERALSPEKGAESAQTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g691
###
# start gene g692
Scaffold_1	AUGUSTUS	gene	3489913	3490617	0.3	-	.	g692
Scaffold_1	AUGUSTUS	transcript	3489913	3490617	0.3	-	.	g692.t1
Scaffold_1	AUGUSTUS	stop_codon	3489913	3489915	.	-	0	transcript_id "g692.t1"; gene_id "g692";
Scaffold_1	AUGUSTUS	CDS	3489913	3490349	0.58	-	2	transcript_id "g692.t1"; gene_id "g692";
Scaffold_1	AUGUSTUS	CDS	3490410	3490617	0.56	-	0	transcript_id "g692.t1"; gene_id "g692";
Scaffold_1	AUGUSTUS	start_codon	3490615	3490617	.	-	0	transcript_id "g692.t1"; gene_id "g692";
# protein sequence = [MMRLAPSKELDVFAPLRGKGSPGASKAVSPPKVSDVISPPPVTKAQAVPPRALRRNREIESLKADASSFLASPRSTHS
# KDSDNELLSGFPLVDEAPRASSSAKVSVGRKEPKSKTTVKVVEDPKADHPPLAGMAYKRVRLPPRSRKNTSIASKGKARQIVVTDEDSTSNEVESEDE
# DEDEDTAPPPKRLKTTSSISGKIFILHFLSHFINSIRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g692
###
# start gene g693
Scaffold_1	AUGUSTUS	gene	3494956	3496479	0.74	-	.	g693
Scaffold_1	AUGUSTUS	transcript	3494956	3496479	0.74	-	.	g693.t1
Scaffold_1	AUGUSTUS	stop_codon	3494956	3494958	.	-	0	transcript_id "g693.t1"; gene_id "g693";
Scaffold_1	AUGUSTUS	CDS	3494956	3496479	0.74	-	0	transcript_id "g693.t1"; gene_id "g693";
Scaffold_1	AUGUSTUS	start_codon	3496477	3496479	.	-	0	transcript_id "g693.t1"; gene_id "g693";
# protein sequence = [MFRARTVLRATRTLTLRPAINSSFIRSNSSNSSRPEDLPPAQTHSVQEGFAQGPIFVLNVAKRFIKFFIIGGVSLGLT
# TGLLFEGTHIWVENVEFALPQDDEETRRWEWNLERENWTGDFEAAGTDPALGIRGRHLVRAAWMAQHWGVDQSTVIVSSDSVKNDDGLLGPRGLVIID
# PRLVRAENFLRDVILIAEQKSIEGKLRPWTMTQLLSLHASVLDRMGSESMITAKAQYERAWSAQPFIAPQSARIALKLGDLNRRLGDDNGALAWLNRA
# IHITQSLSESSGVPPSMPSSPYAQRSLLYALSSLSACYATTGKLAEAQSTAEASLDLIRSVRQPESIASISPPHALHALTLLQRSSVLAIHLAEVLYA
# QNKPTIVSTQWLSTAAESSERVIRVLTGSPLNTGTDRVLVTPVNTIQPSYLNNASLKRPATSLYRDSRRTAAEAWNLTGILLEIKDPKAALAAYEHAV
# HLAGSSEEHGKPADKTLKVDWEIIWGNYTRLKSRIQS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g693
###
# start gene g694
Scaffold_1	AUGUSTUS	gene	3498836	3499183	0.3	+	.	g694
Scaffold_1	AUGUSTUS	transcript	3498836	3499183	0.3	+	.	g694.t1
Scaffold_1	AUGUSTUS	start_codon	3498836	3498838	.	+	0	transcript_id "g694.t1"; gene_id "g694";
Scaffold_1	AUGUSTUS	CDS	3498836	3499183	0.3	+	0	transcript_id "g694.t1"; gene_id "g694";
Scaffold_1	AUGUSTUS	stop_codon	3499181	3499183	.	+	0	transcript_id "g694.t1"; gene_id "g694";
# protein sequence = [MSNGRRLGLYYLSPNRTRERGIRVRGRWVSTRKSHVLPLFLTNRVSFFIKATKRQSDSQGVGSAFDGSQGVDSEDILG
# IPQIGFGSFQLFPDQNSCMSIVHSLPAFGSLILTEKI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g694
###
# start gene g695
Scaffold_1	AUGUSTUS	gene	3499322	3499635	0.64	+	.	g695
Scaffold_1	AUGUSTUS	transcript	3499322	3499635	0.64	+	.	g695.t1
Scaffold_1	AUGUSTUS	start_codon	3499322	3499324	.	+	0	transcript_id "g695.t1"; gene_id "g695";
Scaffold_1	AUGUSTUS	CDS	3499322	3499442	0.65	+	0	transcript_id "g695.t1"; gene_id "g695";
Scaffold_1	AUGUSTUS	CDS	3499496	3499635	0.95	+	2	transcript_id "g695.t1"; gene_id "g695";
Scaffold_1	AUGUSTUS	stop_codon	3499633	3499635	.	+	0	transcript_id "g695.t1"; gene_id "g695";
# protein sequence = [MEYRFDKPVSLLGFGLVTQTNAPDFVPFNSTVAPFASDTTSTVSKASSTSSSASANSTQTFGVTDSEQATAYSTWLNS
# ELKSSYTV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g695
###
# start gene g696
Scaffold_1	AUGUSTUS	gene	3502432	3503173	0.49	+	.	g696
Scaffold_1	AUGUSTUS	transcript	3502432	3503173	0.49	+	.	g696.t1
Scaffold_1	AUGUSTUS	start_codon	3502432	3502434	.	+	0	transcript_id "g696.t1"; gene_id "g696";
Scaffold_1	AUGUSTUS	CDS	3502432	3502458	0.61	+	0	transcript_id "g696.t1"; gene_id "g696";
Scaffold_1	AUGUSTUS	CDS	3502515	3502647	0.52	+	0	transcript_id "g696.t1"; gene_id "g696";
Scaffold_1	AUGUSTUS	CDS	3502791	3503173	0.57	+	2	transcript_id "g696.t1"; gene_id "g696";
Scaffold_1	AUGUSTUS	stop_codon	3503171	3503173	.	+	0	transcript_id "g696.t1"; gene_id "g696";
# protein sequence = [MSIFTVRRMLPFFDIVIYSFHYLLDPKVAEQVSKEMSKDAIVVFDEAHNIGQTLSGNIILRCVIQSEFILRIKVTDAA
# KLQNEYAKLVEGLQEGSEDPEDNDGFMTTPGKTLPFIKETENPSSKTRYSQVLPDDLLHEAIPGNIRKAEHFVAFLKRFVEYLKVYSANFGMSANVTQ
# LNVD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g696
###
# start gene g697
Scaffold_1	AUGUSTUS	gene	3509877	3510643	0.97	+	.	g697
Scaffold_1	AUGUSTUS	transcript	3509877	3510643	0.97	+	.	g697.t1
Scaffold_1	AUGUSTUS	start_codon	3509877	3509879	.	+	0	transcript_id "g697.t1"; gene_id "g697";
Scaffold_1	AUGUSTUS	CDS	3509877	3510203	0.97	+	0	transcript_id "g697.t1"; gene_id "g697";
Scaffold_1	AUGUSTUS	CDS	3510311	3510643	0.97	+	0	transcript_id "g697.t1"; gene_id "g697";
Scaffold_1	AUGUSTUS	stop_codon	3510641	3510643	.	+	0	transcript_id "g697.t1"; gene_id "g697";
# protein sequence = [MTNNDQQKGKSPSISACSFAQAVSAITAIELLVETCKAARDSIFNHPQSTEDPPPLPVLHQDLLSLLSLVYGSVTKLS
# LTLKPSSPTYSACLVPLQDYQTTSPPFHIASIEGSSERSRTGDEYLVRTGAVHSVIDIARHADGGLSENNLTAVRRLWFKDAGALEDGVREVVEMIED
# VQSGITTESEDGWDELGLEPSQPLTEQELKVAQKVNIVNPLQN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g697
###
# start gene g698
Scaffold_1	AUGUSTUS	gene	3512455	3513463	0.71	-	.	g698
Scaffold_1	AUGUSTUS	transcript	3512455	3513463	0.71	-	.	g698.t1
Scaffold_1	AUGUSTUS	stop_codon	3512455	3512457	.	-	0	transcript_id "g698.t1"; gene_id "g698";
Scaffold_1	AUGUSTUS	CDS	3512455	3513327	0.91	-	0	transcript_id "g698.t1"; gene_id "g698";
Scaffold_1	AUGUSTUS	CDS	3513404	3513463	0.73	-	0	transcript_id "g698.t1"; gene_id "g698";
Scaffold_1	AUGUSTUS	start_codon	3513461	3513463	.	-	0	transcript_id "g698.t1"; gene_id "g698";
# protein sequence = [MDEVNFCAIKIIPFSELQTADRAPFSPPQKRTRYSRSPTEPEEDILIDVDDDRSEGLLSPSRSFTPPQQQKSSSKKRE
# SYPSSTRSRESKKRWADDSGDEFDVGVMSDDLGRGILDERDDDEEFVDDVPKKGKGKSSTAKVKGIKGGKGTKNPRVKGKGQSQEKEITVRDERQGVA
# SSSMKIRIKPSVNVDAVPVTNPGMGSVAPDAEKGDGPIPQKKRKLPSIKKNKTAASGTPTTVAKPTASINASSKTTMADGVPSTPAARASAGSQGGDF
# NLQDRNVYEMLFKSVRTVVYILLHLLNLVQNLDGRK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g698
###
# start gene g699
Scaffold_1	AUGUSTUS	gene	3515327	3515782	0.94	-	.	g699
Scaffold_1	AUGUSTUS	transcript	3515327	3515782	0.94	-	.	g699.t1
Scaffold_1	AUGUSTUS	stop_codon	3515327	3515329	.	-	0	transcript_id "g699.t1"; gene_id "g699";
Scaffold_1	AUGUSTUS	CDS	3515327	3515782	0.94	-	0	transcript_id "g699.t1"; gene_id "g699";
Scaffold_1	AUGUSTUS	start_codon	3515780	3515782	.	-	0	transcript_id "g699.t1"; gene_id "g699";
# protein sequence = [MCRLSIPFSTSFTDDSLLYSRYSFSATNAAQTSEEEEQELSESVRTISDLFQSNALAPEPVPVPDSLDRVASISAEIA
# AAIAQAHQRVFEDDEEESDYEQEMPARETITLNTSGIRGLGEDRLHRADSEFEDERFPQQLRALKNNSNKRKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g699
###
# start gene g700
Scaffold_1	AUGUSTUS	gene	3516180	3517154	0.9	-	.	g700
Scaffold_1	AUGUSTUS	transcript	3516180	3517154	0.9	-	.	g700.t1
Scaffold_1	AUGUSTUS	stop_codon	3516180	3516182	.	-	0	transcript_id "g700.t1"; gene_id "g700";
Scaffold_1	AUGUSTUS	CDS	3516180	3517154	0.9	-	0	transcript_id "g700.t1"; gene_id "g700";
Scaffold_1	AUGUSTUS	start_codon	3517152	3517154	.	-	0	transcript_id "g700.t1"; gene_id "g700";
# protein sequence = [MESDTLPLDLSDVVHDESLGQDAHPHTSQGQHDSRSTSVFESDSGLLTTLQPPFEEDPEVHSRGQTPTLSSLEMLENE
# LVNLLHQNASAAAANAALISAAAQQHQSDRPSTREQETPPATDIGSYLSGLAVVLQAAQAQAQLNDSDRIALDALLSAKDLSVLGDKGNRSTRAAPSF
# HSLTAANDSREPSRKRRRRGLEETREDFLYTELHGRSEDDGTEDSGSETRPDDPAANPLPHADFTDINDIFTHLSTQLSAQFEADPAVAPEHCSSKQL
# GPQFSHPRIAVPYSPSPPPLASCLSRIPPRKPKSRGRNSRTHMFVNNSTV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g700
###
# start gene g701
Scaffold_1	AUGUSTUS	gene	3517995	3518441	1	+	.	g701
Scaffold_1	AUGUSTUS	transcript	3517995	3518441	1	+	.	g701.t1
Scaffold_1	AUGUSTUS	start_codon	3517995	3517997	.	+	0	transcript_id "g701.t1"; gene_id "g701";
Scaffold_1	AUGUSTUS	CDS	3517995	3518441	1	+	0	transcript_id "g701.t1"; gene_id "g701";
Scaffold_1	AUGUSTUS	stop_codon	3518439	3518441	.	+	0	transcript_id "g701.t1"; gene_id "g701";
# protein sequence = [MSLSSDDHSSRPQQQNGALWGPEDERYYSANASSSSGGRWRYPANFDDAVLPSSGSKRGKKKKEKKDRWARTEDAYSI
# SEQQSRKRVKKKKSRSSVAPSVISADDSTAGYPEDPEGGLYGNTQAIEEPRSMETNGQRPTNDDIFSHEF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g701
###
# start gene g702
Scaffold_1	AUGUSTUS	gene	3525399	3527054	0.74	+	.	g702
Scaffold_1	AUGUSTUS	transcript	3525399	3527054	0.74	+	.	g702.t1
Scaffold_1	AUGUSTUS	start_codon	3525399	3525401	.	+	0	transcript_id "g702.t1"; gene_id "g702";
Scaffold_1	AUGUSTUS	CDS	3525399	3527054	0.74	+	0	transcript_id "g702.t1"; gene_id "g702";
Scaffold_1	AUGUSTUS	stop_codon	3527052	3527054	.	+	0	transcript_id "g702.t1"; gene_id "g702";
# protein sequence = [MPFNGIASPVVGINEPVNDNDNTLNASVLPSISLSHSASSSYNASNFACLTVAQKQLVFHALIQSSSILCNDLRKMAS
# LHLNLSTRNTYNQHKNKSDLLTDYAQHQCSNYCLIYHAQAEIVKFFSVPSISQFEFLECAKALGLRNYNQKSSNKRKSEHISSSHKRKKVAHSPTPVL
# NSTNSDPVIDSEIWPEILTLDEKLAILQESYDAGCNTSIKKVECSFCGTLETVDKICSILCTDLDISLLNTAVQELRSKTKQAKIKAFQQHTISNGCY
# QLCIQCKREVRFKTSTDNTSVRDKSQCTFVQLPLRSYANGTWTGDLPDALNGLTFLEEQCIARARATKCMFKLELGPSGQYASRGNVCIFPQDPGPLA
# TCFPPPLSQIHDEICVILVGSPDAEITIETLMQTPLLVRRSRIIEALEWLQMNNPLYYDLNLDTMYNNASQYPENGIPIPLKSVIRISSNSEGSSYTA
# QANFEQFNENVSSSGMLSSTVVDADHIDSTYQMRKLSALQHLKRGNKPFIKFPSGSTPLSTYRIQNFMHICGQHFFLMVLE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g702
###
# start gene g703
Scaffold_1	AUGUSTUS	gene	3527265	3527819	0.59	+	.	g703
Scaffold_1	AUGUSTUS	transcript	3527265	3527819	0.59	+	.	g703.t1
Scaffold_1	AUGUSTUS	start_codon	3527265	3527267	.	+	0	transcript_id "g703.t1"; gene_id "g703";
Scaffold_1	AUGUSTUS	CDS	3527265	3527819	0.59	+	0	transcript_id "g703.t1"; gene_id "g703";
Scaffold_1	AUGUSTUS	stop_codon	3527817	3527819	.	+	0	transcript_id "g703.t1"; gene_id "g703";
# protein sequence = [MLLCKLSNNTITEFSEKLKKNPFVHPETEGEKAAKQLMKYINYIGENIPGSMSEVQNMREELFSVVHTNGLPHVFLTL
# NPSDTNNPIAQLIAGRDIDLNQIFHNLKPHTENLERSTCIAQNPIAAAQFFDISVKNLLHILLGTKRQNRKGVFGEVVVYYGVVEAQGRGSLHISAYL
# ARAWLIPQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g703
###
# start gene g704
Scaffold_1	AUGUSTUS	gene	3528335	3528847	0.88	+	.	g704
Scaffold_1	AUGUSTUS	transcript	3528335	3528847	0.88	+	.	g704.t1
Scaffold_1	AUGUSTUS	start_codon	3528335	3528337	.	+	0	transcript_id "g704.t1"; gene_id "g704";
Scaffold_1	AUGUSTUS	CDS	3528335	3528847	0.88	+	0	transcript_id "g704.t1"; gene_id "g704";
Scaffold_1	AUGUSTUS	stop_codon	3528845	3528847	.	+	0	transcript_id "g704.t1"; gene_id "g704";
# protein sequence = [MDTAFVFSALCAAIKLLTENPPMDIDGNLDTYEHSRQFLIKTVNKLIGKRELSGQQIASKLIGTPSCYTNCRYPIFYW
# SGMLREIASDIFDIANWNNDNESDMTINDSGNEDLHTSQQNLQQREFDDSFVFLTEKTVQSGKFSLKNHSHNSLFNDFFSDLKSFLTFVLGI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g704
###
# start gene g705
Scaffold_1	AUGUSTUS	gene	3528955	3529272	0.79	+	.	g705
Scaffold_1	AUGUSTUS	transcript	3528955	3529272	0.79	+	.	g705.t1
Scaffold_1	AUGUSTUS	start_codon	3528955	3528957	.	+	0	transcript_id "g705.t1"; gene_id "g705";
Scaffold_1	AUGUSTUS	CDS	3528955	3529272	0.79	+	0	transcript_id "g705.t1"; gene_id "g705";
Scaffold_1	AUGUSTUS	stop_codon	3529270	3529272	.	+	0	transcript_id "g705.t1"; gene_id "g705";
# protein sequence = [MNIGDDPRVPVLKGYPIPQSDKIEHHEKYMIAMLALFKPWSHNEQSPLKTPEETWDTAFNTWKNTDLFKSHIKIINNM
# QLLYESKDAKLDYSAQRQKRLQSFPTK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g705
###
# start gene g706
Scaffold_1	AUGUSTUS	gene	3530431	3531420	0.96	+	.	g706
Scaffold_1	AUGUSTUS	transcript	3530431	3531420	0.96	+	.	g706.t1
Scaffold_1	AUGUSTUS	start_codon	3530431	3530433	.	+	0	transcript_id "g706.t1"; gene_id "g706";
Scaffold_1	AUGUSTUS	CDS	3530431	3531420	0.96	+	0	transcript_id "g706.t1"; gene_id "g706";
Scaffold_1	AUGUSTUS	stop_codon	3531418	3531420	.	+	0	transcript_id "g706.t1"; gene_id "g706";
# protein sequence = [MRQKGDNVLIDILSRLRTGTCIQADKDILDKYVLSNEACSNETKSLIDITQWITNPENACPLITYTNAARDAHNFESA
# KAFARVTGQEFHICHSTDTHGRGKNKKVIKGIAAEAAWKIPVKDAQDLGGKVPYIPGMPVFATENIATELGLSNGSLGTLVSLTYEIHDDRYYAVSAT
# VDFPAYKSNDPVHPNRVILKPITQSFKFHLPNSEKLYSATRKQLPLIPAFAFTSPNAQGRSMNVACIDFASCRLIQSAYVMLSRVRSLKGLCILRPFS
# INKIRNHISEELRSELKRTENLAAKTAQAAENDLSWYYSRFPAQASRVSTANNSC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g706
###
# start gene g707
Scaffold_1	AUGUSTUS	gene	3533885	3534256	0.99	+	.	g707
Scaffold_1	AUGUSTUS	transcript	3533885	3534256	0.99	+	.	g707.t1
Scaffold_1	AUGUSTUS	start_codon	3533885	3533887	.	+	0	transcript_id "g707.t1"; gene_id "g707";
Scaffold_1	AUGUSTUS	CDS	3533885	3534256	0.99	+	0	transcript_id "g707.t1"; gene_id "g707";
Scaffold_1	AUGUSTUS	stop_codon	3534254	3534256	.	+	0	transcript_id "g707.t1"; gene_id "g707";
# protein sequence = [MTVYEADDFPVTTATANIASNGDVIITVTASRTIHIESDVCSDDVCTAVVFDQSLNYSNVQTYLDGFNIQNVLQMASG
# SVVSTHNGVAVVKDDYSYPFAVNITSLNNDGSVCEFQPEFALIHS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g707
###
# start gene g708
Scaffold_1	AUGUSTUS	gene	3535344	3536321	0.04	-	.	g708
Scaffold_1	AUGUSTUS	transcript	3535344	3536321	0.04	-	.	g708.t1
Scaffold_1	AUGUSTUS	stop_codon	3535344	3535346	.	-	0	transcript_id "g708.t1"; gene_id "g708";
Scaffold_1	AUGUSTUS	CDS	3535344	3535656	0.63	-	1	transcript_id "g708.t1"; gene_id "g708";
Scaffold_1	AUGUSTUS	CDS	3535694	3536124	0.3	-	0	transcript_id "g708.t1"; gene_id "g708";
Scaffold_1	AUGUSTUS	CDS	3536181	3536321	0.08	-	0	transcript_id "g708.t1"; gene_id "g708";
Scaffold_1	AUGUSTUS	start_codon	3536319	3536321	.	-	0	transcript_id "g708.t1"; gene_id "g708";
# protein sequence = [MKHRLGAMVVATSKQGEPVTADDVGVTGALTVLMKDAIKPNLMQTLQGTPVFVHAGPFANIAHGNSSILADRVALKLA
# GTEEGDSSDRVGYVLTEGGFGADMGMEKFCNIKCRVSGLKPDATIIVATTRALKMHGGGPDVTPGKPLHETYTKEDLVTLKEGCKNLVQHIKNSRKFG
# IKVIVAINQFALVFLSDSAAELALVRDESLAGGADAAVVSNHWAEGGKGARALAEAVITTCEGPSNFDFLYDLNLPIEEKITIISKEIYGADGIELSD
# LARQQVETYTRQGYAGLPSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g708
###
# start gene g709
Scaffold_1	AUGUSTUS	gene	3537151	3538289	0.42	-	.	g709
Scaffold_1	AUGUSTUS	transcript	3537151	3538289	0.42	-	.	g709.t1
Scaffold_1	AUGUSTUS	stop_codon	3537151	3537153	.	-	0	transcript_id "g709.t1"; gene_id "g709";
Scaffold_1	AUGUSTUS	CDS	3537151	3537548	0.49	-	2	transcript_id "g709.t1"; gene_id "g709";
Scaffold_1	AUGUSTUS	CDS	3537594	3537720	0.69	-	0	transcript_id "g709.t1"; gene_id "g709";
Scaffold_1	AUGUSTUS	CDS	3537779	3538016	0.96	-	1	transcript_id "g709.t1"; gene_id "g709";
Scaffold_1	AUGUSTUS	CDS	3538072	3538289	0.99	-	0	transcript_id "g709.t1"; gene_id "g709";
Scaffold_1	AUGUSTUS	start_codon	3538287	3538289	.	-	0	transcript_id "g709.t1"; gene_id "g709";
# protein sequence = [MKAKAAQEVGIQYRHVALPAEATVEEVVETVKTLNNDDAVSGILVQLPLGEHVTAEGERKVTEAVKPEKDVDGFHAYN
# IGHLSSRASDPLFSPCTPTAVIRLLESTGQSISGANAVVLGRSDIVGSPVASMLRNRDATVTQCHSRTKNIEAIVKNSDIVVSAIGKAELVKGSWIKP
# GAVVIDVGINYIPGESHTDSSKKSGQRLVGDVEYSSAAEVASYITPVPGGVGPMTVAILMENTLKSAERLWELSHERKVQPLPLNILEKVPSDIEIAM
# GQTPKPITQLAQEIGLSPDELESYGKYKAKVELSVLDRLAHRTDGKYIVVAG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g709
###
# start gene g710
Scaffold_1	AUGUSTUS	gene	3538656	3539620	0.21	+	.	g710
Scaffold_1	AUGUSTUS	transcript	3538656	3539620	0.21	+	.	g710.t1
Scaffold_1	AUGUSTUS	start_codon	3538656	3538658	.	+	0	transcript_id "g710.t1"; gene_id "g710";
Scaffold_1	AUGUSTUS	CDS	3538656	3538662	0.35	+	0	transcript_id "g710.t1"; gene_id "g710";
Scaffold_1	AUGUSTUS	CDS	3538926	3539059	0.7	+	2	transcript_id "g710.t1"; gene_id "g710";
Scaffold_1	AUGUSTUS	CDS	3539138	3539620	0.62	+	0	transcript_id "g710.t1"; gene_id "g710";
Scaffold_1	AUGUSTUS	stop_codon	3539618	3539620	.	+	0	transcript_id "g710.t1"; gene_id "g710";
# protein sequence = [MLKTKSTSAHEEKKKDEPNDEPEKEAHPPCPDTEKLKAKEAEVVDLTADFLNLQRNAAREKEQTRDFAITRFASDLLE
# TVDVLALALKSVPAPALAAETTPASEPLASSSSSKTDTPPPKSAQEYLQELHTGVEMTQRQLLQTLFKYHVKPFDPTGDKFDPNRHEALYQAPIPGKE
# PGTVLDCQKPGYMIKDRVLRAAQVGVVQDIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g710
###
# start gene g711
Scaffold_1	AUGUSTUS	gene	3542421	3542882	0.76	-	.	g711
Scaffold_1	AUGUSTUS	transcript	3542421	3542882	0.76	-	.	g711.t1
Scaffold_1	AUGUSTUS	stop_codon	3542421	3542423	.	-	0	transcript_id "g711.t1"; gene_id "g711";
Scaffold_1	AUGUSTUS	CDS	3542421	3542882	0.76	-	0	transcript_id "g711.t1"; gene_id "g711";
Scaffold_1	AUGUSTUS	start_codon	3542880	3542882	.	-	0	transcript_id "g711.t1"; gene_id "g711";
# protein sequence = [MLSLPSNAASTNPADPTTSGVWNYLTPKRTQALIARESAVAVREAEVARREAELLAGAPGGVIATPSPVLCPPCMAAT
# TVETITGPIQTVIKEIVKEDSLTPPGWSSPRFDDILDRELKIAEREREISKREEGVNRREHDASRRESWIMEQLM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g711
###
# start gene g712
Scaffold_1	AUGUSTUS	gene	3545821	3546804	0.62	+	.	g712
Scaffold_1	AUGUSTUS	transcript	3545821	3546804	0.62	+	.	g712.t1
Scaffold_1	AUGUSTUS	start_codon	3545821	3545823	.	+	0	transcript_id "g712.t1"; gene_id "g712";
Scaffold_1	AUGUSTUS	CDS	3545821	3546804	0.62	+	0	transcript_id "g712.t1"; gene_id "g712";
Scaffold_1	AUGUSTUS	stop_codon	3546802	3546804	.	+	0	transcript_id "g712.t1"; gene_id "g712";
# protein sequence = [MKEAYARLQEFDQNTPFEFGNLDTTLEPNISILKNLLRELKLKLMEAESLRNMVESNFKKASVEQAQVESDGDIIMNA
# PSSTFQKQDGYSTPPHVSLSTEKHLVLLQGMLDRISKQVASVGSNVMEQEDVIKSVIQSSHEIVTSSESIVDGIHQDIEHFDDELSELTEMTAETIAE
# DNRLDIEYQKLQKEREDQEIELQKVSQPLLQPMTNFSDHAKLMGCLEKLEKEREKDESDLATLSTALTAYMEKPTMSPSSSPFIPEDIVVALEEQITP
# LIRNAIKPHIEILRSELEQEITKREMETSSTLSPIFTVTHQALQSVSNATSKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g712
###
# start gene g713
Scaffold_1	AUGUSTUS	gene	3555541	3556791	0.97	-	.	g713
Scaffold_1	AUGUSTUS	transcript	3555541	3556791	0.97	-	.	g713.t1
Scaffold_1	AUGUSTUS	stop_codon	3555541	3555543	.	-	0	transcript_id "g713.t1"; gene_id "g713";
Scaffold_1	AUGUSTUS	CDS	3555541	3556791	0.97	-	0	transcript_id "g713.t1"; gene_id "g713";
Scaffold_1	AUGUSTUS	start_codon	3556789	3556791	.	-	0	transcript_id "g713.t1"; gene_id "g713";
# protein sequence = [MPLWCTSSDSPPGSQLSHHRIVRIPPGESVVLNSAERAPYLLYIEILNDDLDFDPQKRINKDVLKKIVLREDQRAPGP
# KDLNPFTPLLPFQQHKAKSESFQESDVYDGSSVLLGNSLAATPPTPTTPNDDEEMDLVEQLYGPGQSLLSQKIDLSESIVLPPPPKNKDLDRVAWSRP
# SSVHASPSLDNIDRHTPRIPPPLNLHLDNTISQPSPLPVETPYSISLDEYSERMRTAAIMLAQLNANLVREPTNGSAVPDGAHSSGPLSWIPGSSWLS
# NSNEPPKTAPHLTGRGTGSQDFGKPQPSRMRLQASEASAIRDRIMQEMLALEEERMAHMRENRETESIIRVGDISGGMKTAEDEGIIRRELSKVDPSA
# MVFSESWTAKKVRWKRFPYVSSKLDVDDVITESNSACIALWSSW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g713
###
# start gene g714
Scaffold_1	AUGUSTUS	gene	3556983	3557759	0.58	-	.	g714
Scaffold_1	AUGUSTUS	transcript	3556983	3557759	0.58	-	.	g714.t1
Scaffold_1	AUGUSTUS	stop_codon	3556983	3556985	.	-	0	transcript_id "g714.t1"; gene_id "g714";
Scaffold_1	AUGUSTUS	CDS	3556983	3557759	0.58	-	0	transcript_id "g714.t1"; gene_id "g714";
Scaffold_1	AUGUSTUS	start_codon	3557757	3557759	.	-	0	transcript_id "g714.t1"; gene_id "g714";
# protein sequence = [MQAALKDLSASPHDSPSFIICQRVLHKCHEIIFGDLPPPTTPYSTINLPFRSLFPRKKIRPHAEPAIIGMGLVLAGVP
# AMPRLTEIMGEVAIEQGRAEDKATVEVKRSVESDDDDMAVAPSRIKSSVSMDEEPEPESNEDSPPSPDSASSEPAILTRRRAMGPAQTVPALPLHLRG
# LQRSRRSEDPLGQLDAEHKETVTPYQSSPSISSARPPLRTASHSYADTLLQTYDTSSQTHLLKGHYCRSEVGQIKPQLSKFY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g714
###
# start gene g715
Scaffold_1	AUGUSTUS	gene	3558312	3559850	0.97	+	.	g715
Scaffold_1	AUGUSTUS	transcript	3558312	3559850	0.97	+	.	g715.t1
Scaffold_1	AUGUSTUS	start_codon	3558312	3558314	.	+	0	transcript_id "g715.t1"; gene_id "g715";
Scaffold_1	AUGUSTUS	CDS	3558312	3559850	0.97	+	0	transcript_id "g715.t1"; gene_id "g715";
Scaffold_1	AUGUSTUS	stop_codon	3559848	3559850	.	+	0	transcript_id "g715.t1"; gene_id "g715";
# protein sequence = [MANKSLNSPSFSRFSRMGFGLRIKSQSASPSPRIRDSAKSNQDSDWYIPYNGPYEPPRDTYVRSKEPLRDSWGDPVVD
# AQAENDEENPIFSDAELHTRYGNWNPADERKGRPRARTQSSSSGTVDPSRASMATGRRSTVSHVGNPPPVPSYISLAGGVGESPVPNPRAVRETASTK
# RKSLASLFTFNSTSRKLSSSSKAERQHTPNTPSRLSDQGLHSIGLSKLPQTPHLPSDPVAAVELFGASAATGDEEYYNSYYSSLINQPQNNHQTARQP
# PDTSFQHTLQQPSSPQSLPNSEPSSATHPYAYAYSSSTPPAAETPRSAPPPKTHFERTPIPHIYPEKSRVVSPAQILKSKSIPQTKSHLPGHALSLKN
# SISSPDLRSNNRSKSLIPKGKDRWLSAETWCDALLFPRPRFRLKQDKDASASNHAGSGRIVSPPGSPVLGYFSNANAAKPSITSRVLAHSRSMVDLSK
# PTVAEPSNLPRTEAHPPPDLLQIARPSEQSSPFRAPRPKSWA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g715
###
# start gene g716
Scaffold_1	AUGUSTUS	gene	3560352	3561848	0.89	+	.	g716
Scaffold_1	AUGUSTUS	transcript	3560352	3561848	0.89	+	.	g716.t1
Scaffold_1	AUGUSTUS	start_codon	3560352	3560354	.	+	0	transcript_id "g716.t1"; gene_id "g716";
Scaffold_1	AUGUSTUS	CDS	3560352	3561848	0.89	+	0	transcript_id "g716.t1"; gene_id "g716";
Scaffold_1	AUGUSTUS	stop_codon	3561846	3561848	.	+	0	transcript_id "g716.t1"; gene_id "g716";
# protein sequence = [MVKNTANHLCAFDGEGVSPAEEKMAGLEGALQNNATKVITFADPAQMYIESPLPSRNGHSVSPTPSGISESRMGIALT
# TPPMTEETFEPIRMPAHPYAQGGFSFLTPHIDFQSNARVDLPSAQVKPSHESRIQNPIPVPTSWHPYAQAGSSARDSYQSEMKITPRLRSDSDVPPPQ
# KMWAQWSSGVVQEILPTELQYSPYLPDQKSMVEDDSQVRKQVRNSSPIYNTAGVGEALAFAAMHRYSRDSGIGTSEEHASAQAEYEAGSISSNRYRKT
# TQYDVTRPLYLQKTVASSPLQAAIIPTPTPPLELMRQESSNSGGNHSSDSSPPMSPPPPLGNVDDLATFHDLFYRPNISRNVSNDGATPARINGIPWD
# VASAGQRGSGLTSIARQLTEELSESRDSLKNSISFRSQSSLSALRQSLYEARTPPADANMRFVFSDLPETASLNTNGERKNLQANILTFEPSVQISED
# VELSRASSPTRSPVDKDDDLGEYGVYNW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g716
###
# start gene g717
Scaffold_1	AUGUSTUS	gene	3561880	3562422	0.8	+	.	g717
Scaffold_1	AUGUSTUS	transcript	3561880	3562422	0.8	+	.	g717.t1
Scaffold_1	AUGUSTUS	start_codon	3561880	3561882	.	+	0	transcript_id "g717.t1"; gene_id "g717";
Scaffold_1	AUGUSTUS	CDS	3561880	3562422	0.8	+	0	transcript_id "g717.t1"; gene_id "g717";
Scaffold_1	AUGUSTUS	stop_codon	3562420	3562422	.	+	0	transcript_id "g717.t1"; gene_id "g717";
# protein sequence = [MNSELVKSSRTSLPPVSGVSRVSLTGQMAFAIGDDALSEQHNNEDVPPSTAHLTTAHSSLQPPSAGLTRSSYMTTSDG
# SRMSGLSDFPDPPLQRLTPAHMSLLSSYFDNTITEKEIADVRAYGHVKPATRSRSGSVLTSRPEAQGSRPPIDVPDKQEGVSFDGNEEIDNIIASLSP
# SSHS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g717
###
# start gene g718
Scaffold_1	AUGUSTUS	gene	3564760	3565662	0.51	-	.	g718
Scaffold_1	AUGUSTUS	transcript	3564760	3565662	0.51	-	.	g718.t1
Scaffold_1	AUGUSTUS	stop_codon	3564760	3564762	.	-	0	transcript_id "g718.t1"; gene_id "g718";
Scaffold_1	AUGUSTUS	CDS	3564760	3565662	0.51	-	0	transcript_id "g718.t1"; gene_id "g718";
Scaffold_1	AUGUSTUS	start_codon	3565660	3565662	.	-	0	transcript_id "g718.t1"; gene_id "g718";
# protein sequence = [MLEQLKGLSDRIVGVTQADKGGSWMGSKLAKPSLDGIGGWLEGRFAKLVTGDMESPTATEHQREKTDERGFVGPFSQY
# STISSTTTSTTPSPQSSVVNLNAYAPPPPRTGSALSTRSLAPPNGSTERASSTIDHSRQRLQPSAPRVTSANASTTTFSQAQSRSFGQATAAKYPTSP
# NDLLTPRPALGTTEEDEGQEVTWWGSGNAATPTTASFVQLSGSALTPTVDGFISFMDNHDHSIGSTYQAKSDGSPIHNAEEEEEDLGFGNSKPKPKSA
# SDDADKSGVAKTEEHKAAPARPGNFA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g718
###
# start gene g719
Scaffold_1	AUGUSTUS	gene	3566385	3567608	0.73	-	.	g719
Scaffold_1	AUGUSTUS	transcript	3566385	3567608	0.73	-	.	g719.t1
Scaffold_1	AUGUSTUS	stop_codon	3566385	3566387	.	-	0	transcript_id "g719.t1"; gene_id "g719";
Scaffold_1	AUGUSTUS	CDS	3566385	3566868	0.84	-	1	transcript_id "g719.t1"; gene_id "g719";
Scaffold_1	AUGUSTUS	CDS	3566932	3567608	0.73	-	0	transcript_id "g719.t1"; gene_id "g719";
Scaffold_1	AUGUSTUS	start_codon	3567606	3567608	.	-	0	transcript_id "g719.t1"; gene_id "g719";
# protein sequence = [MSNGSILSTLSEDPYAPSKFQSGESYTSRYNYLDNDQASPNPGSASSGISSLGPPQDIKAPTYTPYAPSPSLLGTNDP
# LGRAGARVPVFSFGFGGKFVTCFHGADKMNTGFDVALASRNSTGIEIRALNKIIPNSALNLSSVSFPGPLFSDPGSPTIGLVRPGAAAQAKTKKARVV
# KYLEDRVEEFSQGLGYVPTGSEDQGRTESKLILFKILKVLVENDGKLSGTPSMDAAVRAALVPQTGADPNGAESSNFTSVADLQGADGTLMGLSNTSS
# PGETPISITTLRPSALNKIERFLLHGERRQAYHYALDQKLWSHAMIIASGIDKEAWQEVVNEFLKTELGTQAPSMGPSNGRESLRVVYSLLSGQGAKA
# GNVIPENTNFPKVN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g719
###
# start gene g720
Scaffold_1	AUGUSTUS	gene	3569123	3569539	0.97	-	.	g720
Scaffold_1	AUGUSTUS	transcript	3569123	3569539	0.97	-	.	g720.t1
Scaffold_1	AUGUSTUS	stop_codon	3569123	3569125	.	-	0	transcript_id "g720.t1"; gene_id "g720";
Scaffold_1	AUGUSTUS	CDS	3569123	3569539	0.97	-	0	transcript_id "g720.t1"; gene_id "g720";
Scaffold_1	AUGUSTUS	start_codon	3569537	3569539	.	-	0	transcript_id "g720.t1"; gene_id "g720";
# protein sequence = [MSGLEAAASLFGSEDAGSDPFASLGSDEQPSIAAHGANDDLFSVNDVSAAPDFLVSSQAYSGPAVSQDPVFQPAEQHS
# SWPETNGYDPNLQSVPPTSEQSYGGYGAQSSYDEQWQSHSQPASYAPGTLLSYSQVADSQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g720
###
# start gene g721
Scaffold_1	AUGUSTUS	gene	3576524	3577555	0.35	-	.	g721
Scaffold_1	AUGUSTUS	transcript	3576524	3577555	0.35	-	.	g721.t1
Scaffold_1	AUGUSTUS	stop_codon	3576524	3576526	.	-	0	transcript_id "g721.t1"; gene_id "g721";
Scaffold_1	AUGUSTUS	CDS	3576524	3577206	0.41	-	2	transcript_id "g721.t1"; gene_id "g721";
Scaffold_1	AUGUSTUS	CDS	3577324	3577555	0.71	-	0	transcript_id "g721.t1"; gene_id "g721";
Scaffold_1	AUGUSTUS	start_codon	3577553	3577555	.	-	0	transcript_id "g721.t1"; gene_id "g721";
# protein sequence = [MNAESSRSHSIFLITILQRNTESGAAKTGNLYLVDLAGSEKVGKTGASGQTLEEAKKINKSLSALGMVINALTDPKAR
# NSRTTLIINCSPSSYNESETLSTLRFGIRAKSIKNSARVNAELSPAELKNLLTKAQSSNTGYQKYIAALEAELAIWRSGSQVEESEWATSAKAGAPAS
# AAPSTAAAPKAPTSPTPSTTASSRSMTPINPAIEGLRSELGSRPQTPTVLGLEKDEREDFLRRENELSDALAEKESALVTADKLVKELKEELTFLKEQ
# EATVNKVSASIRSNLFRTLLMYSLGKQVHV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g721
###
# start gene g722
Scaffold_1	AUGUSTUS	gene	3579376	3580568	0.55	+	.	g722
Scaffold_1	AUGUSTUS	transcript	3579376	3580568	0.55	+	.	g722.t1
Scaffold_1	AUGUSTUS	start_codon	3579376	3579378	.	+	0	transcript_id "g722.t1"; gene_id "g722";
Scaffold_1	AUGUSTUS	CDS	3579376	3579869	0.58	+	0	transcript_id "g722.t1"; gene_id "g722";
Scaffold_1	AUGUSTUS	CDS	3580040	3580568	0.84	+	1	transcript_id "g722.t1"; gene_id "g722";
Scaffold_1	AUGUSTUS	stop_codon	3580566	3580568	.	+	0	transcript_id "g722.t1"; gene_id "g722";
# protein sequence = [MNTRRPPSRMRTNSSTSMPPPTLRPRSVMTKSASSSRSGEEQLEHGAAPAVHKQLKHTDDPDTNIQVIIRCRRRSDRE
# IQENSPIIVNSKGAKSNQVSIETTAPVSTLGVVTLPPVRTYPFDLVYGPEADQAMIYHDVVGPMLQQVLEGYNCTLFAYGQTGTGKTVRVSFIELYNE
# ELRDLLASELSAPIGSTQPMGMASKDATKNAGSNIKIFDDSNKRGVIIQGIEEVPVKSSADALALLTKGSERRQIAATKFNDHSSRSHSIFSLTVHTK
# EAGVVGEDLLRIGKLNMVDLAGSENIGRSGAENKRAREAGMINQSLLTLGRVINALVDKAQHVPYR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g722
###
# start gene g723
Scaffold_1	AUGUSTUS	gene	3580602	3581273	0.96	+	.	g723
Scaffold_1	AUGUSTUS	transcript	3580602	3581273	0.96	+	.	g723.t1
Scaffold_1	AUGUSTUS	start_codon	3580602	3580604	.	+	0	transcript_id "g723.t1"; gene_id "g723";
Scaffold_1	AUGUSTUS	CDS	3580602	3581273	0.96	+	0	transcript_id "g723.t1"; gene_id "g723";
Scaffold_1	AUGUSTUS	stop_codon	3581271	3581273	.	+	0	transcript_id "g723.t1"; gene_id "g723";
# protein sequence = [MPCRESKLTRILQDSLGGRTKTSIIATISPARSNLEETLSTLDYAMSAKSIRNKPEINQRMTRNSLLKEYVAEIERLK
# ADVLAAREKNGIFFSEETWAQMDTERELRETEIEEAKKQVEIIENQMRVVREEFEQSIGLLMKRDAELKDTKHRLDVTEVELSERKEELRGVKVALEE
# ETVIRRAHQKTEITLDAVANGLRSVAKESVHDVSALFQKLGLFNSLI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g723
###
# start gene g724
Scaffold_1	AUGUSTUS	gene	3581474	3583197	0.5	+	.	g724
Scaffold_1	AUGUSTUS	transcript	3581474	3583197	0.5	+	.	g724.t1
Scaffold_1	AUGUSTUS	start_codon	3581474	3581476	.	+	0	transcript_id "g724.t1"; gene_id "g724";
Scaffold_1	AUGUSTUS	CDS	3581474	3582196	0.5	+	0	transcript_id "g724.t1"; gene_id "g724";
Scaffold_1	AUGUSTUS	CDS	3582613	3583197	0.99	+	0	transcript_id "g724.t1"; gene_id "g724";
Scaffold_1	AUGUSTUS	stop_codon	3583195	3583197	.	+	0	transcript_id "g724.t1"; gene_id "g724";
# protein sequence = [MKTLENYSKRITEQLQYIKSNIQTIRAHDGAEDEAIASLEMMLNDTYETFNTGFASWSESLQKTCQQTHEELDHASSQ
# TLSEAHMAVKSIHTTMEYVLQETAKYFESEQVVLTKASAIVQQSTDGEVERLREQNRTLMALVEKQKADANKAKEDLLQKVSGLLVNFVNEQDRGLRD
# AAASIRDANIASENGMRSHHQQHRQVIDSLDQSRAPLIALSEKSRSDAKRMRDGSVKVQFITQFATSNLADVTSAYHTASTSQLTVVEKTTMALSDQG
# TKEDIQTGSTPRKRSWRYVDEWDLTEDRKILLGTWRSHGMSGVGSETFLAEHLPLPAEDEDLPEEIETMDVDIEPMPSRSQSPSTSEQEVPIVNSLQS
# SSASSTSSALPVRPTHTRQKSIPILKKASGKAPSLSPPLSIRATSTLLGGQEDEDDISSLYDL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g724
###
# start gene g725
Scaffold_1	AUGUSTUS	gene	3583566	3586282	0.37	+	.	g725
Scaffold_1	AUGUSTUS	transcript	3583566	3586282	0.37	+	.	g725.t1
Scaffold_1	AUGUSTUS	start_codon	3583566	3583568	.	+	0	transcript_id "g725.t1"; gene_id "g725";
Scaffold_1	AUGUSTUS	CDS	3583566	3584650	0.45	+	0	transcript_id "g725.t1"; gene_id "g725";
Scaffold_1	AUGUSTUS	CDS	3584806	3586282	0.52	+	1	transcript_id "g725.t1"; gene_id "g725";
Scaffold_1	AUGUSTUS	stop_codon	3586280	3586282	.	+	0	transcript_id "g725.t1"; gene_id "g725";
# protein sequence = [MAAPLTGTIASSPMIGNNKPENDNTVHVTNEIPHTSLSSQHLYKASEFALLTVLQKQQIFNVLIQSPSISCNELRKLA
# TLHVDLTTWDSQHQQKNKMKLLSDFAQHFCSNHCLIRQVQAETVGITHIPSISQSEFLECAKALKLRNYNETSAYKHKYEHKHFSQKKMKISHTSTLA
# ANDVHFTSPVVDSEIWPEILSLNEKQAILQESYDAGSNASIRMIECSFCGTLETGMNICSIPCTDLDISLLDTAVHEIRLKTQQATIEAFRHETINND
# CYQLCIQCKREVRYKTSIDNSEGHGKSQRSFVRLPLRSYANGTWTGDLPNALKGLTFLEEQCIARARATKCMFKLELGPSDNMLHEEISRIINALQWL
# QLNNPLYYDLNLDAMLVNANQYPEHGIPIPLKSIIRTSSNSEGSSYSAQANSEQFNENVSSSGMLSSTVVDADHIDSTYQMRKLNALQQLKMATVHLS
# NFHLALFLCLHTKTQKCMHIYGQLFPYGVGMMENDDVHCNSSVGFRHIDMRTHTAYLLQSRPNFRFQTHLSFIFVIGNILQRRQTSFNAKLAVKRSWF
# PRVEMLLGKLSNDTILEFSEKLKKNPFVHPETEGEKAAKQLMKYINYIGENIPGSMSEVQNMREELFSLVHTNGLPHVFLTLNPSDTNNPIAQVLAGR
# NIDLDQIFHDLKLHSENLERSTCIAQNPIAAAQFFDISVRNLLDILLGTKRQNKKGVFGEVAVYYGVVEAQGRGSLHIHLLIWLKHGLSPNEIKFKCE
# SDPKWAQHLIDWYDDVFSQSIPNHTQEYIQTEGMYKRQPVMSRPMNPQISGYWYSFDQDLRNVLENAGMVHEHTDTCFKHLPIKLRSLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g725
###
# start gene g726
Scaffold_1	AUGUSTUS	gene	3586740	3587723	0.9	+	.	g726
Scaffold_1	AUGUSTUS	transcript	3586740	3587723	0.9	+	.	g726.t1
Scaffold_1	AUGUSTUS	start_codon	3586740	3586742	.	+	0	transcript_id "g726.t1"; gene_id "g726";
Scaffold_1	AUGUSTUS	CDS	3586740	3587723	0.9	+	0	transcript_id "g726.t1"; gene_id "g726";
Scaffold_1	AUGUSTUS	stop_codon	3587721	3587723	.	+	0	transcript_id "g726.t1"; gene_id "g726";
# protein sequence = [MLREIAPEVFDTADLHNDEESDINCNGNNIEDPETLQQNLPPREEFDCDSFVLLTEKTLKTGKFSSKSYTHNSLFNDI
# FFRPDVLFDICAWDLMCEYSKEELPESKKQIKTYLRFKLGHPQYTTHCLKKIDADNYQRVPVLKGYPIPRSDKIECQDKYMIAMLALFKPWSHNEQSP
# LKAPQEAWNTAFNTWKDTDLFKSHIRIINNMQLLHESKDAKLDYSAQRQKRLAELSHKLALEEDDGESYLYDPEWENAMQVQVPATIDNDILQEVDNY
# NVVSQEVLDVMEATVQRGFYKGELDSSSKKQLQNSYSNCTRVATLLDKVAVEC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g726
###
# start gene g727
Scaffold_1	AUGUSTUS	gene	3587952	3588833	0.69	-	.	g727
Scaffold_1	AUGUSTUS	transcript	3587952	3588833	0.69	-	.	g727.t1
Scaffold_1	AUGUSTUS	stop_codon	3587952	3587954	.	-	0	transcript_id "g727.t1"; gene_id "g727";
Scaffold_1	AUGUSTUS	CDS	3587952	3588833	0.69	-	0	transcript_id "g727.t1"; gene_id "g727";
Scaffold_1	AUGUSTUS	start_codon	3588831	3588833	.	-	0	transcript_id "g727.t1"; gene_id "g727";
# protein sequence = [MENAKMADTPLPAGFQPEPTIGQSNSALRSKFQMVIGSLLYLMLGTRPDISFAVTKLAQHAANPSQEHLNKALYICRY
# LLGTRSYALCYDGESGIGLSAWTDSDWASDPYTRRSQTGFFMKLANGIFSWTSHAQKTIAHSSTEAEYMALSDCSRQVVWIRNLLEELGYKLDAIPIA
# GDNQGSIFMASNPVTSKHSKHIDIRYHYIREVVERGLVQVFFVDGSNNPADLFTKNLGRIKFELFRSMLGLEFYSSPILRLSVLSDAYRYCFEQSTLL
# CCSARGCVERGYAVHMPLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g727
###
# start gene g728
Scaffold_1	AUGUSTUS	gene	3589115	3591883	0.96	-	.	g728
Scaffold_1	AUGUSTUS	transcript	3589115	3591883	0.96	-	.	g728.t1
Scaffold_1	AUGUSTUS	stop_codon	3589115	3589117	.	-	0	transcript_id "g728.t1"; gene_id "g728";
Scaffold_1	AUGUSTUS	CDS	3589115	3591883	0.96	-	0	transcript_id "g728.t1"; gene_id "g728";
Scaffold_1	AUGUSTUS	start_codon	3591881	3591883	.	-	0	transcript_id "g728.t1"; gene_id "g728";
# protein sequence = [MSPVDDVENGSKAPTPPPPSPPMDFEVPGTASFDPDELMNFDLDREILAITGFMDTMGSVPSSDLDHMGYTNAPSSVA
# VAKTCKSAFEPDLLSRLYNYRIDAKYISNEHFCVHDVSYSVCKKCKGKQRNQPKWWMNDSGCSEHTTFDLSDFIEYEDLEEKVLIATATTTAYITGVG
# TVLINFKDVRGRMHSARIAPVFYMKELSHRLIAQGRFLQDGKTVRGNADKVDFWDKDGLFLSFEPRTHSDTIYILKDYSPQPMAVNLVIHSVDYTTMH
# RRMGHPSREALTQLRKHAEGVPTFSIPHEEDLCEGCAKGKMTLRPFPPTNRRASRPFEIIHSDLKEWPTISYHKYKYTIFFIDDYTSHGFYCHLKKKS
# GALPVIKQFIATVKNLYETNVKEWMSDGGGEFRSNALDEFFKNEGIKAQWSSPHIHQQNGRAERFIRTIIEKSEPQRFQACIPDSWWEFSVAHAVHVY
# NRTPMRRHKWKTPYEILYNKVPRIDHLRVFGCGAYVYLHEEIRTNKQSPRSELMTYLGVSDGGHGNIYMRSNNAMFTATHAVFDEKLFPRCKSSERHR
# STRLPDRNPDPKDPIPPPGDDDVPIFHQPTTPQMRQDPEQDVAPPVPAEQPARDPSPPPQPRNEQPPAQEQLRRSGRVRRPPTRLTGDPRSSTKLPTE
# QQVERPKRDIQRRAPQPGSSSAEQERPEPEQVPGPSTEHPTPENGEQPSVTPGDEANTLIRLCREGGAELIYFLMAKAVPFEGELKSSENVREWTYKD
# ITRLPKAEREEWLKACQEELEALKRRGTFELMDRPADRKVIKNRWVFDIKSDGRKKARLVVKGFSQIEGLDYDQVFSPVVRFETVRLLLALTALNNWY
# LTGLDVRMPYLYGVLHETIYMEQPEGFRIKGKEDKVLLLRKALYGLKQAGLVWWQHWTHT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g728
###
# start gene g729
Scaffold_1	AUGUSTUS	gene	3592208	3593017	0.58	-	.	g729
Scaffold_1	AUGUSTUS	transcript	3592208	3593017	0.58	-	.	g729.t1
Scaffold_1	AUGUSTUS	stop_codon	3592208	3592210	.	-	0	transcript_id "g729.t1"; gene_id "g729";
Scaffold_1	AUGUSTUS	CDS	3592208	3593017	0.58	-	0	transcript_id "g729.t1"; gene_id "g729";
Scaffold_1	AUGUSTUS	start_codon	3593015	3593017	.	-	0	transcript_id "g729.t1"; gene_id "g729";
# protein sequence = [MSSALFTAVTTTLKGDNYDTWASEMEAFLQATGLESAITTDQPSEPSPLVAANAASVEAWKNYEVVFKAWKEIDTKAI
# GNIRLRISPSIRILAKEYSDTAKKLWNYLAKTYNVKSLGAVFNDFAAAMAIKIPYKQNPLSSMMEIGMYFTRMDEAGIGLADHLEALILLSKLPSRYS
# VVIQTMSQLETAELKKLTFAKVRIAVMNAFSGDTIGNSQPQNANKFSNVHRKGTIPSSPNSSMVTVVTSSRRDRMGTMTTRRSVSVAVEEQEG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g729
###
# start gene g730
Scaffold_1	AUGUSTUS	gene	3595938	3597193	0.68	-	.	g730
Scaffold_1	AUGUSTUS	transcript	3595938	3597193	0.68	-	.	g730.t1
Scaffold_1	AUGUSTUS	stop_codon	3595938	3595940	.	-	0	transcript_id "g730.t1"; gene_id "g730";
Scaffold_1	AUGUSTUS	CDS	3595938	3596534	0.7	-	0	transcript_id "g730.t1"; gene_id "g730";
Scaffold_1	AUGUSTUS	CDS	3596864	3597193	1	-	0	transcript_id "g730.t1"; gene_id "g730";
Scaffold_1	AUGUSTUS	start_codon	3597191	3597193	.	-	0	transcript_id "g730.t1"; gene_id "g730";
# protein sequence = [MSKLSFSLNKPKTATAAVTATFKQPAAFSAFDDDEPVDAAPTASSSREGVSANKKLLAQNALTSKKLKKQMEEEKKVD
# STVYEYDEVWDKMQMAKLQQKEVKEAESKERKGRGTGMAHFYRRLLEDSEQSHEATVAATQKPIIGPQGPMPNMTITKPPDLTPLSDLERARIARGEG
# KDVELNDDNQIIDKRDLLSGGLNLSGTNTRNLKTRSANKPEPDSDNVQVHRAVGVAASRQEIKERRMREIELQMEEEQERARKEQEREEYEMAQRIIA
# KRNNEEDVESARARYLERKRRRLEEAQDAGEQKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g730
###
# start gene g731
Scaffold_1	AUGUSTUS	gene	3598409	3599305	0.41	+	.	g731
Scaffold_1	AUGUSTUS	transcript	3598409	3599305	0.41	+	.	g731.t1
Scaffold_1	AUGUSTUS	start_codon	3598409	3598411	.	+	0	transcript_id "g731.t1"; gene_id "g731";
Scaffold_1	AUGUSTUS	CDS	3598409	3598437	0.41	+	0	transcript_id "g731.t1"; gene_id "g731";
Scaffold_1	AUGUSTUS	CDS	3598519	3599305	0.69	+	1	transcript_id "g731.t1"; gene_id "g731";
Scaffold_1	AUGUSTUS	stop_codon	3599303	3599305	.	+	0	transcript_id "g731.t1"; gene_id "g731";
# protein sequence = [MATIPILDACVGREPWSDIADKLTQATTLYFKVPPSEVENYQYLSYLYCCCVLRHTSLLFAIWSAKGWGPLAFTTMLQ
# PGPTPYLPPTLSHSESTTWANLERLSSMSGIPRTTISSLLAQVHGPWLLHLGPRERVSVLEAIASTYSCLGYRRKESYILREVLGCILDLIVCGREED
# AHTNMRLFGNKGNVGIRLNESSDGNESILKLLKHVCKVLGVNLDAIQILDDNNDPKNHPEADDDSDVYREPFGWPELQIGVVRESVAVAEALPGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g731
###
# start gene g732
Scaffold_1	AUGUSTUS	gene	3606924	3607226	0.6	-	.	g732
Scaffold_1	AUGUSTUS	transcript	3606924	3607226	0.6	-	.	g732.t1
Scaffold_1	AUGUSTUS	stop_codon	3606924	3606926	.	-	0	transcript_id "g732.t1"; gene_id "g732";
Scaffold_1	AUGUSTUS	CDS	3606924	3607226	0.6	-	0	transcript_id "g732.t1"; gene_id "g732";
Scaffold_1	AUGUSTUS	start_codon	3607224	3607226	.	-	0	transcript_id "g732.t1"; gene_id "g732";
# protein sequence = [MNILPFAIDDMYLAQYMLFKTINEEVDDLHVAKQEKGAGRFVRVAWPEGLQPPKDLQDADGICDWLDQRKVVEMEWEK
# LKGYMERARGLELAAKRGDDAD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g732
###
# start gene g733
Scaffold_1	AUGUSTUS	gene	3607620	3608012	0.63	-	.	g733
Scaffold_1	AUGUSTUS	transcript	3607620	3608012	0.63	-	.	g733.t1
Scaffold_1	AUGUSTUS	stop_codon	3607620	3607622	.	-	0	transcript_id "g733.t1"; gene_id "g733";
Scaffold_1	AUGUSTUS	CDS	3607620	3608012	0.63	-	0	transcript_id "g733.t1"; gene_id "g733";
Scaffold_1	AUGUSTUS	start_codon	3608010	3608012	.	-	0	transcript_id "g733.t1"; gene_id "g733";
# protein sequence = [MESDDDDEDEEEMEEEEEAPFKAARPDSDKNSLFDGSESDGSESFIVEDDGAGLAALPVEFSMESHQDLSHNFKKIFQ
# FFVHIAVHPPIERHEFMEMQMKSQSRSAISHFLNSSILLRLHKMRCTSLSLF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g733
###
# start gene g734
Scaffold_1	AUGUSTUS	gene	3608378	3608770	0.59	-	.	g734
Scaffold_1	AUGUSTUS	transcript	3608378	3608770	0.59	-	.	g734.t1
Scaffold_1	AUGUSTUS	stop_codon	3608378	3608380	.	-	0	transcript_id "g734.t1"; gene_id "g734";
Scaffold_1	AUGUSTUS	CDS	3608378	3608770	0.59	-	0	transcript_id "g734.t1"; gene_id "g734";
Scaffold_1	AUGUSTUS	start_codon	3608768	3608770	.	-	0	transcript_id "g734.t1"; gene_id "g734";
# protein sequence = [MPRQRKSRETSKKLKQTTLTGSIQSPSRGRSKPSPSQPVAKRRRIDYLSDEQNEPSDDSDIGAFKLEPKGPVEDDDEL
# TPPPAKRKRMSFVVGSDTEEIRRRCPYCEARNTKCEAEGKRQGEEEECACEE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g734
###
# start gene g735
Scaffold_1	AUGUSTUS	gene	3610979	3611872	0.91	+	.	g735
Scaffold_1	AUGUSTUS	transcript	3610979	3611872	0.91	+	.	g735.t1
Scaffold_1	AUGUSTUS	start_codon	3610979	3610981	.	+	0	transcript_id "g735.t1"; gene_id "g735";
Scaffold_1	AUGUSTUS	CDS	3610979	3611872	0.91	+	0	transcript_id "g735.t1"; gene_id "g735";
Scaffold_1	AUGUSTUS	stop_codon	3611870	3611872	.	+	0	transcript_id "g735.t1"; gene_id "g735";
# protein sequence = [MIPPSALVQSCVDFYQTLFSLTEQNIKNGGYEDVSIIYSSLSTQLQIINNGLELGSIVLGEGNSSRSQTQEVPVFRLH
# DLLAWCEHYLSSETLPVSPVISEYLEENHVFRRNLNMMFEWSNLVYIASAIKTTFTPRGPLPLTSEMLSVSALQESSLDPEENNSPFEVVSLAHMRDV
# LGYEFNVHLDAAAKLLLSHMHHVGLFDRIDLEPKLFLSEAQDTYCSFPLPIGLDESPDVEALFASVEACLSDLDLSVNEVGLLLLCRRLWPSGMASDY
# ALTRLTRSIISWVLSEASFILCP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g735
###
# start gene g736
Scaffold_1	AUGUSTUS	gene	3618164	3619069	0.76	-	.	g736
Scaffold_1	AUGUSTUS	transcript	3618164	3619069	0.76	-	.	g736.t1
Scaffold_1	AUGUSTUS	stop_codon	3618164	3618166	.	-	0	transcript_id "g736.t1"; gene_id "g736";
Scaffold_1	AUGUSTUS	CDS	3618164	3619069	0.76	-	0	transcript_id "g736.t1"; gene_id "g736";
Scaffold_1	AUGUSTUS	start_codon	3619067	3619069	.	-	0	transcript_id "g736.t1"; gene_id "g736";
# protein sequence = [MIPSPGLDVDIFVTNFKPLLAKNVPPPPNDSDLGLLAPTPTYARSKRISSEESTFYDSDGADDNFVDFNYYTDAFGDE
# ENDISSIPLSEREDYTLNLTNFEGDNDDSLPGERQLNRKVQKQGKKLRAKSRKLSQILNLTQDGDRGVMLNGMNNPNNQVHGHGHGHSSGLDSDPNAL
# AFLRDSNESDDESVDLGMRSVALYSSTEYPPRLIGPGSPNSSRSSSPLPFVPEDASTSTLTFPDRSSSAFHLSHDSRATSPPISQEQTAILIISLVKP
# AKFTAPPISACTHQVLSPRQPTSTQYI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g736
###
# start gene g737
Scaffold_1	AUGUSTUS	gene	3625135	3625584	0.55	+	.	g737
Scaffold_1	AUGUSTUS	transcript	3625135	3625584	0.55	+	.	g737.t1
Scaffold_1	AUGUSTUS	start_codon	3625135	3625137	.	+	0	transcript_id "g737.t1"; gene_id "g737";
Scaffold_1	AUGUSTUS	CDS	3625135	3625399	0.58	+	0	transcript_id "g737.t1"; gene_id "g737";
Scaffold_1	AUGUSTUS	CDS	3625478	3625584	0.95	+	2	transcript_id "g737.t1"; gene_id "g737";
Scaffold_1	AUGUSTUS	stop_codon	3625582	3625584	.	+	0	transcript_id "g737.t1"; gene_id "g737";
# protein sequence = [MSSSSTTTSPPFPVPDGFKLHTENNAHILMSENEAFLNPVQEFNRDLSVACIRTWSEELNKAKDAKRAQARQKRASRA
# KEELAKKRQREPESLQPSESTSEIPQAGSKEDVQVESSAKPEANL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g737
###
# start gene g738
Scaffold_1	AUGUSTUS	gene	3628125	3628613	0.69	-	.	g738
Scaffold_1	AUGUSTUS	transcript	3628125	3628613	0.69	-	.	g738.t1
Scaffold_1	AUGUSTUS	stop_codon	3628125	3628127	.	-	0	transcript_id "g738.t1"; gene_id "g738";
Scaffold_1	AUGUSTUS	CDS	3628125	3628613	0.69	-	0	transcript_id "g738.t1"; gene_id "g738";
Scaffold_1	AUGUSTUS	start_codon	3628611	3628613	.	-	0	transcript_id "g738.t1"; gene_id "g738";
# protein sequence = [MDASTGRLMAVKQVELPNGSAPNLERKQSMLTALEHEIELLQDLQHDNIVQISLFAPFFCLIAHHLISCLDSTLEDDC
# LNIFLEYVPGGSVTALLRNYGAFEETLVSNFTRQISQGLSYLHERGIIHRDIKGANILVDNKGGVKISDFGISKKVDVRKSSTS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g738
###
# start gene g739
Scaffold_1	AUGUSTUS	gene	3634261	3635079	0.15	-	.	g739
Scaffold_1	AUGUSTUS	transcript	3634261	3635079	0.15	-	.	g739.t1
Scaffold_1	AUGUSTUS	stop_codon	3634261	3634263	.	-	0	transcript_id "g739.t1"; gene_id "g739";
Scaffold_1	AUGUSTUS	CDS	3634261	3634658	0.49	-	2	transcript_id "g739.t1"; gene_id "g739";
Scaffold_1	AUGUSTUS	CDS	3634755	3635079	0.18	-	0	transcript_id "g739.t1"; gene_id "g739";
Scaffold_1	AUGUSTUS	start_codon	3635077	3635079	.	-	0	transcript_id "g739.t1"; gene_id "g739";
# protein sequence = [MLPAPKQKAPVPSAPERVLGGGNGPGLVFNTSRPATTAAALFTEDEESISGADEPTLEGLTSSSTSFAFRPPSVARGK
# VNISLEEEKPRVTLKSRDPTSTMSADFFGLVPSSSFISSAPSASITVSSAPDIPTFSVPEPSVNDPYPGYYQLPSGEWKQHDLEYYEKFRKRWEKSYN
# DHVRALEKGAVKGFEGYDRHEMADVDAAKEMERAKIEIKGAGGEEGRIKESWRGVGEAEDEYYG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g739
###
# start gene g740
Scaffold_1	AUGUSTUS	gene	3639214	3640946	0.89	-	.	g740
Scaffold_1	AUGUSTUS	transcript	3639214	3640946	0.89	-	.	g740.t1
Scaffold_1	AUGUSTUS	stop_codon	3639214	3639216	.	-	0	transcript_id "g740.t1"; gene_id "g740";
Scaffold_1	AUGUSTUS	CDS	3639214	3640627	0.9	-	1	transcript_id "g740.t1"; gene_id "g740";
Scaffold_1	AUGUSTUS	CDS	3640693	3640946	0.89	-	0	transcript_id "g740.t1"; gene_id "g740";
Scaffold_1	AUGUSTUS	start_codon	3640944	3640946	.	-	0	transcript_id "g740.t1"; gene_id "g740";
# protein sequence = [MVTQFRHTLLFTDWSQAALSTAAVVHADYGYSGYPRRVPQFLARGPFNDWGFDKGLANQMTQNSEGKWELEIMAQWPT
# YVQLNGDFYYGDTDGDGVLDRLPPNTAAPNYLNMSAPPSPHLAWSLIVDDATMTWSLSPRGQSSVGATMYALLLSIPLVTGSLAVLIFMWSFYGIKYN
# QYGVKVKSSNSNYFPIFSAFSNNRSNTDFKDGGAVSEKLFGHKHNNEIIGWPEDKNKRRKVLIATLEYEIIDWKLKVKIGGLGVMSSLMGKAMTDVDL
# VWVVPKVKDLEYPPGEPAQPIEVIIFGEPYLIEVETHILDNITYVILDSPVFRAQTKADPYPARMDDLSSAIFYSTWNQAIAATVRRFPLIDIYHIND
# YHGALAPIYLLPKVLPICLSLHNAEFQGLWPLRTKEEMKEVCSAFNISKEHCTKYVQFGNTFNLLHAAASFISTHQKSVGVAGVSDKYGKRSWARYPA
# LWTLKHVDSLPNPDPTDIAALDEKPVDAHDVQIDQVSEAARPEMKRQAQVWAGIKQDPDSDLFVFVGRWSKQKGVDLIADVLPSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g740
###
# start gene g741
Scaffold_1	AUGUSTUS	gene	3641157	3642221	0.62	-	.	g741
Scaffold_1	AUGUSTUS	transcript	3641157	3642221	0.62	-	.	g741.t1
Scaffold_1	AUGUSTUS	stop_codon	3641157	3641159	.	-	0	transcript_id "g741.t1"; gene_id "g741";
Scaffold_1	AUGUSTUS	CDS	3641157	3642221	0.62	-	0	transcript_id "g741.t1"; gene_id "g741";
Scaffold_1	AUGUSTUS	start_codon	3642219	3642221	.	-	0	transcript_id "g741.t1"; gene_id "g741";
# protein sequence = [MPGTQAWKRHGCYKLGSTQYFNMPLNKGALGCYDEWNGRDHFDPTTDSRRLFGQFNHLRSVYGSLQDGFNLVERGNWT
# YYIERPGSNGSATEMGLWSISRSAISGVQTLGGTYQDQVWLLFTNENTTKTWSYDCKGDLWISSPYTSGTTVRNLFAPYETYTLEDSLSSYNNDNQSV
# WYGCLSSVTMAPYGFKALVPANEWTAPPPALTAFNPGHDARILANPGDANATTVDISLEFNTEMDCNSVTNSISMNMSSFSGASTPSITNVNCGALTN
# PATGNVPGVSQTQWVWNATLANFPDGILTLTVNNPSSSGGNGTGVSHNSYPFFLISYLCYTVDRSSHVEEGHIWKRHGLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g741
###
# start gene g742
Scaffold_1	AUGUSTUS	gene	3642855	3643529	0.57	-	.	g742
Scaffold_1	AUGUSTUS	transcript	3642855	3643529	0.57	-	.	g742.t1
Scaffold_1	AUGUSTUS	stop_codon	3642855	3642857	.	-	0	transcript_id "g742.t1"; gene_id "g742";
Scaffold_1	AUGUSTUS	CDS	3642855	3643315	0.73	-	2	transcript_id "g742.t1"; gene_id "g742";
Scaffold_1	AUGUSTUS	CDS	3643469	3643529	0.57	-	0	transcript_id "g742.t1"; gene_id "g742";
Scaffold_1	AUGUSTUS	start_codon	3643527	3643529	.	-	0	transcript_id "g742.t1"; gene_id "g742";
# protein sequence = [MADFTVGTMSDLIGFDGFVTLLNRHPVIKTFDLCHRLATHATTRVKLPNSGSTMVQLSPWTPTVVSDFDQYGDMEAFG
# VHPDWQRQLSKFASVQDRLREWKPSVMDKLTAFSCLAITALDIDAIRIDKATQVTVDALATWASSTRNCANKLGKNNFFIPGEVTGGNTFGSLYM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g742
###
# start gene g743
Scaffold_1	AUGUSTUS	gene	3651968	3653177	0.64	+	.	g743
Scaffold_1	AUGUSTUS	transcript	3651968	3653177	0.64	+	.	g743.t1
Scaffold_1	AUGUSTUS	start_codon	3651968	3651970	.	+	0	transcript_id "g743.t1"; gene_id "g743";
Scaffold_1	AUGUSTUS	CDS	3651968	3652135	0.81	+	0	transcript_id "g743.t1"; gene_id "g743";
Scaffold_1	AUGUSTUS	CDS	3652316	3652486	0.82	+	0	transcript_id "g743.t1"; gene_id "g743";
Scaffold_1	AUGUSTUS	CDS	3652848	3653177	0.96	+	0	transcript_id "g743.t1"; gene_id "g743";
Scaffold_1	AUGUSTUS	stop_codon	3653175	3653177	.	+	0	transcript_id "g743.t1"; gene_id "g743";
# protein sequence = [MFSQDEAYSAYMDKFFERNPTTSISWLHDLGKKRHREAAEALLIEAQQTVNLEVKHLLAFHDALDVVSVHKALLDEFT
# AVVANMRGRRSLDTQVDTLIQEKASLLSEKPELTNLERDTKTTGIGDAELTQRFRETALYTTFLDILSQPDQDEPEGFETDPDVALVVPTIEEIASRW
# PGIPQDQVERIHDDYTSECDKLGEFELEESYPRVRELAEYELSIRD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g743
###
# start gene g744
Scaffold_1	AUGUSTUS	gene	3655984	3656472	0.5	+	.	g744
Scaffold_1	AUGUSTUS	transcript	3655984	3656472	0.5	+	.	g744.t1
Scaffold_1	AUGUSTUS	start_codon	3655984	3655986	.	+	0	transcript_id "g744.t1"; gene_id "g744";
Scaffold_1	AUGUSTUS	CDS	3655984	3656472	0.5	+	0	transcript_id "g744.t1"; gene_id "g744";
Scaffold_1	AUGUSTUS	stop_codon	3656470	3656472	.	+	0	transcript_id "g744.t1"; gene_id "g744";
# protein sequence = [MPATFNLELVPGQHVALDTTVTSDELDMARMEDGTTVDGMFWGKLDIVHNGDDHRMEFSGTRLTNQQDYSPDFMFDSR
# VMTKLAVAAKPTTAKCNLSLLTPETTYCDVTLMFSPYWKPGTIWPPAESLGDNKVKYFLRVHPGGALEHFDSEVVSTALYYEAM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g744
###
# start gene g745
Scaffold_1	AUGUSTUS	gene	3659380	3659739	0.66	-	.	g745
Scaffold_1	AUGUSTUS	transcript	3659380	3659739	0.66	-	.	g745.t1
Scaffold_1	AUGUSTUS	stop_codon	3659380	3659382	.	-	0	transcript_id "g745.t1"; gene_id "g745";
Scaffold_1	AUGUSTUS	CDS	3659380	3659739	0.66	-	0	transcript_id "g745.t1"; gene_id "g745";
Scaffold_1	AUGUSTUS	start_codon	3659737	3659739	.	-	0	transcript_id "g745.t1"; gene_id "g745";
# protein sequence = [MNPPDPLTTHFDPVRLQEEATYANAIPLPSPPSSHPDFNLNITAVDIATVKAYLKRTAHSDSKGADSTTYSQLISIPN
# DRLALLFGRAFSNSEFPASWLTSIIIAVPKPGKDPSNPNSY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g745
###
# start gene g746
Scaffold_1	AUGUSTUS	gene	3661318	3661608	0.79	-	.	g746
Scaffold_1	AUGUSTUS	transcript	3661318	3661608	0.79	-	.	g746.t1
Scaffold_1	AUGUSTUS	stop_codon	3661318	3661320	.	-	0	transcript_id "g746.t1"; gene_id "g746";
Scaffold_1	AUGUSTUS	CDS	3661318	3661608	0.79	-	0	transcript_id "g746.t1"; gene_id "g746";
Scaffold_1	AUGUSTUS	start_codon	3661606	3661608	.	-	0	transcript_id "g746.t1"; gene_id "g746";
# protein sequence = [MVRSNPIHPDLCLASSNSSDGRTINEQRATASSRMEIEKEEKIERQKRAEAERMQIQSTQAGLDDDIDPNEVRPSAEG
# RNSDSELGEAWEDWGESD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g746
###
# start gene g747
Scaffold_1	AUGUSTUS	gene	3667343	3667705	0.46	+	.	g747
Scaffold_1	AUGUSTUS	transcript	3667343	3667705	0.46	+	.	g747.t1
Scaffold_1	AUGUSTUS	start_codon	3667343	3667345	.	+	0	transcript_id "g747.t1"; gene_id "g747";
Scaffold_1	AUGUSTUS	CDS	3667343	3667705	0.46	+	0	transcript_id "g747.t1"; gene_id "g747";
Scaffold_1	AUGUSTUS	stop_codon	3667703	3667705	.	+	0	transcript_id "g747.t1"; gene_id "g747";
# protein sequence = [MPQAADQERLAKEAEERIETQEREWFAKKPRHEELDLITLTDEVSAKAASLSIALQNISQTPQAKRPADAEAFVFEED
# AKDQAQVEQLREKLQALKVVARAKVTEIACTVLCFTLIVQRI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g747
###
# start gene g748
Scaffold_1	AUGUSTUS	gene	3673201	3674055	0.68	-	.	g748
Scaffold_1	AUGUSTUS	transcript	3673201	3674055	0.68	-	.	g748.t1
Scaffold_1	AUGUSTUS	stop_codon	3673201	3673203	.	-	0	transcript_id "g748.t1"; gene_id "g748";
Scaffold_1	AUGUSTUS	CDS	3673201	3674055	0.68	-	0	transcript_id "g748.t1"; gene_id "g748";
Scaffold_1	AUGUSTUS	start_codon	3674053	3674055	.	-	0	transcript_id "g748.t1"; gene_id "g748";
# protein sequence = [MSFQAHACTRYSFAYYACHPLKGLSQNKLSMWRDEAHGKAHPDTEDEGTEENADDGPTTDVNPEGGAASRRVSSLAPE
# SDAAAYASSSPSPPTHPPSSTTPSNAGGDEFDDQDMEAIWKEMETEQANEARRATTTTSNVASRDGDVQSSTNANGAEGSFMDVDDDIEGWLAMEEAM
# DGRSLTSTAAPTGLSFATAVNSNPSKNANGSVTLAVDDDEMWGISHETEAEDARKQAALKDHSAVGPHPKHLRKHRQYPLQNEASTICIAKSSRNQLC
# IAAIRGNTRN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g748
###
# start gene g749
Scaffold_1	AUGUSTUS	gene	3674491	3674730	0.99	-	.	g749
Scaffold_1	AUGUSTUS	transcript	3674491	3674730	0.99	-	.	g749.t1
Scaffold_1	AUGUSTUS	stop_codon	3674491	3674493	.	-	0	transcript_id "g749.t1"; gene_id "g749";
Scaffold_1	AUGUSTUS	CDS	3674491	3674730	0.99	-	0	transcript_id "g749.t1"; gene_id "g749";
Scaffold_1	AUGUSTUS	start_codon	3674728	3674730	.	-	0	transcript_id "g749.t1"; gene_id "g749";
# protein sequence = [MDIFDDDNEVEIISRPSTSASTASFGSSSSSQPLFLPDHDDEDEFNNGPEKNLPQQQDINVDEIFDSVVGDDLNFDYV
# P]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g749
###
# start gene g750
Scaffold_1	AUGUSTUS	gene	3678518	3679384	0.85	+	.	g750
Scaffold_1	AUGUSTUS	transcript	3678518	3679384	0.85	+	.	g750.t1
Scaffold_1	AUGUSTUS	start_codon	3678518	3678520	.	+	0	transcript_id "g750.t1"; gene_id "g750";
Scaffold_1	AUGUSTUS	CDS	3678518	3679384	0.85	+	0	transcript_id "g750.t1"; gene_id "g750";
Scaffold_1	AUGUSTUS	stop_codon	3679382	3679384	.	+	0	transcript_id "g750.t1"; gene_id "g750";
# protein sequence = [MGEITSFYERKTLSRSDSSEIPTFGFLPFSRDNVFRIRNEGGSYNDQKIIAKKVFEAFNVSTSSSKVAEGESKYQPNS
# QSHYNEEMMEEEIKLTLGILPSGASLLLLTFTQVKQLCSYWRYSLPLPNEALQSSVFESLSPIEFDDIDSLAAKLRSLAPKSRGDRRDTSRDNKGFCQ
# SVDLQEGSKRGVFENVRLLRQLATKRIPPPPSTPGLGNTIHEPYAQFSVPQNLDKTLLPRIQVAAFAYTLWSVGMGNLDLLDVAWARAEGGMHDLRAS
# RDGGGTSGLWLEFV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g750
###
# start gene g751
Scaffold_1	AUGUSTUS	gene	3680259	3681009	0.52	+	.	g751
Scaffold_1	AUGUSTUS	transcript	3680259	3681009	0.52	+	.	g751.t1
Scaffold_1	AUGUSTUS	start_codon	3680259	3680261	.	+	0	transcript_id "g751.t1"; gene_id "g751";
Scaffold_1	AUGUSTUS	CDS	3680259	3680643	0.52	+	0	transcript_id "g751.t1"; gene_id "g751";
Scaffold_1	AUGUSTUS	CDS	3680777	3681009	0.76	+	2	transcript_id "g751.t1"; gene_id "g751";
Scaffold_1	AUGUSTUS	stop_codon	3681007	3681009	.	+	0	transcript_id "g751.t1"; gene_id "g751";
# protein sequence = [MGDRFDEDGYDTTSGEEDIIISESNERPIAKKEENGFRVKGEPRESAANTIKRGTRLLLAQSPNRNLPANPNRASKHP
# SNHSFQSSKFMLLISRHFSTPPQALIPVRTVYREWQESSTWVEVEYHFTEYGRTINEQRATASSRMEIEKEEKIERQKRAEAERMQIQSTQAGLDDDI
# DPNEVRPSAEGQNSDSELGEAWEDWGESD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g751
###
# start gene g752
Scaffold_1	AUGUSTUS	gene	3685758	3686293	0.58	-	.	g752
Scaffold_1	AUGUSTUS	transcript	3685758	3686293	0.58	-	.	g752.t1
Scaffold_1	AUGUSTUS	stop_codon	3685758	3685760	.	-	0	transcript_id "g752.t1"; gene_id "g752";
Scaffold_1	AUGUSTUS	CDS	3685758	3686014	0.87	-	2	transcript_id "g752.t1"; gene_id "g752";
Scaffold_1	AUGUSTUS	CDS	3686185	3686293	0.58	-	0	transcript_id "g752.t1"; gene_id "g752";
Scaffold_1	AUGUSTUS	start_codon	3686291	3686293	.	-	0	transcript_id "g752.t1"; gene_id "g752";
# protein sequence = [MHALSIATFVLLSAAVTAPAVGYVVPRKETPSTYAVETLETARPSYCIPSTSASASASAAEATSTATTPADGDNGNDN
# DDDDSDDCDDGDDDDSTSTSVVSTATLSSTSEAFSPTSSSAFF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g752
###
# start gene g753
Scaffold_1	AUGUSTUS	gene	3688976	3689665	0.49	+	.	g753
Scaffold_1	AUGUSTUS	transcript	3688976	3689665	0.49	+	.	g753.t1
Scaffold_1	AUGUSTUS	start_codon	3688976	3688978	.	+	0	transcript_id "g753.t1"; gene_id "g753";
Scaffold_1	AUGUSTUS	CDS	3688976	3689145	0.49	+	0	transcript_id "g753.t1"; gene_id "g753";
Scaffold_1	AUGUSTUS	CDS	3689224	3689665	0.5	+	1	transcript_id "g753.t1"; gene_id "g753";
Scaffold_1	AUGUSTUS	stop_codon	3689663	3689665	.	+	0	transcript_id "g753.t1"; gene_id "g753";
# protein sequence = [MHIVGNDNNGNGTGGSSRLTVGQNLQNDNSCLNNNSPSSTAGTPAGGSYPTDTSGDSTNVGAIVGGVVGGVLGLLALL
# LTFYFIRRRTRQNRKNNEKPVDLLQSDEGDERPNGPGEPPEYYRPDPFIVPDPTYDESSASASGRPLSASERPTSRSGTPDVASSSTGTKKTGAPRVL
# RPVNIIQHDDAGPSESWWKERRGARDH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g753
###
# start gene g754
Scaffold_1	AUGUSTUS	gene	3690403	3692080	0.45	+	.	g754
Scaffold_1	AUGUSTUS	transcript	3690403	3692080	0.45	+	.	g754.t1
Scaffold_1	AUGUSTUS	start_codon	3690403	3690405	.	+	0	transcript_id "g754.t1"; gene_id "g754";
Scaffold_1	AUGUSTUS	CDS	3690403	3690650	1	+	0	transcript_id "g754.t1"; gene_id "g754";
Scaffold_1	AUGUSTUS	CDS	3690698	3690731	0.45	+	1	transcript_id "g754.t1"; gene_id "g754";
Scaffold_1	AUGUSTUS	CDS	3691094	3692080	1	+	0	transcript_id "g754.t1"; gene_id "g754";
Scaffold_1	AUGUSTUS	stop_codon	3692078	3692080	.	+	0	transcript_id "g754.t1"; gene_id "g754";
# protein sequence = [MSAPVVAETSAISTVEAAGVPAVAPPSGAAPMPAIAPAPAPTYAPQGSAASTPSASLYVGELDPTVTEAMLFEIFNMI
# GPVASPVSVFAVTQSPALHDTFAAFGNVLSCKVATDEHGRSKGYGFVHYETAEAADGAIKAVNGMLLNDKKVYVGHHISRKVNKTTTQSISLMLITVM
# QERQSKLDEMKAQFTNLYIKNLDPEVTEEEFEKLFEPYGKVTSAIVQKDEEGKSRGFGFVNYESHEDAQKAVDALHDTEQHGRKLFVSRAQKKAEREE
# ELRKSYEQAKMEKLSKYQGVNLYIKNLEDDVDDEKLRAEFEPFGTITSCKVMRDDKTASKGFGFVCFSSPDEATKAVAEMNNKMIGSKPLYVSLLSVA
# KLGASNWRARSLSATKLECNRLLLPVYLEDISMDRCIILLVPDSLLKDVV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g754
###
# start gene g755
Scaffold_1	AUGUSTUS	gene	3692191	3692783	0.99	+	.	g755
Scaffold_1	AUGUSTUS	transcript	3692191	3692783	0.99	+	.	g755.t1
Scaffold_1	AUGUSTUS	start_codon	3692191	3692193	.	+	0	transcript_id "g755.t1"; gene_id "g755";
Scaffold_1	AUGUSTUS	CDS	3692191	3692576	1	+	0	transcript_id "g755.t1"; gene_id "g755";
Scaffold_1	AUGUSTUS	CDS	3692633	3692783	0.99	+	1	transcript_id "g755.t1"; gene_id "g755";
Scaffold_1	AUGUSTUS	stop_codon	3692781	3692783	.	+	0	transcript_id "g755.t1"; gene_id "g755";
# protein sequence = [MPGYPGRGGPRPPAPRGPPSPTLQNAVPPRPNGGAPPNGASPNGAPRAPGPQVQSRPTGAPAPPAGRSPQGLQPQGQP
# QGYKLNPQTRNAPGQAPVPEIPPFNTAVLANSSPMEQKQMLGEQIYMRIAGTQPELAGKITGMLLEMDNTELLQLLESQEAMNNKVQEALVVLQEYSK
# DE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g755
###
# start gene g756
Scaffold_1	AUGUSTUS	gene	3694652	3695030	0.42	+	.	g756
Scaffold_1	AUGUSTUS	transcript	3694652	3695030	0.42	+	.	g756.t1
Scaffold_1	AUGUSTUS	start_codon	3694652	3694654	.	+	0	transcript_id "g756.t1"; gene_id "g756";
Scaffold_1	AUGUSTUS	CDS	3694652	3694697	0.45	+	0	transcript_id "g756.t1"; gene_id "g756";
Scaffold_1	AUGUSTUS	CDS	3694786	3695030	0.71	+	2	transcript_id "g756.t1"; gene_id "g756";
Scaffold_1	AUGUSTUS	stop_codon	3695028	3695030	.	+	0	transcript_id "g756.t1"; gene_id "g756";
# protein sequence = [MTAPQQLVWFITGGIISTALSRGDLVIATGRSQEKLDKLLEKHVKTDNLRVLQLDVTSSPDIVKDVVNQAVAFWGRID
# VAVNNAGNGELGLIEETE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g756
###
# start gene g757
Scaffold_1	AUGUSTUS	gene	3696158	3698039	0.73	-	.	g757
Scaffold_1	AUGUSTUS	transcript	3696158	3698039	0.73	-	.	g757.t1
Scaffold_1	AUGUSTUS	stop_codon	3696158	3696160	.	-	0	transcript_id "g757.t1"; gene_id "g757";
Scaffold_1	AUGUSTUS	CDS	3696158	3697784	0.96	-	1	transcript_id "g757.t1"; gene_id "g757";
Scaffold_1	AUGUSTUS	CDS	3697876	3698039	0.75	-	0	transcript_id "g757.t1"; gene_id "g757";
Scaffold_1	AUGUSTUS	start_codon	3698037	3698039	.	-	0	transcript_id "g757.t1"; gene_id "g757";
# protein sequence = [MVQLAEPIITPAPWPTLLGRQYVQFRPRQTVSYVPWLQNQFVEYERDRPLIRIWVHWSSLSYKRRWKLKSKPKWIYVF
# EVSTRQFHEEFFHRLTINGTSSSPTSSPDSTPPTSAPPSSTSPTSTSSSTTSSQSSTNPDSSSLSPSQSSSSTSSSDSDSSSPSQTSSSSTSSSQSNT
# SISSSSTLTSTASSESSSSIQSSITFVTVVTTEPDGSVSTFVVPSSLSSQSPDSKSADTHTAIIAGSAVGGALFAILLAVLVSLFCWRRRKNRKLGFI
# EALTRRSKEGKGAGGIGLLDGEFDDDEEYRDELAGVHMRERTTSAHSPQPSVGAGSMASLSGPTQNSQHANYPYNPAPTLYRARASDSGSMFHEEGVW
# PPPNHGTQFVDPFVPARELSKDSELGSIVDQIMGTDISAHASSLPPGAAPAVVPGAVGVPNSSSHVRGASGSSVNSTTPKRSSPLSKMLSKPDPPRSI
# LTRTQTDPNASFDAHNNSTMVSSPTSIHPRNWLERQPKTPSPRDPPLTLPPPLNLSGTGGSSAPPSAFANSASSLVSAYGAPHMTSPPTSAGTSKHNK
# RVSWGELPTPSRPGSRTGSIAGGIGEAM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g757
###
# start gene g758
Scaffold_1	AUGUSTUS	gene	3700946	3702312	0.48	+	.	g758
Scaffold_1	AUGUSTUS	transcript	3700946	3702312	0.48	+	.	g758.t1
Scaffold_1	AUGUSTUS	start_codon	3700946	3700948	.	+	0	transcript_id "g758.t1"; gene_id "g758";
Scaffold_1	AUGUSTUS	CDS	3700946	3701438	0.51	+	0	transcript_id "g758.t1"; gene_id "g758";
Scaffold_1	AUGUSTUS	CDS	3701519	3702312	0.49	+	2	transcript_id "g758.t1"; gene_id "g758";
Scaffold_1	AUGUSTUS	stop_codon	3702310	3702312	.	+	0	transcript_id "g758.t1"; gene_id "g758";
# protein sequence = [MSLRTNPPRKADNRPTKPTAACAHREHIFDKDDIKDRYHDPDGNKYRVCKHQPCPNRYDKITTGYIPGFARLIDRKQE
# DLILGRGAPPEQVASSSSQKPEGTPEAAPAPEPEYPVFPPPPSPVLDRPSSPISSLPRSSPPPPDPEDPDPGAEVSDPESDDDDDILELATRSIGFSN
# HLTSNPKDDTEAWEAKKDDDGNLLNAIVGRLSDQIYRRYKNYENVFDLWKNLLSDFDSKSALTEAHLQQQLHSMHCHEPSKVNEHLDKLLEIRDSLEA
# RKITIPEEMFNNTIIASIPNIFKPTINALVVVAARTSVPLTTRELVSTIRAEASGHTRGQSGKKESANYAGEIPTAAGVDLTEIVETSEASPGAEEMV
# IEEEVKVDQTPTIPHATIAVEKGISLINAVHRSDNRPTRPKRVLKRRRKTNHLERQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g758
###
# start gene g759
Scaffold_1	AUGUSTUS	gene	3702516	3703610	0.58	+	.	g759
Scaffold_1	AUGUSTUS	transcript	3702516	3703610	0.58	+	.	g759.t1
Scaffold_1	AUGUSTUS	start_codon	3702516	3702518	.	+	0	transcript_id "g759.t1"; gene_id "g759";
Scaffold_1	AUGUSTUS	CDS	3702516	3703610	0.58	+	0	transcript_id "g759.t1"; gene_id "g759";
Scaffold_1	AUGUSTUS	stop_codon	3703608	3703610	.	+	0	transcript_id "g759.t1"; gene_id "g759";
# protein sequence = [MTPLQDKLRNTRSVPTRIIQAANAETFTSNTAGNLQIDLPINEDGISKSLTLQNTLLCPNTPNTLVSLGKLDDAGYVM
# VIKDGTLKIINRQGETIGIVPKTNGLYQIPSAEYAYAGKATRMVSLYEAHCIAGHQNYAYVKHMFKSNQVHGIKLDPKQMEEPECRTCMLAKAARSPI
# SKIRTSPRAEKFGDVFHMDVWGPASVQTLNHYVYALTVIDEATSWLEEPLMKGKDEAFAQYVILQTGLQTQYGVTVKKLHSDRGGEFLSGEFTAYLER
# LGTKRSLTVHDTPEHNGIAERSHRTLLNGVRSLMISSGLPKWLWGFMMGYTVYVWNRTPKKANGMISPWENDLAQSRHLQLPHLWKHGLC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g759
###
# start gene g760
Scaffold_1	AUGUSTUS	gene	3704410	3705098	0.46	+	.	g760
Scaffold_1	AUGUSTUS	transcript	3704410	3705098	0.46	+	.	g760.t1
Scaffold_1	AUGUSTUS	start_codon	3704410	3704412	.	+	0	transcript_id "g760.t1"; gene_id "g760";
Scaffold_1	AUGUSTUS	CDS	3704410	3704460	0.46	+	0	transcript_id "g760.t1"; gene_id "g760";
Scaffold_1	AUGUSTUS	CDS	3704577	3705098	0.46	+	0	transcript_id "g760.t1"; gene_id "g760";
Scaffold_1	AUGUSTUS	stop_codon	3705096	3705098	.	+	0	transcript_id "g760.t1"; gene_id "g760";
# protein sequence = [MDLESRTESSGILQHHLRGTYDIVIPPDDANILTSKWVFRTKRDEQGKVTGHRARLVVRGFNQIPDVDYFPDETFTSV
# TKLAAARAILSTGAEQNMFIHQMDVKSAYLYGKLDDNEQIYMKAPPGVDIEVKAGQVLKLKLALYGLKQAGRHWYMRFREIMTSVGLTRSNFDHAVFY
# RTDPFVSYSSTSMI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g760
###
# start gene g761
Scaffold_1	AUGUSTUS	gene	3706304	3706657	0.91	+	.	g761
Scaffold_1	AUGUSTUS	transcript	3706304	3706657	0.91	+	.	g761.t1
Scaffold_1	AUGUSTUS	start_codon	3706304	3706306	.	+	0	transcript_id "g761.t1"; gene_id "g761";
Scaffold_1	AUGUSTUS	CDS	3706304	3706657	0.91	+	0	transcript_id "g761.t1"; gene_id "g761";
Scaffold_1	AUGUSTUS	stop_codon	3706655	3706657	.	+	0	transcript_id "g761.t1"; gene_id "g761";
# protein sequence = [MSATSTERPSSSKAESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ
# GPPQWNLGWDHHNGGIPPWVTPNLPVAPWEVSHTPLPGE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g761
###
# start gene g762
Scaffold_1	AUGUSTUS	gene	3708611	3709384	0.44	+	.	g762
Scaffold_1	AUGUSTUS	transcript	3708611	3709384	0.44	+	.	g762.t1
Scaffold_1	AUGUSTUS	start_codon	3708611	3708613	.	+	0	transcript_id "g762.t1"; gene_id "g762";
Scaffold_1	AUGUSTUS	CDS	3708611	3709384	0.44	+	0	transcript_id "g762.t1"; gene_id "g762";
Scaffold_1	AUGUSTUS	stop_codon	3709382	3709384	.	+	0	transcript_id "g762.t1"; gene_id "g762";
# protein sequence = [MREYTREGPSPVVPQPRSWQATESISFNRNTPTGAKDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPE
# GGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPRDRVIVIRKVPTRGNRTNRVGMVKERGDRGELPT
# GAPEVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDWSAWKTCVKIMYTV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g762
###
# start gene g763
Scaffold_1	AUGUSTUS	gene	3715362	3716550	0.65	-	.	g763
Scaffold_1	AUGUSTUS	transcript	3715362	3716550	0.65	-	.	g763.t1
Scaffold_1	AUGUSTUS	stop_codon	3715362	3715364	.	-	0	transcript_id "g763.t1"; gene_id "g763";
Scaffold_1	AUGUSTUS	CDS	3715362	3716091	0.91	-	1	transcript_id "g763.t1"; gene_id "g763";
Scaffold_1	AUGUSTUS	CDS	3716180	3716550	0.69	-	0	transcript_id "g763.t1"; gene_id "g763";
Scaffold_1	AUGUSTUS	start_codon	3716548	3716550	.	-	0	transcript_id "g763.t1"; gene_id "g763";
# protein sequence = [MEPILLRAVHSEVAARAADCSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYP
# LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLPPLAKIYTKLDLAHAYHLVRITEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQ
# RFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHQEHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQS
# FLGFANFYRRFIYNYRYRCADDSAYPKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIVSCAGSKPQRSTPPFYSK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g763
###
# start gene g764
Scaffold_1	AUGUSTUS	gene	3717369	3718862	0.41	-	.	g764
Scaffold_1	AUGUSTUS	transcript	3717369	3718862	0.41	-	.	g764.t1
Scaffold_1	AUGUSTUS	stop_codon	3717369	3717371	.	-	0	transcript_id "g764.t1"; gene_id "g764";
Scaffold_1	AUGUSTUS	CDS	3717369	3717698	0.91	-	0	transcript_id "g764.t1"; gene_id "g764";
Scaffold_1	AUGUSTUS	CDS	3718489	3718712	0.44	-	2	transcript_id "g764.t1"; gene_id "g764";
Scaffold_1	AUGUSTUS	CDS	3718784	3718862	0.96	-	0	transcript_id "g764.t1"; gene_id "g764";
Scaffold_1	AUGUSTUS	start_codon	3718860	3718862	.	-	0	transcript_id "g764.t1"; gene_id "g764";
# protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRPIARRTGKQPQRRAASESPRDPPPHFDLDAGDHDDQDPPVDPDDPGADNNND
# DLGDDSGGLPRGEPGDPSGRLLVPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPTFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIA
# DCNKRKARESKGRAAEVEETPEATVEVVEEESEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g764
###
# start gene g765
Scaffold_1	AUGUSTUS	gene	3721842	3722543	0.7	+	.	g765
Scaffold_1	AUGUSTUS	transcript	3721842	3722543	0.7	+	.	g765.t1
Scaffold_1	AUGUSTUS	start_codon	3721842	3721844	.	+	0	transcript_id "g765.t1"; gene_id "g765";
Scaffold_1	AUGUSTUS	CDS	3721842	3722543	0.7	+	0	transcript_id "g765.t1"; gene_id "g765";
Scaffold_1	AUGUSTUS	stop_codon	3722541	3722543	.	+	0	transcript_id "g765.t1"; gene_id "g765";
# protein sequence = [MPTTVEDITYMCDKPYREAVGALQYLSVATRPDITYAVGILAKFLQNPGITHWNAVKRVYAYLKYTRDLWLTFGGTQA
# EIKGYTDADGMSQEDRHAISGYVFMLNGGAVSWTSKRQDTISLSTTEAEYIALTHAAKEAIWFRNLLSELFGPITKPIILNANNQSAITLAKDDRFHA
# RTKHIDIRYHFIRYVIEEGKIRLVYCPTEDMTADIFTKALPSLKAKHFAASMGLTKV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g765
###
# start gene g766
Scaffold_1	AUGUSTUS	gene	3729521	3730935	0.18	+	.	g766
Scaffold_1	AUGUSTUS	transcript	3729521	3730935	0.18	+	.	g766.t1
Scaffold_1	AUGUSTUS	start_codon	3729521	3729523	.	+	0	transcript_id "g766.t1"; gene_id "g766";
Scaffold_1	AUGUSTUS	CDS	3729521	3729685	0.33	+	0	transcript_id "g766.t1"; gene_id "g766";
Scaffold_1	AUGUSTUS	CDS	3730323	3730464	0.41	+	0	transcript_id "g766.t1"; gene_id "g766";
Scaffold_1	AUGUSTUS	CDS	3730538	3730935	0.9	+	2	transcript_id "g766.t1"; gene_id "g766";
Scaffold_1	AUGUSTUS	stop_codon	3730933	3730935	.	+	0	transcript_id "g766.t1"; gene_id "g766";
# protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKAISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKEEKSA
# VNDVLLVSARFIATLTVMFLLTVCLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILK
# SRQDSGSDSSASDASFATAQSIPTTGSEDTSSLLQRLLFQSLRPSNEPLLHSLVVLLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g766
###
# start gene g767
Scaffold_1	AUGUSTUS	gene	3731223	3731528	0.94	-	.	g767
Scaffold_1	AUGUSTUS	transcript	3731223	3731528	0.94	-	.	g767.t1
Scaffold_1	AUGUSTUS	stop_codon	3731223	3731225	.	-	0	transcript_id "g767.t1"; gene_id "g767";
Scaffold_1	AUGUSTUS	CDS	3731223	3731528	0.94	-	0	transcript_id "g767.t1"; gene_id "g767";
Scaffold_1	AUGUSTUS	start_codon	3731526	3731528	.	-	0	transcript_id "g767.t1"; gene_id "g767";
# protein sequence = [MVVIRRTKGGSYIIAEMDGTILKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIF
# DAIPRLRLSDTDSDEELSEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g767
###
# start gene g768
Scaffold_1	AUGUSTUS	gene	3736233	3736933	0.59	-	.	g768
Scaffold_1	AUGUSTUS	transcript	3736233	3736933	0.59	-	.	g768.t1
Scaffold_1	AUGUSTUS	stop_codon	3736233	3736235	.	-	0	transcript_id "g768.t1"; gene_id "g768";
Scaffold_1	AUGUSTUS	CDS	3736233	3736598	0.84	-	0	transcript_id "g768.t1"; gene_id "g768";
Scaffold_1	AUGUSTUS	CDS	3736757	3736933	0.6	-	0	transcript_id "g768.t1"; gene_id "g768";
Scaffold_1	AUGUSTUS	start_codon	3736931	3736933	.	-	0	transcript_id "g768.t1"; gene_id "g768";
# protein sequence = [MDTNDVNKKRSLRKLSEAYVLASREHLKSQDEQAEEKIIDCYLNQKMIGINKYSVYGEMFGGELAINLNPQRPQNQCN
# NENTSETIRDDNWNKPKNSQRTRKRMVRYEVLKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQPGLVNEPPTNKLEERIKLNQQDRSPI
# NFNR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g768
###
# start gene g769
Scaffold_1	AUGUSTUS	gene	3737064	3737714	0.47	-	.	g769
Scaffold_1	AUGUSTUS	transcript	3737064	3737714	0.47	-	.	g769.t1
Scaffold_1	AUGUSTUS	stop_codon	3737064	3737066	.	-	0	transcript_id "g769.t1"; gene_id "g769";
Scaffold_1	AUGUSTUS	CDS	3737064	3737714	0.47	-	0	transcript_id "g769.t1"; gene_id "g769";
Scaffold_1	AUGUSTUS	start_codon	3737712	3737714	.	-	0	transcript_id "g769.t1"; gene_id "g769";
# protein sequence = [MFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDE
# EIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSE
# ITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g769
###
# start gene g770
Scaffold_1	AUGUSTUS	gene	3738108	3738431	0.46	-	.	g770
Scaffold_1	AUGUSTUS	transcript	3738108	3738431	0.46	-	.	g770.t1
Scaffold_1	AUGUSTUS	stop_codon	3738108	3738110	.	-	0	transcript_id "g770.t1"; gene_id "g770";
Scaffold_1	AUGUSTUS	CDS	3738108	3738431	0.46	-	0	transcript_id "g770.t1"; gene_id "g770";
Scaffold_1	AUGUSTUS	start_codon	3738429	3738431	.	-	0	transcript_id "g770.t1"; gene_id "g770";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g770
###
# start gene g771
Scaffold_1	AUGUSTUS	gene	3738461	3739105	0.43	-	.	g771
Scaffold_1	AUGUSTUS	transcript	3738461	3739105	0.43	-	.	g771.t1
Scaffold_1	AUGUSTUS	stop_codon	3738461	3738463	.	-	0	transcript_id "g771.t1"; gene_id "g771";
Scaffold_1	AUGUSTUS	CDS	3738461	3739105	0.43	-	0	transcript_id "g771.t1"; gene_id "g771";
Scaffold_1	AUGUSTUS	start_codon	3739103	3739105	.	-	0	transcript_id "g771.t1"; gene_id "g771";
# protein sequence = [MVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNG
# TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN
# LAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g771
###
# start gene g772
Scaffold_1	AUGUSTUS	gene	3739193	3739852	0.96	-	.	g772
Scaffold_1	AUGUSTUS	transcript	3739193	3739852	0.96	-	.	g772.t1
Scaffold_1	AUGUSTUS	stop_codon	3739193	3739195	.	-	0	transcript_id "g772.t1"; gene_id "g772";
Scaffold_1	AUGUSTUS	CDS	3739193	3739852	0.96	-	0	transcript_id "g772.t1"; gene_id "g772";
Scaffold_1	AUGUSTUS	start_codon	3739850	3739852	.	-	0	transcript_id "g772.t1"; gene_id "g772";
# protein sequence = [MSSEASNPAEKPWENFEGGDSSELRAVQWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLV
# HQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDN
# YYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g772
###
# start gene g773
Scaffold_1	AUGUSTUS	gene	3740084	3740794	0.65	+	.	g773
Scaffold_1	AUGUSTUS	transcript	3740084	3740794	0.65	+	.	g773.t1
Scaffold_1	AUGUSTUS	start_codon	3740084	3740086	.	+	0	transcript_id "g773.t1"; gene_id "g773";
Scaffold_1	AUGUSTUS	CDS	3740084	3740794	0.65	+	0	transcript_id "g773.t1"; gene_id "g773";
Scaffold_1	AUGUSTUS	stop_codon	3740792	3740794	.	+	0	transcript_id "g773.t1"; gene_id "g773";
# protein sequence = [MTDGSGTTASRKKAWEKVGLMGKMLQEMSWKDRTNELKEDIAEHITQKIDDEVLTFKTWVTTAKNETAEAAENGRKGN
# RILKEVVGRLDFNMSNGETAVEGEEGEITGSPTGTVNLSYAQALQVRNVANHLQRPKHAAAIQASKRMDHRIVVKTGSTSDLALGEAELVAKGKPSSG
# AGRGCGGRQVKVIAVYRRPKERVLYASCELRKRHGGLGREPGWRASARHGSRSNGTVELP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g773
###
# start gene g774
Scaffold_1	AUGUSTUS	gene	3751473	3751877	0.72	-	.	g774
Scaffold_1	AUGUSTUS	transcript	3751473	3751877	0.72	-	.	g774.t1
Scaffold_1	AUGUSTUS	stop_codon	3751473	3751475	.	-	0	transcript_id "g774.t1"; gene_id "g774";
Scaffold_1	AUGUSTUS	CDS	3751473	3751877	0.72	-	0	transcript_id "g774.t1"; gene_id "g774";
Scaffold_1	AUGUSTUS	start_codon	3751875	3751877	.	-	0	transcript_id "g774.t1"; gene_id "g774";
# protein sequence = [MGRFAGPVTSKASSARREGKTSAGTGTCEDNAEAVRRNIAAPSAAVAPTTLSSGNAPPNPQLSKEDLMEILHSPPLAF
# HDFENSIIIRQASPDTPAEHVELYERIVTPYNADAFELELTTHNILDRHPLLVNIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g774
###
# start gene g775
Scaffold_1	AUGUSTUS	gene	3752134	3753027	0.82	-	.	g775
Scaffold_1	AUGUSTUS	transcript	3752134	3753027	0.82	-	.	g775.t1
Scaffold_1	AUGUSTUS	stop_codon	3752134	3752136	.	-	0	transcript_id "g775.t1"; gene_id "g775";
Scaffold_1	AUGUSTUS	CDS	3752134	3753027	0.82	-	0	transcript_id "g775.t1"; gene_id "g775";
Scaffold_1	AUGUSTUS	start_codon	3753025	3753027	.	-	0	transcript_id "g775.t1"; gene_id "g775";
# protein sequence = [MKGFQSYPSLSRENRVRKTHKTEEILALFKKMDIGLKLKLNFKIDKENRRRREKSLEYQLGNAAEDASDIASFVTIDT
# KSLENVRKDQTIFERLKDFLTTDTLDFFRQRNEEEEGDRRSRTRGREEDAEEGARKKRKAGKVVLVPRSAGPCITTFDTLLFDTINAFPTFPLFLFTN
# KNLDLINTHMPELKRAKISHLEGKPHVPDLKEMAKWVKEAGGIFRDEDLDFIQWSQAAKNFYQFECLRDEDLGKEAPRALFYVEHFAFFLNQQDSEDF
# FAYWLKVEVKLQRNINQAICFRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g775
###
# start gene g776
Scaffold_1	AUGUSTUS	gene	3754236	3755206	0.27	+	.	g776
Scaffold_1	AUGUSTUS	transcript	3754236	3755206	0.27	+	.	g776.t1
Scaffold_1	AUGUSTUS	start_codon	3754236	3754238	.	+	0	transcript_id "g776.t1"; gene_id "g776";
Scaffold_1	AUGUSTUS	CDS	3754236	3754529	0.27	+	0	transcript_id "g776.t1"; gene_id "g776";
Scaffold_1	AUGUSTUS	CDS	3754634	3755206	0.95	+	0	transcript_id "g776.t1"; gene_id "g776";
Scaffold_1	AUGUSTUS	stop_codon	3755204	3755206	.	+	0	transcript_id "g776.t1"; gene_id "g776";
# protein sequence = [MSGSRTQTTTTITSAGPSWSKPTNPPPSEPVDDDDEVLEEKVRRMKARKAAAAAKKKAEEEAARKAAEEEGGSSAGVG
# GAAEAATARSRRGSSPGGSSPIGGDPDDGGDGEDDDDDDDDRAPCEQCRSKKISCQMQAGKRSSIICKPCHDAKVQCSYSRRPSTVKQEGGGNPLGKR
# IAILESQMAQLLADNRQLRDGQIKANTYHRHMTRKLEWLIMDANRRRNSPPELPEAGPSAPSKKRRRAADSDEEEEKEMEGEEVESEEEGEEENNEPA
# PKKAQLEKGKERAE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g776
###
# start gene g777
Scaffold_1	AUGUSTUS	gene	3755571	3756158	0.37	-	.	g777
Scaffold_1	AUGUSTUS	transcript	3755571	3756158	0.37	-	.	g777.t1
Scaffold_1	AUGUSTUS	stop_codon	3755571	3755573	.	-	0	transcript_id "g777.t1"; gene_id "g777";
Scaffold_1	AUGUSTUS	CDS	3755571	3756158	0.37	-	0	transcript_id "g777.t1"; gene_id "g777";
Scaffold_1	AUGUSTUS	start_codon	3756156	3756158	.	-	0	transcript_id "g777.t1"; gene_id "g777";
# protein sequence = [MKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPEFPIGSKVFVLAKHIRSTHPTEKFSEKYLGPFKVI
# SRPGTLSYKLKLPDYLRWIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLCYYIRWAGYEGTDDEFSWVAADEL
# HADELVPAFHARYPLKPGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g777
###
# start gene g778
Scaffold_1	AUGUSTUS	gene	3758136	3759773	0.55	+	.	g778
Scaffold_1	AUGUSTUS	transcript	3758136	3759773	0.55	+	.	g778.t1
Scaffold_1	AUGUSTUS	start_codon	3758136	3758138	.	+	0	transcript_id "g778.t1"; gene_id "g778";
Scaffold_1	AUGUSTUS	CDS	3758136	3759773	0.55	+	0	transcript_id "g778.t1"; gene_id "g778";
Scaffold_1	AUGUSTUS	stop_codon	3759771	3759773	.	+	0	transcript_id "g778.t1"; gene_id "g778";
# protein sequence = [MSLMLSGEDYTIALPNKLIQLAASAKDGKPKADIWEKIGLIGKILQECSYKDRMRKFRDEIIEKIEEKFDDETCRLEG
# RVKAMRKEVEDASNASTKLKDKVEGLVKEAEARGTTSWAGLVELEAGEVAGTNTAQLSYANAAQAKSVAQHIQQPRHNPAIRDAELKDRRIIIRSEAD
# SDWKLTEKEIVVKANLALEKIWQDEGEGTEMKVIAATKLRGNGAFLLMRSVAEAEAMKIGERMMRFCDAWGSKAFLRPNYHELVVESLPVETLIESLF
# ERSRIEDTNNLPNGSIAQIRWIKPIEKRRADQKYAHAILSMNDRVTANKLILNQVIVGGKVLRVRKNKPDPRRCAKCNLFGHIAEQCRAEHDSCARCA
# GQHRTSICIATRDQMQCANCKVKGHGAASRECPFFLRKLKDKAQWEPERGYEFFVTPDPETWIRDDDPLKEDFDQSWRQEVKEKHDTWTTVRRGMGQG
# RLAGGAPGQGGGIQKSQPIRGRTSRQRPLPPSAGPPQATLERFNFSRSRPPPSQSQPRGGDPTTQSSQMSTATSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g778
###
# start gene g779
Scaffold_1	AUGUSTUS	gene	3759851	3762045	0.38	+	.	g779
Scaffold_1	AUGUSTUS	transcript	3759851	3762045	0.38	+	.	g779.t1
Scaffold_1	AUGUSTUS	start_codon	3759851	3759853	.	+	0	transcript_id "g779.t1"; gene_id "g779";
Scaffold_1	AUGUSTUS	CDS	3759851	3761162	0.38	+	0	transcript_id "g779.t1"; gene_id "g779";
Scaffold_1	AUGUSTUS	CDS	3761234	3762045	0.38	+	2	transcript_id "g779.t1"; gene_id "g779";
Scaffold_1	AUGUSTUS	stop_codon	3762043	3762045	.	+	0	transcript_id "g779.t1"; gene_id "g779";
# protein sequence = [MHDDFLRGSATNTDIYAIQEPYIDSKGRTRALPHLQVVYPTGHIEHFGNLNRPKSRSVILISTRIPTGNWTQIDIDSP
# DITAIQITTRIGTIRIFNIYNDCEHDDTLQALNNWMRSPAARLSANGPHHYIWLGDFNRHHPLWDEPRNHHLFTARNLDAAQSLISLTAQFGLYMALP
# GSIPTLQAHNTGNYTRVDNLFCTDVLLNHIIVCDTVPSKRPILTDHFPIHTIFDIQLPTADERDRWNWAKVDWEDFAARLEEALGKLAPPREIETEET
# FWTTLGNFDTAIQQVIKEVVPKAKPSPHQRRWWNSTLTEMKRKTGTLSAKSHKKRFNPEHPIHEEFRRMRQAYDVEIKKAKVEKWVEYLEYADTSSVW
# EVGRLMENGYSDGGRTRVPGLKVNQPGNTECIVEDNVGKEYVFRNAFFSPPPNLPTSQRMRNTQTTTKPGTIPNDLFKATSELIVPHLGPIYRATFTL
# GIYPDDWSSTETIILKKPGRPDYRDPNAWHPITLSNGHGRLMNGCVADEITKRAELLGLLPALQFGARPGRNTTDSIHLMVDRIKELWREGYLVAVLY
# MDVKGAFPSVDLAMLQHELRMVGVPGEILDWIRRRYSGRKTQLSFDDYISQPFAVPGGEDQGDPFAAVGYILYAAGLLTTFRTLDKEEGFGFMDDVAA
# MKWGRGVDQLHAEIGQMMNKANGPLEWAASQTANLASRSSN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g779
###
# start gene g780
Scaffold_1	AUGUSTUS	gene	3766872	3767535	0.22	-	.	g780
Scaffold_1	AUGUSTUS	transcript	3766872	3767535	0.22	-	.	g780.t1
Scaffold_1	AUGUSTUS	stop_codon	3766872	3766874	.	-	0	transcript_id "g780.t1"; gene_id "g780";
Scaffold_1	AUGUSTUS	CDS	3766872	3767335	0.67	-	2	transcript_id "g780.t1"; gene_id "g780";
Scaffold_1	AUGUSTUS	CDS	3767460	3767535	0.22	-	0	transcript_id "g780.t1"; gene_id "g780";
Scaffold_1	AUGUSTUS	start_codon	3767533	3767535	.	-	0	transcript_id "g780.t1"; gene_id "g780";
# protein sequence = [MRLHDSRPSDSSESKSKVKEPEVFDAKEWFVPDILDPDLDSLPAWMSSFKALVKELQENFGVYDAQGEAEDSLGNLKM
# KETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAEHIKDKMACLPEPATLADYHQRFFVLTTVIGNARKLESCHEAAEAGTNGAGSGVTKLGSEAE
# RLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g780
###
# start gene g781
Scaffold_1	AUGUSTUS	gene	3767945	3768635	0.67	-	.	g781
Scaffold_1	AUGUSTUS	transcript	3767945	3768635	0.67	-	.	g781.t1
Scaffold_1	AUGUSTUS	stop_codon	3767945	3767947	.	-	0	transcript_id "g781.t1"; gene_id "g781";
Scaffold_1	AUGUSTUS	CDS	3767945	3768381	0.67	-	2	transcript_id "g781.t1"; gene_id "g781";
Scaffold_1	AUGUSTUS	CDS	3768611	3768635	1	-	0	transcript_id "g781.t1"; gene_id "g781";
Scaffold_1	AUGUSTUS	start_codon	3768633	3768635	.	-	0	transcript_id "g781.t1"; gene_id "g781";
# protein sequence = [MCSEKNNKKSPHDPPPHFDLDAGDHNDQNPPVNPDDPGADNDNDNDNDNLDDDSGGLPRGEPGEPGDPSGPRSPTSPE
# IPNEQRAMLELLSGFKGSIETLGTVLAALGCCRDEAGSGRREVWIRLGATVAERRSTEQAQSTDGRNNDLEQSVG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g781
###
# start gene g782
Scaffold_1	AUGUSTUS	gene	3772477	3773865	0.69	+	.	g782
Scaffold_1	AUGUSTUS	transcript	3772477	3773865	0.69	+	.	g782.t1
Scaffold_1	AUGUSTUS	start_codon	3772477	3772479	.	+	0	transcript_id "g782.t1"; gene_id "g782";
Scaffold_1	AUGUSTUS	CDS	3772477	3773865	0.69	+	0	transcript_id "g782.t1"; gene_id "g782";
Scaffold_1	AUGUSTUS	stop_codon	3773863	3773865	.	+	0	transcript_id "g782.t1"; gene_id "g782";
# protein sequence = [MSNLSLIKILSSYSLPLILESLFSRVPPHNQEVEEQEEIVLDALYYCVPTPRALRLYFEPLMLEEQCSEPEQDTKQTP
# LVQEVQPLESGQTALGTKQTPLNSQGPFNPAKNKYGQAVVDAIKCLNSLQELAKILEIRAEAGYASEISHQLLCIYRSEPDGSPSNRLVKIASDTAYM
# DFASPWVGEELLRRHNEWQFSDLCQFYHKISQTSELGVAAGVLFERLFVKRIITPSRTNLRFGLYSALNTPPKRQTRKSAKISHTRFIGFTLARPSSK
# SVLHWSNSEADEVDKLDLPDADDTKEDDGDTDDPNPSSIPQPRWNDTFSLNPYHMIQEVEPVLCTLHVPSKRNNPLFDALLLQEDIPSCVTLWVIQIT
# SAKKHGGASAGYNDIQDIYNRSVEKYSDGNVRVGYMLLVPPKYHQVEWTFENIHLLPEISDLLTVTFISKFSKSINWELVYHTMKVRRFG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g782
###
# start gene g783
Scaffold_1	AUGUSTUS	gene	3774719	3775114	1	-	.	g783
Scaffold_1	AUGUSTUS	transcript	3774719	3775114	1	-	.	g783.t1
Scaffold_1	AUGUSTUS	stop_codon	3774719	3774721	.	-	0	transcript_id "g783.t1"; gene_id "g783";
Scaffold_1	AUGUSTUS	CDS	3774719	3775114	1	-	0	transcript_id "g783.t1"; gene_id "g783";
Scaffold_1	AUGUSTUS	start_codon	3775112	3775114	.	-	0	transcript_id "g783.t1"; gene_id "g783";
# protein sequence = [MKEVNQHSGINETSLTPPPPEPPIPASHSPSVTVAIDPLLVTQTQTDHSALPLEPSISSSSVDPSSSGVPSSSSSEAN
# YDTITDFPHDYATYIVVMLAEIFTTNSRYAGNTIMSTIGMATSQGVAGKWLDK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g783
###
# start gene g784
Scaffold_1	AUGUSTUS	gene	3781270	3781680	0.84	-	.	g784
Scaffold_1	AUGUSTUS	transcript	3781270	3781680	0.84	-	.	g784.t1
Scaffold_1	AUGUSTUS	stop_codon	3781270	3781272	.	-	0	transcript_id "g784.t1"; gene_id "g784";
Scaffold_1	AUGUSTUS	CDS	3781270	3781680	0.84	-	0	transcript_id "g784.t1"; gene_id "g784";
Scaffold_1	AUGUSTUS	start_codon	3781678	3781680	.	-	0	transcript_id "g784.t1"; gene_id "g784";
# protein sequence = [MLRYEDKGPQDTQTVDPPAFTGNTRIDSDTRSDVSFDPLFDDEPEDGHKPFVDGVTSQAVPIAKPSLSTIAPPKGAPP
# LLDSQRYKTFSPDILMTAAIDGQIMLWDKRVNTIGQGVGRLWISEKTPPWCLSVCLSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g784
###
# start gene g785
Scaffold_1	AUGUSTUS	gene	3782045	3782937	0.65	-	.	g785
Scaffold_1	AUGUSTUS	transcript	3782045	3782937	0.65	-	.	g785.t1
Scaffold_1	AUGUSTUS	stop_codon	3782045	3782047	.	-	0	transcript_id "g785.t1"; gene_id "g785";
Scaffold_1	AUGUSTUS	CDS	3782045	3782749	0.65	-	0	transcript_id "g785.t1"; gene_id "g785";
Scaffold_1	AUGUSTUS	CDS	3782821	3782937	0.95	-	0	transcript_id "g785.t1"; gene_id "g785";
Scaffold_1	AUGUSTUS	start_codon	3782935	3782937	.	-	0	transcript_id "g785.t1"; gene_id "g785";
# protein sequence = [MAHSDSEDEQEPFEDVEEYNEEDPEDLDAAEEATEDGDDDSPSDDTEDGFEEAEDDDSEPAIDITGDLLSEAFAQVEA
# SAAAENTGSSSRSPEPDEFDKQEQSKGMVSSPERPEYMRFNLYPYSYNKSRLPAPPPRLRNRPISPSGARKRALRLAKVPRGFVVEAVCAIPHPAPTN
# ALAASSCMSHLLTGSEDGYIRDYDIFTALNSKNFLSAPQRQHTGVVEGLMKAGHHRFWWENNLSSNFSGVNEDRTLVPVHSLAMHSDALWVLAGTNV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g785
###
# start gene g786
Scaffold_1	AUGUSTUS	gene	3787103	3788011	0.79	-	.	g786
Scaffold_1	AUGUSTUS	transcript	3787103	3788011	0.79	-	.	g786.t1
Scaffold_1	AUGUSTUS	stop_codon	3787103	3787105	.	-	0	transcript_id "g786.t1"; gene_id "g786";
Scaffold_1	AUGUSTUS	CDS	3787103	3788011	0.79	-	0	transcript_id "g786.t1"; gene_id "g786";
Scaffold_1	AUGUSTUS	start_codon	3788009	3788011	.	-	0	transcript_id "g786.t1"; gene_id "g786";
# protein sequence = [MKVKHRIDDEQAPDPLDDTRIHPEDYELARKMATDALELDEEDIHDEHPSHVVGLIMQDRENDKKLSELNLDEFAVSL
# FNANQELKRHTLNVIRDELLKPFSEQRSPFPPIDGWNVLTMLSGETQKTLRIGLIVSVLVFRTRPDSVHVRLDSGLEGIIKQEYLVDDTPGAEKPVKG
# KTIQGVIIDVRIDHENDIYEVELSSRWSDVVENDTEFRRKQPDVYWNRAQHEKDLDILARKQRAEVTKTRRIIKHPNFHNFNTSQAEQYLDGQQRGDV
# VIRPSSKGIDHLAVTWKVDDKLYQHIGA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g786
###
# start gene g787
Scaffold_1	AUGUSTUS	gene	3788366	3789106	0.96	-	.	g787
Scaffold_1	AUGUSTUS	transcript	3788366	3789106	0.96	-	.	g787.t1
Scaffold_1	AUGUSTUS	stop_codon	3788366	3788368	.	-	0	transcript_id "g787.t1"; gene_id "g787";
Scaffold_1	AUGUSTUS	CDS	3788366	3789106	0.96	-	0	transcript_id "g787.t1"; gene_id "g787";
Scaffold_1	AUGUSTUS	start_codon	3789104	3789106	.	-	0	transcript_id "g787.t1"; gene_id "g787";
# protein sequence = [MEQHLIPAAVKWTREFLREEEEDYVANRCGDQLRKVSHFAQCNRYLMIQCYKHKRIDVSPYYNPQNSPMKLGDTPSVL
# AVSWGKGDPQKDAICVVFMDDGGRMREWIKIDNLVDTETRDEFVDIIRRRKPDVIIVGGFTTATAKLSQRVKEIVSGRSSYDPNSTFGDSFDIPVIYV
# PDELARIYHHSPRSKVEFSSLPPNARYCVGLARYAQSPLNEYAAVGSDITALSFDDDDQHLVSQRIPHMP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g787
###
# start gene g788
Scaffold_1	AUGUSTUS	gene	3789704	3791420	0.28	-	.	g788
Scaffold_1	AUGUSTUS	transcript	3789704	3791420	0.28	-	.	g788.t1
Scaffold_1	AUGUSTUS	stop_codon	3789704	3789706	.	-	0	transcript_id "g788.t1"; gene_id "g788";
Scaffold_1	AUGUSTUS	CDS	3789704	3790468	0.95	-	0	transcript_id "g788.t1"; gene_id "g788";
Scaffold_1	AUGUSTUS	CDS	3790520	3790637	1	-	1	transcript_id "g788.t1"; gene_id "g788";
Scaffold_1	AUGUSTUS	CDS	3790747	3790901	0.35	-	0	transcript_id "g788.t1"; gene_id "g788";
Scaffold_1	AUGUSTUS	CDS	3790984	3791114	0.48	-	2	transcript_id "g788.t1"; gene_id "g788";
Scaffold_1	AUGUSTUS	CDS	3791162	3791420	0.78	-	0	transcript_id "g788.t1"; gene_id "g788";
Scaffold_1	AUGUSTUS	start_codon	3791418	3791420	.	-	0	transcript_id "g788.t1"; gene_id "g788";
# protein sequence = [MASPVSAYPPEDDPMQGAAEEEEEEGESWTGEPDDSSEEEERKMRTKKGASEKDSSWMKTRMMRMTRKNGNDARDVRN
# IIGEDVRFREEEEDLEEDDLDLLEENTGGTFKKSRLKRLVRRGASESPPDSIQIWDDQRDEFDDDADGDIDDFIEYDDEEEGGMPMDERAREERRKER
# RRQQQDAWAEIHDVFGDGHEYDWALVADEEAEYEQETQKDMTLQNVFEPSEIREHLLTEDDNLIRARDTPERMQLTTSSLSEAASISLHQTIIAEDLN
# KDGARWVTLRLSPEKQKEFFSANGAYQHLQGELVMAVTFALRAMFVEEYEVPFIWTHRRDYISHFDVNDTRSPRLELLSLPELWRIYALGQKYRSLVE
# RRNALSASYRRLGVTDTYYTDEIFPAIDSVELVADTSEWLLMKYKDKKENVAAFRFHDDDEAEVEKKHKMPSRISAYELAKKSIVSRLADVQFLTLLS
# SSVRF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g788
###
# start gene g789
Scaffold_1	AUGUSTUS	gene	3791558	3792061	0.71	+	.	g789
Scaffold_1	AUGUSTUS	transcript	3791558	3792061	0.71	+	.	g789.t1
Scaffold_1	AUGUSTUS	start_codon	3791558	3791560	.	+	0	transcript_id "g789.t1"; gene_id "g789";
Scaffold_1	AUGUSTUS	CDS	3791558	3792061	0.71	+	0	transcript_id "g789.t1"; gene_id "g789";
Scaffold_1	AUGUSTUS	stop_codon	3792059	3792061	.	+	0	transcript_id "g789.t1"; gene_id "g789";
# protein sequence = [MTSEGQHLQFLRLALDEAKKCTPTPTAFCVGCVIVSCLEAEPVVISAGYSRELPGNTHAEANALSKFRSLPWDQLSKF
# NASAQSHADILASADVYTTMEPCSIRTSGLSPCAEALIDARVKRCFIGVGEPDDFVHCEGAQKLVDAGIDVIWLKGLEEESLNVARRGH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g789
###
# start gene g790
Scaffold_1	AUGUSTUS	gene	3794861	3795870	0.66	-	.	g790
Scaffold_1	AUGUSTUS	transcript	3794861	3795870	0.66	-	.	g790.t1
Scaffold_1	AUGUSTUS	stop_codon	3794861	3794863	.	-	0	transcript_id "g790.t1"; gene_id "g790";
Scaffold_1	AUGUSTUS	CDS	3794861	3795470	0.87	-	1	transcript_id "g790.t1"; gene_id "g790";
Scaffold_1	AUGUSTUS	CDS	3795659	3795870	0.7	-	0	transcript_id "g790.t1"; gene_id "g790";
Scaffold_1	AUGUSTUS	start_codon	3795868	3795870	.	-	0	transcript_id "g790.t1"; gene_id "g790";
# protein sequence = [MIYDDLPRNPDYLDESFGAAGGLRELREEDLNDFDDEEVIQPHPVMRISTVLFQDLEAKQSEYFDLKVFSSTIENEVK
# EMRKRLAKIRQLVAKGQTQQFAGEETSALLFNSVYIGLKEDTDELDSNALIAAIDEELKEDIDTATESSWQSLPVPSQPKTSAPATRLNGKRLARAKS
# PSIEFRISGLDADIAQYHPDDPLVSRVFATMKDLEILDHIKSSTWKKFLTALRSDSRGNVRETDSKMVKVELRTVRPVVNDPSEEARLKVGQTCILS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g790
###
# start gene g791
Scaffold_1	AUGUSTUS	gene	3797235	3798250	0.21	-	.	g791
Scaffold_1	AUGUSTUS	transcript	3797235	3798250	0.21	-	.	g791.t1
Scaffold_1	AUGUSTUS	stop_codon	3797235	3797237	.	-	0	transcript_id "g791.t1"; gene_id "g791";
Scaffold_1	AUGUSTUS	CDS	3797235	3797855	0.88	-	0	transcript_id "g791.t1"; gene_id "g791";
Scaffold_1	AUGUSTUS	CDS	3797999	3798250	0.23	-	0	transcript_id "g791.t1"; gene_id "g791";
Scaffold_1	AUGUSTUS	start_codon	3798248	3798250	.	-	0	transcript_id "g791.t1"; gene_id "g791";
# protein sequence = [MSALKSPGATQLETEMNGSGSDNDGDTPPATPRVNRYHNIPAEHEEERRSLEKLVLQDLDLDLDYRQIPTSKDFKHSG
# AAKPVTPSRSGAVVVDIQDLALTNRQIPTSRRTASFESPSSTRRLKPAGNVILTSEFRRLVIASSSAGSPKASVVVSLGHLQNEEASDRSESQALLPR
# FVLSQFSQALNSTTMITLSLPSLLVSMDKDSFDALQYWADDASQLVQKSSGYSDSDGDTEKPTSRDSSLIGSHYFAKSNTSSEVTSLASNPRELKTII
# TVQVFVVESEDASASA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g791
###
# start gene g792
Scaffold_1	AUGUSTUS	gene	3798406	3800241	0.29	-	.	g792
Scaffold_1	AUGUSTUS	transcript	3798406	3800241	0.29	-	.	g792.t1
Scaffold_1	AUGUSTUS	stop_codon	3798406	3798408	.	-	0	transcript_id "g792.t1"; gene_id "g792";
Scaffold_1	AUGUSTUS	CDS	3798406	3800241	0.29	-	0	transcript_id "g792.t1"; gene_id "g792";
Scaffold_1	AUGUSTUS	start_codon	3800239	3800241	.	-	0	transcript_id "g792.t1"; gene_id "g792";
# protein sequence = [MCVDYSMTLSFCTDCLTKAINSIVSQTGLPLELVDSSLASVTARIPWPNPLTSTLGFSLSSLHVTLRVIPVQESTNHA
# DINLSESVASYAESFIQDELTPREEANLRKSFRYDPSASLHHEPDDENVPGGLNPFRDLSEEEELADMDPDGVSLFATLIERLLAKFEFDATDTKVTI
# LHPQSSRLSLSIADINYRTEAPSNANITDGFECAGESRTVSISGITLSGCDLRPHSAVPLSPDRLSFEGTPSYSLTPRSPSPSSSSSSSSMDEQVQWA
# MSQSLAFLPPRPGSPASSVASSIYQSAISGHASYAEHTGRIEESLSSPASASKHDLEHVKEADDEVFLSFGVDPIIIKLTTPSLRGRTPSQTVLEELH
# ISMDIGIISCALRPWHVPSVVRLVDAIMPSRVSLTPKPSNASTSPFSLGTDKRLSLNVKAVVVLLLASSSNGASSSFSLGGYFSRPRVPPSLSEGYLR
# LFLDNLSATASNVTMKSKAPQPDSGSGSQTSTLTFSLSLNEISVFASRLSSNNNEAEVLAFPLMITDPLLPSQHISEHKHPDPSSEFPILLDFDVMDW
# TTEAACKHGMKPSAWRTKQNKTRRPIPLMLRLQGLIETVLSQC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g792
###
# start gene g793
Scaffold_1	AUGUSTUS	gene	3804365	3804910	0.44	-	.	g793
Scaffold_1	AUGUSTUS	transcript	3804365	3804910	0.44	-	.	g793.t1
Scaffold_1	AUGUSTUS	stop_codon	3804365	3804367	.	-	0	transcript_id "g793.t1"; gene_id "g793";
Scaffold_1	AUGUSTUS	CDS	3804365	3804910	0.44	-	0	transcript_id "g793.t1"; gene_id "g793";
Scaffold_1	AUGUSTUS	start_codon	3804908	3804910	.	-	0	transcript_id "g793.t1"; gene_id "g793";
# protein sequence = [MASARPAPSEISRDLQDLQLHSEASPDLTEDDELTDSVSRSVDVDSVLETPAKVRNARYLPPPSPTPRPRRAARGRDG
# HTLSSGRGDSAESGPSRIAGLRYPPTTLKPLREEQSSDLGQIILSVISDSMAALRTSRPTFTYEGIRRGDIVEQVLNRTPSISLSQVKYASSLAINIH
# YMTNL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g793
###
# start gene g794
Scaffold_1	AUGUSTUS	gene	3812554	3813507	0.58	+	.	g794
Scaffold_1	AUGUSTUS	transcript	3812554	3813507	0.58	+	.	g794.t1
Scaffold_1	AUGUSTUS	start_codon	3812554	3812556	.	+	0	transcript_id "g794.t1"; gene_id "g794";
Scaffold_1	AUGUSTUS	CDS	3812554	3813507	0.58	+	0	transcript_id "g794.t1"; gene_id "g794";
Scaffold_1	AUGUSTUS	stop_codon	3813505	3813507	.	+	0	transcript_id "g794.t1"; gene_id "g794";
# protein sequence = [MSIQKLPRPSSSNLASSSSSIPFLALSIVTAILSNRSTDDLTHSFLPSSTPLIEVAEVLHHVFTLLDRYVPGSFTLQL
# GITVESYRARTLRTSSNIHDRERADVIWRTAHDMISVATCNAVFNDCTDGQEYQTGMDNHCRPISCNSLGQDLVWQMIDLSSWILGLVETIVKECILS
# SDFADSTESTGSSGDDLFGSGVSNLSYKFPRDIHCMAITMLDSPIKDTNLRSLDYPVFMHLVHIQALRNLRIALGHVNRFRKYLIGLTPRTENSQLSK
# EVLLDLVDYSGIDISGLDKIFQELENFVQKFDGMTTDLKPTFG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g794
###
# start gene g795
Scaffold_1	AUGUSTUS	gene	3814837	3815358	0.5	+	.	g795
Scaffold_1	AUGUSTUS	transcript	3814837	3815358	0.5	+	.	g795.t1
Scaffold_1	AUGUSTUS	start_codon	3814837	3814839	.	+	0	transcript_id "g795.t1"; gene_id "g795";
Scaffold_1	AUGUSTUS	CDS	3814837	3815358	0.5	+	0	transcript_id "g795.t1"; gene_id "g795";
Scaffold_1	AUGUSTUS	stop_codon	3815356	3815358	.	+	0	transcript_id "g795.t1"; gene_id "g795";
# protein sequence = [MDGKPLYEYARNGIPLPRPIEPRTVTVHSLELVEWKGSAHSFSWPEKALNEDQKKAMEAAIRGVDKTATIEDDPESTV
# QDEKPIAFVIKMKVSGGTYVRSLVHDLAHALGSAGHVVTLTRSRQGRFVLNSTEDGDRTCIPWLVFEKALTDPGAADEDGWTEWEREVLQHMEVI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g795
###
# start gene g796
Scaffold_1	AUGUSTUS	gene	3815801	3816313	0.73	+	.	g796
Scaffold_1	AUGUSTUS	transcript	3815801	3816313	0.73	+	.	g796.t1
Scaffold_1	AUGUSTUS	start_codon	3815801	3815803	.	+	0	transcript_id "g796.t1"; gene_id "g796";
Scaffold_1	AUGUSTUS	CDS	3815801	3816313	0.73	+	0	transcript_id "g796.t1"; gene_id "g796";
Scaffold_1	AUGUSTUS	stop_codon	3816311	3816313	.	+	0	transcript_id "g796.t1"; gene_id "g796";
# protein sequence = [MTANGFSNGQTSRLLKPGIYAPIPTFFLPESEDLGESNLQSYRKRIRLTSKIDLPSFEAHVTRVATAGVGPLIAGSMG
# EAVHLLHSERVALIHAARKALDTAGLNHVPLIVGTGTGSTRETIELTKEAAEAGADYAIVIASGYFAGALAGNKEALKAFWTENQRKVRSPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g796
###
# start gene g797
Scaffold_1	AUGUSTUS	gene	3824144	3825919	0.99	-	.	g797
Scaffold_1	AUGUSTUS	transcript	3824144	3825919	0.99	-	.	g797.t1
Scaffold_1	AUGUSTUS	stop_codon	3824144	3824146	.	-	0	transcript_id "g797.t1"; gene_id "g797";
Scaffold_1	AUGUSTUS	CDS	3824144	3825919	0.99	-	0	transcript_id "g797.t1"; gene_id "g797";
Scaffold_1	AUGUSTUS	start_codon	3825917	3825919	.	-	0	transcript_id "g797.t1"; gene_id "g797";
# protein sequence = [MPNLHRIRPYQRVVDNEIKTNTGSKDAPSKSNEKVFSGKYTDVPVPIPETGITTSNDLSALSNTVSVSRTTLSPFISV
# TPVSLVIPTIFSSLRPTTLNLVSSAYPTTKVSLSTTLHSTVASISSPSPSTAVHPASAHKLPMTVVAILAVGSAFFLLGIFIVLKACTRPTRPTRPKP
# SLPILDDAFADDDLYSPTKVDSPIFGGKERLSSQNESGAPTWTWTQYSENKPEAVPPLPYSQASDSDSRHGATPHTPNPISPGEMIGPSDFLFPRPPP
# SQSVPTTLISNTSHFGIPGVLATAASRFSIARSVSVYPASPVTPAVDGRNYTADGHPIMKRSSKLGLRRSRSDMTEVTSRLSRDSLAYDGADLKSPQF
# LAHSQSEAPTVPVGRTRIKSSYYTPGSYPRMSSLPSSTSTKTKADDIIEFNIQELPPIRTNSRKDRDTEALTSALGLASPLMETIALSPVQTLYPDDS
# LSVVDVKRMPSHKHSKKPAIVDTSTALGSLMLVDFGTTVSGLAARLGDSIEFSSSKKVPLQTQHDMPPRVPSPPHLPSLAQMGLEHANPEAYAEYRSP
# TYSIFGLYGEDRKSRLSMHSKTG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g797
###
# start gene g798
Scaffold_1	AUGUSTUS	gene	3826292	3828037	0.96	+	.	g798
Scaffold_1	AUGUSTUS	transcript	3826292	3828037	0.96	+	.	g798.t1
Scaffold_1	AUGUSTUS	start_codon	3826292	3826294	.	+	0	transcript_id "g798.t1"; gene_id "g798";
Scaffold_1	AUGUSTUS	CDS	3826292	3828037	0.96	+	0	transcript_id "g798.t1"; gene_id "g798";
Scaffold_1	AUGUSTUS	stop_codon	3828035	3828037	.	+	0	transcript_id "g798.t1"; gene_id "g798";
# protein sequence = [MTDSRIVRSETGESQTSQELAKLLANENPGTLAEESQVSEELSTKYEPSDPAQSEHYSPRQQYSLLGLGQGSPMSQTQ
# HFSDDVEEGTHGSQKENHHSSTELESSKLEPNDPCSSNENAFTWSKNVRNVAMRPLFPFSSFTLKSPNAHPDPDEQSESLQRLSVSLERRDEPSVEAA
# GNVPSPPYQLPGERPESEMICSDFGASSPERLDGIREALSNHHATPISQIVDSQSQNSDKASQFSEIGSQDDEPQAQVVPEYDMDVLRRMENELYPDS
# QSQATQSTQPAASSDDNVVINDKDWANFTGIQVPPHRRHRYLASAKEGAAIAAVRNDTFYDGYDSSAPPLDDGFMRQFPAGMPDPGDSDQETQPATQP
# VESSQQEGEWVPPVQFPAGHGSTSQEEGAATQIVEAQDVANQILDDSTVNSDEVKPGSVVHSVIPAPQPPVRTTFTRAKSPISALEIVPDSEPPVPSP
# VKSTKRSSSVHAVTSPRQVFDTRAINQPVGTHPQPMEVDEVDEVEIPLAAVVKSGIKKVDNVKGCPSAVHMPPPPPKVGLSSLTRDLKLIFYTPSVQR
# RPKRNVEIIKTKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g798
###
# start gene g799
Scaffold_1	AUGUSTUS	gene	3828154	3829557	0.4	+	.	g799
Scaffold_1	AUGUSTUS	transcript	3828154	3829557	0.4	+	.	g799.t1
Scaffold_1	AUGUSTUS	start_codon	3828154	3828156	.	+	0	transcript_id "g799.t1"; gene_id "g799";
Scaffold_1	AUGUSTUS	CDS	3828154	3829242	0.43	+	0	transcript_id "g799.t1"; gene_id "g799";
Scaffold_1	AUGUSTUS	CDS	3829303	3829557	0.78	+	0	transcript_id "g799.t1"; gene_id "g799";
Scaffold_1	AUGUSTUS	stop_codon	3829555	3829557	.	+	0	transcript_id "g799.t1"; gene_id "g799";
# protein sequence = [MPPARRSTRPTRNRRSLVESDSDGDIDDEIVLIKEEDDVVTVSGDGVDMTPSPSAAGESHRKRKRSVAISVPRKASKK
# EHTQTPANHPRRHSTASVNGKNTIQVASLRVLVLYTDGYWYPGTVREFQTPDSYKILYDDNSAGWAKTGSMRQLELRVGDEVMDSKTKKSGTVSEVKE
# DMIVVSGSGITFDLTYRYLRIPCDKVEAQWSDRELTIGVLAGIHDTSRQSALPEGADSFLRGCGIIITSNPNALQWNKEKNEILAAMIENGATLIEDW
# SDALQTSGTYIYDKGKGKKGKGKDTGNRNPKSWKITKEQARWFEDPDEGSIRRVFVLADAVCQKPKYLIALALGVPCLSTNWMTDSLQNRDAKEWSSY
# LLPKGIDNYTSQNVRLSQSVNLDWGMMPEHLTNIMDNPYAQKLFSGSSVLCVGDDYIPEQHEERMVSLLISFSMH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g799
###
# start gene g800
Scaffold_1	AUGUSTUS	gene	3834192	3834682	0.96	+	.	g800
Scaffold_1	AUGUSTUS	transcript	3834192	3834682	0.96	+	.	g800.t1
Scaffold_1	AUGUSTUS	start_codon	3834192	3834194	.	+	0	transcript_id "g800.t1"; gene_id "g800";
Scaffold_1	AUGUSTUS	CDS	3834192	3834353	1	+	0	transcript_id "g800.t1"; gene_id "g800";
Scaffold_1	AUGUSTUS	CDS	3834404	3834682	0.96	+	0	transcript_id "g800.t1"; gene_id "g800";
Scaffold_1	AUGUSTUS	stop_codon	3834680	3834682	.	+	0	transcript_id "g800.t1"; gene_id "g800";
# protein sequence = [MAATGGEGIGDEYEQKGKLKTIIVKSMHERKMKMAILAEGGFVALPGGYGTLEEIFEVTTWSQLGIHSKPVILLNVEG
# YFNPLRTFIQDAVAAGYIRQQYAELITFVDAPSDCSQESFDWGLATLQSLSTWNSAKEGLFQWAGTKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g800
###
# start gene g801
Scaffold_1	AUGUSTUS	gene	3844482	3845273	0.82	+	.	g801
Scaffold_1	AUGUSTUS	transcript	3844482	3845273	0.82	+	.	g801.t1
Scaffold_1	AUGUSTUS	start_codon	3844482	3844484	.	+	0	transcript_id "g801.t1"; gene_id "g801";
Scaffold_1	AUGUSTUS	CDS	3844482	3845273	0.82	+	0	transcript_id "g801.t1"; gene_id "g801";
Scaffold_1	AUGUSTUS	stop_codon	3845271	3845273	.	+	0	transcript_id "g801.t1"; gene_id "g801";
# protein sequence = [MNNKRLRTPSPTIPEEPSPKRARQLTDDGVETPSGRRTNRTLTSISPRRPVRKLQKEASVVPASEGEEEDEIEIVETA
# IASEAPPRFRRRSADNIGQNSLEDNEAQSKPDPPVPAHRMRAANPLVHMLDDFGDMDGAIGVKARISGKGKADASGSSKPSTSNSVHRRKPGPGRSSE
# GFGKNKSTSSLLTFDKGQLKTVKGKYVATEIVARREQDDAGDGTPDILNDSSQQPSFTCASSDKWRVSPTRLSRRGRCRGATSFRRN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g801
###
# start gene g802
Scaffold_1	AUGUSTUS	gene	3847352	3848293	0.92	-	.	g802
Scaffold_1	AUGUSTUS	transcript	3847352	3848293	0.92	-	.	g802.t1
Scaffold_1	AUGUSTUS	stop_codon	3847352	3847354	.	-	0	transcript_id "g802.t1"; gene_id "g802";
Scaffold_1	AUGUSTUS	CDS	3847352	3848293	0.92	-	0	transcript_id "g802.t1"; gene_id "g802";
Scaffold_1	AUGUSTUS	start_codon	3848291	3848293	.	-	0	transcript_id "g802.t1"; gene_id "g802";
# protein sequence = [MLKREIIVRPYGSLGTSAATIRVQNPCNHNILSLTDSLGRPRFGSPSSYRGTTSVFASPKKKQKRDLSTVDDSWQAAV
# FEILRDKEDEDDGLPPIEFALSAASRYASVSASQSTVTAPKRDTKTTWKQKKRGNDIEVIDLDTQGDVESDWDPPEPDEMLDIPGELVLARDRADRRI
# AHWPAKLLAYIPPSKPKKKTRQKEPKYRVLWLDDTEQEVPRDWFYACHEPEFGTCEVGQIVNAIDNDIDFFLGRWASLQVTTWIMEMMAMKTIQQTPR
# EIAITIPRILVSFLPVPAPVQSHFLLYPVLSTIFPFAPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g802
###
# start gene g803
Scaffold_1	AUGUSTUS	gene	3852434	3853288	0.98	+	.	g803
Scaffold_1	AUGUSTUS	transcript	3852434	3853288	0.98	+	.	g803.t1
Scaffold_1	AUGUSTUS	start_codon	3852434	3852436	.	+	0	transcript_id "g803.t1"; gene_id "g803";
Scaffold_1	AUGUSTUS	CDS	3852434	3853288	0.98	+	0	transcript_id "g803.t1"; gene_id "g803";
Scaffold_1	AUGUSTUS	stop_codon	3853286	3853288	.	+	0	transcript_id "g803.t1"; gene_id "g803";
# protein sequence = [MNSTKNTLIEFKYWQTPPTSMQRQKRRPTDSIDEPSSSSKRAPPYKKTRIVEPGEDPATFAEEVDSALENPSAHRKGR
# VKNEGYDSDSSDDGEGVVYSRKKETENNDDDDMFAAAEKEEKAEETSTKKKKESYMRLGDIEGQEFGKSDSDEDDLEEEPEDEDDAERRKKAGMGYEL
# SSFNMREEMEEGKFTEDGSYVRSFDPHGIHDRWMEGLDEKEIKLARKRKRQQEQIQKERIMAEEKELEESGGKPTLEKQLLPLLKKGETVLESLQRLG
# VEVKKAKRRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g803
###
# start gene g804
Scaffold_1	AUGUSTUS	gene	3853373	3853732	0.99	+	.	g804
Scaffold_1	AUGUSTUS	transcript	3853373	3853732	0.99	+	.	g804.t1
Scaffold_1	AUGUSTUS	start_codon	3853373	3853375	.	+	0	transcript_id "g804.t1"; gene_id "g804";
Scaffold_1	AUGUSTUS	CDS	3853373	3853732	0.99	+	0	transcript_id "g804.t1"; gene_id "g804";
Scaffold_1	AUGUSTUS	stop_codon	3853730	3853732	.	+	0	transcript_id "g804.t1"; gene_id "g804";
# protein sequence = [MNVEPVAKVPSDIEHITHLASTIMSLGDTDIYSKTYEELVRSVRSSGTVDANWVPPSANKKYEYKWDMPGASQSDQIF
# GPFEEEEMQSWFKASYFGPSGEKVKVRHVGGEWMDWDELLP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g804
###
# start gene g805
Scaffold_1	AUGUSTUS	gene	3856479	3856988	0.97	-	.	g805
Scaffold_1	AUGUSTUS	transcript	3856479	3856988	0.97	-	.	g805.t1
Scaffold_1	AUGUSTUS	stop_codon	3856479	3856481	.	-	0	transcript_id "g805.t1"; gene_id "g805";
Scaffold_1	AUGUSTUS	CDS	3856479	3856988	0.97	-	0	transcript_id "g805.t1"; gene_id "g805";
Scaffold_1	AUGUSTUS	start_codon	3856986	3856988	.	-	0	transcript_id "g805.t1"; gene_id "g805";
# protein sequence = [MLRRAPTTADGKVVDRLQESTRINKPFRPPSFTINLERIQPQRKRKRVSYKDQQGEDSDSDDEGSKKKKKKKDDRDYM
# NEDELLAAVKQYPVFKPKPFNQVRRFSMPSMRNKDGHDVILVPSNVSLGIRPQAKLIPRPLHDPMEDHAIVLYDPTIDDRETEEEKMERES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g805
###
# start gene g806
Scaffold_1	AUGUSTUS	gene	3858782	3860288	0.77	+	.	g806
Scaffold_1	AUGUSTUS	transcript	3858782	3860288	0.77	+	.	g806.t1
Scaffold_1	AUGUSTUS	start_codon	3858782	3858784	.	+	0	transcript_id "g806.t1"; gene_id "g806";
Scaffold_1	AUGUSTUS	CDS	3858782	3860005	0.77	+	0	transcript_id "g806.t1"; gene_id "g806";
Scaffold_1	AUGUSTUS	CDS	3860079	3860288	0.77	+	0	transcript_id "g806.t1"; gene_id "g806";
Scaffold_1	AUGUSTUS	stop_codon	3860286	3860288	.	+	0	transcript_id "g806.t1"; gene_id "g806";
# protein sequence = [MTESYISPSDVAQYHSSQDRVRNWITAHADHVFTSPNIPPSELDDQDALSSPPSDVESSHSIPPRLKLRYPDGRESPI
# PHTTNSSSSTGRNSRSRSNPQPNSSRQRSKLATAPSSSPILISDPRREREKLRSHSPEEIQIFPSASDEIPPVPLSSHHSRSRSLPRDAFSPSRNHDP
# MPNSSYGATPVMQMQTEMSPPVIPLLQSPGPYAGFARTQPAPAPWHPYTNAVRTGPMMPPSREHFKHNPPSIVYAPSNNSRTNYHPPAILSYRPTAGP
# NRIFYSHSVPPAQAQIANAGYPSVHGSYAPQEERVHHHKRSSELRHSSSHHRDRSVGSAKSGKSSKSKDTTSRRHGRDRSRSLPLEQEYPPNPPSEHY
# RHPHHHRPRPPSPTGSHGSGSTYYVLPTARQKVHVLRSPDTLYTATTTTQSPTTPISPTGSIKKPFLQRLLGGFAERFSSSGSSKGSLRRRHSTGTRP
# PDPVSGH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g806
###
# start gene g807
Scaffold_1	AUGUSTUS	gene	3861281	3862270	0.34	-	.	g807
Scaffold_1	AUGUSTUS	transcript	3861281	3862270	0.34	-	.	g807.t1
Scaffold_1	AUGUSTUS	stop_codon	3861281	3861283	.	-	0	transcript_id "g807.t1"; gene_id "g807";
Scaffold_1	AUGUSTUS	CDS	3861281	3861706	0.99	-	0	transcript_id "g807.t1"; gene_id "g807";
Scaffold_1	AUGUSTUS	CDS	3861862	3862115	0.68	-	2	transcript_id "g807.t1"; gene_id "g807";
Scaffold_1	AUGUSTUS	CDS	3862195	3862270	0.49	-	0	transcript_id "g807.t1"; gene_id "g807";
Scaffold_1	AUGUSTUS	start_codon	3862268	3862270	.	-	0	transcript_id "g807.t1"; gene_id "g807";
# protein sequence = [MAPETAFEDTPERSPLMTALGYDKGTYNRPMLFSKVIFQECSPTHLLTTRSGFDWASLPQGSVIVDVGGGIGVSSISI
# ARAFDHLKCIVQDRAMVLKLGTEVYPTLHIGCPQTSATVFLLKQITHDWSDRYVVQILQRLRDAATPTTTLVIVDTIIVHPCPSPPSDIPGANLVPPP
# SPLLANLGVANASTHFADLSMFVHFNAQERTLVHMVELLAKTGWKVIRVYRSDDSGGYLPQIVATPVTIPASTKE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g807
###
# start gene g808
Scaffold_1	AUGUSTUS	gene	3864569	3865309	0.6	+	.	g808
Scaffold_1	AUGUSTUS	transcript	3864569	3865309	0.6	+	.	g808.t1
Scaffold_1	AUGUSTUS	start_codon	3864569	3864571	.	+	0	transcript_id "g808.t1"; gene_id "g808";
Scaffold_1	AUGUSTUS	CDS	3864569	3865309	0.6	+	0	transcript_id "g808.t1"; gene_id "g808";
Scaffold_1	AUGUSTUS	stop_codon	3865307	3865309	.	+	0	transcript_id "g808.t1"; gene_id "g808";
# protein sequence = [MLLNKYFPEVLSLSSSLRFEDTLVSSSKMDYLAPNSVYSSHLVLNLRIQAFIEACRTTPLAYPPDYTTSESPSSPPSF
# KVPLDTIDQQTALLNNAQKLYAVVKMLPSEEDISRYMKELESVTGLLAYHVPEDSPVSEYLAQERREAVADQIDYGILCKSSLRVERLVMVYDFLAAD
# HVKRPVISYLELYARYISTISDILNKLGVKPPPGMINPSTVAKTTSNSKGEVQEVSCGIDICGQANRKYV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g808
###
# start gene g809
Scaffold_1	AUGUSTUS	gene	3871265	3872280	0.16	+	.	g809
Scaffold_1	AUGUSTUS	transcript	3871265	3872280	0.16	+	.	g809.t1
Scaffold_1	AUGUSTUS	start_codon	3871265	3871267	.	+	0	transcript_id "g809.t1"; gene_id "g809";
Scaffold_1	AUGUSTUS	CDS	3871265	3871391	0.16	+	0	transcript_id "g809.t1"; gene_id "g809";
Scaffold_1	AUGUSTUS	CDS	3871515	3871641	0.74	+	2	transcript_id "g809.t1"; gene_id "g809";
Scaffold_1	AUGUSTUS	CDS	3871686	3872280	0.81	+	1	transcript_id "g809.t1"; gene_id "g809";
Scaffold_1	AUGUSTUS	stop_codon	3872278	3872280	.	+	0	transcript_id "g809.t1"; gene_id "g809";
# protein sequence = [MFRISERGRLTCVDLKQSGNDITSSFAATQFFPSRTNDIPAMQLFPSIVSIDTQEEKNSEAVYDLLEQLPSFWQQDTP
# IEQVLTTVRYDILFRTGDEPGHTSRADFLTETVFNSTRGYRILLQDRLPVQSLMDGASWYSDIAPIMNHFDESTVGNIRSIAERFRSFDLSLSPDHPI
# QASRRQNKAREQLALDLTLSKDIFSTQRFTQFPRTPTGDCTEASGPSATVHFHYLQPMPRRDHYSREEQQEDNVNFPFGVGLLLEDWDVGVDPDNTST
# IRTTLSGT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g809
###
# start gene g810
Scaffold_1	AUGUSTUS	gene	3874809	3875517	0.25	-	.	g810
Scaffold_1	AUGUSTUS	transcript	3874809	3875517	0.25	-	.	g810.t1
Scaffold_1	AUGUSTUS	stop_codon	3874809	3874811	.	-	0	transcript_id "g810.t1"; gene_id "g810";
Scaffold_1	AUGUSTUS	CDS	3874809	3875090	0.67	-	0	transcript_id "g810.t1"; gene_id "g810";
Scaffold_1	AUGUSTUS	CDS	3875221	3875517	0.36	-	0	transcript_id "g810.t1"; gene_id "g810";
Scaffold_1	AUGUSTUS	start_codon	3875515	3875517	.	-	0	transcript_id "g810.t1"; gene_id "g810";
# protein sequence = [MCKKIKKANCNVLLLQKSILRDAVDDTSLNFLKRLNILVVKDVERDEIEFLSKSLGCKPIADIEAFTEDKLGYADLVE
# ETSADEVKVVKITGIKNRGRTAFSSFYRALIGGGGAPEIHVSRMLSQYAQSLKGMEAYCFQAYADALEVIPTTLAENAGLNPIAIVTELRNRHALGER
# TAGINVRKVRINLVCY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g810
###
# start gene g811
Scaffold_1	AUGUSTUS	gene	3877567	3878519	0.83	+	.	g811
Scaffold_1	AUGUSTUS	transcript	3877567	3878519	0.83	+	.	g811.t1
Scaffold_1	AUGUSTUS	start_codon	3877567	3877569	.	+	0	transcript_id "g811.t1"; gene_id "g811";
Scaffold_1	AUGUSTUS	CDS	3877567	3877931	0.96	+	0	transcript_id "g811.t1"; gene_id "g811";
Scaffold_1	AUGUSTUS	CDS	3877984	3878140	0.85	+	1	transcript_id "g811.t1"; gene_id "g811";
Scaffold_1	AUGUSTUS	CDS	3878190	3878519	1	+	0	transcript_id "g811.t1"; gene_id "g811";
Scaffold_1	AUGUSTUS	stop_codon	3878517	3878519	.	+	0	transcript_id "g811.t1"; gene_id "g811";
# protein sequence = [METSPGGGGIDILDTDLSVDFAAPVGYVEPEKPKAAPPPTMASKFKIDINSVSPGSSRPGSSLSGGFAGSIAGQNVVS
# KDGDTWESFKGKGETLAGRKTKGKGISHRKVEQVAESSKIIRTDNRRIVSNDTLEDNSKVPAALNLPFGQLFFGYNITPYVPPATDDTPTSPTVTQGS
# VAFSGSGRSLNGRSTGSQPPSTSAKGKAKASDESSPQSSASWSGAGRTLGSSAPRESGSVGAGGAPVPRPQQRNSEGQKGKKKQRSPSPEIDWGVDDD
# DDVMIIDSD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g811
###
# start gene g812
Scaffold_1	AUGUSTUS	gene	3878676	3879116	1	+	.	g812
Scaffold_1	AUGUSTUS	transcript	3878676	3879116	1	+	.	g812.t1
Scaffold_1	AUGUSTUS	start_codon	3878676	3878678	.	+	0	transcript_id "g812.t1"; gene_id "g812";
Scaffold_1	AUGUSTUS	CDS	3878676	3879116	1	+	0	transcript_id "g812.t1"; gene_id "g812";
Scaffold_1	AUGUSTUS	stop_codon	3879114	3879116	.	+	0	transcript_id "g812.t1"; gene_id "g812";
# protein sequence = [MSVPTSKIEEIIDTTQDSDAQDDSDDNIAVENEHDDAEHQQGPSSSTASSSKKKKKRSKAAKALNALTGKSIPQALVD
# QVLDTVKAEGGEGSEQANAENVRQVLEHMKIMEIVKGKAGLGGLNKKDMGEHKARRSYDFHRDYRSHS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g812
###
# start gene g813
Scaffold_1	AUGUSTUS	gene	3880962	3881329	0.92	+	.	g813
Scaffold_1	AUGUSTUS	transcript	3880962	3881329	0.92	+	.	g813.t1
Scaffold_1	AUGUSTUS	start_codon	3880962	3880964	.	+	0	transcript_id "g813.t1"; gene_id "g813";
Scaffold_1	AUGUSTUS	CDS	3880962	3881028	0.92	+	0	transcript_id "g813.t1"; gene_id "g813";
Scaffold_1	AUGUSTUS	CDS	3881082	3881329	1	+	2	transcript_id "g813.t1"; gene_id "g813";
Scaffold_1	AUGUSTUS	stop_codon	3881327	3881329	.	+	0	transcript_id "g813.t1"; gene_id "g813";
# protein sequence = [MSGLKQQNSERTNQGIVDGRPEGQEPKHAPITLDTVVDKDASLSNAEHSSMAHTSASQTINGATSAEVNDSLGKPGSG
# MSSKEKHHDGMPGRKKQEIGEMQWQK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g813
###
# start gene g814
Scaffold_1	AUGUSTUS	gene	3882224	3882562	0.94	-	.	g814
Scaffold_1	AUGUSTUS	transcript	3882224	3882562	0.94	-	.	g814.t1
Scaffold_1	AUGUSTUS	stop_codon	3882224	3882226	.	-	0	transcript_id "g814.t1"; gene_id "g814";
Scaffold_1	AUGUSTUS	CDS	3882224	3882562	0.94	-	0	transcript_id "g814.t1"; gene_id "g814";
Scaffold_1	AUGUSTUS	start_codon	3882560	3882562	.	-	0	transcript_id "g814.t1"; gene_id "g814";
# protein sequence = [MKTQAPQFYTPPGRTGNIKSWILRMVFVVALASTLQLSTVYASPLPTNPGSGSGTPVHANSPAPESTGAPDHARLNKA
# LDKWTMFATGSTLIGFAYAKPVSSLCLAIKEILI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g814
###
# start gene g815
Scaffold_1	AUGUSTUS	gene	3888458	3889204	0.69	+	.	g815
Scaffold_1	AUGUSTUS	transcript	3888458	3889204	0.69	+	.	g815.t1
Scaffold_1	AUGUSTUS	start_codon	3888458	3888460	.	+	0	transcript_id "g815.t1"; gene_id "g815";
Scaffold_1	AUGUSTUS	CDS	3888458	3889204	0.69	+	0	transcript_id "g815.t1"; gene_id "g815";
Scaffold_1	AUGUSTUS	stop_codon	3889202	3889204	.	+	0	transcript_id "g815.t1"; gene_id "g815";
# protein sequence = [MSLGLPIQNSEGSPQGQHLLRGRSSHTAVAATSLSPDQATSAPPTPRGQINPTATSVVESNAYSRPRRPSAAERILES
# VRNRDQNLTRSPASPRTAWIHYPPDPPSTSTVIPGITATASTPKENSNNLAQNLRMDSGLVVSRRQSLIPPVTATHVPPNSPNIPRLALNPAPRPQME
# RSPSAPITRTYNAKSALAPVPLAYPTDLLELLDGEHHTDEVAVKFEAGWPLLEDWLRRVGEDHNGRVLVIYR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g815
###
# start gene g816
Scaffold_1	AUGUSTUS	gene	3891878	3892795	0.59	-	.	g816
Scaffold_1	AUGUSTUS	transcript	3891878	3892795	0.59	-	.	g816.t1
Scaffold_1	AUGUSTUS	stop_codon	3891878	3891880	.	-	0	transcript_id "g816.t1"; gene_id "g816";
Scaffold_1	AUGUSTUS	CDS	3891878	3892795	0.59	-	0	transcript_id "g816.t1"; gene_id "g816";
Scaffold_1	AUGUSTUS	start_codon	3892793	3892795	.	-	0	transcript_id "g816.t1"; gene_id "g816";
# protein sequence = [MLSQRSCPRLTHLWLPILGIEESKPAATIILLRAYAAAVEERFSTFATSQSGSFHYCKAVPLLKFLKHLFKFHSVFVE
# SRPDNHLEGQPFEQAFKDYTVRFNHFVRAENSSVMTAEAASVMYLRCAAVMGSAHNKDFDIMIPAVYSKANNPLDSKKVTAIPVSLKRIPFSGKVITH
# PIDERAIPFFRPFGTKSTAKRLSISLTIPYISLAMNLAASYSKPHNTQEKEKTRENGEQMKHGRGTSVLRRSRQESPSSDGVLDRPLGNTPATVSLLM
# EYLSTAIWMLISPGHCCRSLISLLTIRANTQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g816
###
# start gene g817
Scaffold_1	AUGUSTUS	gene	3897538	3898125	0.85	-	.	g817
Scaffold_1	AUGUSTUS	transcript	3897538	3898125	0.85	-	.	g817.t1
Scaffold_1	AUGUSTUS	stop_codon	3897538	3897540	.	-	0	transcript_id "g817.t1"; gene_id "g817";
Scaffold_1	AUGUSTUS	CDS	3897538	3898125	0.85	-	0	transcript_id "g817.t1"; gene_id "g817";
Scaffold_1	AUGUSTUS	start_codon	3898123	3898125	.	-	0	transcript_id "g817.t1"; gene_id "g817";
# protein sequence = [MDIVLTAIDSPATSREIVDLCRQAKIPVNAADIPELCDFYLVLISAMAFADHDSSNGNGPRISALMKEKVQASLEGYE
# GLALSKIGQLRAELKERVPEIGGPLGRKRMKWMSKICNEWPLIDFTLLDSAMIQKLLDEGWEKDRVPTFTEVCSKPRPLGVEDSSKGHRFGSNLLIPI
# AHFVAGAALMAAVILARRQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g817
###
# start gene g818
Scaffold_1	AUGUSTUS	gene	3902291	3903390	0.66	-	.	g818
Scaffold_1	AUGUSTUS	transcript	3902291	3903390	0.66	-	.	g818.t1
Scaffold_1	AUGUSTUS	stop_codon	3902291	3902293	.	-	0	transcript_id "g818.t1"; gene_id "g818";
Scaffold_1	AUGUSTUS	CDS	3902291	3902883	0.88	-	2	transcript_id "g818.t1"; gene_id "g818";
Scaffold_1	AUGUSTUS	CDS	3903132	3903390	0.97	-	0	transcript_id "g818.t1"; gene_id "g818";
Scaffold_1	AUGUSTUS	start_codon	3903388	3903390	.	-	0	transcript_id "g818.t1"; gene_id "g818";
# protein sequence = [MSVTLEKIAPPTDLTDSDQNTLFQYLYRRLAAYRNAAELHALAEYQLSALPEENKQKIKDDFSQTLNEWAQELVDKAY
# MVCGQPDGARTRSFLFNDIFEDAAPDEELIVATLKHPDQALQEAQQKAEASTKDHASKSKTLRMVGISLGAIAGGVLVGVTGGLAAPLIGASITTILG
# WLGVGGTAAGLLASGLAGSSAICGALFGVYGAKSTANMVERHTREIRDLAILPVSLNTNGDETLGVRLCISGWLSSESDVTAPWTVFEGDDTLALRWV
# RDVIFVFFA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g818
###
# start gene g819
Scaffold_1	AUGUSTUS	gene	3911349	3912509	0.51	+	.	g819
Scaffold_1	AUGUSTUS	transcript	3911349	3912509	0.51	+	.	g819.t1
Scaffold_1	AUGUSTUS	start_codon	3911349	3911351	.	+	0	transcript_id "g819.t1"; gene_id "g819";
Scaffold_1	AUGUSTUS	CDS	3911349	3912509	0.51	+	0	transcript_id "g819.t1"; gene_id "g819";
Scaffold_1	AUGUSTUS	stop_codon	3912507	3912509	.	+	0	transcript_id "g819.t1"; gene_id "g819";
# protein sequence = [MQRNIVPQLPDRRRIRGAVSPSSNDPSSTPAKPSRKPRGNPIPARQIRPVESSNFTNELASVINASGNSISGAISSTS
# ARRVQSSSSTHQDRSKRNEVQKQSNISVSTGKRRLIQSDIESDSSADLPIVAKPHIPPASSKTMLDRAGLKFRRSIVPLGKKRGEQPHATAPPGPSFS
# SSMAIQNNRHRDRAVRKDSISLLDTLSQMSSPAPEETFVKPSNTDKPLLPVARKRRERSPDNVRVPAAESSRMGAKAPRRAGTSRRRSGSESPERDDR
# RESQSTHNKGGLALDEISLLRLENTELRFRLANLEHAVHQPTPVQQAQIQDPNAFYLHATFIQRTVQHAVADTLQTVINSMPPSAAIVSTSVSRSIEA
# FTMNGLGRSTHLPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g819
###
# start gene g820
Scaffold_1	AUGUSTUS	gene	3913808	3914320	0.35	-	.	g820
Scaffold_1	AUGUSTUS	transcript	3913808	3914320	0.35	-	.	g820.t1
Scaffold_1	AUGUSTUS	stop_codon	3913808	3913810	.	-	0	transcript_id "g820.t1"; gene_id "g820";
Scaffold_1	AUGUSTUS	CDS	3913808	3914320	0.35	-	0	transcript_id "g820.t1"; gene_id "g820";
Scaffold_1	AUGUSTUS	start_codon	3914318	3914320	.	-	0	transcript_id "g820.t1"; gene_id "g820";
# protein sequence = [MVAQMQSAGITASPDRRREHRDDRRRASQVGNVVPPSPALVRHGSKQRKAPNNLNTLSPGGVNTPGQLTPHSTAAQIN
# VPVGSQQRGSPQHPYASVSGGYDYTADDTYVQQQQYGRASPMVSSSAAPPALSNVRARGGDVGVSRGEHDGQELEDSPPRMTLLRILTCRCG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g820
###
# start gene g821
Scaffold_1	AUGUSTUS	gene	3935367	3936176	1	-	.	g821
Scaffold_1	AUGUSTUS	transcript	3935367	3936176	1	-	.	g821.t1
Scaffold_1	AUGUSTUS	stop_codon	3935367	3935369	.	-	0	transcript_id "g821.t1"; gene_id "g821";
Scaffold_1	AUGUSTUS	CDS	3935367	3936176	1	-	0	transcript_id "g821.t1"; gene_id "g821";
Scaffold_1	AUGUSTUS	start_codon	3936174	3936176	.	-	0	transcript_id "g821.t1"; gene_id "g821";
# protein sequence = [MGDDKIRSTKLKFKGDKQKKKRRREDAEEGSSDNKRRKEDNVDPDTWVFPENPNEIRGPTFIIHPSDPSPISLNFSST
# TNRVVLHFIDKEKSEDDSEPQSLLERTPTDISQVWVTTRVAGSPTINIRSGSGEGKFLSANTLGIVSCDRDARGPQEEWTPVIMPDGMTALMNSYEKY
# LGIDEVAGGSLQLRADSDEVGFKERFWLKIQSKYKKEANEEEKTKKEGMAGPPKIDESATKSVLYVTLSKYLADSRSAISIKRGVLDKCCLFS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g821
###
# start gene g822
Scaffold_1	AUGUSTUS	gene	3942523	3942918	0.77	+	.	g822
Scaffold_1	AUGUSTUS	transcript	3942523	3942918	0.77	+	.	g822.t1
Scaffold_1	AUGUSTUS	start_codon	3942523	3942525	.	+	0	transcript_id "g822.t1"; gene_id "g822";
Scaffold_1	AUGUSTUS	CDS	3942523	3942918	0.77	+	0	transcript_id "g822.t1"; gene_id "g822";
Scaffold_1	AUGUSTUS	stop_codon	3942916	3942918	.	+	0	transcript_id "g822.t1"; gene_id "g822";
# protein sequence = [MIEISLSPSTITTILNDPSVLARASSIGLPDEQALHVLEHGYEAGFKTFFIINASLGVMATIVSATMVKHKELSRDDD
# EKLKSEAKAGLKKQEENQDTEAGVQSSELVVKRDTEMEVSDVRMVSRAGSLKM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g822
###
# start gene g823
Scaffold_1	AUGUSTUS	gene	3955827	3957842	0.66	-	.	g823
Scaffold_1	AUGUSTUS	transcript	3955827	3957842	0.66	-	.	g823.t1
Scaffold_1	AUGUSTUS	stop_codon	3955827	3955829	.	-	0	transcript_id "g823.t1"; gene_id "g823";
Scaffold_1	AUGUSTUS	CDS	3955827	3957842	0.66	-	0	transcript_id "g823.t1"; gene_id "g823";
Scaffold_1	AUGUSTUS	start_codon	3957840	3957842	.	-	0	transcript_id "g823.t1"; gene_id "g823";
# protein sequence = [MSIDQNRPAVASLPMVFDVDDVSPVPSSEVPDLMLAQNPPHSLSHSLPEPLPPFSNLPNGSVTTVHVPLSNLTSSAFM
# DSPTPLDPVAFSSTASSSATFIPEFNPSFSVTSPVENGMAVKLPTSRHASSLSPPMNHSVPSSALHGPASSYSACSSSLQSALESSVPSPGQHSPSLT
# LPVNIAMPVPSALVVPPPPPAETISLTSDERALTIGRDILDQYVLHFLWHTSHNLIVLLFRVVQSASTAADLCRSEVNGRADAGKIVDIVDDLRSKLA
# YVSDVISGFKEMSVVDHPMYTQSNAVTDYPTPLPPVFESPETYAVNHSTVNHPNSLNNHPYVVDSTLDLTRKRCVTDTDAERRVKFKIEPQDDPSPPS
# SSNVYPSVNDISHIHALQSPPPSRPATPPSGHHFVFNPVKSTSKYPSIANGSVQSVDNTPAPKFPPLRSVWSESVVPTRHSHSMSTGSISARPVADTS
# LPPTAVSQPVIPGRMNRSGSIGGAFVHPFTFAYGQAAPPQWQSSSASHPPAPASSRTSPDVGGIGDHYEDGGDDDDDEDSPRSGYHSQVCSFLFSSHP
# SDHLCSRHHRLMFLRSIAVKLTASSLSISTKRVRIVRAHNVSLRVITELTLTYIVDATDSKGESIHQTLMAKKMQRLDESPDFRPFKFRIQAFTNAFL
# EEVRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g823
###
# start gene g824
Scaffold_1	AUGUSTUS	gene	3961096	3961596	0.92	-	.	g824
Scaffold_1	AUGUSTUS	transcript	3961096	3961596	0.92	-	.	g824.t1
Scaffold_1	AUGUSTUS	stop_codon	3961096	3961098	.	-	0	transcript_id "g824.t1"; gene_id "g824";
Scaffold_1	AUGUSTUS	CDS	3961096	3961596	0.92	-	0	transcript_id "g824.t1"; gene_id "g824";
Scaffold_1	AUGUSTUS	start_codon	3961594	3961596	.	-	0	transcript_id "g824.t1"; gene_id "g824";
# protein sequence = [MEERDSQNYTAFHVAIQQGHLKIIAYLFEHYPPQDPDHNQLYVPPPSISVLSLALQSHEPEVVFKVLQPENKLSNSRD
# INDAWSWINSPEGLSAMTRYSKGISGDIVVKFNDICTLLGQFGGFTPPATPILNRKNKSSSPVSKVVPQTDQHYNSRKGRGRGRARVA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g824
###
# start gene g825
Scaffold_1	AUGUSTUS	gene	3966743	3967513	0.74	-	.	g825
Scaffold_1	AUGUSTUS	transcript	3966743	3967513	0.74	-	.	g825.t1
Scaffold_1	AUGUSTUS	stop_codon	3966743	3966745	.	-	0	transcript_id "g825.t1"; gene_id "g825";
Scaffold_1	AUGUSTUS	CDS	3966743	3967513	0.74	-	0	transcript_id "g825.t1"; gene_id "g825";
Scaffold_1	AUGUSTUS	start_codon	3967511	3967513	.	-	0	transcript_id "g825.t1"; gene_id "g825";
# protein sequence = [MVHILGINLPDNQLARVRSYAFSLICTTYANACIQFALTTIYGVGPHLSHRLCARFQIHDKCRVKDLTPLQTTSLASF
# LQSPKTALPLPQYPLAPLNFVARPPSKSIQELQAEFNAARAAQKQKREEKLLQMGKSTAEDVKGKTTRGRKAPEKKSRDPLTELRIESELRREIRENI
# AHQRMIGSYVGRRHAMHLPVSSILTFIARQQHSFCFAGSWTKNTDQRQDGSQTQQFGQMVNVDYCRTNAAHFFVTLSFLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g825
###
# start gene g826
Scaffold_1	AUGUSTUS	gene	3967634	3968405	0.74	+	.	g826
Scaffold_1	AUGUSTUS	transcript	3967634	3968405	0.74	+	.	g826.t1
Scaffold_1	AUGUSTUS	start_codon	3967634	3967636	.	+	0	transcript_id "g826.t1"; gene_id "g826";
Scaffold_1	AUGUSTUS	CDS	3967634	3967908	0.78	+	0	transcript_id "g826.t1"; gene_id "g826";
Scaffold_1	AUGUSTUS	CDS	3967973	3968405	0.88	+	1	transcript_id "g826.t1"; gene_id "g826";
Scaffold_1	AUGUSTUS	stop_codon	3968403	3968405	.	+	0	transcript_id "g826.t1"; gene_id "g826";
# protein sequence = [MATSKAEGRREDALAKERERMREEFERQKKNLIDETEKSRPSSHRFVGQNDSMEDSLKYSTVGLVHLEEFQQKRKELE
# EAKAREAARTNELKDDIKKVKKRKKAAKATLSFAMDDEGEGEESISKAESEPRSASKDEEDADGDGDDERAKKRSKFRKNPNVDTSFLPDREREEAER
# KERERLRQEFLRKQEELKNEDIEITYSYWDGSGHRKSVVVSCSPLVFPLFSGLTSSLYA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g826
###
# start gene g827
Scaffold_1	AUGUSTUS	gene	3987284	3987742	0.39	+	.	g827
Scaffold_1	AUGUSTUS	transcript	3987284	3987742	0.39	+	.	g827.t1
Scaffold_1	AUGUSTUS	start_codon	3987284	3987286	.	+	0	transcript_id "g827.t1"; gene_id "g827";
Scaffold_1	AUGUSTUS	CDS	3987284	3987742	0.39	+	0	transcript_id "g827.t1"; gene_id "g827";
Scaffold_1	AUGUSTUS	stop_codon	3987740	3987742	.	+	0	transcript_id "g827.t1"; gene_id "g827";
# protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE
# LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQRPPEAPQPPPEVPQQLRSSP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g827
###
# start gene g828
Scaffold_1	AUGUSTUS	gene	3987864	3988808	0.88	+	.	g828
Scaffold_1	AUGUSTUS	transcript	3987864	3988808	0.88	+	.	g828.t1
Scaffold_1	AUGUSTUS	start_codon	3987864	3987866	.	+	0	transcript_id "g828.t1"; gene_id "g828";
Scaffold_1	AUGUSTUS	CDS	3987864	3988808	0.88	+	0	transcript_id "g828.t1"; gene_id "g828";
Scaffold_1	AUGUSTUS	stop_codon	3988806	3988808	.	+	0	transcript_id "g828.t1"; gene_id "g828";
# protein sequence = [MGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPEGSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREWTLSRP
# PHLRHRKPEHTQDSFKVWSDSQGFNKTQQLPEKAAHSGYPCGGTKIGPNHTRETHQLNRSCWDGSSTEGGNPSVLPSYIATKEESPTEEMLRASDSSA
# TEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKE
# YIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTCDSAWTIEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g828
###
# start gene g829
Scaffold_1	AUGUSTUS	gene	3989277	3990938	0.43	+	.	g829
Scaffold_1	AUGUSTUS	transcript	3989277	3990938	0.43	+	.	g829.t1
Scaffold_1	AUGUSTUS	start_codon	3989277	3989279	.	+	0	transcript_id "g829.t1"; gene_id "g829";
Scaffold_1	AUGUSTUS	CDS	3989277	3990938	0.43	+	0	transcript_id "g829.t1"; gene_id "g829";
Scaffold_1	AUGUSTUS	stop_codon	3990936	3990938	.	+	0	transcript_id "g829.t1"; gene_id "g829";
# protein sequence = [MDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPV
# VLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAEL
# LSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALKRIARNEEESFVWEDGL
# IKRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQ
# LPATAGPEKYDAILVVVCRLTKQAIYVPCHTTDKAEDFANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVN
# QSVEAYLRIYCSYDQDDWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQERRSMSTRPTSRSYMRTSRNESG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g829
###
# start gene g830
Scaffold_1	AUGUSTUS	gene	3996816	3997295	0.46	-	.	g830
Scaffold_1	AUGUSTUS	transcript	3996816	3997295	0.46	-	.	g830.t1
Scaffold_1	AUGUSTUS	stop_codon	3996816	3996818	.	-	0	transcript_id "g830.t1"; gene_id "g830";
Scaffold_1	AUGUSTUS	CDS	3996816	3997295	0.46	-	0	transcript_id "g830.t1"; gene_id "g830";
Scaffold_1	AUGUSTUS	start_codon	3997293	3997295	.	-	0	transcript_id "g830.t1"; gene_id "g830";
# protein sequence = [MKALLKRLGIESALTMSYHPETNGQTERANQEIKRYIRMYVSRRQDDWDHLLPTAEFVINSRVHFAHDKAPFEVLYGY
# TPEFSIPIGSWKEYPSITDRLDALRHAREDAEAALRMSKQRIADTIAEHPNQPSFEVGQPVWLSVNNLKFDAKVRSWEAAD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g830
###
# start gene g831
Scaffold_1	AUGUSTUS	gene	3998328	3998630	0.9	+	.	g831
Scaffold_1	AUGUSTUS	transcript	3998328	3998630	0.9	+	.	g831.t1
Scaffold_1	AUGUSTUS	start_codon	3998328	3998330	.	+	0	transcript_id "g831.t1"; gene_id "g831";
Scaffold_1	AUGUSTUS	CDS	3998328	3998630	0.9	+	0	transcript_id "g831.t1"; gene_id "g831";
Scaffold_1	AUGUSTUS	stop_codon	3998628	3998630	.	+	0	transcript_id "g831.t1"; gene_id "g831";
# protein sequence = [MEEDQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPAQGRSTTRIDSPILQAIVRRTGKQPQRRAASESPRDPPPHFDL
# DTGDHDDQDPPVTPMTRAPTKS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g831
###
# start gene g832
Scaffold_1	AUGUSTUS	gene	4000835	4001728	0.71	+	.	g832
Scaffold_1	AUGUSTUS	transcript	4000835	4001728	0.71	+	.	g832.t1
Scaffold_1	AUGUSTUS	start_codon	4000835	4000837	.	+	0	transcript_id "g832.t1"; gene_id "g832";
Scaffold_1	AUGUSTUS	CDS	4000835	4001728	0.71	+	0	transcript_id "g832.t1"; gene_id "g832";
Scaffold_1	AUGUSTUS	stop_codon	4001726	4001728	.	+	0	transcript_id "g832.t1"; gene_id "g832";
# protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT
# RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR
# GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD
# LLGIKLESLIPRELTEEQQQWLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g832
###
# start gene g833
Scaffold_1	AUGUSTUS	gene	4001812	4002360	0.52	+	.	g833
Scaffold_1	AUGUSTUS	transcript	4001812	4002360	0.52	+	.	g833.t1
Scaffold_1	AUGUSTUS	start_codon	4001812	4001814	.	+	0	transcript_id "g833.t1"; gene_id "g833";
Scaffold_1	AUGUSTUS	CDS	4001812	4002360	0.52	+	0	transcript_id "g833.t1"; gene_id "g833";
Scaffold_1	AUGUSTUS	stop_codon	4002358	4002360	.	+	0	transcript_id "g833.t1"; gene_id "g833";
# protein sequence = [MTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMP
# EGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQD
# SSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g833
###
# start gene g834
Scaffold_1	AUGUSTUS	gene	4002390	4004802	0.13	+	.	g834
Scaffold_1	AUGUSTUS	transcript	4002390	4004802	0.13	+	.	g834.t1
Scaffold_1	AUGUSTUS	start_codon	4002390	4002392	.	+	0	transcript_id "g834.t1"; gene_id "g834";
Scaffold_1	AUGUSTUS	CDS	4002390	4003113	0.9	+	0	transcript_id "g834.t1"; gene_id "g834";
Scaffold_1	AUGUSTUS	CDS	4003164	4003543	0.3	+	2	transcript_id "g834.t1"; gene_id "g834";
Scaffold_1	AUGUSTUS	CDS	4003877	4004169	0.31	+	0	transcript_id "g834.t1"; gene_id "g834";
Scaffold_1	AUGUSTUS	CDS	4004225	4004414	0.99	+	1	transcript_id "g834.t1"; gene_id "g834";
Scaffold_1	AUGUSTUS	CDS	4004557	4004802	0.98	+	0	transcript_id "g834.t1"; gene_id "g834";
Scaffold_1	AUGUSTUS	stop_codon	4004800	4004802	.	+	0	transcript_id "g834.t1"; gene_id "g834";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA
# ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQRILQKDIVESFLRDLSIDDERRNIAIVANQSVAYE
# DHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHQNIV
# LDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGGSSLNPLGEN
# CDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRWFDMKYSKEELNHSKDLNRQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYK
# PVEKKVNPIKATLPDEFRIERHIHGDPLELPDCRTVKIMYTV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g834
###
# start gene g835
Scaffold_1	AUGUSTUS	gene	4005443	4005874	0.65	+	.	g835
Scaffold_1	AUGUSTUS	transcript	4005443	4005874	0.65	+	.	g835.t1
Scaffold_1	AUGUSTUS	start_codon	4005443	4005445	.	+	0	transcript_id "g835.t1"; gene_id "g835";
Scaffold_1	AUGUSTUS	CDS	4005443	4005874	0.65	+	0	transcript_id "g835.t1"; gene_id "g835";
Scaffold_1	AUGUSTUS	stop_codon	4005872	4005874	.	+	0	transcript_id "g835.t1"; gene_id "g835";
# protein sequence = [MMCKQEAGFAWQPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFKDVCKIIKSKIDSGIYEPSNASYRLKWFC
# VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPAIADLARSFSGRSCGGTLDLYIGYDERELDICLET]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g835
###
# start gene g836
Scaffold_1	AUGUSTUS	gene	4006222	4006593	0.66	+	.	g836
Scaffold_1	AUGUSTUS	transcript	4006222	4006593	0.66	+	.	g836.t1
Scaffold_1	AUGUSTUS	start_codon	4006222	4006224	.	+	0	transcript_id "g836.t1"; gene_id "g836";
Scaffold_1	AUGUSTUS	CDS	4006222	4006593	0.66	+	0	transcript_id "g836.t1"; gene_id "g836";
Scaffold_1	AUGUSTUS	stop_codon	4006591	4006593	.	+	0	transcript_id "g836.t1"; gene_id "g836";
# protein sequence = [MKAVCQKKHIAQVVLEWPSCRDKTKVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRD
# CPALRPINFDWDVYLAVDTSYKLWDGISIKLIHLRRRSSSITLDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g836
###
# start gene g837
Scaffold_1	AUGUSTUS	gene	4006734	4007115	0.39	+	.	g837
Scaffold_1	AUGUSTUS	transcript	4006734	4007115	0.39	+	.	g837.t1
Scaffold_1	AUGUSTUS	start_codon	4006734	4006736	.	+	0	transcript_id "g837.t1"; gene_id "g837";
Scaffold_1	AUGUSTUS	CDS	4006734	4006752	0.39	+	0	transcript_id "g837.t1"; gene_id "g837";
Scaffold_1	AUGUSTUS	CDS	4006826	4007115	0.99	+	2	transcript_id "g837.t1"; gene_id "g837";
Scaffold_1	AUGUSTUS	stop_codon	4007113	4007115	.	+	0	transcript_id "g837.t1"; gene_id "g837";
# protein sequence = [MLDNPSCATLDGLSQITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEA
# DDIELDVQELWMKSEATRFVGTTY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g837
###
# start gene g838
Scaffold_1	AUGUSTUS	gene	4013681	4015539	0.3	-	.	g838
Scaffold_1	AUGUSTUS	transcript	4013681	4015539	0.3	-	.	g838.t1
Scaffold_1	AUGUSTUS	stop_codon	4013681	4013683	.	-	0	transcript_id "g838.t1"; gene_id "g838";
Scaffold_1	AUGUSTUS	CDS	4013681	4015051	1	-	0	transcript_id "g838.t1"; gene_id "g838";
Scaffold_1	AUGUSTUS	CDS	4015240	4015539	0.3	-	0	transcript_id "g838.t1"; gene_id "g838";
Scaffold_1	AUGUSTUS	start_codon	4015537	4015539	.	-	0	transcript_id "g838.t1"; gene_id "g838";
# protein sequence = [MVGRSSEDKKIDALPVGLWADSVGGLDIPPSRGVSNDIRLVNPQHADHESIVPVQALQAEHFTDPDTLGPDFFPDALD
# QVDDVNLFTRNDGEQGAFRPERAKLLTPPQREYLHAKVDELLEAGVIERCNPEDVKCVSPLTLAQKVHEGRGLTVEELKYKLNDECVAAGLPASFDLP
# TRQVQPSGPPERAELARPAKWRICQNFMAINKLTEIAPMPQGNIRSKQQSLSGHNYICLFDFASGFYACEVERGSRPYTAFYVEGKGYFWCAKLPFGL
# TGAPSTFANMTALHLDDLIADGTIELFVDDGGSADDDFESMFAKLTRILDRVRARDLSLSAAKSEFFMSEGIFAGGKISKEGVTADPAKLTAMEWKQP
# ADALNLASFVGLTGHFRDLIRNYARIEGPLRNLLKSVPLPQNYTKSTYRRAMESFRLEGKWTLDHTKAFLVLKQALVSEPVLKAPRWDGSSFVVTTDG
# CKEGFAAVVAQRFEVVHPNGTTTYKMHPVGFASKRTSASEQNYKPFLLEFAALKFGLDKFSDMIWGFPVEIETDCQALRDVIATTN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g838
###
# start gene g839
Scaffold_1	AUGUSTUS	gene	4016793	4017602	0.98	-	.	g839
Scaffold_1	AUGUSTUS	transcript	4016793	4017602	0.98	-	.	g839.t1
Scaffold_1	AUGUSTUS	stop_codon	4016793	4016795	.	-	0	transcript_id "g839.t1"; gene_id "g839";
Scaffold_1	AUGUSTUS	CDS	4016793	4017602	0.98	-	0	transcript_id "g839.t1"; gene_id "g839";
Scaffold_1	AUGUSTUS	start_codon	4017600	4017602	.	-	0	transcript_id "g839.t1"; gene_id "g839";
# protein sequence = [MTTSEDTNQPYHQWWADRLLRLAKGAEIEKTKQSIGAVWKKLPYALKKTVDEEHDNWADFTSAIKAVKWGVLKVEAEH
# EASRKVLPPIPETPRTKLARDFAAARISSPPSPSPMRARPAYAGNIGGRKPRRVFTSLNEARKEVLRRGIAAKVQQPNTPEGFAAWKAELLEWASRHG
# VDGALSELTIVPLKPGTEAVCSGECFRCGGTRHGFEVPCPKPGAIPPVESDWRAYCQRELGGRVARVNAVHVLGPEAIFEGMVESGNGEGSAF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g839
###
# start gene g840
Scaffold_1	AUGUSTUS	gene	4020295	4021697	0.19	-	.	g840
Scaffold_1	AUGUSTUS	transcript	4020295	4021697	0.19	-	.	g840.t1
Scaffold_1	AUGUSTUS	stop_codon	4020295	4020297	.	-	0	transcript_id "g840.t1"; gene_id "g840";
Scaffold_1	AUGUSTUS	CDS	4020295	4021222	0.84	-	1	transcript_id "g840.t1"; gene_id "g840";
Scaffold_1	AUGUSTUS	CDS	4021495	4021697	0.29	-	0	transcript_id "g840.t1"; gene_id "g840";
Scaffold_1	AUGUSTUS	start_codon	4021695	4021697	.	-	0	transcript_id "g840.t1"; gene_id "g840";
# protein sequence = [MSQCSWDGGINHEVRSLSSETDSNYSNDSADRHSESESDWDADDEDILEMNPDHLIEKMIRREEEIESESASLMRRFF
# AQPPKLGTTLGSPSSPFPSTSPSPSPSPSPSPSPSPSMASLAPLSMGNNIFRGYLSDLEISDQESDNESIFSKDDTPHSHSRAPSPSPAPLSQSIIGP
# EAILNLHPVPPSKRRKLDVSARETKRIAKEERKKQYSAAFDAIDKVLKSRKTEFWAGCNSLQERRAHAIHGVLLMVVKRQMALIPASKSSATTHGFAP
# NHGSRMLRGWVKSWILTRELPTSSRGSHAKVFSLLSDPTLRAEIRSYLRSNKWAMNPGKFQAFVNKTMLPDAAKAYAKQITATEMPEGLKKYFELELF
# LGLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g840
###
# start gene g841
Scaffold_1	AUGUSTUS	gene	4021942	4022592	0.3	-	.	g841
Scaffold_1	AUGUSTUS	transcript	4021942	4022592	0.3	-	.	g841.t1
Scaffold_1	AUGUSTUS	stop_codon	4021942	4021944	.	-	0	transcript_id "g841.t1"; gene_id "g841";
Scaffold_1	AUGUSTUS	CDS	4021942	4022354	0.9	-	2	transcript_id "g841.t1"; gene_id "g841";
Scaffold_1	AUGUSTUS	CDS	4022436	4022476	0.43	-	1	transcript_id "g841.t1"; gene_id "g841";
Scaffold_1	AUGUSTUS	CDS	4022579	4022592	0.37	-	0	transcript_id "g841.t1"; gene_id "g841";
Scaffold_1	AUGUSTUS	start_codon	4022590	4022592	.	-	0	transcript_id "g841.t1"; gene_id "g841";
# protein sequence = [MTHSIKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLELQSTKFIAATLNFQAAEFEFNANLFKTYATRAR
# IAKVIADEACSILKSRQDSGSDSSASGASFTTAQSIPTTGSEDTVVTPMVQSGIRQPIRNRRHLGWRKFFYIYSTEK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g841
###
# start gene g842
Scaffold_1	AUGUSTUS	gene	4027394	4027732	1	-	.	g842
Scaffold_1	AUGUSTUS	transcript	4027394	4027732	1	-	.	g842.t1
Scaffold_1	AUGUSTUS	stop_codon	4027394	4027396	.	-	0	transcript_id "g842.t1"; gene_id "g842";
Scaffold_1	AUGUSTUS	CDS	4027394	4027732	1	-	0	transcript_id "g842.t1"; gene_id "g842";
Scaffold_1	AUGUSTUS	start_codon	4027730	4027732	.	-	0	transcript_id "g842.t1"; gene_id "g842";
# protein sequence = [MSSKTAHTEKPPAVTVDAEDIWKQSAKTSSWDSDETEADAQQISATGPTPFSLFPNESVQIASSTPTSAPATVPATPS
# PPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g842
###
# start gene g843
Scaffold_1	AUGUSTUS	gene	4028749	4029105	0.95	-	.	g843
Scaffold_1	AUGUSTUS	transcript	4028749	4029105	0.95	-	.	g843.t1
Scaffold_1	AUGUSTUS	stop_codon	4028749	4028751	.	-	0	transcript_id "g843.t1"; gene_id "g843";
Scaffold_1	AUGUSTUS	CDS	4028749	4029105	0.95	-	0	transcript_id "g843.t1"; gene_id "g843";
Scaffold_1	AUGUSTUS	start_codon	4029103	4029105	.	-	0	transcript_id "g843.t1"; gene_id "g843";
# protein sequence = [MSTLIPPATPAPPASAEDLMTQLIKQVANLATAMEERSSSKSSMNKPKVFKGKDSAEVRRFMAQFQNWAPEQPDLTKS
# QAKLIKSALGFFTESAGDWATPHLLHFNAEHPPLEEIGSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g843
###
# start gene g844
Scaffold_1	AUGUSTUS	gene	4030844	4032213	0.3	-	.	g844
Scaffold_1	AUGUSTUS	transcript	4030844	4032213	0.3	-	.	g844.t1
Scaffold_1	AUGUSTUS	stop_codon	4030844	4030846	.	-	0	transcript_id "g844.t1"; gene_id "g844";
Scaffold_1	AUGUSTUS	CDS	4030844	4031387	0.54	-	1	transcript_id "g844.t1"; gene_id "g844";
Scaffold_1	AUGUSTUS	CDS	4032206	4032213	0.3	-	0	transcript_id "g844.t1"; gene_id "g844";
Scaffold_1	AUGUSTUS	start_codon	4032211	4032213	.	-	0	transcript_id "g844.t1"; gene_id "g844";
# protein sequence = [MKGLLTGILMMAATMKMTELPANDAGARRSLARCRLARGALSFVNPAMMQRYDARTPGGLQREGGGNPTGEHLAVLES
# QMAQLLADNRQFREEQVKSNTYNCHFNRNLDWLIMDAARRRSPPELPQAGPLQLPRKRRRVVDSQKEEEEEEEEVEVEVEERGEEERDELAPKRAQSE
# KGKKKEE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g844
###
# start gene g845
Scaffold_1	AUGUSTUS	gene	4034156	4034506	0.69	+	.	g845
Scaffold_1	AUGUSTUS	transcript	4034156	4034506	0.69	+	.	g845.t1
Scaffold_1	AUGUSTUS	start_codon	4034156	4034158	.	+	0	transcript_id "g845.t1"; gene_id "g845";
Scaffold_1	AUGUSTUS	CDS	4034156	4034506	0.69	+	0	transcript_id "g845.t1"; gene_id "g845";
Scaffold_1	AUGUSTUS	stop_codon	4034504	4034506	.	+	0	transcript_id "g845.t1"; gene_id "g845";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWRRF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g845
###
# start gene g846
Scaffold_1	AUGUSTUS	gene	4041100	4041909	0.56	+	.	g846
Scaffold_1	AUGUSTUS	transcript	4041100	4041909	0.56	+	.	g846.t1
Scaffold_1	AUGUSTUS	start_codon	4041100	4041102	.	+	0	transcript_id "g846.t1"; gene_id "g846";
Scaffold_1	AUGUSTUS	CDS	4041100	4041909	0.56	+	0	transcript_id "g846.t1"; gene_id "g846";
Scaffold_1	AUGUSTUS	stop_codon	4041907	4041909	.	+	0	transcript_id "g846.t1"; gene_id "g846";
# protein sequence = [MSWAAQRLKDQWEAHIGGLKAQYQVQLQEAETLREQRRQEAAVAESLAEAERQEKERELTKEAEKKRLPIYDFQKGLG
# VDSIPLQLHPYAKKMMMARKYTPLWYFLPDAAVEAKERSKESLDTNHLQFAVEDSNSLSGSTVSLVGSHSVRASPNAIPNSQLSWPQVMRAKSAFLNA
# IRLGTWPDHFIAMFAGFYSNMDMHRELQEQDGDRVMAHYHAEMRLAWYNAMERKAPFDLSIISDRVLGESRQQIVKQKQEKSLKGKQFSPSMK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g846
###
# start gene g847
Scaffold_1	AUGUSTUS	gene	4042141	4043232	0.89	+	.	g847
Scaffold_1	AUGUSTUS	transcript	4042141	4043232	0.89	+	.	g847.t1
Scaffold_1	AUGUSTUS	start_codon	4042141	4042143	.	+	0	transcript_id "g847.t1"; gene_id "g847";
Scaffold_1	AUGUSTUS	CDS	4042141	4043232	0.89	+	0	transcript_id "g847.t1"; gene_id "g847";
Scaffold_1	AUGUSTUS	stop_codon	4043230	4043232	.	+	0	transcript_id "g847.t1"; gene_id "g847";
# protein sequence = [MNHQTFKPPQHRWKQGSKPGFNNCPRRPQTLPRVLGNPPIEHAKLPIPPHLLAKPVDKPKTINQTPPIFNAPFGTQTN
# HSSHAATNVSDGTNTTSATVRGHQSGMENAESPATGTSTDISRSLKEPTRVWNSAQTGRDRMDAPVGPTPRNTSAQVALTATTELAAAPTENRFIVRT
# PLQAKEWKSAITRLNLAHKYPTLAESIQHGFNVGIPKIKHTFSPPNKLNSSESIAAFHEISTGRWLGPYSKETIERTIGPFQTSPISMIPKSGKPGKF
# RLLENLSYPYRPTFIPSIPAVISSINSHIDSTLYPCLWGTFATTCRLIWTLPPDSQGAVRDISEAYRLIPLLHHNGREPLLEHLKRNIA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g847
###
# start gene g848
Scaffold_1	AUGUSTUS	gene	4044018	4044437	0.77	+	.	g848
Scaffold_1	AUGUSTUS	transcript	4044018	4044437	0.77	+	.	g848.t1
Scaffold_1	AUGUSTUS	start_codon	4044018	4044020	.	+	0	transcript_id "g848.t1"; gene_id "g848";
Scaffold_1	AUGUSTUS	CDS	4044018	4044437	0.77	+	0	transcript_id "g848.t1"; gene_id "g848";
Scaffold_1	AUGUSTUS	stop_codon	4044435	4044437	.	+	0	transcript_id "g848.t1"; gene_id "g848";
# protein sequence = [MPTLTPAAALALAYTSAATGEPIVYSQDGEEGTKNGTLGGPKQSASISLSSSSPGKQPQGDNTKYGVTMKEWSRGGGT
# EEAETEPRTIYSDTFTKSLHVAISESTPDMLPVLTTQPIRSREAPVAEQNTSSQRLTSLTT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g848
###
# start gene g849
Scaffold_1	AUGUSTUS	gene	4050767	4051027	0.53	-	.	g849
Scaffold_1	AUGUSTUS	transcript	4050767	4051027	0.53	-	.	g849.t1
Scaffold_1	AUGUSTUS	stop_codon	4050767	4050769	.	-	0	transcript_id "g849.t1"; gene_id "g849";
Scaffold_1	AUGUSTUS	CDS	4050767	4051027	0.53	-	0	transcript_id "g849.t1"; gene_id "g849";
Scaffold_1	AUGUSTUS	start_codon	4051025	4051027	.	-	0	transcript_id "g849.t1"; gene_id "g849";
# protein sequence = [MEAMAEANADAKEIDEAVRIGGDVAIGVPDFDDAELEEELHRLAIESVEEKQDESRETKLGSLPAAPLHDVWETSRTN
# PEREAVAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g849
###
# start gene g850
Scaffold_1	AUGUSTUS	gene	4052984	4054225	0.46	+	.	g850
Scaffold_1	AUGUSTUS	transcript	4052984	4054225	0.46	+	.	g850.t1
Scaffold_1	AUGUSTUS	start_codon	4052984	4052986	.	+	0	transcript_id "g850.t1"; gene_id "g850";
Scaffold_1	AUGUSTUS	CDS	4052984	4053101	0.46	+	0	transcript_id "g850.t1"; gene_id "g850";
Scaffold_1	AUGUSTUS	CDS	4053267	4054225	0.81	+	2	transcript_id "g850.t1"; gene_id "g850";
Scaffold_1	AUGUSTUS	stop_codon	4054223	4054225	.	+	0	transcript_id "g850.t1"; gene_id "g850";
# protein sequence = [MWETDLERAESEKIRVRVHWFDRPSDLPSIRAKRYHHDVSRWIIKSIEDVDQKFQCLLAIDSRRGIYYNFDWSLHRKE
# ALEARTTLTDSEWGTGNAWDVTAMDEFQDDAQGRVKAEEKKSSRTSASPRKRVKDESEEKEEGEEESHKPTAKKHTQRKPARQRRAVTNSEDRSKSTK
# PMPKPKRTVRMVKEDVLELDDDLSSGAEYKDEELSDEDEEHEAELSDNASEPATSDEDDIDDDVPKTPSRKRKRAATTTPRKQRGRTFAQPTPHSKAA
# LSRRNRSITGSPSKKRALPVKSQNTYAASKSLFHHLPEDPWLRAMHALHVGSRPDALPCRESEFQLVHKSVSQLLEEGSGGCIC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g850
###
# start gene g851
Scaffold_1	AUGUSTUS	gene	4060681	4061166	0.93	-	.	g851
Scaffold_1	AUGUSTUS	transcript	4060681	4061166	0.93	-	.	g851.t1
Scaffold_1	AUGUSTUS	stop_codon	4060681	4060683	.	-	0	transcript_id "g851.t1"; gene_id "g851";
Scaffold_1	AUGUSTUS	CDS	4060681	4061166	0.93	-	0	transcript_id "g851.t1"; gene_id "g851";
Scaffold_1	AUGUSTUS	start_codon	4061164	4061166	.	-	0	transcript_id "g851.t1"; gene_id "g851";
# protein sequence = [MHSSSPDSVLCVDATESTALPSTTSTTSSTQSSVTVSQTSSAPASASSTTSTSESLTAPNNPRSNAIGGGVVGGILGL
# ALLLLLIGCSIAFRRRRRIRALLRTNSDSEQGALSSPSRGILDNSSKSADSESASADMSEIQSGVTTTQMVRKSETMCSKTRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g851
###
# start gene g852
Scaffold_1	AUGUSTUS	gene	4064015	4064811	0.83	-	.	g852
Scaffold_1	AUGUSTUS	transcript	4064015	4064811	0.83	-	.	g852.t1
Scaffold_1	AUGUSTUS	stop_codon	4064015	4064017	.	-	0	transcript_id "g852.t1"; gene_id "g852";
Scaffold_1	AUGUSTUS	CDS	4064015	4064595	0.9	-	2	transcript_id "g852.t1"; gene_id "g852";
Scaffold_1	AUGUSTUS	CDS	4064688	4064811	0.83	-	0	transcript_id "g852.t1"; gene_id "g852";
Scaffold_1	AUGUSTUS	start_codon	4064809	4064811	.	-	0	transcript_id "g852.t1"; gene_id "g852";
# protein sequence = [MTNFLHFHSPALGGVLASPATQWPQSFGKIAFFHDYPYFLAYVQNVMYFQSSPRLKNKKPQNRASFEESEPLLLDGEP
# QIDYGGLTPSTGKTNDDHLKPPSAWELLTPNLKIVLLNYGLLSFTDMSYFVLIPLIYSSSLSIGGLGLSPYQVGLILGIFALLNGFWNLLVLSKILKV
# LGPRKMYIISYSSFLVTFPLLWILRDVAHLAGGVNALVWSLIVCQLLAASFVNTAYSE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g852
###
# start gene g853
Scaffold_1	AUGUSTUS	gene	4066283	4066687	0.87	+	.	g853
Scaffold_1	AUGUSTUS	transcript	4066283	4066687	0.87	+	.	g853.t1
Scaffold_1	AUGUSTUS	start_codon	4066283	4066285	.	+	0	transcript_id "g853.t1"; gene_id "g853";
Scaffold_1	AUGUSTUS	CDS	4066283	4066687	0.87	+	0	transcript_id "g853.t1"; gene_id "g853";
Scaffold_1	AUGUSTUS	stop_codon	4066685	4066687	.	+	0	transcript_id "g853.t1"; gene_id "g853";
# protein sequence = [MPSNLTLSDPFKATFYQLDQLFSQYPFISMSTKSLGVALITGASQGIGKAIALRLAKDGYRVALNDIPNKDPQLRSLA
# REIEREHGAKTYVTPADVSNESEVEKMVVQTSKALGGLDVVRNTSLGVVGCRLVRI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g853
###
# start gene g854
Scaffold_1	AUGUSTUS	gene	4068867	4069214	0.99	-	.	g854
Scaffold_1	AUGUSTUS	transcript	4068867	4069214	0.99	-	.	g854.t1
Scaffold_1	AUGUSTUS	stop_codon	4068867	4068869	.	-	0	transcript_id "g854.t1"; gene_id "g854";
Scaffold_1	AUGUSTUS	CDS	4068867	4069214	0.99	-	0	transcript_id "g854.t1"; gene_id "g854";
Scaffold_1	AUGUSTUS	start_codon	4069212	4069214	.	-	0	transcript_id "g854.t1"; gene_id "g854";
# protein sequence = [MLEQFLPQETQDRGAANNPNNVKLKNAANDERGTGVWPREVGVQRVVWNSGNGLAAAGMLASATGSGLCRVDVLSGRW
# LKEGNVKMPYGGIENIRLEADNVVDDIEADSDEGSSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g854
###
# start gene g855
Scaffold_1	AUGUSTUS	gene	4070026	4070836	0.14	-	.	g855
Scaffold_1	AUGUSTUS	transcript	4070026	4070836	0.14	-	.	g855.t1
Scaffold_1	AUGUSTUS	stop_codon	4070026	4070028	.	-	0	transcript_id "g855.t1"; gene_id "g855";
Scaffold_1	AUGUSTUS	CDS	4070026	4070594	0.85	-	2	transcript_id "g855.t1"; gene_id "g855";
Scaffold_1	AUGUSTUS	CDS	4070659	4070778	0.58	-	2	transcript_id "g855.t1"; gene_id "g855";
Scaffold_1	AUGUSTUS	CDS	4070833	4070836	0.2	-	0	transcript_id "g855.t1"; gene_id "g855";
Scaffold_1	AUGUSTUS	start_codon	4070834	4070836	.	-	0	transcript_id "g855.t1"; gene_id "g855";
# protein sequence = [MADFIPNSSAHVFNAGAPVWGIDWCPLHPDTRKGASDLGFGPVAPLPSPSHSPEIGIRVQRPSKACIQIWSFGSDAGY
# ESASTGREGSTHGASEPNPGRMKCDLVICIDCGPAYELKWCPLPSPSAQTAFAGPKKLGLLAGTFEDGSFAIFAIPDPKDIAPPNHDYSEPHYSEFLL
# RCWFIIAQHAAVRLPDPVLRIEMEETCCWSIDWANSEVVAIGMTNGESPRQTQD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g855
###
# start gene g856
Scaffold_1	AUGUSTUS	gene	4071849	4072487	0.98	-	.	g856
Scaffold_1	AUGUSTUS	transcript	4071849	4072487	0.98	-	.	g856.t1
Scaffold_1	AUGUSTUS	stop_codon	4071849	4071851	.	-	0	transcript_id "g856.t1"; gene_id "g856";
Scaffold_1	AUGUSTUS	CDS	4071849	4072487	0.98	-	0	transcript_id "g856.t1"; gene_id "g856";
Scaffold_1	AUGUSTUS	start_codon	4072485	4072487	.	-	0	transcript_id "g856.t1"; gene_id "g856";
# protein sequence = [MCLGSAWSEYKTSGTVHGIPLPPGLVESQQLPEPLFTPSTKAEQGAHDENISPEQGTSSTISAFPNSPMLTIHLASKL
# IGESIYAQISQAALKLYSEAAAFAHSKGVILADTKFEFGLVPSTKSPNEETLILVDELLTPDSSRYWPLKGYEVGKSQPSFDKQYLRDWLVGVGFRKG
# LERGKEGEEGHGWTIDSSVVEGTRDRYEEAVKLLTG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g856
###
# start gene g857
Scaffold_1	AUGUSTUS	gene	4098429	4099211	0.85	-	.	g857
Scaffold_1	AUGUSTUS	transcript	4098429	4099211	0.85	-	.	g857.t1
Scaffold_1	AUGUSTUS	stop_codon	4098429	4098431	.	-	0	transcript_id "g857.t1"; gene_id "g857";
Scaffold_1	AUGUSTUS	CDS	4098429	4099211	0.85	-	0	transcript_id "g857.t1"; gene_id "g857";
Scaffold_1	AUGUSTUS	start_codon	4099209	4099211	.	-	0	transcript_id "g857.t1"; gene_id "g857";
# protein sequence = [MTPWTRIFHTPAARRTSSYFSSKAGSGRYFNSAKPLSAPATPKKATGVDSTESSKNGVTGQALKVAEESSSSRREMLT
# RSSVPEFVPSTHPVIGDKDFKLHQFFSLHRPLLLLSDPPSIMRSSPPTSIFSLSKPPSAHALPATEASPEFAAASDAEAARTLARALAINHAGATFVW
# EETLKHIGLDVNLEPGRVGLQERLDKELQEVRLDSTRRKKRKKMKKHKLVFSSTFYFYILIPSLRRLKKRRRVSSSDINSEGPF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g857
###
# start gene g858
Scaffold_1	AUGUSTUS	gene	4099680	4101350	0.7	+	.	g858
Scaffold_1	AUGUSTUS	transcript	4099680	4101350	0.7	+	.	g858.t1
Scaffold_1	AUGUSTUS	start_codon	4099680	4099682	.	+	0	transcript_id "g858.t1"; gene_id "g858";
Scaffold_1	AUGUSTUS	CDS	4099680	4101350	0.7	+	0	transcript_id "g858.t1"; gene_id "g858";
Scaffold_1	AUGUSTUS	stop_codon	4101348	4101350	.	+	0	transcript_id "g858.t1"; gene_id "g858";
# protein sequence = [MSTVFHRIPRVPIDLEKVHNYSRLSRGLSEHQSSEVKVLVGALDEDLRDYDNDITQLEIQLSFLKNQRTRAKNYRKFL
# GSLCSPFHRLPNELLGEIFQEVCNDVHVEPWAKYDVSVAPFVLSAVCNRWREFVVGNPKLWTTIRFRCPLEDPEYLSSAQYERLQEVVDLYIERSTTF
# HLKVQLFSSPDHEESGLFQYFLTSSPRWKCLSLYVTSLSTSCYPTLRLLDLPVLETVSIHHCLNSDTQVGADLSVFNNAPKLHTLDVLEGGLSTTSNS
# TVWDQLTTFTYKTSFGNLTEVLRLCPNLQYLTLTDQRPSDPFAPELPITAPKLTSISVIFGRSYLNRSDMLQTAFLSSLTAPALTTLSLALEQVQRDP
# RPLNALTRTSESIFRGIDNFIIQSHCKSQLTKLVLDGMPLEDRDLVSLLKTLPFLEELTVIDPCMEMNRVLPISKAFVQSLHSCSKTSHLQTSDVVLV
# PKLHTLILKVVAPGFDHDAFVETILSRWCPANAKPPKDLSPLRRVNLSLSEPINEEDYKLLFTLRRSGLIFSVQLETLLPSKDAYV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g858
###
# start gene g859
Scaffold_1	AUGUSTUS	gene	4101612	4102250	0.7	-	.	g859
Scaffold_1	AUGUSTUS	transcript	4101612	4102250	0.7	-	.	g859.t1
Scaffold_1	AUGUSTUS	stop_codon	4101612	4101614	.	-	0	transcript_id "g859.t1"; gene_id "g859";
Scaffold_1	AUGUSTUS	CDS	4101612	4102250	0.7	-	0	transcript_id "g859.t1"; gene_id "g859";
Scaffold_1	AUGUSTUS	start_codon	4102248	4102250	.	-	0	transcript_id "g859.t1"; gene_id "g859";
# protein sequence = [MEDLSNLSRSSRIESGRSTSTSFFAGSTRWMAPELVLALVEDENHEDERDARDVGKAEPGIERGRPRVTTASDVYAFA
# SVCLEVRLFLSTSLVRSNVISAQIVTGDLPYPHRKNDYSVTVDILRGVSPARGSDLSTALKRMFDTTPDNDGSTLNYSPNPSSRAAADNDEEALRSVL
# ESCWDGQSFMRPNMEEVLVRLNGIGISEILTPLRLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g859
###
# start gene g860
Scaffold_1	AUGUSTUS	gene	4102952	4104031	0.37	-	.	g860
Scaffold_1	AUGUSTUS	transcript	4102952	4104031	0.37	-	.	g860.t1
Scaffold_1	AUGUSTUS	stop_codon	4102952	4102954	.	-	0	transcript_id "g860.t1"; gene_id "g860";
Scaffold_1	AUGUSTUS	CDS	4102952	4104031	0.37	-	0	transcript_id "g860.t1"; gene_id "g860";
Scaffold_1	AUGUSTUS	start_codon	4104029	4104031	.	-	0	transcript_id "g860.t1"; gene_id "g860";
# protein sequence = [MEPMDFQVSTSAIPGAKGKTVLSVYSPLIHQVRFQTVLEAFCRFFEGAIWDMKPLCSSTFSDGDHPDSPFSPSSLIPS
# YAFKSSDRHSVRKDTCLDVLNKHCWQYSREAEVCLGISVEADCEFILPECCFGILDESFGGGIKNPSRSIGFFPILPKLALYVLRDEDGCRDDVRAKG
# PSFIEVGSELGLDIYLRNAMVLCSIPHVQRSSEIFIPHHDLKTPILELDQFTWTTVDSTDSDTATTPTTIAEHLATQLDALSAMEDFQRLADKDMPEL
# SGPKLFFSSLSSIVRSISSYDEFRCRWMFDNFIDYSRLKQRCRHKFGMESVKKMWTLRQNIVLSDLTDEVGTVLLFTIIVLLMIN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g860
###
# start gene g861
Scaffold_1	AUGUSTUS	gene	4105531	4106082	0.67	+	.	g861
Scaffold_1	AUGUSTUS	transcript	4105531	4106082	0.67	+	.	g861.t1
Scaffold_1	AUGUSTUS	start_codon	4105531	4105533	.	+	0	transcript_id "g861.t1"; gene_id "g861";
Scaffold_1	AUGUSTUS	CDS	4105531	4106082	0.67	+	0	transcript_id "g861.t1"; gene_id "g861";
Scaffold_1	AUGUSTUS	stop_codon	4106080	4106082	.	+	0	transcript_id "g861.t1"; gene_id "g861";
# protein sequence = [MSKGSLSNSLVMLCVDFAAHAQERQISYAPAHFASKSVSLRYNPYSHLPITISCLASEELAIGNVKFTTYDLEDICKV
# SRARMSYSQCFLLNSLSARRLWRDYFPEVDAIVFLVDSADFERFPESKAELDALLAIEELSKVPFLILGNKIDAQGAVSEEELRHHLGLWQTTGKVRD
# HPGLFCV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g861
###
# start gene g862
Scaffold_1	AUGUSTUS	gene	4108506	4109025	0.43	-	.	g862
Scaffold_1	AUGUSTUS	transcript	4108506	4109025	0.43	-	.	g862.t1
Scaffold_1	AUGUSTUS	stop_codon	4108506	4108508	.	-	0	transcript_id "g862.t1"; gene_id "g862";
Scaffold_1	AUGUSTUS	CDS	4108506	4108937	0.43	-	0	transcript_id "g862.t1"; gene_id "g862";
Scaffold_1	AUGUSTUS	CDS	4109023	4109025	0.8	-	0	transcript_id "g862.t1"; gene_id "g862";
Scaffold_1	AUGUSTUS	start_codon	4109023	4109025	.	-	0	transcript_id "g862.t1"; gene_id "g862";
# protein sequence = [MAGYRHVYISRKFAQENGFIPDDAAPGLYGYSGLVNIGTWPISLTPSTVPSSLPDAPPAHASISSKRPKQTKDNSKGP
# KPTLMTVYLSEEPHFDVVLGRSFIERRQIRLTSVDPTDVVCLDTGEKIECELVILKDGRGEIVTVT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g862
###
# start gene g863
Scaffold_1	AUGUSTUS	gene	4116660	4117187	0.86	-	.	g863
Scaffold_1	AUGUSTUS	transcript	4116660	4117187	0.86	-	.	g863.t1
Scaffold_1	AUGUSTUS	stop_codon	4116660	4116662	.	-	0	transcript_id "g863.t1"; gene_id "g863";
Scaffold_1	AUGUSTUS	CDS	4116660	4117187	0.86	-	0	transcript_id "g863.t1"; gene_id "g863";
Scaffold_1	AUGUSTUS	start_codon	4117185	4117187	.	-	0	transcript_id "g863.t1"; gene_id "g863";
# protein sequence = [MRSVKPFAETKIGSFSGGPVDCCRLLEFDEVGPFVDEHHFNRHLRGPLEGPSISPAVLSSQQRQHELCATHNDLFPRN
# IMVDDQLNIVAIVDWKSAGWFPVHWEYCMCRNWTYNEVDQDWKKWVSEFLDPWIEEETADRDLLRTYPNFMVYWSTRVNPDSKDGYELYKYLRSSPK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g863
###
# start gene g864
Scaffold_1	AUGUSTUS	gene	4118265	4119093	0.37	+	.	g864
Scaffold_1	AUGUSTUS	transcript	4118265	4119093	0.37	+	.	g864.t1
Scaffold_1	AUGUSTUS	start_codon	4118265	4118267	.	+	0	transcript_id "g864.t1"; gene_id "g864";
Scaffold_1	AUGUSTUS	CDS	4118265	4118297	0.41	+	0	transcript_id "g864.t1"; gene_id "g864";
Scaffold_1	AUGUSTUS	CDS	4118392	4119093	0.88	+	0	transcript_id "g864.t1"; gene_id "g864";
Scaffold_1	AUGUSTUS	stop_codon	4119091	4119093	.	+	0	transcript_id "g864.t1"; gene_id "g864";
# protein sequence = [MGQNQYSPMLQATTFQGLSSAPSSLPQMGASLPNSHPVSGASQPIPTPPSSASQPAQILPSPQLSQQPQVQVPPGTQS
# QTPSASAPYLQAQPLPPSSSQHLIASSSLHQTPASQSNLGSSNMRQPSSFPASIQQNIEPQPLFPYIQSAEPMQMYRNSQTSPEGPSLPPPPPSCRPY
# TSMQASTGATDGYGQLVGLQGHSRVTTAPGFPGLTAIQRTNHTRLDHASQSLPQNPRREGCSPTCPCP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g864
###
# start gene g865
Scaffold_1	AUGUSTUS	gene	4135298	4135651	0.73	-	.	g865
Scaffold_1	AUGUSTUS	transcript	4135298	4135651	0.73	-	.	g865.t1
Scaffold_1	AUGUSTUS	stop_codon	4135298	4135300	.	-	0	transcript_id "g865.t1"; gene_id "g865";
Scaffold_1	AUGUSTUS	CDS	4135298	4135651	0.73	-	0	transcript_id "g865.t1"; gene_id "g865";
Scaffold_1	AUGUSTUS	start_codon	4135649	4135651	.	-	0	transcript_id "g865.t1"; gene_id "g865";
# protein sequence = [MNLWLNIPSLTNLKLRIQAIVVVARPRRITAGQTPVDFSVEIVDAGGGQFETYRMCYSDGTEESLKDILKNHLGWNIG
# TFKVATKDFEDAENLPQLYDWNPQTISNYADIPPAAPGK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g865
###
# start gene g866
Scaffold_1	AUGUSTUS	gene	4141636	4142802	0.86	+	.	g866
Scaffold_1	AUGUSTUS	transcript	4141636	4142802	0.86	+	.	g866.t1
Scaffold_1	AUGUSTUS	start_codon	4141636	4141638	.	+	0	transcript_id "g866.t1"; gene_id "g866";
Scaffold_1	AUGUSTUS	CDS	4141636	4142802	0.86	+	0	transcript_id "g866.t1"; gene_id "g866";
Scaffold_1	AUGUSTUS	stop_codon	4142800	4142802	.	+	0	transcript_id "g866.t1"; gene_id "g866";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g866
###
# start gene g867
Scaffold_1	AUGUSTUS	gene	4142853	4144808	0.89	+	.	g867
Scaffold_1	AUGUSTUS	transcript	4142853	4144808	0.89	+	.	g867.t1
Scaffold_1	AUGUSTUS	start_codon	4142853	4142855	.	+	0	transcript_id "g867.t1"; gene_id "g867";
Scaffold_1	AUGUSTUS	CDS	4142853	4144808	0.89	+	0	transcript_id "g867.t1"; gene_id "g867";
Scaffold_1	AUGUSTUS	stop_codon	4144806	4144808	.	+	0	transcript_id "g867.t1"; gene_id "g867";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE
# LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS
# ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL
# VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSKRSRGTPTN
# GTGSINRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT
# DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPANGTTKSTIEKCLLSLKH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g867
###
# start gene g868
Scaffold_1	AUGUSTUS	gene	4159361	4159702	0.67	+	.	g868
Scaffold_1	AUGUSTUS	transcript	4159361	4159702	0.67	+	.	g868.t1
Scaffold_1	AUGUSTUS	start_codon	4159361	4159363	.	+	0	transcript_id "g868.t1"; gene_id "g868";
Scaffold_1	AUGUSTUS	CDS	4159361	4159702	0.67	+	0	transcript_id "g868.t1"; gene_id "g868";
Scaffold_1	AUGUSTUS	stop_codon	4159700	4159702	.	+	0	transcript_id "g868.t1"; gene_id "g868";
# protein sequence = [MSLTFKLNDGAQIPWLGFGTGTALFNKDSTEAVKVAIQNGVTHLDGAQLYRNEESLGQGIKDSGVPREKALCYDEIGG
# NPFSAYHKSYFKRVVEETWFGLCRSVFDTFACLWP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g868
###
# start gene g869
Scaffold_1	AUGUSTUS	gene	4161914	4164803	0.08	-	.	g869
Scaffold_1	AUGUSTUS	transcript	4161914	4164803	0.08	-	.	g869.t1
Scaffold_1	AUGUSTUS	stop_codon	4161914	4161916	.	-	0	transcript_id "g869.t1"; gene_id "g869";
Scaffold_1	AUGUSTUS	CDS	4161914	4163510	0.84	-	1	transcript_id "g869.t1"; gene_id "g869";
Scaffold_1	AUGUSTUS	CDS	4163606	4163741	0.13	-	2	transcript_id "g869.t1"; gene_id "g869";
Scaffold_1	AUGUSTUS	CDS	4163951	4164803	0.16	-	0	transcript_id "g869.t1"; gene_id "g869";
Scaffold_1	AUGUSTUS	start_codon	4164801	4164803	.	-	0	transcript_id "g869.t1"; gene_id "g869";
# protein sequence = [MSSSSARSGSSDDRDTTRDTMNSSTSSGNRNRDTVSSVGTNRPSFISSGRSDEVSITRGPQAPPRSPTSPSPLSAQKF
# PTSPQPPISPRTPEPRTMSSLSPLSSSFNPATTSTMIASMTTSSSAPSTLTGPLPRPSFLSSTSMPGMNANIRGSGAPMNRGPPVPNAPMSPRLPNSL
# LPGRIPFASGSGSIVGPPRTTYSPAPSLNGPPLSPPLPIPASRVHSMSPSIHQPEPDTKIGGEAGMAGVGRRGFAAAARAALFTSNMGGEGPRGMLGG
# PFLDIAAAVRNLTFSVPVQFFLLSFFRTVFVFCMSSTSQAISFDSAMLDKTLPRWYNLDTPLTTNSSSPHSPGPVSPVTPFSTSPTSVYPLQASAMDK
# GMGADGSFFDKFRDRIPGLGIDSESSSPTDDIPTAKIGVGGGSVTPRAGPSRQNSNASEASTSSSVLSLGLAYSASNASSESKNPRRRTRRSSANSPG
# DEDGTLRAVNMAWLMQMIRITKTKKEHDTQSRLSVQSGLSRRTIRKSRDGATPTPGQRSDSLVKARQRPVSGSLYSDDDDDDNDLKNRLRLQSSPPSK
# TNLIRVNSNASVSSVSSTSSTSSAAAIAKALGLSRSSVERDPEGYSMGRLVMGGPGAPGVARTPSGSKSINETRRNRSATVSSMRSFRSDGLGRARSG
# TEGSVVGSKGDLEQAMKDLMNNMTTGSPPQPVRIGLRDDGPSPVIPPFFDSPPSTRGSKLAHRSNTVGITTPYTSAADAAKLLPKLPARSKTERGSKA
# LHASAQQHYATPSIASSSDETGKRKVRICMKCDKRIDDGRWISIENPGGESPGGVGTGGKSERGEKGERKRRSVLCESCWKNMYLPKVSFITCLALF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g869
###
# start gene g870
Scaffold_1	AUGUSTUS	gene	4166853	4167188	0.93	-	.	g870
Scaffold_1	AUGUSTUS	transcript	4166853	4167188	0.93	-	.	g870.t1
Scaffold_1	AUGUSTUS	stop_codon	4166853	4166855	.	-	0	transcript_id "g870.t1"; gene_id "g870";
Scaffold_1	AUGUSTUS	CDS	4166853	4167188	0.93	-	0	transcript_id "g870.t1"; gene_id "g870";
Scaffold_1	AUGUSTUS	start_codon	4167186	4167188	.	-	0	transcript_id "g870.t1"; gene_id "g870";
# protein sequence = [MENRTCFAAFKMLPIDPTRVRRGSSYGSTIEYSQAADELTGAANCKEAVDLVVDVIRRACEDVGSAATESRSGADQFV
# VEEDVVGLADAQKMTSMYAKMEYGVKRLLWLGG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g870
###
# start gene g871
Scaffold_1	AUGUSTUS	gene	4170023	4171165	0.32	-	.	g871
Scaffold_1	AUGUSTUS	transcript	4170023	4171165	0.32	-	.	g871.t1
Scaffold_1	AUGUSTUS	stop_codon	4170023	4170025	.	-	0	transcript_id "g871.t1"; gene_id "g871";
Scaffold_1	AUGUSTUS	CDS	4170023	4170531	0.74	-	2	transcript_id "g871.t1"; gene_id "g871";
Scaffold_1	AUGUSTUS	CDS	4170841	4171165	0.59	-	0	transcript_id "g871.t1"; gene_id "g871";
Scaffold_1	AUGUSTUS	start_codon	4171163	4171165	.	-	0	transcript_id "g871.t1"; gene_id "g871";
# protein sequence = [MKRLFSKSGAKPPAKSLSTSTSVPVTAKTTAPHTTGLQPKDIVPPVPHPYPYDSIALLVSEDGLLLRPNLSEPDAALG
# CVRVAWGKGGQIEELSGGSGKVYDWKESDNQNGLSRPTLQSTITIDTISSSAENGPTDHDELVASTASFPRVQFSEPEINRDKAFAESGLNSAQSSIH
# SPSDSTSELSLSGSSTPSVADPQNPSAPIAKILASRLSFWSRLSKRGSLFPTSPDQDNLPTIEKKVPKPLTLSLHAMNEEEDPEEVIEGILSATRAST
# RNC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g871
###
# start gene g872
Scaffold_1	AUGUSTUS	gene	4175818	4176760	0.83	+	.	g872
Scaffold_1	AUGUSTUS	transcript	4175818	4176760	0.83	+	.	g872.t1
Scaffold_1	AUGUSTUS	start_codon	4175818	4175820	.	+	0	transcript_id "g872.t1"; gene_id "g872";
Scaffold_1	AUGUSTUS	CDS	4175818	4175838	0.91	+	0	transcript_id "g872.t1"; gene_id "g872";
Scaffold_1	AUGUSTUS	CDS	4176263	4176760	0.94	+	0	transcript_id "g872.t1"; gene_id "g872";
Scaffold_1	AUGUSTUS	stop_codon	4176758	4176760	.	+	0	transcript_id "g872.t1"; gene_id "g872";
# protein sequence = [MPFLTLLNFENPRVAQSETIVLTSDPTRTASLTRHTSRVTETQTSSPDTRTLKSKRFLEEVAHGLSNAAGSIQNTTDH
# FEDVKHKYTQPFADAGAAMHNATSDVKEGFENLGDGVKNGTENLTNGVKNSVEGAAGKMKNGTESVVNGVEDGAKGALAGGKAGWNNAGPDSSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g872
###
# start gene g873
Scaffold_1	AUGUSTUS	gene	4179170	4181326	0.52	+	.	g873
Scaffold_1	AUGUSTUS	transcript	4179170	4181326	0.52	+	.	g873.t1
Scaffold_1	AUGUSTUS	start_codon	4179170	4179172	.	+	0	transcript_id "g873.t1"; gene_id "g873";
Scaffold_1	AUGUSTUS	CDS	4179170	4181326	0.52	+	0	transcript_id "g873.t1"; gene_id "g873";
Scaffold_1	AUGUSTUS	stop_codon	4181324	4181326	.	+	0	transcript_id "g873.t1"; gene_id "g873";
# protein sequence = [MERRIRVYKRRQAKAAGNSQEPSGDTTEEEEPEPNALRTLKRKVTPVAESRTQVKRLKKEEVHSSLLANNGFVRVSQL
# VRRRPAVAGDKGEGPSRIAGPSTMQPKPQPIINKPKTPTILQKPKASPRPQKKVAPEEQIMVYPNLPASDDYSGQQFEAKVDLKTPTIPQKPHASPHR
# SQKKVVPEEQIMIHPDLPASDDYSGQLFEGGSDAEMQLDPEAGQEDDNDDMEVNHILTDPVEPDSDKTNAYASTFFPHTLILIPSTFYSTHSYLTPRS
# KKQLTAGTSTSDRNRVPRGSSDGMTTTADSGFFESTTPPPPFPRYITNPSNNIFDGFSDTDSPPRPLKARPVPKLIEGPFGGARHKHPVRRIVFSSPE
# SDSIKTPVKGAWPPVRGTKRKLPITPEVNITAPLSSSKSGHVPSSSRPSGSSKFSPPLPSTRSPLIQLSQKGEEHQLVAEDENQPSGSNPRVSEQSAR
# QDDELQEEEVEEEKEPLFTQRIPSRDTDSHEEEEEEEPLFTQRIPFREVVNHEEEEEEPLFTQRIPFREADGHEEEEEEPLFTQRIPSREADSQEEEE
# EEEPLFTQRIPSREADSQEEEEEEPLFTQRIPSREVDSHEEDEEEEPLFTQRIPSREVDSHEEDEEEEPLFTQRIPSREADSQEEEEEEEPLFTQRIP
# SRKADTQEEQEEEEPLFTQRMPREGENDSQEEEGDGSEEEREGKYLKLMTQT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g873
###
# start gene g874
Scaffold_1	AUGUSTUS	gene	4181584	4182899	0.5	+	.	g874
Scaffold_1	AUGUSTUS	transcript	4181584	4182899	0.5	+	.	g874.t1
Scaffold_1	AUGUSTUS	start_codon	4181584	4181586	.	+	0	transcript_id "g874.t1"; gene_id "g874";
Scaffold_1	AUGUSTUS	CDS	4181584	4181927	0.51	+	0	transcript_id "g874.t1"; gene_id "g874";
Scaffold_1	AUGUSTUS	CDS	4182047	4182899	0.83	+	1	transcript_id "g874.t1"; gene_id "g874";
Scaffold_1	AUGUSTUS	stop_codon	4182897	4182899	.	+	0	transcript_id "g874.t1"; gene_id "g874";
# protein sequence = [MPDIQHPQSHPSVPLAIGTPQSDRSDDIARPSVSNETAESVVRALNAFILEMDRSRKTIERDRLTRAERAKKEAERMA
# TQDLTSSEQSLNGAGSQFLRFRERRSKRVSSAPGGLRSAKKNLGKLAANEFPVQIARPSAQSEPTASGSGLKLAIRNADIDPNVVRDSANSHSSSFRD
# PGQSTSRNKGKNRVIEEIEVKSSNHRDSTPSTVSTVRSKQIDLRQLERAQSRRRSSLPTAGRNTSGPVSGFSASSPAAPTISITPTTGRPFLSASFSN
# SRRVAHSPPPHSPLKLSSSDQSRLIDQTIQDMAEEYQFPPDYVRRVWKETGDLNEAAAILRKLRDMAGTLLRKASARRSSGFGAASDNERSRGVPPES
# IPATDINTYSRDRFRSPNRFHHPDSR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g874
###
# start gene g875
Scaffold_1	AUGUSTUS	gene	4185569	4186318	0.41	-	.	g875
Scaffold_1	AUGUSTUS	transcript	4185569	4186318	0.41	-	.	g875.t1
Scaffold_1	AUGUSTUS	stop_codon	4185569	4185571	.	-	0	transcript_id "g875.t1"; gene_id "g875";
Scaffold_1	AUGUSTUS	CDS	4185569	4186318	0.41	-	0	transcript_id "g875.t1"; gene_id "g875";
Scaffold_1	AUGUSTUS	start_codon	4186316	4186318	.	-	0	transcript_id "g875.t1"; gene_id "g875";
# protein sequence = [MALLYEAIQTPVMPLEAPVLNPTGGVKGRQQAVLDYKPDPTRPGTGVFVAHGQIDSDPPMATAVPTSTQSTTSAGPIV
# NFTPLTGAAIGSGVSNVNPAMNVQAGTNDRIINTLDTPATVENLAEFAVTDTGFLEGMPNLMFDWGKYCSFVAKVNSNDTDFGRFVLFTHQVNGIASS
# LDLMAPQMGQCRPSHRPRLNNMTAFFPIMLSSVSSKKNPTSSWCINICMLIRYSRSVFHFENVVFGLQNFTFT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g875
###
# start gene g876
Scaffold_1	AUGUSTUS	gene	4187256	4187957	0.21	-	.	g876
Scaffold_1	AUGUSTUS	transcript	4187256	4187957	0.21	-	.	g876.t1
Scaffold_1	AUGUSTUS	stop_codon	4187256	4187258	.	-	0	transcript_id "g876.t1"; gene_id "g876";
Scaffold_1	AUGUSTUS	CDS	4187256	4187957	0.21	-	0	transcript_id "g876.t1"; gene_id "g876";
Scaffold_1	AUGUSTUS	start_codon	4187955	4187957	.	-	0	transcript_id "g876.t1"; gene_id "g876";
# protein sequence = [MAGVTSPTHLLHSQATISSRVYQGYDARYNHTFEVSKTGDGLISVQKPSNEEQQTKPVEYRVERNLIEQLINAYFTDV
# APLLPVVTQVEFLAHSSPPPILLYSMCLVAAARRDVPQQVFDSIRYTVNSIIKAEDVLSTASIVNVQALLILCMTGDCHSPFVPTALSALWIRLGTAI
# RMVIVLIQPTRVVSYGNFKAQDLGLHRCESVQQNVELRRRLWGACLISDRWYLFFSY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g876
###
# start gene g877
Scaffold_1	AUGUSTUS	gene	4188411	4189150	0.59	-	.	g877
Scaffold_1	AUGUSTUS	transcript	4188411	4189150	0.59	-	.	g877.t1
Scaffold_1	AUGUSTUS	stop_codon	4188411	4188413	.	-	0	transcript_id "g877.t1"; gene_id "g877";
Scaffold_1	AUGUSTUS	CDS	4188411	4188892	0.59	-	2	transcript_id "g877.t1"; gene_id "g877";
Scaffold_1	AUGUSTUS	CDS	4188979	4189150	0.74	-	0	transcript_id "g877.t1"; gene_id "g877";
Scaffold_1	AUGUSTUS	start_codon	4189148	4189150	.	-	0	transcript_id "g877.t1"; gene_id "g877";
# protein sequence = [MQTNTKSGSETPPGNKSKSTSSPPLLPSVPPAAPPQNPKPSSSTKKSRQRKPSADVQHPPPQPAVAQGPVLQPYPGPP
# YYMNHPYPINGPPYQQPQHPGYPPPPQSTSTPGAPPPPHYAYPMAASPHPYYTYQYPPPQPMMVYGAPPPPQPPPAEIAQANSPPPQTPTTSSSGAKR
# KRKSAKEKAASDDEAASGQDGSRTQGQSQIDPKKRTKTVSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g877
###
# start gene g878
Scaffold_1	AUGUSTUS	gene	4191516	4192855	0.62	-	.	g878
Scaffold_1	AUGUSTUS	transcript	4191516	4192855	0.62	-	.	g878.t1
Scaffold_1	AUGUSTUS	stop_codon	4191516	4191518	.	-	0	transcript_id "g878.t1"; gene_id "g878";
Scaffold_1	AUGUSTUS	CDS	4191516	4191644	0.86	-	0	transcript_id "g878.t1"; gene_id "g878";
Scaffold_1	AUGUSTUS	CDS	4191701	4192855	0.62	-	0	transcript_id "g878.t1"; gene_id "g878";
Scaffold_1	AUGUSTUS	start_codon	4192853	4192855	.	-	0	transcript_id "g878.t1"; gene_id "g878";
# protein sequence = [MSTPSSANSQSVTPNPSIIPASAVKLRSPGSPLSSTFPVSTFTSPQTHPMHTGSTHAGGVQPSASFFHPSRPHYSPPD
# SPSSSHMHAREDKDVFQLSELKRLSDSTADHSDFVGGDTSDLSMQEQQIMKGVKQSREPLLPFGEGPPVAIRTSMAKDRSDTSYTVKPQLPHSRIGLR
# TSLDLVFNLRRGLSIDSHKSASTPSPAAQSHRRQVHSVSSEGGFGSIGDKRKLHDEERGYPTTHFASLRRQHSIASSHDPSSFATTSKFPQSAPIPTG
# YKPTGSKNGQSSDEKTQFLFAVPMYTPHGKIIRKWQLHPSRNKFFLNGRMLTGGDSPWAFIASFSVLCAIAGIWFGTTCRWWWLQEGAGGKVLVCVAG
# YLTLIVITSMLKTAFTDPGILPRNLDPDPPYPSTSPSDGGVRAPMPRDLKVRADM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g878
###
# start gene g879
Scaffold_1	AUGUSTUS	gene	4198992	4199714	0.97	+	.	g879
Scaffold_1	AUGUSTUS	transcript	4198992	4199714	0.97	+	.	g879.t1
Scaffold_1	AUGUSTUS	start_codon	4198992	4198994	.	+	0	transcript_id "g879.t1"; gene_id "g879";
Scaffold_1	AUGUSTUS	CDS	4198992	4198997	0.97	+	0	transcript_id "g879.t1"; gene_id "g879";
Scaffold_1	AUGUSTUS	CDS	4199049	4199714	0.98	+	0	transcript_id "g879.t1"; gene_id "g879";
Scaffold_1	AUGUSTUS	stop_codon	4199712	4199714	.	+	0	transcript_id "g879.t1"; gene_id "g879";
# protein sequence = [MDIWEANSISAAVTPHPCTVTEQTSCTGTTCSSPNSTAGVCDQAGCDFNSYRLGDTTFYGPGMTVDTTKPFTVVTQFI
# SSNNETTGTLSAIRRLYVQNGVVIQNSETNIPGITTTNEIDATFCEQQKTAFGDTDTFDSKGGLSGMGDALSAGVVLVLSLWDDYAVNMLWLDSTYPT
# DGTTAGDFRGTCPTTSGVPATVEAASPNAQVIYSNIKFGAIGSTFST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g879
###
# start gene g880
Scaffold_1	AUGUSTUS	gene	4204642	4205514	0.5	-	.	g880
Scaffold_1	AUGUSTUS	transcript	4204642	4205514	0.5	-	.	g880.t1
Scaffold_1	AUGUSTUS	stop_codon	4204642	4204644	.	-	0	transcript_id "g880.t1"; gene_id "g880";
Scaffold_1	AUGUSTUS	CDS	4204642	4205514	0.5	-	0	transcript_id "g880.t1"; gene_id "g880";
Scaffold_1	AUGUSTUS	start_codon	4205512	4205514	.	-	0	transcript_id "g880.t1"; gene_id "g880";
# protein sequence = [MDKISEIMVTNQSAQVQELCRSVLLQFLLDYPQGKGRLRNQMTFFTKNLSYEYESGRKSVLELLGAIVTKFQTGLIQE
# FSDLLFVALVMTIANDDSSKCREMAAHLINALFVRLDERKRSEMMSHLHTWCSQHNQPPLVRVTAQVYGLVVDALQNEIVPFIPTILKNLRSSLEHSA
# AQLENFDDDSMAVDLEWQLPYHSLTTLAKLAKVFPELILQSKDVDWSSIANHLLFPHSWVRTASSRLLGTFFSSATIQTPSASDLNAPFSPLSSEGMK
# TVAQKLCQQLKSEHLG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g880
###
# start gene g881
Scaffold_1	AUGUSTUS	gene	4206972	4208917	0.23	-	.	g881
Scaffold_1	AUGUSTUS	transcript	4206972	4208917	0.23	-	.	g881.t1
Scaffold_1	AUGUSTUS	stop_codon	4206972	4206974	.	-	0	transcript_id "g881.t1"; gene_id "g881";
Scaffold_1	AUGUSTUS	CDS	4206972	4206987	0.35	-	1	transcript_id "g881.t1"; gene_id "g881";
Scaffold_1	AUGUSTUS	CDS	4207113	4208917	0.25	-	0	transcript_id "g881.t1"; gene_id "g881";
Scaffold_1	AUGUSTUS	start_codon	4208915	4208917	.	-	0	transcript_id "g881.t1"; gene_id "g881";
# protein sequence = [MLEKKGRSRGADRRSAVLTTLAGCTNDELALLIDLMLRPLTEGQGLKQGAIIQRTSTEALDRQLVGFLTLLGDVLKNL
# GSRITKYWDALLGTTIDIIAKSQSRIDGDDTEAEVEDMEEDDTSLPTTKIIRSIRQLGLKRLADFFRCRVEFDFSPYMKAAFTAFITPRIPLLDRENT
# QAPSALLELFYVWTLDSEQIHFLVEYDRQVIPKIFSCLTATNVKPAVISRIFDIVDRLIAFSADDEEILGNILRPNVSLLLSSLSVLVQQSKNITSIS
# TLLGQRQIGILSQVAQYSSDAEEAITLLKLFSPLLRKPPKVVSEKIKSDLLNILGHQMRLIPDLHDITSEVYQQLYELLSMLFQSLRSRQARINLVSA
# FHDLANLQTSLQDLAQLMDELNAYSTKRIDEPDFERRLAAFAYLNDTFYRSLSISDWLPVLYNMLSFIQDPEELSIRNHASFSMRHFVDLVAAQTSVE
# HDRAFSRVLFPGLKNGLRSKKEMVRAEVVAVIAYAVEKCENNISLQDMRILLANGDEEANFFNNIHHVQLHRRSRALRRLADQCDEQPLRNSTLTEIL
# IPLISNYIVETASLDHHLVNDSINTTGRLAKHLSKRFT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g881
###
# start gene g882
Scaffold_1	AUGUSTUS	gene	4218443	4218847	0.69	+	.	g882
Scaffold_1	AUGUSTUS	transcript	4218443	4218847	0.69	+	.	g882.t1
Scaffold_1	AUGUSTUS	start_codon	4218443	4218445	.	+	0	transcript_id "g882.t1"; gene_id "g882";
Scaffold_1	AUGUSTUS	CDS	4218443	4218847	0.69	+	0	transcript_id "g882.t1"; gene_id "g882";
Scaffold_1	AUGUSTUS	stop_codon	4218845	4218847	.	+	0	transcript_id "g882.t1"; gene_id "g882";
# protein sequence = [MLLFFLQGVKPLHPKASFNFVELLKQTLAATAAAVASEGAKEEVLVAVQSSEAFEEATLGPPVIPASSTSPALQLGVP
# EVADTPTPSSSANNPRKRKAKSASKRSKKRKLEKEALKEPELPKQHVLKYYRTALR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g882
###
# start gene g883
Scaffold_1	AUGUSTUS	gene	4228083	4230109	0.16	-	.	g883
Scaffold_1	AUGUSTUS	transcript	4228083	4230109	0.16	-	.	g883.t1
Scaffold_1	AUGUSTUS	stop_codon	4228083	4228085	.	-	0	transcript_id "g883.t1"; gene_id "g883";
Scaffold_1	AUGUSTUS	CDS	4228083	4229003	0.37	-	0	transcript_id "g883.t1"; gene_id "g883";
Scaffold_1	AUGUSTUS	CDS	4229057	4230109	0.25	-	0	transcript_id "g883.t1"; gene_id "g883";
Scaffold_1	AUGUSTUS	start_codon	4230107	4230109	.	-	0	transcript_id "g883.t1"; gene_id "g883";
# protein sequence = [MSEGIFAGGKISKEGVTADPAKLTAIVEWKQPADALNLASFVGLTGHFRDLIRNYARIEGPLRNLLKSVPLPQNYTKS
# TYRRAMESFRLEGKWTLDHTKAFCLKQALVSEPVLKAPRWDGSSFVVTTDGCKEGFAAVVAQRFEVVHPNGTTTYKMHPVGFASKRTSASEQNYKPFL
# LEFAALKFGLDKFSDMIWGFPVEIETDCQALRDVIADDKLNAAHCRWRDGVLAHHIVDVRHIPGKLNVVADGLSRMWEGQDRVVGDGSEWSVSEDWEA
# VTGLVNDVFGVSVGDRVLQDGDATDWKALSDRFVHEPVFTEVVEALRVLESPASDKVKQKAKHKAARYMVENNRLWKKEAIVLAKAQHGEAGHWGRDA
# VKLALMDRIWSPKLDESIMEAIVSCPECKNFGSTHLHALLNPITRRHPFELLVGDYLSMSKGKGGYKTIGLYLDTYSQRVWAFKFKVAGSGTTTSGSL
# TSLFNGYLPPETFMTDNGTHFANKEVEALCARWGTKQHFTPAYSPWVNGLVEGSNKILLHVLKRLCAPKLGEDSAEFTAMTWDTLPDQWPEHLDEAVR
# IINNRILPSVKFSPNELLLGAVVNTRRTPVAEAASVLPRESVAVQAAYVDQQQLDGYNAFVNHAVKRKRVFDRRVLKKEGERSCSKRVI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g883
###
# start gene g884
Scaffold_1	AUGUSTUS	gene	4232240	4233709	0.47	-	.	g884
Scaffold_1	AUGUSTUS	transcript	4232240	4233709	0.47	-	.	g884.t1
Scaffold_1	AUGUSTUS	stop_codon	4232240	4232242	.	-	0	transcript_id "g884.t1"; gene_id "g884";
Scaffold_1	AUGUSTUS	CDS	4232240	4233709	0.47	-	0	transcript_id "g884.t1"; gene_id "g884";
Scaffold_1	AUGUSTUS	start_codon	4233707	4233709	.	-	0	transcript_id "g884.t1"; gene_id "g884";
# protein sequence = [MATQQPLTRFSGDPDDPIQPATFLQDFEVRMTELMTPRADLASRIKPYLERDSRAWDWYTEDLTATERTGPWEAFETK
# FHARFPSQKKEKKSAKSYLTSLEGERITHEQIMTTSEDTNQPYHQWWADRLLRLAKGAEIEKTKQSIGAVWKKLPYALKKTVDEEHDNWADFTSAIKA
# VKWGVLKVEAEHEASRKVPTDSGTPRTKLAGDFAAARISSPPSPSPMRARPAYAGNIGGRKPRRVFTSLNEARKEVLRRGIAAKVQPNTPEGFAAWKA
# ELLEWASRHGVDGALSELTIVPLKPGTEAVCSGECFRCGGTRRIRSSLPQARSHTTGRIGLEGILPERIGRKGSKSQRSARFGAGSHFRRHGRVGKWG
# RVSVLSGEQLTPGTMSVVNNVQSVLEESNIIDVYSVHNGNSHISSPFAMDISLRDFEGEQVQVEAMVDDGAMVAAMDSAVYDKLKNAIGGWEPTQRKF
# RMANGVWCQGRHVGRAVSR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g884
###
# start gene g885
Scaffold_1	AUGUSTUS	gene	4238182	4238388	0.58	-	.	g885
Scaffold_1	AUGUSTUS	transcript	4238182	4238388	0.58	-	.	g885.t1
Scaffold_1	AUGUSTUS	stop_codon	4238182	4238184	.	-	0	transcript_id "g885.t1"; gene_id "g885";
Scaffold_1	AUGUSTUS	CDS	4238182	4238388	0.58	-	0	transcript_id "g885.t1"; gene_id "g885";
Scaffold_1	AUGUSTUS	start_codon	4238386	4238388	.	-	0	transcript_id "g885.t1"; gene_id "g885";
# protein sequence = [MFGGNRDDDEEDEGDEEDENGLGGGGGGTWDWEGSSVPGGWSHSLHGGHAARKKKNTDERRGEACSLV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g885
###
# start gene g886
Scaffold_1	AUGUSTUS	gene	4241806	4243178	0.09	-	.	g886
Scaffold_1	AUGUSTUS	transcript	4241806	4243178	0.09	-	.	g886.t1
Scaffold_1	AUGUSTUS	stop_codon	4241806	4241808	.	-	0	transcript_id "g886.t1"; gene_id "g886";
Scaffold_1	AUGUSTUS	CDS	4241806	4242333	0.4	-	0	transcript_id "g886.t1"; gene_id "g886";
Scaffold_1	AUGUSTUS	CDS	4242738	4243178	0.26	-	0	transcript_id "g886.t1"; gene_id "g886";
Scaffold_1	AUGUSTUS	start_codon	4243176	4243178	.	-	0	transcript_id "g886.t1"; gene_id "g886";
# protein sequence = [MFQLFTFSASATPAVSSSPSSSAPSTSAIVTSTSVAPSSAEAIASVSSTASTTVSAPASTGTTILDPAAVAQAQVRDD
# TATRAFSAAEIQTSDGQCLSVDANSGDFRENLIPITAQACDGSAGQQWDVITSGVHNNVNSTALIVSTLLFSISASGASVVSSSPATATPSISAIVSS
# ASAAPSSVEIIASASSIASASTTASTIVSAPASTGTTVLDPASVAQAQVRDDTATRAFSAAEIQTSDGQCLSVDATSGDFRENLIPITTQTCDGSAGQ
# QWDVITAGVHNNVPGTALFVSTLVCAKSKHFRTFVTNRRNCCSRFKDV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g886
###
# start gene g887
Scaffold_1	AUGUSTUS	gene	4243557	4244018	0.33	-	.	g887
Scaffold_1	AUGUSTUS	transcript	4243557	4244018	0.33	-	.	g887.t1
Scaffold_1	AUGUSTUS	stop_codon	4243557	4243559	.	-	0	transcript_id "g887.t1"; gene_id "g887";
Scaffold_1	AUGUSTUS	CDS	4243557	4244018	0.33	-	0	transcript_id "g887.t1"; gene_id "g887";
Scaffold_1	AUGUSTUS	start_codon	4244016	4244018	.	-	0	transcript_id "g887.t1"; gene_id "g887";
# protein sequence = [MFQQLFTISASGSQPATASNPSSTATETPSSVASSSSVAVSSGVEAAATSSTASAPASTGTTVLDPAAVAQAQVRDDT
# ATRAFSAAEIQTSDGQCLSVDANSGDFRENLIPITVQACDGSSGQQWDVITSGVHNNVNGTALIVSTLVRIARII]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g887
###
# start gene g888
Scaffold_1	AUGUSTUS	gene	4248554	4249301	0.27	+	.	g888
Scaffold_1	AUGUSTUS	transcript	4248554	4249301	0.27	+	.	g888.t1
Scaffold_1	AUGUSTUS	start_codon	4248554	4248556	.	+	0	transcript_id "g888.t1"; gene_id "g888";
Scaffold_1	AUGUSTUS	CDS	4248554	4248615	0.39	+	0	transcript_id "g888.t1"; gene_id "g888";
Scaffold_1	AUGUSTUS	CDS	4248659	4249301	0.39	+	1	transcript_id "g888.t1"; gene_id "g888";
Scaffold_1	AUGUSTUS	stop_codon	4249299	4249301	.	+	0	transcript_id "g888.t1"; gene_id "g888";
# protein sequence = [MIKHFERIPPLYTEDGKLVDLKPNTANDPNGFYSSDFYVDNLIKYLSERPTDKPFFAFLPFAAPHWPLQVDKLYRDRY
# KGVYNDGPEALRLRRLARLKDLGLIAQDVIPHEVVAPPETEWSTLTDEERELSARAMETFAGMVEKMDENIGKLLKYLERIGEADNTFIIFQSDNGAE
# GASYEAAPTMGNSIMDVVNRFYDNSIENIGEHNSFVWYGPRWAQAATGTDRLFLRASC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g888
###
# start gene g889
Scaffold_1	AUGUSTUS	gene	4249435	4249944	0.6	+	.	g889
Scaffold_1	AUGUSTUS	transcript	4249435	4249944	0.6	+	.	g889.t1
Scaffold_1	AUGUSTUS	start_codon	4249435	4249437	.	+	0	transcript_id "g889.t1"; gene_id "g889";
Scaffold_1	AUGUSTUS	CDS	4249435	4249944	0.6	+	0	transcript_id "g889.t1"; gene_id "g889";
Scaffold_1	AUGUSTUS	stop_codon	4249942	4249944	.	+	0	transcript_id "g889.t1"; gene_id "g889";
# protein sequence = [MDVMPTILDLAGVQHPGKFFRGRDVEEMRGKSWINFFENEKQSENATTEIHSTDDPAVGWELFGRAALRKENWKIVYM
# TPWSYGKGDWELFDLSKDPGETRDLSEKEPAKLKELLELWEKYVEKNGVVWGSPVSEVEVKVPGLERKDVIGGDPLDDTRAWMPHRGHCKD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g889
###
# start gene g890
Scaffold_1	AUGUSTUS	gene	4258019	4258510	0.99	-	.	g890
Scaffold_1	AUGUSTUS	transcript	4258019	4258510	0.99	-	.	g890.t1
Scaffold_1	AUGUSTUS	stop_codon	4258019	4258021	.	-	0	transcript_id "g890.t1"; gene_id "g890";
Scaffold_1	AUGUSTUS	CDS	4258019	4258510	0.99	-	0	transcript_id "g890.t1"; gene_id "g890";
Scaffold_1	AUGUSTUS	start_codon	4258508	4258510	.	-	0	transcript_id "g890.t1"; gene_id "g890";
# protein sequence = [MVRDHPHVVASQPFEYVSSFPGPITANVVQRIKVKEIRSAYNVEQVFSMDIPALQHENDGLIYTCVNTPYSPGTDSNV
# WVIITSCIAFKILTCYIRIKWKPPTENSIDFKLVLRFPPLPSSPTQPDFAAKPKFLLHVWCGDQNGTPRYEQYDEMYVDEDEWEK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g890
###
# start gene g891
Scaffold_1	AUGUSTUS	gene	4274013	4275127	0.93	+	.	g891
Scaffold_1	AUGUSTUS	transcript	4274013	4275127	0.93	+	.	g891.t1
Scaffold_1	AUGUSTUS	start_codon	4274013	4274015	.	+	0	transcript_id "g891.t1"; gene_id "g891";
Scaffold_1	AUGUSTUS	CDS	4274013	4274433	0.93	+	0	transcript_id "g891.t1"; gene_id "g891";
Scaffold_1	AUGUSTUS	CDS	4274493	4275127	1	+	2	transcript_id "g891.t1"; gene_id "g891";
Scaffold_1	AUGUSTUS	stop_codon	4275125	4275127	.	+	0	transcript_id "g891.t1"; gene_id "g891";
# protein sequence = [MKRTIPTTSITPTGWSDLCAASGIHDISITDLCFDLGQDGWEYALSAVADACVQQNIADEMISFAKIPGILNSDDIIS
# YAIAYRQQPREAVSVLGVVPSTLYCMIPPVNPELSNIVNVQPAGVNPGLFGSPSAPVVPFGSDGTCPYGSTPDVSVCACATINGTTGASSVPIPVPAN
# TTNSTLTGANSTLAGSDLTNGTGVNATSTSTSSAATLNGTDTTNSPLTGSGSTGTDSTLTGSDSTNGTDITNSTLTGSDSTNGTDTTNSTLTGSDSTN
# STDSADSSTLTFSSSGATSTGISATVSIDTATASATATLITSTDSTDASITSTASANASTGTSGVTFDGNIHDPAGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g891
###
# start gene g892
Scaffold_1	AUGUSTUS	gene	4275540	4276434	0.82	-	.	g892
Scaffold_1	AUGUSTUS	transcript	4275540	4276434	0.82	-	.	g892.t1
Scaffold_1	AUGUSTUS	stop_codon	4275540	4275542	.	-	0	transcript_id "g892.t1"; gene_id "g892";
Scaffold_1	AUGUSTUS	CDS	4275540	4275914	0.93	-	0	transcript_id "g892.t1"; gene_id "g892";
Scaffold_1	AUGUSTUS	CDS	4275977	4276017	0.85	-	2	transcript_id "g892.t1"; gene_id "g892";
Scaffold_1	AUGUSTUS	CDS	4276107	4276434	0.83	-	0	transcript_id "g892.t1"; gene_id "g892";
Scaffold_1	AUGUSTUS	start_codon	4276432	4276434	.	-	0	transcript_id "g892.t1"; gene_id "g892";
# protein sequence = [MLALKRRFQLGAKHHRHDFDQDLDSDVDEEGNTTLPRRPRHLSSAEVYGVMASHAEWFLAQQLATSHTSHTYVNLKSW
# YNFCLKLEQAKPEKRRLQRETQSWKNGDGVTLPGGWETRIERRCINYEFPDVFDDEGYPGVEQVSEYDDAHGRPIYDSDMSLEDAPAPPDSDSDSDSD
# IDVQWVKTIPRWLMDAPVIHPGQVKWCCPDRDCEYSLDLLELPKSTRFSGPEHDFLRDESYESFIFRPKVL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g892
###
# start gene g893
Scaffold_1	AUGUSTUS	gene	4277874	4279019	1	+	.	g893
Scaffold_1	AUGUSTUS	transcript	4277874	4279019	1	+	.	g893.t1
Scaffold_1	AUGUSTUS	start_codon	4277874	4277876	.	+	0	transcript_id "g893.t1"; gene_id "g893";
Scaffold_1	AUGUSTUS	CDS	4277874	4279019	1	+	0	transcript_id "g893.t1"; gene_id "g893";
Scaffold_1	AUGUSTUS	stop_codon	4279017	4279019	.	+	0	transcript_id "g893.t1"; gene_id "g893";
# protein sequence = [MQQRAGPSSNFGQSNRKGSIGSLASFSSLEPLNTSRLQAFNPNQPKNLPSLESVPSVFFQSDFDLGNPQTFALITDQD
# QFGEGDPTVIAHSVPLLERFSHYADTVELHLSNEIAARAPSFFAALTNLHTLQSESTATLSQISRLRQMLEQVDETVAKKGMEVISLEKRVQGVEEIE
# RSVEGVKDVVKFTGEAREKVGKGMYGDALVILSVLDDMWNDALPTQSSLPKQPSGRLSSLPPTPEGEEADSESPPPGYSTSPVSLTPSTSKIKLLPSL
# GIPLSQLNAFSALPSHLRSLTLEIASSLSDELVSILRDDLLWRIGNGGSIATGSGKETVSEETKNQLTELLVGLIKTRGLKEATLSYREIVFDEFRGL
# TRKVRASYL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g893
###
# start gene g894
Scaffold_1	AUGUSTUS	gene	4279250	4279663	0.52	+	.	g894
Scaffold_1	AUGUSTUS	transcript	4279250	4279663	0.52	+	.	g894.t1
Scaffold_1	AUGUSTUS	start_codon	4279250	4279252	.	+	0	transcript_id "g894.t1"; gene_id "g894";
Scaffold_1	AUGUSTUS	CDS	4279250	4279663	0.52	+	0	transcript_id "g894.t1"; gene_id "g894";
Scaffold_1	AUGUSTUS	stop_codon	4279661	4279663	.	+	0	transcript_id "g894.t1"; gene_id "g894";
# protein sequence = [MLSGVEGLHVQIALLGEISESIEATERATKAARQGKSIPAPTPLSSESPSSGDSTSVTSLLLAELTDTLSSATELAHT
# QAAQLLSSRSEIHAGLSLPEFVELFNDTWKFVVRSEVVCRRMIVGLRGAVVSQVREIHV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g894
###
# start gene g895
Scaffold_1	AUGUSTUS	gene	4286050	4287439	0.32	+	.	g895
Scaffold_1	AUGUSTUS	transcript	4286050	4287439	0.32	+	.	g895.t1
Scaffold_1	AUGUSTUS	start_codon	4286050	4286052	.	+	0	transcript_id "g895.t1"; gene_id "g895";
Scaffold_1	AUGUSTUS	CDS	4286050	4286099	0.71	+	0	transcript_id "g895.t1"; gene_id "g895";
Scaffold_1	AUGUSTUS	CDS	4286164	4287439	0.52	+	1	transcript_id "g895.t1"; gene_id "g895";
Scaffold_1	AUGUSTUS	stop_codon	4287437	4287439	.	+	0	transcript_id "g895.t1"; gene_id "g895";
# protein sequence = [MFEEICLTCGKHLSDDGRVYCSDECQNIDTASPSISSASSALSSPRFGYAIGGEVPALVSSALGKALRGYHTRDHHSI
# SSSASSTSCSVLTDEEDEDSHFVSGSEGAYQDEYAEGKSKILRPLPGITSTSFLCSTTFWYKQRTRAPHVLGRVPTSASTSGHVYSAPRSAPIHSHSQ
# LSTDDETYSDFGSPSRDELESFTSLTTPDEDQNRSTITKAKRTRNRASLPAYFSLLQVSSDAQPRVSLSVSNSSGHSVTRPSPPTPKLTIAGMPIHPF
# TAPPAAVMQATPRGRRRDLEASRSTRVSSNDSSSSRSRAENPFAPPATASEAFRSQLSSKGSKSSMEKILDWTAVSGLSRGRATIRRNSSPPPKMVLT
# ADTEQFNIVSRGRKADSTSRLRSRGRVMVSELDGVIVNKEAPGFGHGRSGLLHREQAISQRFMSGKPSF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g895
###
# start gene g896
Scaffold_1	AUGUSTUS	gene	4305954	4306550	0.36	-	.	g896
Scaffold_1	AUGUSTUS	transcript	4305954	4306550	0.36	-	.	g896.t1
Scaffold_1	AUGUSTUS	stop_codon	4305954	4305956	.	-	0	transcript_id "g896.t1"; gene_id "g896";
Scaffold_1	AUGUSTUS	CDS	4305954	4306550	0.36	-	0	transcript_id "g896.t1"; gene_id "g896";
Scaffold_1	AUGUSTUS	start_codon	4306548	4306550	.	-	0	transcript_id "g896.t1"; gene_id "g896";
# protein sequence = [MGISGLKMSTVLDFHQQVTTQDRSQQQYGDIWKARGVYPVEKIEDDFAVFSAPLEDGVYPYDREQMLDIIQPLGVPWH
# PLKGDKLFISIVMFIGFCWDIDNQWSLLKSSPVKKHHYLNSNLYTALYVILLSYIPTAVHISLLYQTSWLHTVANAKLYQLFPDTCAPYRNQVVARTS
# QRPSVLLETANVELPARFKHIR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g896
###
# start gene g897
Scaffold_1	AUGUSTUS	gene	4309625	4311415	1	-	.	g897
Scaffold_1	AUGUSTUS	transcript	4309625	4311415	1	-	.	g897.t1
Scaffold_1	AUGUSTUS	stop_codon	4309625	4309627	.	-	0	transcript_id "g897.t1"; gene_id "g897";
Scaffold_1	AUGUSTUS	CDS	4309625	4311415	1	-	0	transcript_id "g897.t1"; gene_id "g897";
Scaffold_1	AUGUSTUS	start_codon	4311413	4311415	.	-	0	transcript_id "g897.t1"; gene_id "g897";
# protein sequence = [MEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHSKPFVPTGRYMEERKEIIDKNHPE
# GFLWEQERNLMHEMMCKQEAGFAWQPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPLNASYCLKWFCVIKKDGK
# SLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYIGYDERELDQLSRDMMTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTECTTQKGP
# RWRAESSLRRQWQNPAVDHCGILIISNPTQPRTPPPPPLTQTSPFCRTVRLTTPDLAVLDAVSGAINWENTRMVNRDHYSGLSTTTPVWSCLTKQPSE
# SASPGTWQLPAVPHHVHTSMFAPYVAVRTTMQKSVIISPLDHFSQSSIYPTLLFHDFSSAVIEQNPLPNMPAHLAHLYNKIVTPYNADAFEQMLSECS
# LTSSHPLLVRNLCLGFRIGVMPPLTETIITPNYPSVSEYPQVVDQYIAEEVAAGRMDGPFTHNEIYLICRGHFRVSPFIVSKSEQGPGIPPKFRVCHN
# LSKDGRDSKEYNAISKLFHQKDIISDNV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g897
###
# start gene g898
Scaffold_1	AUGUSTUS	gene	4319267	4319773	0.96	+	.	g898
Scaffold_1	AUGUSTUS	transcript	4319267	4319773	0.96	+	.	g898.t1
Scaffold_1	AUGUSTUS	start_codon	4319267	4319269	.	+	0	transcript_id "g898.t1"; gene_id "g898";
Scaffold_1	AUGUSTUS	CDS	4319267	4319773	0.96	+	0	transcript_id "g898.t1"; gene_id "g898";
Scaffold_1	AUGUSTUS	stop_codon	4319771	4319773	.	+	0	transcript_id "g898.t1"; gene_id "g898";
# protein sequence = [MYVRSISSIQWFFNNAVDEDEGLYHMILKHSRFDNDSPFLTAAHHAGFIPPPDDSVEPPLHWQMLGLSTALPHSDGVG
# RWDDIVPALPSIDQLTADWEQLMLRYIHHITDTPLSGTDTQDPMSSVEPATESLAEVLVERSPEAPVALESTSSVGPPPTSLCSCPSRSR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g898
###
# start gene g899
Scaffold_1	AUGUSTUS	gene	4320229	4320717	0.41	-	.	g899
Scaffold_1	AUGUSTUS	transcript	4320229	4320717	0.41	-	.	g899.t1
Scaffold_1	AUGUSTUS	stop_codon	4320229	4320231	.	-	0	transcript_id "g899.t1"; gene_id "g899";
Scaffold_1	AUGUSTUS	CDS	4320229	4320717	0.41	-	0	transcript_id "g899.t1"; gene_id "g899";
Scaffold_1	AUGUSTUS	start_codon	4320715	4320717	.	-	0	transcript_id "g899.t1"; gene_id "g899";
# protein sequence = [MENVRTRRPMKKLDHKWMGPYSILSKVGSHAYQLDLPGDLHKIHNVFHVDRLKPHFHDKFKQQTSPPPPIFIKGETEH
# FVEDILDSKPKKGRPDEVEYLVKWEGYSEEFNSWVGWEGMAGSLRLLRNWHKKHPKKRQPSQRHWACLEKDAQEDEEDKREDMR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g899
###
# start gene g900
Scaffold_1	AUGUSTUS	gene	4321928	4322515	0.28	-	.	g900
Scaffold_1	AUGUSTUS	transcript	4321928	4322515	0.28	-	.	g900.t1
Scaffold_1	AUGUSTUS	stop_codon	4321928	4321930	.	-	0	transcript_id "g900.t1"; gene_id "g900";
Scaffold_1	AUGUSTUS	CDS	4321928	4322515	0.28	-	0	transcript_id "g900.t1"; gene_id "g900";
Scaffold_1	AUGUSTUS	start_codon	4322513	4322515	.	-	0	transcript_id "g900.t1"; gene_id "g900";
# protein sequence = [MDPEKVKAVMDWPKPRMVKELQAFLGFANFYRRFIDNYSGITKVFMKLLWKDSVWNWTPQCSSAFELLKSAFSEAPVL
# GHYNPELPVVLECDASNLAIAGILSQLDPEMGEIHPIAFHARSMIATELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFSTTKQMT
# ARQARWAELLSGYDFIINY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g900
###
# start gene g901
Scaffold_1	AUGUSTUS	gene	4323495	4324424	0.69	-	.	g901
Scaffold_1	AUGUSTUS	transcript	4323495	4324424	0.69	-	.	g901.t1
Scaffold_1	AUGUSTUS	stop_codon	4323495	4323497	.	-	0	transcript_id "g901.t1"; gene_id "g901";
Scaffold_1	AUGUSTUS	CDS	4323495	4324424	0.69	-	0	transcript_id "g901.t1"; gene_id "g901";
Scaffold_1	AUGUSTUS	start_codon	4324422	4324424	.	-	0	transcript_id "g901.t1"; gene_id "g901";
# protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE
# LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQQPPEAPQPPPEVPQQPPEAPLRAPRTRVKLEEVKDEEYEASQPG
# HTQVIPLGQRSRARRPNPYGDQRMASVRERKHGRRGGGNPRGWAIRHGESNPETTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDL
# PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRESSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g901
###
# start gene g902
Scaffold_1	AUGUSTUS	gene	4332232	4332438	0.5	-	.	g902
Scaffold_1	AUGUSTUS	transcript	4332232	4332438	0.5	-	.	g902.t1
Scaffold_1	AUGUSTUS	stop_codon	4332232	4332234	.	-	0	transcript_id "g902.t1"; gene_id "g902";
Scaffold_1	AUGUSTUS	CDS	4332232	4332438	0.5	-	0	transcript_id "g902.t1"; gene_id "g902";
Scaffold_1	AUGUSTUS	start_codon	4332436	4332438	.	-	0	transcript_id "g902.t1"; gene_id "g902";
# protein sequence = [MDGGKKLQYLVQWKGYDEGHDTWENEENVVGSSDEAINEFYAAHPNAPRKISANDLSLTTMAANGQLH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g902
###
# start gene g903
Scaffold_1	AUGUSTUS	gene	4342683	4343033	0.41	-	.	g903
Scaffold_1	AUGUSTUS	transcript	4342683	4343033	0.41	-	.	g903.t1
Scaffold_1	AUGUSTUS	stop_codon	4342683	4342685	.	-	0	transcript_id "g903.t1"; gene_id "g903";
Scaffold_1	AUGUSTUS	CDS	4342683	4343033	0.41	-	0	transcript_id "g903.t1"; gene_id "g903";
Scaffold_1	AUGUSTUS	start_codon	4343031	4343033	.	-	0	transcript_id "g903.t1"; gene_id "g903";
# protein sequence = [MQSVGKLNYEKLFPDDGPPEDYYARATYKDVATAHFMAKAKELPWATPRMAHVYATSEGHIGQVVSLFDNFTHHLGQL
# GTPRRPGPKQLTPEIIEQYQKAIGLDISPRWYYMYDQA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g903
###
# start gene g904
Scaffold_1	AUGUSTUS	gene	4350194	4351240	0.76	+	.	g904
Scaffold_1	AUGUSTUS	transcript	4350194	4351240	0.76	+	.	g904.t1
Scaffold_1	AUGUSTUS	start_codon	4350194	4350196	.	+	0	transcript_id "g904.t1"; gene_id "g904";
Scaffold_1	AUGUSTUS	CDS	4350194	4351240	0.76	+	0	transcript_id "g904.t1"; gene_id "g904";
Scaffold_1	AUGUSTUS	stop_codon	4351238	4351240	.	+	0	transcript_id "g904.t1"; gene_id "g904";
# protein sequence = [MIHCFPTTTELTAEGVADFYYKEIFRLHGLPRRFISDRGPQFAADIMKALLKRLGIESALTTSYHPETNGQTERANQE
# IERYIRMYVSRRQDDWDRLLPTAEFVINSRVHFAHDKAPFEVLYGYTPEFSIPIGSWKEYPSITDRLDALRHAREDAEAALRMSKQRIADTIAEHPNQ
# PSFEVGQPVWLSVNNLKIRRKSEKLGSRRLGPFEVIEKTGAHTYRLALPTWMKIHDNINVKRLAPWKGNEVNGILPAPPEPEVIDGEEFYDVDRILDS
# RIHGRWKKLQYLVRWKGYDEGHDTWENEENVVGSSDEAINEFYAAHPNAPRKISATIFHSLPWQPMVNFTEVNN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g904
###
# start gene g905
Scaffold_1	AUGUSTUS	gene	4353969	4354301	0.57	+	.	g905
Scaffold_1	AUGUSTUS	transcript	4353969	4354301	0.57	+	.	g905.t1
Scaffold_1	AUGUSTUS	start_codon	4353969	4353971	.	+	0	transcript_id "g905.t1"; gene_id "g905";
Scaffold_1	AUGUSTUS	CDS	4353969	4354301	0.57	+	0	transcript_id "g905.t1"; gene_id "g905";
Scaffold_1	AUGUSTUS	stop_codon	4354299	4354301	.	+	0	transcript_id "g905.t1"; gene_id "g905";
# protein sequence = [MHGPRLSGAKREWHKTVTFHEICKVVEFSRDEDESGEVFESDEDDNYGNAAEEDVDFFGEGKNEETPHDSYEDIELSD
# QEPEVQLELDADTSITVLDHVHRGTVPRPQGV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g905
###
# start gene g906
Scaffold_1	AUGUSTUS	gene	4354885	4356663	0.67	-	.	g906
Scaffold_1	AUGUSTUS	transcript	4354885	4356663	0.67	-	.	g906.t1
Scaffold_1	AUGUSTUS	stop_codon	4354885	4354887	.	-	0	transcript_id "g906.t1"; gene_id "g906";
Scaffold_1	AUGUSTUS	CDS	4354885	4356663	0.67	-	0	transcript_id "g906.t1"; gene_id "g906";
Scaffold_1	AUGUSTUS	start_codon	4356661	4356663	.	-	0	transcript_id "g906.t1"; gene_id "g906";
# protein sequence = [MDASYVKGMINNPDMHPNAAMNRWIAAIQLFDFELKHVPGKDFVGPDGLSRRRQTEDEGDEEEGEADTWVEEILSCGI
# WVASAWQGGSNAGGVLEYRDSDGAISLTVSAEDSWTEILIPHSKEVARRDNDLKLIKAYLSTFTTPRNLSEKQLKQFTKRASRFFLRGDQLWRREHSG
# RHQIVIIPPSERLSLLRQTHDDLGHKGFFSTRRTIADRFWWPSLDDDLRWFLRTCHACQVRSTEKVVIPPSISTPATLFRRVHIDTMYMPKVQGYQFI
# IQGRCSLSRWPEWRMLKSETGRTVGQFIFEEILCRWGGLEEITTDNGPAMVAALDWLGKKYKIHHIRIAAYNSQANGIVEVSHRYIRDGLVKACGGDI
# RKWVSVAPYIFWADRITTRRDTGYSPYYIAHGVEPLLPFDITQATFLLPEIIRKLSDDDLIALRAQQLQRREEDLARIHERVIQSRFRSIEAFRKHHK
# NVIRDYKFNPGDLVLVLNKRIEKGVSKKALPRYFGPMVVAKRTEGGNYRLAEVTGAISKLRYAAFRIIPYYARSSKRLDVTEFLDPRALAGIEDDGDD
# DREEADEDSRDSIKHRLRPRTVDS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g906
###
# start gene g907
Scaffold_1	AUGUSTUS	gene	4356702	4356950	0.62	-	.	g907
Scaffold_1	AUGUSTUS	transcript	4356702	4356950	0.62	-	.	g907.t1
Scaffold_1	AUGUSTUS	stop_codon	4356702	4356704	.	-	0	transcript_id "g907.t1"; gene_id "g907";
Scaffold_1	AUGUSTUS	CDS	4356702	4356950	0.62	-	0	transcript_id "g907.t1"; gene_id "g907";
Scaffold_1	AUGUSTUS	start_codon	4356948	4356950	.	-	0	transcript_id "g907.t1"; gene_id "g907";
# protein sequence = [MDKVKDAISTSDALITIDYTSLLPVILAVDSSILGCESLSPNTTRRIDVDHPDSGPSLGTNVNPGTPKQKSNFMASSV
# PSTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g907
###
# start gene g908
Scaffold_1	AUGUSTUS	gene	4358391	4359191	0.83	-	.	g908
Scaffold_1	AUGUSTUS	transcript	4358391	4359191	0.83	-	.	g908.t1
Scaffold_1	AUGUSTUS	stop_codon	4358391	4358393	.	-	0	transcript_id "g908.t1"; gene_id "g908";
Scaffold_1	AUGUSTUS	CDS	4358391	4359191	0.83	-	0	transcript_id "g908.t1"; gene_id "g908";
Scaffold_1	AUGUSTUS	start_codon	4359189	4359191	.	-	0	transcript_id "g908.t1"; gene_id "g908";
# protein sequence = [MIHQEEQTSNHVQVIEEEQVLEGNEGEEVIWGAVIELERLQEEEAIGLAVTRGNNEGATKHEEQTKPHTTPRTQPAFN
# YESKAVDPQAANRMFKRILAVVVPDVTVNDLVSLSSDLRKELIEHTRTQRAPRDKVPPPSSSLLTKSLQLDYSTPLREIPVTLAGKKVEVGLLDEGSE
# IVVVRKDLWEEIGFKVNPMVKMLMQTANGGKEEMEGCAEFLEVVVDGLRTWVHAFVVPRAPYKLLLGRPWQKSEAGKRRAFRWASGCDNS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g908
###
# start gene g909
Scaffold_1	AUGUSTUS	gene	4359249	4360544	0.94	-	.	g909
Scaffold_1	AUGUSTUS	transcript	4359249	4360544	0.94	-	.	g909.t1
Scaffold_1	AUGUSTUS	stop_codon	4359249	4359251	.	-	0	transcript_id "g909.t1"; gene_id "g909";
Scaffold_1	AUGUSTUS	CDS	4359249	4360544	0.94	-	0	transcript_id "g909.t1"; gene_id "g909";
Scaffold_1	AUGUSTUS	start_codon	4360542	4360544	.	-	0	transcript_id "g909.t1"; gene_id "g909";
# protein sequence = [MSTTRATTKGPAAMPAPGSSKAPTKFTGEAQDLKDFIEEFEDCADAQELTSEEKVKMVAKYVDRETKRYWKTLDAYAK
# KDWGALKKELLKAYPGAEKGHRFSVLGLRRLAQKQARKRIASENDLVKYYQHFQVMSAALKADNKLTDNEVNRYFWFGIHQDDRRDILTQLENQDRAF
# DRKTVPHMQKAVEAGRVVFCDEAMDLDWDDPIAEIVSKDTKRKKKIGRERREVISSEEDESSDSDNESDDEEEDRPKKKTVRQEVQTKVVARSNLDDI
# EELAKKLRGLDVGDVNYAGTYARLVVLSPAVASAILSLPPQPMSTSAAASALPIQPYPRPNQGPGPATYPNNVPLPQNNYRQRNPQWNDRPPTALPRD
# IQCHFCKENHLIRLSTCSGVYSTTEDHPHWKMVLLPGWAPKCALHDQGRRGGRDQGNHR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g909
###
# start gene g910
Scaffold_1	AUGUSTUS	gene	4362740	4363763	0.35	+	.	g910
Scaffold_1	AUGUSTUS	transcript	4362740	4363763	0.35	+	.	g910.t1
Scaffold_1	AUGUSTUS	start_codon	4362740	4362742	.	+	0	transcript_id "g910.t1"; gene_id "g910";
Scaffold_1	AUGUSTUS	CDS	4362740	4362917	0.35	+	0	transcript_id "g910.t1"; gene_id "g910";
Scaffold_1	AUGUSTUS	CDS	4362994	4363763	0.93	+	2	transcript_id "g910.t1"; gene_id "g910";
Scaffold_1	AUGUSTUS	stop_codon	4363761	4363763	.	+	0	transcript_id "g910.t1"; gene_id "g910";
# protein sequence = [MENSAEMATIETAEKQKVVAVGVIQEHEPAETEASMEVTHDVTIDFEVKGEELQEQAEPTGDEVDSGMDDNDDADDDN
# NGEEFGLLKTPAFTNSKKLKFDLGSKFGLGKLGLLDLELSSEDLTTPSTSKRSDLGFGFNASSSELPPKSVQNMPVGSVNVRMAMRNALDCLMDDVAS
# VGGSTVEELHEVSMTTTEEDAPGSHLMQRAATDYALVGSLGPPPGSSVHSAMPSRNASSSSITPPPPPKDNICAREAIIIEKRQKMRRMEEGDDNDDD
# GPLDNYGNKDDVDFFSEGKDEETTHDPHEDAEPPAKNRENS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g910
###
# start gene g911
Scaffold_1	AUGUSTUS	gene	4367047	4367499	0.41	-	.	g911
Scaffold_1	AUGUSTUS	transcript	4367047	4367499	0.41	-	.	g911.t1
Scaffold_1	AUGUSTUS	stop_codon	4367047	4367049	.	-	0	transcript_id "g911.t1"; gene_id "g911";
Scaffold_1	AUGUSTUS	CDS	4367047	4367499	0.41	-	0	transcript_id "g911.t1"; gene_id "g911";
Scaffold_1	AUGUSTUS	start_codon	4367497	4367499	.	-	0	transcript_id "g911.t1"; gene_id "g911";
# protein sequence = [MCSLSMGENDVTMADAENLAGVIAVPCSSSTQAETANIVSRTEVSTVHPPAVKDITTIKIAHGQVLNFNRADVHDPRQ
# ISFATNIPRLERVWDDEGTNWDPADCGTNLLSINGIPIALRYWPEVFSGKKDARWRALKKNWTEWKVSFYFF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g911
###
# start gene g912
Scaffold_1	AUGUSTUS	gene	4381029	4381586	0.58	-	.	g912
Scaffold_1	AUGUSTUS	transcript	4381029	4381586	0.58	-	.	g912.t1
Scaffold_1	AUGUSTUS	stop_codon	4381029	4381031	.	-	0	transcript_id "g912.t1"; gene_id "g912";
Scaffold_1	AUGUSTUS	CDS	4381029	4381586	0.58	-	0	transcript_id "g912.t1"; gene_id "g912";
Scaffold_1	AUGUSTUS	start_codon	4381584	4381586	.	-	0	transcript_id "g912.t1"; gene_id "g912";
# protein sequence = [MIMVFGEITTQAKLDYQKIIRETIKNIGYDDSAKGFDYKTCNILVAIEQQSPDIAQGLDHGSLESHGAGDQGIMFGYA
# TDETEEYMPLTVVLSHKLNRALADARRTGLLPWVLPDTKTQVTIEYKKDGGATIPVRVDTVVISTQHTEDVSLGVLRKEVLEKIVKATIPLTYLMSEL
# STTYVFSRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g912
###
# start gene g913
Scaffold_1	AUGUSTUS	gene	4382195	4384325	0.83	-	.	g913
Scaffold_1	AUGUSTUS	transcript	4382195	4384325	0.83	-	.	g913.t1
Scaffold_1	AUGUSTUS	stop_codon	4382195	4382197	.	-	0	transcript_id "g913.t1"; gene_id "g913";
Scaffold_1	AUGUSTUS	CDS	4382195	4383764	0.97	-	1	transcript_id "g913.t1"; gene_id "g913";
Scaffold_1	AUGUSTUS	CDS	4383883	4384245	0.86	-	1	transcript_id "g913.t1"; gene_id "g913";
Scaffold_1	AUGUSTUS	CDS	4384321	4384325	0.87	-	0	transcript_id "g913.t1"; gene_id "g913";
Scaffold_1	AUGUSTUS	start_codon	4384323	4384325	.	-	0	transcript_id "g913.t1"; gene_id "g913";
# protein sequence = [MLSIQDEKLIETMFQSHFSPESRVSNAVVYGATTTNLVIDARPTTNAMANTAKGAGTENMDHYKEAKKVYLGIDHIHT
# MRESLGKVVDALREADALLASINNDLSGQISGVSVLDRGALRRSGYHHYRNLCLDPFYRTIKGFEILIEKEWLSYGHKFLDRCGHLSSDKFFVSNTET
# NGNSGGADAAQAFLASMQNRFASQNHVKETSPVFHQFLETVRQIQRQFPQRFEFNERFLHQLYYHPIRVSFGTFLFNSERERRLGDGNGPPPCDRTVS
# VWDFFNSPSEMEQNLNELYDSSLDDPVSRIPGADMGVLFPNPKDVRFWHELYGRTDEEMNGRHIPVIVRPEVVGPVETVEDDPVNRIATPSNIPLPPS
# PSKTPLPPPTQTLPRNVANSLLESNDSSPSTPELASLNLGSPSVVESFRPFLSTSSNFSMKPTSSPTSDSSSRPLTKAQEFFAGGGVKSVWGKLSFNA
# SAAFSVVQGAYDGVARDLSTRPGPASPLPSRTEELSARSHLTSWGEEAHTVSVFSPSTLSSSSPPGVRNPWATVNSSKPSASSLFSPYDNPWNSAQAQ
# DLGSEDEPKPPSPLPIDPTVSDPSLRAPANSIARSNSSSSRLAGNFTGIGSDGDSELSTPSQDLSSASTDPLGVGLA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g913
###
# start gene g914
Scaffold_1	AUGUSTUS	gene	4388903	4389367	0.79	+	.	g914
Scaffold_1	AUGUSTUS	transcript	4388903	4389367	0.79	+	.	g914.t1
Scaffold_1	AUGUSTUS	start_codon	4388903	4388905	.	+	0	transcript_id "g914.t1"; gene_id "g914";
Scaffold_1	AUGUSTUS	CDS	4388903	4389367	0.79	+	0	transcript_id "g914.t1"; gene_id "g914";
Scaffold_1	AUGUSTUS	stop_codon	4389365	4389367	.	+	0	transcript_id "g914.t1"; gene_id "g914";
# protein sequence = [MKLSTFFVSSALLFSVAIARPSRLAERVAARESRRSRPFTASTNAAIASSNATHAEFSTNWSGVVIETPPSGQTFSKV
# TGTFVVPTPSGNSGAASAWVGIDGDTASQSILQSGVDFTISGGRVTYDAWFEWSADTFFFLYICSLIILKVPQLRH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g914
###
# start gene g915
Scaffold_1	AUGUSTUS	gene	4390131	4391372	0.59	+	.	g915
Scaffold_1	AUGUSTUS	transcript	4390131	4391372	0.59	+	.	g915.t1
Scaffold_1	AUGUSTUS	start_codon	4390131	4390133	.	+	0	transcript_id "g915.t1"; gene_id "g915";
Scaffold_1	AUGUSTUS	CDS	4390131	4390811	0.74	+	0	transcript_id "g915.t1"; gene_id "g915";
Scaffold_1	AUGUSTUS	CDS	4391133	4391372	0.76	+	0	transcript_id "g915.t1"; gene_id "g915";
Scaffold_1	AUGUSTUS	stop_codon	4391370	4391372	.	+	0	transcript_id "g915.t1"; gene_id "g915";
# protein sequence = [MPIRSQGYQLLPVKNNESEHSRENDDVSGVPSRRLRLGFLILFIVITFYALFLAPEKPSLTESFQNSAHPGLDKCASP
# IAPAAKPPTRTNPWAPLVVSEITDIQRWLEAPQRELNLTRGSSAILSDNVVYLIETYYPAKADALAYLAGGSAPDKYAHVVIHHGGSDAPIIKNYLVG
# PLPVSEQMSMRLLSEIYHESEIPFNARGFVNIEELRDVFKFISPELSEALDIVYNHQIFGSTEEFLQSYGTLIRVPEQVTGANEDFSWTTRKRVGTPR
# DLDHLPGPRSVSFAGLRFTRVTEVLALIGTWD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g915
###
# start gene g916
Scaffold_1	AUGUSTUS	gene	4395273	4396214	0.9	-	.	g916
Scaffold_1	AUGUSTUS	transcript	4395273	4396214	0.9	-	.	g916.t1
Scaffold_1	AUGUSTUS	stop_codon	4395273	4395275	.	-	0	transcript_id "g916.t1"; gene_id "g916";
Scaffold_1	AUGUSTUS	CDS	4395273	4396214	0.9	-	0	transcript_id "g916.t1"; gene_id "g916";
Scaffold_1	AUGUSTUS	start_codon	4396212	4396214	.	-	0	transcript_id "g916.t1"; gene_id "g916";
# protein sequence = [MVYQTSSSVRDLKSRGHSTAFNPRNLEHDWYPVWNEVFIDMKSLLSDVYIYPQYFLWLRNSKDLPLALRKRMLQHLDP
# NEHGVTRELDDADHTLLALQADIDDSDIAPLLASSLLIDGDTSFGSTITVSGSEKDLIPDFSFMHLTSVPLGGYRANSAYATSRADRKILHECHLALC
# EVKGAPSRHFSEPRKSKMRAELFEDAQTDLAMYANLYFVAEGGMRRDKLLLWACVGAFWTWTLVSREEVPAWDWVTGSFASGASPGRFRRRFSRNFEL
# CTPESDQEINYLITHYFQPDQIHEREGNDGDDVMSEEGD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g916
###
# start gene g917
Scaffold_1	AUGUSTUS	gene	4407876	4410229	0.14	-	.	g917
Scaffold_1	AUGUSTUS	transcript	4407876	4410229	0.14	-	.	g917.t1
Scaffold_1	AUGUSTUS	stop_codon	4407876	4407878	.	-	0	transcript_id "g917.t1"; gene_id "g917";
Scaffold_1	AUGUSTUS	CDS	4407876	4408315	0.7	-	2	transcript_id "g917.t1"; gene_id "g917";
Scaffold_1	AUGUSTUS	CDS	4408368	4408652	0.5	-	2	transcript_id "g917.t1"; gene_id "g917";
Scaffold_1	AUGUSTUS	CDS	4408708	4409283	0.34	-	2	transcript_id "g917.t1"; gene_id "g917";
Scaffold_1	AUGUSTUS	CDS	4409548	4410229	0.91	-	0	transcript_id "g917.t1"; gene_id "g917";
Scaffold_1	AUGUSTUS	start_codon	4410227	4410229	.	-	0	transcript_id "g917.t1"; gene_id "g917";
# protein sequence = [MQPKFGRPEEFIWQYISVPPVCIRPSVAQDGGSNEDDLTVKLTEIVFTNAVIKQGLARGVPTPQFMEQWDLLQLSVAM
# YINSELPGVPSQMGLKPIRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPQRVAQILTYPERVTSHNIEALQQAVRNGPEIHPGA
# NFVSRGQNKKFLKFGNRKAIADGLAIGDIVERHIIDGDVALFNRQPSLHKVHIPQTEEARTEALELMNIKHNLVTPRNGEPVIAAIQDFITASYLLSR
# KDQFFDRRQVTQICCYMADANLQIDIPPPTILKPVRLWTGKQIFSVLMRPNRKSKIMVNVESKCHRWEEAKPENYPDRMKLAKDMSPNDGWLVIVNSE
# VMCGVMDKAIVGSGKKKSIFGVIMRDYGPHEAAAAMNRLAKLCARWLANYGFSLGINDVIPGPELSTKKDGLVEEAYAHCQRLITKAKNGELENKPGC
# DQEQTLEAEISSVLSKVREAVGQICMKELSRQNAPLIMATCGSKGSVINVSQMVACVGQQIIAGHRVPNGFQDRSLPHFPKHSKEPPSKGFVRNSFYS
# GLVATEFLFHAISGREGLVDTAVKTAETGYMQRRLMKALEDLTTQYDLSVRNSTGGVVQFRYGDDGLDPACLEGDAQPLDLDRAWQYATVSV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g917
###
# start gene g918
Scaffold_1	AUGUSTUS	gene	4412006	4412445	0.39	+	.	g918
Scaffold_1	AUGUSTUS	transcript	4412006	4412445	0.39	+	.	g918.t1
Scaffold_1	AUGUSTUS	start_codon	4412006	4412008	.	+	0	transcript_id "g918.t1"; gene_id "g918";
Scaffold_1	AUGUSTUS	CDS	4412006	4412221	0.39	+	0	transcript_id "g918.t1"; gene_id "g918";
Scaffold_1	AUGUSTUS	CDS	4412272	4412445	0.41	+	0	transcript_id "g918.t1"; gene_id "g918";
Scaffold_1	AUGUSTUS	stop_codon	4412443	4412445	.	+	0	transcript_id "g918.t1"; gene_id "g918";
# protein sequence = [MILIGIDAEYGPQCFKLDPAGYFVGYHATAAGQKQQEAMNHLEKKWKKLDNGRGADDPIAAGQKLSRAEVIEMAIEAM
# STVHGVDYKPSEIEIGIVSTSPEEDVKTQGSWRTMDESEIEKHLLAYAEKD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g918
###
# start gene g919
Scaffold_1	AUGUSTUS	gene	4413550	4414161	0.67	-	.	g919
Scaffold_1	AUGUSTUS	transcript	4413550	4414161	0.67	-	.	g919.t1
Scaffold_1	AUGUSTUS	stop_codon	4413550	4413552	.	-	0	transcript_id "g919.t1"; gene_id "g919";
Scaffold_1	AUGUSTUS	CDS	4413550	4413653	0.8	-	2	transcript_id "g919.t1"; gene_id "g919";
Scaffold_1	AUGUSTUS	CDS	4413712	4413823	0.75	-	0	transcript_id "g919.t1"; gene_id "g919";
Scaffold_1	AUGUSTUS	CDS	4413880	4414039	0.81	-	1	transcript_id "g919.t1"; gene_id "g919";
Scaffold_1	AUGUSTUS	CDS	4414091	4414161	0.9	-	0	transcript_id "g919.t1"; gene_id "g919";
Scaffold_1	AUGUSTUS	start_codon	4414159	4414161	.	-	0	transcript_id "g919.t1"; gene_id "g919";
# protein sequence = [MSLAESSETRKARLQELKQRKEASQGIIKNRNFDPESRTLKKHTASEDVEMDTVEKNIDGLAQLVIAEDEEKRAEELN
# VFNIAPKRPNWDLKRETDKKLAKLERKTQEAIHTLIRQRLAAQKGESDDIVGAMRAQENAQNEEALSDEE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g919
###
# start gene g920
Scaffold_1	AUGUSTUS	gene	4415766	4416463	0.36	+	.	g920
Scaffold_1	AUGUSTUS	transcript	4415766	4416463	0.36	+	.	g920.t1
Scaffold_1	AUGUSTUS	start_codon	4415766	4415768	.	+	0	transcript_id "g920.t1"; gene_id "g920";
Scaffold_1	AUGUSTUS	CDS	4415766	4415784	0.41	+	0	transcript_id "g920.t1"; gene_id "g920";
Scaffold_1	AUGUSTUS	CDS	4415965	4416107	0.46	+	2	transcript_id "g920.t1"; gene_id "g920";
Scaffold_1	AUGUSTUS	CDS	4416200	4416463	0.48	+	0	transcript_id "g920.t1"; gene_id "g920";
Scaffold_1	AUGUSTUS	stop_codon	4416461	4416463	.	+	0	transcript_id "g920.t1"; gene_id "g920";
# protein sequence = [MKESSEGRQVYAGIFPVDSSDFPKLEESIKRVPSSNCLVTNTHSDLSSLLLLTERLEDEYDANIIITAPTVPYKGKNS
# MTSIIYCKPLIRIPVLYRDGTEKFISNPTEFPDMSDSTTKVSEIQEPIVKASIIVPEGTASLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g920
###
# start gene g921
Scaffold_1	AUGUSTUS	gene	4417507	4417887	0.51	-	.	g921
Scaffold_1	AUGUSTUS	transcript	4417507	4417887	0.51	-	.	g921.t1
Scaffold_1	AUGUSTUS	stop_codon	4417507	4417509	.	-	0	transcript_id "g921.t1"; gene_id "g921";
Scaffold_1	AUGUSTUS	CDS	4417507	4417887	0.51	-	0	transcript_id "g921.t1"; gene_id "g921";
Scaffold_1	AUGUSTUS	start_codon	4417885	4417887	.	-	0	transcript_id "g921.t1"; gene_id "g921";
# protein sequence = [MAASLSSAGISTFLVPDSSIYALMSRVNKVILGAHAILANGGMFATSGSLLAATAARSYSTPVVVCAGQFKLTPLWNL
# YHEYGALDFGDPSAVLGFEEGDLVDKVDVVNPYYDYVRPELLDVFITN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g921
###
# start gene g922
Scaffold_1	AUGUSTUS	gene	4422391	4423288	0.58	+	.	g922
Scaffold_1	AUGUSTUS	transcript	4422391	4423288	0.58	+	.	g922.t1
Scaffold_1	AUGUSTUS	start_codon	4422391	4422393	.	+	0	transcript_id "g922.t1"; gene_id "g922";
Scaffold_1	AUGUSTUS	CDS	4422391	4422393	0.62	+	0	transcript_id "g922.t1"; gene_id "g922";
Scaffold_1	AUGUSTUS	CDS	4422866	4423288	0.7	+	0	transcript_id "g922.t1"; gene_id "g922";
Scaffold_1	AUGUSTUS	stop_codon	4423286	4423288	.	+	0	transcript_id "g922.t1"; gene_id "g922";
# protein sequence = [MGNQKVTEYLSQISHKGEPATSRSPPPPRLSTPTLNVNKDGPPIANTTADPTVLPARFGQFGGQYVPEAIVDCLAELE
# EAHKSAMADPEFWKEFRGLYGYMNRPSELYLAENLTKDAGGANIWLKREDLCEDLLTTTDDSC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g922
###
# start gene g923
Scaffold_1	AUGUSTUS	gene	4424070	4424384	0.78	+	.	g923
Scaffold_1	AUGUSTUS	transcript	4424070	4424384	0.78	+	.	g923.t1
Scaffold_1	AUGUSTUS	start_codon	4424070	4424072	.	+	0	transcript_id "g923.t1"; gene_id "g923";
Scaffold_1	AUGUSTUS	CDS	4424070	4424384	0.78	+	0	transcript_id "g923.t1"; gene_id "g923";
Scaffold_1	AUGUSTUS	stop_codon	4424382	4424384	.	+	0	transcript_id "g923.t1"; gene_id "g923";
# protein sequence = [MQSPAGQIIETHSISAGLDYPGVGPEHSWLKDSGRAEYIVATDEEALRGFRILTQREGIIPGLSYLRRNYIGLNYLCL
# ALESSHAIWGAMQLAKTLPKDAISLW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g923
###
# start gene g924
Scaffold_1	AUGUSTUS	gene	4426179	4427858	0.99	+	.	g924
Scaffold_1	AUGUSTUS	transcript	4426179	4427858	0.99	+	.	g924.t1
Scaffold_1	AUGUSTUS	start_codon	4426179	4426181	.	+	0	transcript_id "g924.t1"; gene_id "g924";
Scaffold_1	AUGUSTUS	CDS	4426179	4427858	0.99	+	0	transcript_id "g924.t1"; gene_id "g924";
Scaffold_1	AUGUSTUS	stop_codon	4427856	4427858	.	+	0	transcript_id "g924.t1"; gene_id "g924";
# protein sequence = [MSRQSTLSSAGTLRRGTPNKTRPESVNEVLEPTETDNTPTVTATKEQIAREYLTSKAAIIGTNALLTKEDVYDTMLRA
# TRLPKKEIDVTLKTVEHGITLLRDIDEKRSQRELLGEIKGAVESLFAKLDIEKQLQHQLTQVRNEFNERLDSIAANINGTEEKIDSIAKKSQPITPEI
# SYADITRTNGKRTMAPTQAMTRQRMRAHVEVKHRQILILNAGNDAGKEIISKNPGEMLEYLNNMLIKMGALNKGTFVSATKLKNTDNLLTEVSSPELA
# DWIHRVEQMIQFTTLSSQALTIADKEYEIILHFVPTTFSADDAFELRRLEDINDLPTCSITRAKWAKAVQRRKEGQRVASLLLYLNNANAANRLLLSG
# AVISNKRVEAEKTVREEKRCYKCQRFGHIAGQCTEEVENICGKCGEHHSTANCSSEKRYCINCKTDEHASLDRECPIFRQKCESLNKCSPTNLLPFFP
# SDEEWTWAEEPDNAPRMGPPPKITFRQDRHQQRQTQLTGWQQSNQLNVNTLPLGGPLRWGSQDPTGSQNEIADISDENQEVYVRNRTLY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g924
###
# start gene g925
Scaffold_1	AUGUSTUS	gene	4428851	4431639	0.72	+	.	g925
Scaffold_1	AUGUSTUS	transcript	4428851	4431639	0.72	+	.	g925.t1
Scaffold_1	AUGUSTUS	start_codon	4428851	4428853	.	+	0	transcript_id "g925.t1"; gene_id "g925";
Scaffold_1	AUGUSTUS	CDS	4428851	4431393	0.73	+	0	transcript_id "g925.t1"; gene_id "g925";
Scaffold_1	AUGUSTUS	CDS	4431474	4431639	0.79	+	1	transcript_id "g925.t1"; gene_id "g925";
Scaffold_1	AUGUSTUS	stop_codon	4431637	4431639	.	+	0	transcript_id "g925.t1"; gene_id "g925";
# protein sequence = [MKKALNRLSAKSYKYRAIPDDDSHRELRELRTQYKALIFKEKEEHWKDFLDNVDTDSIFTAAKYATTPNIDQDTTTVI
# PELKALDENGAVRRIASTNEEKAALLAETFFPSAPRNYSLDRNPCRDQLPNPPPITQQRIIDALQRLKSYKAPGPDGIPNIILKKCAGMLAPYLCEIY
# NAIGYLKAYPKEWLNSTTVVIRKPARKSYSLPKSYRPIALINTLAKGYTSIIAEDITFLATQHNLLPDTQFGGRPCRMTTDGIHMVIDKIKNAWRNKR
# EASMLSLDIEGAFPNAVTQRLLYNLRKRRIPERLVQAVSLSLKGRVTRLKFGDFTSAPISLTNGIGQGDPLSMIAYLFYNADFFDIAFKSRRQGLSVG
# FVDDKNILVEGKSLTGNVEMIESFMNKPGGGFSWATKHNSSFELSKLVLTHFPRPKTKQEAPPPALVLQGTAVTEKTEVRMLGITLDSKLKWNEQAAQ
# AAAKASSIASAFWKLSRPSAGVSLKMMRKLYLTVVIPKMTYGLDVWYTPPHRPEGAKNRRGSLKALRNFTRIQRMVTITTAGAMRSSPMDLLDIHTNL
# LPMDLMLEKICHRAILRIYTLPDENPVVKIAQAAFRQRRVEKMAPPLRLLPRIFGLPSPATVETITSPQRTAQWTSPIETRILKKDDASRSLEEESAT
# YKIFSDGSGYGGMIGAAAVLYKNGQLLTDAVLRYQLGPITEHTTYDAEGVGILLGLQLIDRYVNEPNHLSSLICLDGRSAIEALESRLPKSGQNIIEA
# TLRTAKRMAKANNTEKISTIAWIPGHCGIEGNERADREAKKAAEGNTSAKVDLPAYLRNGNLPATASAIRQHFHKSLKTRWAHRGDATKANKHPIPTA
# NRTCAPKLAPPQDRKGRQPKLPTLRHRREDNHRNGKTLHY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g925
###
# start gene g926
Scaffold_1	AUGUSTUS	gene	4432717	4433874	0.94	+	.	g926
Scaffold_1	AUGUSTUS	transcript	4432717	4433874	0.94	+	.	g926.t1
Scaffold_1	AUGUSTUS	start_codon	4432717	4432719	.	+	0	transcript_id "g926.t1"; gene_id "g926";
Scaffold_1	AUGUSTUS	CDS	4432717	4433874	0.94	+	0	transcript_id "g926.t1"; gene_id "g926";
Scaffold_1	AUGUSTUS	stop_codon	4433872	4433874	.	+	0	transcript_id "g926.t1"; gene_id "g926";
# protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVK
# QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPATPSPANQDFSTQIGQIRELLDRAN
# AMSPPSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g926
###
# start gene g927
Scaffold_1	AUGUSTUS	gene	4437368	4438072	0.41	+	.	g927
Scaffold_1	AUGUSTUS	transcript	4437368	4438072	0.41	+	.	g927.t1
Scaffold_1	AUGUSTUS	start_codon	4437368	4437370	.	+	0	transcript_id "g927.t1"; gene_id "g927";
Scaffold_1	AUGUSTUS	CDS	4437368	4437575	0.56	+	0	transcript_id "g927.t1"; gene_id "g927";
Scaffold_1	AUGUSTUS	CDS	4437636	4438072	0.68	+	2	transcript_id "g927.t1"; gene_id "g927";
Scaffold_1	AUGUSTUS	stop_codon	4438070	4438072	.	+	0	transcript_id "g927.t1"; gene_id "g927";
# protein sequence = [MMRLAPSKELDVFAPLRGKGSPGASKAVSPPKVSDVISPPPVTKAQAVPPRALRRNREIESLKADASSFLASPRSTHS
# KDSDNELLSGFPLVDEAPRASSSAKVSVGRKEPKSKTTVKVVEDPKADHPPLAGMAYKRVRLPPRSRKNTSIASKGKARQIVVTDEDSTSNEVESEDE
# DEDEDTAPPPKRLKTTSSISGKIFILHFLSHFINSIRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g927
###
# start gene g928
Scaffold_1	AUGUSTUS	gene	4438670	4439226	0.36	+	.	g928
Scaffold_1	AUGUSTUS	transcript	4438670	4439226	0.36	+	.	g928.t1
Scaffold_1	AUGUSTUS	start_codon	4438670	4438672	.	+	0	transcript_id "g928.t1"; gene_id "g928";
Scaffold_1	AUGUSTUS	CDS	4438670	4438718	0.36	+	0	transcript_id "g928.t1"; gene_id "g928";
Scaffold_1	AUGUSTUS	CDS	4438781	4439226	0.65	+	2	transcript_id "g928.t1"; gene_id "g928";
Scaffold_1	AUGUSTUS	stop_codon	4439224	4439226	.	+	0	transcript_id "g928.t1"; gene_id "g928";
# protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTARELFLRSILDLQNAGEDPIVVLEALKTAEPNRRAIT
# LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIQSGESTVHIDEHGHLVEASPPPDSATEALEGLKESRGGLRTRGPAVQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g928
###
# start gene g929
Scaffold_1	AUGUSTUS	gene	4441076	4441750	0.89	+	.	g929
Scaffold_1	AUGUSTUS	transcript	4441076	4441750	0.89	+	.	g929.t1
Scaffold_1	AUGUSTUS	start_codon	4441076	4441078	.	+	0	transcript_id "g929.t1"; gene_id "g929";
Scaffold_1	AUGUSTUS	CDS	4441076	4441241	0.89	+	0	transcript_id "g929.t1"; gene_id "g929";
Scaffold_1	AUGUSTUS	CDS	4441323	4441750	1	+	2	transcript_id "g929.t1"; gene_id "g929";
Scaffold_1	AUGUSTUS	stop_codon	4441748	4441750	.	+	0	transcript_id "g929.t1"; gene_id "g929";
# protein sequence = [MFCIHDSFHVVESSRTPYPTGPNKGSNKDEKSAVNEVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPP
# APLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSVSDASFATAQSIPTTGSEDTVVTPTEIAVPVPKTVER
# ATTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g929
###
# start gene g930
Scaffold_1	AUGUSTUS	gene	4442006	4443759	0.32	-	.	g930
Scaffold_1	AUGUSTUS	transcript	4442006	4443759	0.32	-	.	g930.t1
Scaffold_1	AUGUSTUS	stop_codon	4442006	4442008	.	-	0	transcript_id "g930.t1"; gene_id "g930";
Scaffold_1	AUGUSTUS	CDS	4442006	4442299	0.62	-	0	transcript_id "g930.t1"; gene_id "g930";
Scaffold_1	AUGUSTUS	CDS	4442383	4443759	0.45	-	0	transcript_id "g930.t1"; gene_id "g930";
Scaffold_1	AUGUSTUS	start_codon	4443757	4443759	.	-	0	transcript_id "g930.t1"; gene_id "g930";
# protein sequence = [MGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDE
# EFVQNNPYPEAHRSSEGNRLDELIPLIEKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGH
# KGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTL
# GEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGC
# SPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLTTKGGSYIIAE
# MDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDENSVRERINN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g930
###
# start gene g931
Scaffold_1	AUGUSTUS	gene	4445423	4445785	0.99	-	.	g931
Scaffold_1	AUGUSTUS	transcript	4445423	4445785	0.99	-	.	g931.t1
Scaffold_1	AUGUSTUS	stop_codon	4445423	4445425	.	-	0	transcript_id "g931.t1"; gene_id "g931";
Scaffold_1	AUGUSTUS	CDS	4445423	4445785	0.99	-	0	transcript_id "g931.t1"; gene_id "g931";
Scaffold_1	AUGUSTUS	start_codon	4445783	4445785	.	-	0	transcript_id "g931.t1"; gene_id "g931";
# protein sequence = [MVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDE
# TNKQVDNEAIGVEKPINLNTEEVFTKYNQLIKRLPYKGNVTR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g931
###
# start gene g932
Scaffold_1	AUGUSTUS	gene	4445903	4447977	0.96	-	.	g932
Scaffold_1	AUGUSTUS	transcript	4445903	4447977	0.96	-	.	g932.t1
Scaffold_1	AUGUSTUS	stop_codon	4445903	4445905	.	-	0	transcript_id "g932.t1"; gene_id "g932";
Scaffold_1	AUGUSTUS	CDS	4445903	4446711	0.99	-	2	transcript_id "g932.t1"; gene_id "g932";
Scaffold_1	AUGUSTUS	CDS	4446786	4447977	0.97	-	0	transcript_id "g932.t1"; gene_id "g932";
Scaffold_1	AUGUSTUS	start_codon	4447975	4447977	.	-	0	transcript_id "g932.t1"; gene_id "g932";
# protein sequence = [MFESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEE
# DIAKKIFDAKVDLSTEELAALSPAIRKIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVG
# SIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRM
# QDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNE
# PKNVTPDNEKSTGENDSKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQ
# FNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQ
# RSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVNEAIGVEKPINLNTEEVFTKYKPVERRLTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g932
###
# start gene g933
Scaffold_1	AUGUSTUS	gene	4448242	4449638	0.84	-	.	g933
Scaffold_1	AUGUSTUS	transcript	4448242	4449638	0.84	-	.	g933.t1
Scaffold_1	AUGUSTUS	stop_codon	4448242	4448244	.	-	0	transcript_id "g933.t1"; gene_id "g933";
Scaffold_1	AUGUSTUS	CDS	4448242	4449046	0.98	-	1	transcript_id "g933.t1"; gene_id "g933";
Scaffold_1	AUGUSTUS	CDS	4449157	4449638	0.85	-	0	transcript_id "g933.t1"; gene_id "g933";
Scaffold_1	AUGUSTUS	start_codon	4449636	4449638	.	-	0	transcript_id "g933.t1"; gene_id "g933";
# protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL
# VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPLRLTNRGHINLPFAADVPKT
# DRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGP
# SNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANM
# EDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g933
###
# start gene g934
Scaffold_1	AUGUSTUS	gene	4453442	4454896	0.88	-	.	g934
Scaffold_1	AUGUSTUS	transcript	4453442	4454896	0.88	-	.	g934.t1
Scaffold_1	AUGUSTUS	stop_codon	4453442	4453444	.	-	0	transcript_id "g934.t1"; gene_id "g934";
Scaffold_1	AUGUSTUS	CDS	4453442	4454896	0.88	-	0	transcript_id "g934.t1"; gene_id "g934";
Scaffold_1	AUGUSTUS	start_codon	4454894	4454896	.	-	0	transcript_id "g934.t1"; gene_id "g934";
# protein sequence = [MDIEALHQAIILALPKDPSSVVGLELAKDPSSECWSLGSDGLLRLDNRIYVPNHGNLRLQVLRYFHDHPLSGHFGQNR
# TLEAVRRQYTWPKVRDFVCDYVTSCTTCGCNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTFNTITSEQLA
# ELFVIHVFSKHGVPNHVTSDRGFEFVSAFFWALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDNWSHLLPIAEFAYNNAPNASTGI
# TPFFANKGYHPNITVWPEVDMKSDLARDFVINLDELHVFLREEILLAQSRYKEQADRKRISHPEFLIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVI
# SRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNIAKILDSKLDRRYKHCPLCYYIRWAGYEGTDDEFSWVAVDEL
# HADKLVPAFHARYL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g934
###
# start gene g935
Scaffold_1	AUGUSTUS	gene	4455081	4455925	0.34	-	.	g935
Scaffold_1	AUGUSTUS	transcript	4455081	4455925	0.34	-	.	g935.t1
Scaffold_1	AUGUSTUS	stop_codon	4455081	4455083	.	-	0	transcript_id "g935.t1"; gene_id "g935";
Scaffold_1	AUGUSTUS	CDS	4455081	4455546	0.92	-	1	transcript_id "g935.t1"; gene_id "g935";
Scaffold_1	AUGUSTUS	CDS	4455660	4455925	0.34	-	0	transcript_id "g935.t1"; gene_id "g935";
Scaffold_1	AUGUSTUS	start_codon	4455923	4455925	.	-	0	transcript_id "g935.t1"; gene_id "g935";
# protein sequence = [MPFGLMNAPAAFQCFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHQKHVKEVLQWLRKHWLYANPDKCEFNMDTVEYL
# GYILSPDGLTIDIIVPMTRLTRKGAPWIWDNDCQEAFENLKIAFTSAPILAHWEPNCPIIVETDASGYAIAVILSIQTVDGEIHPLAFLSRTLHAAEL
# NYDTHDKELLAICEAFKAWRHYLEGSGDPVDVVTDHKNLEYSTTKILTHQQVRWSEYLHQFNMVICF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g935
###
# start gene g936
Scaffold_1	AUGUSTUS	gene	4457049	4458142	0.34	+	.	g936
Scaffold_1	AUGUSTUS	transcript	4457049	4458142	0.34	+	.	g936.t1
Scaffold_1	AUGUSTUS	start_codon	4457049	4457051	.	+	0	transcript_id "g936.t1"; gene_id "g936";
Scaffold_1	AUGUSTUS	CDS	4457049	4457319	0.42	+	0	transcript_id "g936.t1"; gene_id "g936";
Scaffold_1	AUGUSTUS	CDS	4457421	4457724	0.42	+	2	transcript_id "g936.t1"; gene_id "g936";
Scaffold_1	AUGUSTUS	CDS	4457896	4458142	0.73	+	1	transcript_id "g936.t1"; gene_id "g936";
Scaffold_1	AUGUSTUS	stop_codon	4458140	4458142	.	+	0	transcript_id "g936.t1"; gene_id "g936";
# protein sequence = [MPPKTRAQSRANFEENTFFTTAQSSAPFSESISAIGQPCRRNRSFGPATVPTTLTLPEAMEEEQQFEYSTLYTGDGQP
# VQVLTPCCGQPRESPRDPPLTSIWTLVITMIKTLLSTLTTPGADNNNDNLENDSGDLPHGEPGDPSGPGGPGGPGGPHFPISPDIPTSNMLCWNFSQD
# SRVPLKPLVPFSPPRPGSAKERFVPDILNPDLNSLPAWSSSFKALVKPLQDNFGVYDAQGEAEDSLSNLKMKETENIRKYNIRFNTLAASTNWDSAA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g936
###
# start gene g937
Scaffold_1	AUGUSTUS	gene	4458187	4458615	0.99	+	.	g937
Scaffold_1	AUGUSTUS	transcript	4458187	4458615	0.99	+	.	g937.t1
Scaffold_1	AUGUSTUS	start_codon	4458187	4458189	.	+	0	transcript_id "g937.t1"; gene_id "g937";
Scaffold_1	AUGUSTUS	CDS	4458187	4458615	0.99	+	0	transcript_id "g937.t1"; gene_id "g937";
Scaffold_1	AUGUSTUS	stop_codon	4458613	4458615	.	+	0	transcript_id "g937.t1"; gene_id "g937";
# protein sequence = [MAHLPEPVMLADYRQEVLCIDNCYWKCGETQKREAGKPFIAQNPKKGSSDFKTGSTNQQNNSQPSGSSALFTPKPKPF
# SGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g937
###
# start gene g938
Scaffold_1	AUGUSTUS	gene	4467519	4468637	0.89	+	.	g938
Scaffold_1	AUGUSTUS	transcript	4467519	4468637	0.89	+	.	g938.t1
Scaffold_1	AUGUSTUS	start_codon	4467519	4467521	.	+	0	transcript_id "g938.t1"; gene_id "g938";
Scaffold_1	AUGUSTUS	CDS	4467519	4468637	0.89	+	0	transcript_id "g938.t1"; gene_id "g938";
Scaffold_1	AUGUSTUS	stop_codon	4468635	4468637	.	+	0	transcript_id "g938.t1"; gene_id "g938";
# protein sequence = [MSRPTLWSTADMDDDLADAVDAELSIYAQQGQNPAIYDQLGAQIEQLEPLLAIQQHMAALAAVPDVVKSVSGAEPFDE
# LNSILPQFIVSFHQAILNRDLPSITMFYTTTFPKLTDRFYSRAEWPEPEIIAPLLSSNNATEDQVHIFLVLYRDLYYRHVYSRLQPNIDDRFHSYENS
# CELFNYLLNSPSSANDESDEPAPVDLVLPEQWLWDIIDEFIYQFQVFCSWRSKVKSKTDDELMMLADGTGVWSSYSVLNVLYSLIQKSKINEYIVALK
# EEQGKEILGLRRKWRNPFPPIRLFLSTEPLDTFLSLDFSVCTYSSVTLPLGSKSWIKWGNFSLAAPVSAPKPTNPPSPPFLPFQQLISQLIIMSVFAI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g938
###
# start gene g939
Scaffold_1	AUGUSTUS	gene	4478280	4480549	0.15	+	.	g939
Scaffold_1	AUGUSTUS	transcript	4478280	4480549	0.15	+	.	g939.t1
Scaffold_1	AUGUSTUS	start_codon	4478280	4478282	.	+	0	transcript_id "g939.t1"; gene_id "g939";
Scaffold_1	AUGUSTUS	CDS	4478280	4478429	0.31	+	0	transcript_id "g939.t1"; gene_id "g939";
Scaffold_1	AUGUSTUS	CDS	4478481	4479029	0.38	+	0	transcript_id "g939.t1"; gene_id "g939";
Scaffold_1	AUGUSTUS	CDS	4479125	4480549	0.61	+	0	transcript_id "g939.t1"; gene_id "g939";
Scaffold_1	AUGUSTUS	stop_codon	4480547	4480549	.	+	0	transcript_id "g939.t1"; gene_id "g939";
# protein sequence = [MCAISSHGGRRRFQVLAIVFLMALSSFLLASSKKQTTVDTELDALFQSTAKEFEVSSSTLRSGKLKRKHQDVGSAPSK
# LAIKKAKAKESKSSLKQKKILLPDTGTTKLNNPTKTSNAIVEKSSDGDEEEREESKPDGDDENDSELENAYLSRANGKGNFSASHRAGKHEEQSEGAD
# DDVEEASSGADDDDEGRPPPDHESLTKRQRSKKPPKSIIKYVPPDENQDQRNARTIFSLLKSLQRHILSLILTPSGSSNMTPRIESTRFRSVPFAVPT
# SRLEKEGDQSSTNNSNPKSSTKSRQHDIDRTKSWRRSSGDKDDEDAVKGEKQFLTPAQKKKVAFINQEIHASGSSVNAYIVFAHPTPASASDEVPKRK
# SNLPPLPDVMNPYDAARLAKEYCDGSEFMERTLRVDVVAHTTDLSVAEAGRVLRTGSDVDPKRCVFVGNLDFESKEEDVRTYFEGIISAEKGPRPGEG
# TEEKDVWSDDEGNEKKKGSAKARARSEGWVIRVRIIRDKDTQLGKGFAYVQFADRDCVDEILAAALEPGKLKFAKRKLRVERCKTIPGGSFKVKVKST
# PITSSSRPNNPNHPSNFKTKRSTPSTSLASISIPKGDPTLGAKLAHLSKEDRKSAKAGDADRMARRLAKKKSRMVMAVGGRTGTGGVKLQGKERDRER
# KLRSGGDAHGKKGKGHGAGSGTKNKGKAISTRALEQRNAKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g939
###
# start gene g940
Scaffold_1	AUGUSTUS	gene	4483299	4484198	0.58	-	.	g940
Scaffold_1	AUGUSTUS	transcript	4483299	4484198	0.58	-	.	g940.t1
Scaffold_1	AUGUSTUS	stop_codon	4483299	4483301	.	-	0	transcript_id "g940.t1"; gene_id "g940";
Scaffold_1	AUGUSTUS	CDS	4483299	4484198	0.58	-	0	transcript_id "g940.t1"; gene_id "g940";
Scaffold_1	AUGUSTUS	start_codon	4484196	4484198	.	-	0	transcript_id "g940.t1"; gene_id "g940";
# protein sequence = [MWDPLWNLLALKIKDVNAGKPTVTVGVMSQYRIEKNYGNVRRYKVPDTVVLGLDDTPQKVLLFWAEIKPLDYYDWFTP
# EAYDAARVQIANTVNQVNTQAQYICEEFQIDRTRPFTIYAFIIAGPYWVLVDYTNNSLSPDFFTTAHSRRNGPYIRSQVPVPVAEDAGIEIDVGVEVP
# AEEEDAEDVVTAPGFPYGTEPRCSFKMRRLGDDDRDDDSKGDELGEDNDDELDDLNEDEGDEEEEAKSEGGMFNGEFSLDLPLRRYHINPILLMALRR
# IMGNNHDAFRRRMQNVSWFDCNYGS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g940
###
# start gene g941
Scaffold_1	AUGUSTUS	gene	4487973	4488746	0.71	-	.	g941
Scaffold_1	AUGUSTUS	transcript	4487973	4488746	0.71	-	.	g941.t1
Scaffold_1	AUGUSTUS	stop_codon	4487973	4487975	.	-	0	transcript_id "g941.t1"; gene_id "g941";
Scaffold_1	AUGUSTUS	CDS	4487973	4488746	0.71	-	0	transcript_id "g941.t1"; gene_id "g941";
Scaffold_1	AUGUSTUS	start_codon	4488744	4488746	.	-	0	transcript_id "g941.t1"; gene_id "g941";
# protein sequence = [MNPTIKSLAVPARNKRSRPNSSNDTSDDVGSVASRLKRRKASLAASSDPAPQGNTPTAAPPPVSTSPVIPSVPSNPVD
# RAISSAQPVQRSDGPFNLWGPMPVHMHRVPATRQTASSSAHVAASSNNPSITASGLPRIEESYNLWTAKFPIPFERRRNLSPDPADSSQPATDSNQPN
# VGNLLNAPSSSSVTSSSLPIASSSRPTTTSSQPIASSSQPTASFSQPTERRRPAPLKRANERLMMNSDGTLELMISTPQNA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g941
###
# start gene g942
Scaffold_1	AUGUSTUS	gene	4496500	4497325	0.38	-	.	g942
Scaffold_1	AUGUSTUS	transcript	4496500	4497325	0.38	-	.	g942.t1
Scaffold_1	AUGUSTUS	stop_codon	4496500	4496502	.	-	0	transcript_id "g942.t1"; gene_id "g942";
Scaffold_1	AUGUSTUS	CDS	4496500	4496849	0.46	-	2	transcript_id "g942.t1"; gene_id "g942";
Scaffold_1	AUGUSTUS	CDS	4496902	4497325	0.4	-	0	transcript_id "g942.t1"; gene_id "g942";
Scaffold_1	AUGUSTUS	start_codon	4497323	4497325	.	-	0	transcript_id "g942.t1"; gene_id "g942";
# protein sequence = [MELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPE
# VDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTLDLVLCLTSSSSQTIFADSPGFPRLTAGAGYAESF
# PNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g942
###
# start gene g943
Scaffold_1	AUGUSTUS	gene	4500795	4501882	0.46	-	.	g943
Scaffold_1	AUGUSTUS	transcript	4500795	4501882	0.46	-	.	g943.t1
Scaffold_1	AUGUSTUS	stop_codon	4500795	4500797	.	-	0	transcript_id "g943.t1"; gene_id "g943";
Scaffold_1	AUGUSTUS	CDS	4500795	4501185	0.76	-	1	transcript_id "g943.t1"; gene_id "g943";
Scaffold_1	AUGUSTUS	CDS	4501275	4501726	0.76	-	0	transcript_id "g943.t1"; gene_id "g943";
Scaffold_1	AUGUSTUS	CDS	4501841	4501882	0.65	-	0	transcript_id "g943.t1"; gene_id "g943";
Scaffold_1	AUGUSTUS	start_codon	4501880	4501882	.	-	0	transcript_id "g943.t1"; gene_id "g943";
# protein sequence = [MEENNNSNTAPCTLPAVRETTPTSAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG
# DPSGPGGPGGPGGPGGPGGPGGPRSPSPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTGSAKEWFVPDI
# LDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLAD
# YVKKFFVLTIVIGNARKLEA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g943
###
# start gene g944
Scaffold_1	AUGUSTUS	gene	4502700	4503077	0.6	+	.	g944
Scaffold_1	AUGUSTUS	transcript	4502700	4503077	0.6	+	.	g944.t1
Scaffold_1	AUGUSTUS	start_codon	4502700	4502702	.	+	0	transcript_id "g944.t1"; gene_id "g944";
Scaffold_1	AUGUSTUS	CDS	4502700	4503077	0.6	+	0	transcript_id "g944.t1"; gene_id "g944";
Scaffold_1	AUGUSTUS	stop_codon	4503075	4503077	.	+	0	transcript_id "g944.t1"; gene_id "g944";
# protein sequence = [MFLKLEAKPGTLVQTADCAGTGEGVPGAGGEIEIESGMHEEFAAVGTNGGGGSPRRHARFGVATPYLLKYHLGRLAPI
# LSPPRTLTAQQMALEVFVDGEKEEEEKSLIILWFLLLHMLQVMASPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g944
###
# start gene g945
Scaffold_1	AUGUSTUS	gene	4507657	4510110	0.6	-	.	g945
Scaffold_1	AUGUSTUS	transcript	4507657	4510110	0.6	-	.	g945.t1
Scaffold_1	AUGUSTUS	stop_codon	4507657	4507659	.	-	0	transcript_id "g945.t1"; gene_id "g945";
Scaffold_1	AUGUSTUS	CDS	4507657	4510110	0.6	-	0	transcript_id "g945.t1"; gene_id "g945";
Scaffold_1	AUGUSTUS	start_codon	4510108	4510110	.	-	0	transcript_id "g945.t1"; gene_id "g945";
# protein sequence = [MFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEY
# LGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPT
# RIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYL
# SRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDN
# GLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLIT
# QLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQE
# VEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRK
# AHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEE
# ILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g945
###
# start gene g946
Scaffold_1	AUGUSTUS	gene	4510250	4511371	0.85	-	.	g946
Scaffold_1	AUGUSTUS	transcript	4510250	4511371	0.85	-	.	g946.t1
Scaffold_1	AUGUSTUS	stop_codon	4510250	4510252	.	-	0	transcript_id "g946.t1"; gene_id "g946";
Scaffold_1	AUGUSTUS	CDS	4510250	4511371	0.85	-	0	transcript_id "g946.t1"; gene_id "g946";
Scaffold_1	AUGUSTUS	start_codon	4511369	4511371	.	-	0	transcript_id "g946.t1"; gene_id "g946";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE
# LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS
# ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKGWETPFRTRLPETERVHCEEPIPSPIS
# C]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g946
###
# start gene g947
Scaffold_1	AUGUSTUS	gene	4511422	4512588	0.87	-	.	g947
Scaffold_1	AUGUSTUS	transcript	4511422	4512588	0.87	-	.	g947.t1
Scaffold_1	AUGUSTUS	stop_codon	4511422	4511424	.	-	0	transcript_id "g947.t1"; gene_id "g947";
Scaffold_1	AUGUSTUS	CDS	4511422	4512588	0.87	-	0	transcript_id "g947.t1"; gene_id "g947";
Scaffold_1	AUGUSTUS	start_codon	4512586	4512588	.	-	0	transcript_id "g947.t1"; gene_id "g947";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g947
###
# start gene g948
Scaffold_1	AUGUSTUS	gene	4514581	4514931	0.6	+	.	g948
Scaffold_1	AUGUSTUS	transcript	4514581	4514931	0.6	+	.	g948.t1
Scaffold_1	AUGUSTUS	start_codon	4514581	4514583	.	+	0	transcript_id "g948.t1"; gene_id "g948";
Scaffold_1	AUGUSTUS	CDS	4514581	4514931	0.6	+	0	transcript_id "g948.t1"; gene_id "g948";
Scaffold_1	AUGUSTUS	stop_codon	4514929	4514931	.	+	0	transcript_id "g948.t1"; gene_id "g948";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLQMPPFRRKLGGVSEGI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g948
###
# start gene g949
Scaffold_1	AUGUSTUS	gene	4515787	4517262	0.66	+	.	g949
Scaffold_1	AUGUSTUS	transcript	4515787	4517262	0.66	+	.	g949.t1
Scaffold_1	AUGUSTUS	start_codon	4515787	4515789	.	+	0	transcript_id "g949.t1"; gene_id "g949";
Scaffold_1	AUGUSTUS	CDS	4515787	4517262	0.66	+	0	transcript_id "g949.t1"; gene_id "g949";
Scaffold_1	AUGUSTUS	stop_codon	4517260	4517262	.	+	0	transcript_id "g949.t1"; gene_id "g949";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE
# LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS
# ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL
# VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM
# VREVLTRLEKHDLYLRPKMRI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g949
###
# start gene g950
Scaffold_1	AUGUSTUS	gene	4518843	4519373	0.6	+	.	g950
Scaffold_1	AUGUSTUS	transcript	4518843	4519373	0.6	+	.	g950.t1
Scaffold_1	AUGUSTUS	start_codon	4518843	4518845	.	+	0	transcript_id "g950.t1"; gene_id "g950";
Scaffold_1	AUGUSTUS	CDS	4518843	4519373	0.6	+	0	transcript_id "g950.t1"; gene_id "g950";
Scaffold_1	AUGUSTUS	stop_codon	4519371	4519373	.	+	0	transcript_id "g950.t1"; gene_id "g950";
# protein sequence = [MSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAED
# INLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g950
###
# start gene g951
Scaffold_1	AUGUSTUS	gene	4520347	4521792	0.06	-	.	g951
Scaffold_1	AUGUSTUS	transcript	4520347	4521792	0.06	-	.	g951.t1
Scaffold_1	AUGUSTUS	stop_codon	4520347	4520349	.	-	0	transcript_id "g951.t1"; gene_id "g951";
Scaffold_1	AUGUSTUS	CDS	4520347	4520540	0.58	-	2	transcript_id "g951.t1"; gene_id "g951";
Scaffold_1	AUGUSTUS	CDS	4520620	4520769	0.94	-	2	transcript_id "g951.t1"; gene_id "g951";
Scaffold_1	AUGUSTUS	CDS	4520849	4520984	0.72	-	0	transcript_id "g951.t1"; gene_id "g951";
Scaffold_1	AUGUSTUS	CDS	4521625	4521792	0.86	-	0	transcript_id "g951.t1"; gene_id "g951";
Scaffold_1	AUGUSTUS	start_codon	4521790	4521792	.	-	0	transcript_id "g951.t1"; gene_id "g951";
# protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKDEKS
# AVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNKPDSGSDSSASDASFATAQSIPTTGSE
# DTVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g951
###
# start gene g952
Scaffold_1	AUGUSTUS	gene	4522779	4523437	0.59	-	.	g952
Scaffold_1	AUGUSTUS	transcript	4522779	4523437	0.59	-	.	g952.t1
Scaffold_1	AUGUSTUS	stop_codon	4522779	4522781	.	-	0	transcript_id "g952.t1"; gene_id "g952";
Scaffold_1	AUGUSTUS	CDS	4522779	4523326	1	-	2	transcript_id "g952.t1"; gene_id "g952";
Scaffold_1	AUGUSTUS	CDS	4523389	4523437	0.59	-	0	transcript_id "g952.t1"; gene_id "g952";
Scaffold_1	AUGUSTUS	start_codon	4523435	4523437	.	-	0	transcript_id "g952.t1"; gene_id "g952";
# protein sequence = [MDALNALHTASSSSTHNLANSLRRAADLNDQLKQLGSLFDTTKELFLRSILDLQNAGTDPIVVLKALKAAEPNRRAIN
# LNEWTLLATLFRWPSPFNLSGLDFDNRTPGEWIKLLRSIHSGESTASIDEHSHLVESSPPPDSAAEALEGLNDVEKGSADEDTSSQVGGSVPMELDLP
# TIKSLAERTLSPEKGAEPAQTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g952
###
# start gene g953
Scaffold_1	AUGUSTUS	gene	4524037	4524414	0.46	-	.	g953
Scaffold_1	AUGUSTUS	transcript	4524037	4524414	0.46	-	.	g953.t1
Scaffold_1	AUGUSTUS	stop_codon	4524037	4524039	.	-	0	transcript_id "g953.t1"; gene_id "g953";
Scaffold_1	AUGUSTUS	CDS	4524037	4524414	0.46	-	0	transcript_id "g953.t1"; gene_id "g953";
Scaffold_1	AUGUSTUS	start_codon	4524412	4524414	.	-	0	transcript_id "g953.t1"; gene_id "g953";
# protein sequence = [MSGFLLVDAAPRASLSTKVPLGRKEPKSKTTFKVVEDSKASNSSSRKIAPITAKGKSQQVVVSDDDSASNEVESEDEE
# EDEDEDEEEDEEEEEEDSAPPPKHLKTTSSISGKTLFFLLFPLINSI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g953
###
# start gene g954
Scaffold_1	AUGUSTUS	gene	4530070	4531122	0.74	+	.	g954
Scaffold_1	AUGUSTUS	transcript	4530070	4531122	0.74	+	.	g954.t1
Scaffold_1	AUGUSTUS	start_codon	4530070	4530072	.	+	0	transcript_id "g954.t1"; gene_id "g954";
Scaffold_1	AUGUSTUS	CDS	4530070	4531122	0.74	+	0	transcript_id "g954.t1"; gene_id "g954";
Scaffold_1	AUGUSTUS	stop_codon	4531120	4531122	.	+	0	transcript_id "g954.t1"; gene_id "g954";
# protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLS
# YLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIK
# DEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSG
# QSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g954
###
# start gene g955
Scaffold_1	AUGUSTUS	gene	4533779	4534591	0.94	+	.	g955
Scaffold_1	AUGUSTUS	transcript	4533779	4534591	0.94	+	.	g955.t1
Scaffold_1	AUGUSTUS	start_codon	4533779	4533781	.	+	0	transcript_id "g955.t1"; gene_id "g955";
Scaffold_1	AUGUSTUS	CDS	4533779	4534591	0.94	+	0	transcript_id "g955.t1"; gene_id "g955";
Scaffold_1	AUGUSTUS	stop_codon	4534589	4534591	.	+	0	transcript_id "g955.t1"; gene_id "g955";
# protein sequence = [MDFIEQLPMLNGYTAILVVVDRSSKQAIFIPTLDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVLAFFRALGKA
# LSMELHYTSGYHPEADGQTECVNQTLEQYIRIYCSYQQDDWSPLLPIAEFTYNNAPNASTGITPFFTNKGYHPNITVRPEVDMKSDLARDFVVNLDEL
# HVFLQEEILLAQSCYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTENSQKNILVLSRSSVDLVLCLTSSSSWTIFAASTRSSMYHSWSRLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g955
###
# start gene g956
Scaffold_1	AUGUSTUS	gene	4546338	4547215	0.15	-	.	g956
Scaffold_1	AUGUSTUS	transcript	4546338	4547215	0.15	-	.	g956.t1
Scaffold_1	AUGUSTUS	stop_codon	4546338	4546340	.	-	0	transcript_id "g956.t1"; gene_id "g956";
Scaffold_1	AUGUSTUS	CDS	4546338	4546630	0.96	-	2	transcript_id "g956.t1"; gene_id "g956";
Scaffold_1	AUGUSTUS	CDS	4546705	4546825	0.69	-	0	transcript_id "g956.t1"; gene_id "g956";
Scaffold_1	AUGUSTUS	CDS	4546892	4547215	0.24	-	0	transcript_id "g956.t1"; gene_id "g956";
Scaffold_1	AUGUSTUS	start_codon	4547213	4547215	.	-	0	transcript_id "g956.t1"; gene_id "g956";
# protein sequence = [MAHKDNLQTAVGTADDSKWYFSPLYPQSSDRCILSVPVDAFAGQIDEAANGGNSSTSSTAKLSLQDAVNLKAALRTQV
# EGVLAAFAANQNASLLTAGSNFNFTGNLTTETVAQANSDADAAQAAGTTSINAGNAGVGEVQTAIKNSLLVSTVQSVTNGATLLGASPTTAAAVATTT
# AAAAATTTAAASVSSAAAAAVTSTTTNKKSKNNKASTNNAASNKDDKSARALNKRLLRSRVRAVFDDVE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g956
###
# start gene g957
Scaffold_1	AUGUSTUS	gene	4549286	4550514	0.19	-	.	g957
Scaffold_1	AUGUSTUS	transcript	4549286	4550514	0.19	-	.	g957.t1
Scaffold_1	AUGUSTUS	stop_codon	4549286	4549288	.	-	0	transcript_id "g957.t1"; gene_id "g957";
Scaffold_1	AUGUSTUS	CDS	4549286	4549944	0.59	-	2	transcript_id "g957.t1"; gene_id "g957";
Scaffold_1	AUGUSTUS	CDS	4550024	4550276	0.47	-	0	transcript_id "g957.t1"; gene_id "g957";
Scaffold_1	AUGUSTUS	CDS	4550320	4550514	0.57	-	0	transcript_id "g957.t1"; gene_id "g957";
Scaffold_1	AUGUSTUS	start_codon	4550512	4550514	.	-	0	transcript_id "g957.t1"; gene_id "g957";
# protein sequence = [MDQERRLITAQSLQTLFDSTNTSLTIVRNVAEFSAHKLDEGDVSDVEDIDTRDPAIVAIDVASQVLFEPPQSYLRKLK
# HQYLEQNAKDKYVKLIVTDIDDPPTVTDGDNKQLEKQNMEQKEKLKVAKEKLSTIEEEFRVVSSKVEEGRAKLAQKIIDARLALSRLRQTHPHPRVTV
# QTADKKLEDQVMEMQALTDEMQVVEQKVHSVKGKLKSESLEMESLKSQRNEVEKSVKKSESGFNDDRRFVPLYDWSVISVFQLVSVNLTYLHRLTGSL
# MIHRSMQGLEVMEAISENELRLQYGVEDKHGRSRSISITLIFVPNSRKLAAANANVQGMEEFAIDFSDIIEAHLQMNNIRGMLAAILARTREGT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g957
###
# start gene g958
Scaffold_1	AUGUSTUS	gene	4557407	4558015	0.46	+	.	g958
Scaffold_1	AUGUSTUS	transcript	4557407	4558015	0.46	+	.	g958.t1
Scaffold_1	AUGUSTUS	start_codon	4557407	4557409	.	+	0	transcript_id "g958.t1"; gene_id "g958";
Scaffold_1	AUGUSTUS	CDS	4557407	4558015	0.46	+	0	transcript_id "g958.t1"; gene_id "g958";
Scaffold_1	AUGUSTUS	stop_codon	4558013	4558015	.	+	0	transcript_id "g958.t1"; gene_id "g958";
# protein sequence = [MKDMTEAASTMMTDEEKAEIDKQLNPDKPSTPPVAGEQTPAIHHEEPPPNPTSVANTSSELPTSSPSSLSEATTQPNG
# NSSLVIHGEHAQSPSPSPSHSVAEKEKLEKEREAARKRKAEQKEKLREQEKERRKVMEARVNMLTTKMIERLRPFVDAKHPGDKDDPETLAFEAKMKR
# EVEDLKLESFGVEVRSSKVCSTTEND]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g958
###
# start gene g959
Scaffold_1	AUGUSTUS	gene	4562440	4563035	0.56	+	.	g959
Scaffold_1	AUGUSTUS	transcript	4562440	4563035	0.56	+	.	g959.t1
Scaffold_1	AUGUSTUS	start_codon	4562440	4562442	.	+	0	transcript_id "g959.t1"; gene_id "g959";
Scaffold_1	AUGUSTUS	CDS	4562440	4562551	0.61	+	0	transcript_id "g959.t1"; gene_id "g959";
Scaffold_1	AUGUSTUS	CDS	4562722	4563035	0.6	+	2	transcript_id "g959.t1"; gene_id "g959";
Scaffold_1	AUGUSTUS	stop_codon	4563033	4563035	.	+	0	transcript_id "g959.t1"; gene_id "g959";
# protein sequence = [MPSDTAAKLWDDDINRRIFDLMHSQNTAENFGGLLAIASKTLGQIAEIGGSAFGERFMDFEVPAAIDLVKQESPRYAG
# VLILKELARNSPTYFHSHISMVFENILVSLRDQRVMVREGAAELLAACLESSLSVNVKHGARS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g959
###
# start gene g960
Scaffold_1	AUGUSTUS	gene	4566331	4567295	0.39	+	.	g960
Scaffold_1	AUGUSTUS	transcript	4566331	4567295	0.39	+	.	g960.t1
Scaffold_1	AUGUSTUS	start_codon	4566331	4566333	.	+	0	transcript_id "g960.t1"; gene_id "g960";
Scaffold_1	AUGUSTUS	CDS	4566331	4566565	0.39	+	0	transcript_id "g960.t1"; gene_id "g960";
Scaffold_1	AUGUSTUS	CDS	4566649	4567295	0.86	+	2	transcript_id "g960.t1"; gene_id "g960";
Scaffold_1	AUGUSTUS	stop_codon	4567293	4567295	.	+	0	transcript_id "g960.t1"; gene_id "g960";
# protein sequence = [MIVNQQHLKQAWDTSDVSTKEDWTAWMHKLSVEFMKESPSPALRACMSLVDVHTPLAKELFNAAFLSCWTELYDQYQV
# SISAPSAPSELIHRWLNLAEFMEHEEKPLPIEHRTLGEYALKYLAYAKALHYKELEYWSEPSPSTIEALITINTRLQQHDAAWGTLLMAREQYDVTRH
# EEWYERLGRWQEALQVYNKKAESDPNAPGVQIGRMKCLNALGEWDQLAVQVDEIWDHANHDDRREIGPIAAAAAWSLNEWDSMDDYIATMRPDSPDRA
# FYRAIYPYTKTSFRKQKHR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g960
###
# start gene g961
Scaffold_1	AUGUSTUS	gene	4571839	4572210	0.56	-	.	g961
Scaffold_1	AUGUSTUS	transcript	4571839	4572210	0.56	-	.	g961.t1
Scaffold_1	AUGUSTUS	stop_codon	4571839	4571841	.	-	0	transcript_id "g961.t1"; gene_id "g961";
Scaffold_1	AUGUSTUS	CDS	4571839	4572210	0.56	-	0	transcript_id "g961.t1"; gene_id "g961";
Scaffold_1	AUGUSTUS	start_codon	4572208	4572210	.	-	0	transcript_id "g961.t1"; gene_id "g961";
# protein sequence = [MVISTQHLLPGPSDTPALQYTDQKGGVFLVIVKVRGLIAKSNSRQTSSDAGPTLGTSSNIIVEGSIDVPMEVIDIELE
# DNKSSGPQQSSPSKSARRPSSEPVQPFPGSFGVDVSLRPVNYLWT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g961
###
# start gene g962
Scaffold_1	AUGUSTUS	gene	4577944	4579371	1	+	.	g962
Scaffold_1	AUGUSTUS	transcript	4577944	4579371	1	+	.	g962.t1
Scaffold_1	AUGUSTUS	start_codon	4577944	4577946	.	+	0	transcript_id "g962.t1"; gene_id "g962";
Scaffold_1	AUGUSTUS	CDS	4577944	4579371	1	+	0	transcript_id "g962.t1"; gene_id "g962";
Scaffold_1	AUGUSTUS	stop_codon	4579369	4579371	.	+	0	transcript_id "g962.t1"; gene_id "g962";
# protein sequence = [MFPSSEQVTSNLYPLQCEEAACKPFVHRSGSESFYEDIAQLVSSSISPANSPDTVDDDLSSSPGLSPTHTSPNYYYVD
# RVEPSFGSPSSPTEMYDTDPPSAYPASSSNIYQQPLPTPQNTYSFTAVNDIRESDAPASYPSDSPSPGDVQSSADFSHSYPESHPQHPHISSYQTDSD
# PRYNPATLSRDSYLETSSASNISSSGLLDQRRMSEPAILAIPNNYSTNSSTADTSSRYSYPMSYNNSSRSSYAPSLQRGSSIGSLRDLRLHHQHLHYS
# SPRSHNGWKTEDDSHHMAHSTHVNEGLDSPLSPFQPSFTGGQVGGSPTMAQGLQYSSIAEDHCSASPTGTSTPASLGTSRLPSQASISAGDAPGEDVD
# ADGNRSPMDPNSKTYSFVALPGNTVKKRPRRRYDEIERLYQCSWPDCNKAYGTLNHLNAHVTMQKHGSKRSPNGKFTRFFLSTSPYFILLRSELVLHL
# FPRFR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g962
###
# start gene g963
Scaffold_1	AUGUSTUS	gene	4583473	4583763	0.84	+	.	g963
Scaffold_1	AUGUSTUS	transcript	4583473	4583763	0.84	+	.	g963.t1
Scaffold_1	AUGUSTUS	start_codon	4583473	4583475	.	+	0	transcript_id "g963.t1"; gene_id "g963";
Scaffold_1	AUGUSTUS	CDS	4583473	4583763	0.84	+	0	transcript_id "g963.t1"; gene_id "g963";
Scaffold_1	AUGUSTUS	stop_codon	4583761	4583763	.	+	0	transcript_id "g963.t1"; gene_id "g963";
# protein sequence = [MGEMDNEEENSAHSTNDRLIMCAPWDLQTDPVVLPSLPSLPKLFGAEPDSDTPRVVKIAGFDNAMIALTNQGHVLLFD
# TLQSASESSLGSWKYVSF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g963
###
# start gene g964
Scaffold_1	AUGUSTUS	gene	4584012	4584443	0.84	+	.	g964
Scaffold_1	AUGUSTUS	transcript	4584012	4584443	0.84	+	.	g964.t1
Scaffold_1	AUGUSTUS	start_codon	4584012	4584014	.	+	0	transcript_id "g964.t1"; gene_id "g964";
Scaffold_1	AUGUSTUS	CDS	4584012	4584443	0.84	+	0	transcript_id "g964.t1"; gene_id "g964";
Scaffold_1	AUGUSTUS	stop_codon	4584441	4584443	.	+	0	transcript_id "g964.t1"; gene_id "g964";
# protein sequence = [MGDTETNPDTLPKIIPGLQDKSIISVVLGDYHFAAVTATGKLLTWGQYSDGALGLGDPGSLQAGTPGGFANETLRVRA
# LETRHGTPPDVEIPTEVRFDSHRKKPKDRFWFSAAASGWHTGALVIDLEASLTRDPFTTFRFNND]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g964
###
# start gene g965
Scaffold_1	AUGUSTUS	gene	4584913	4585872	0.62	-	.	g965
Scaffold_1	AUGUSTUS	transcript	4584913	4585872	0.62	-	.	g965.t1
Scaffold_1	AUGUSTUS	stop_codon	4584913	4584915	.	-	0	transcript_id "g965.t1"; gene_id "g965";
Scaffold_1	AUGUSTUS	CDS	4584913	4585872	0.62	-	0	transcript_id "g965.t1"; gene_id "g965";
Scaffold_1	AUGUSTUS	start_codon	4585870	4585872	.	-	0	transcript_id "g965.t1"; gene_id "g965";
# protein sequence = [MIESLRSQCASLQVETAHFPALQEEENNFQMIQSCPHVPPASPSARDGDNDWAFADSLLQEFPEFCSKQNLEPPNVEL
# QSDKIFPEASITDPAQLTHTISSNDPSNSHLPSPSIAGSVSPTPSSNSPRGILKRCKSVRFAEAPLIDPDSVHTTPVQEVVCPSTRHSTGPPIARSLK
# RPSPLRHTYAPQLKLTSSADSSLPLRNAGSLKPTIASETTNSKPSVHLQRTAMKKLGRECIVSSPIKPHKPKTQGPPSLGRSFRNTLISGKENKLIKL
# RTSSFANRHTMDENALRRVGNSSSPSETLKSRMPVPLRNILTRFK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g965
###
# start gene g966
Scaffold_1	AUGUSTUS	gene	4586580	4586942	0.58	+	.	g966
Scaffold_1	AUGUSTUS	transcript	4586580	4586942	0.58	+	.	g966.t1
Scaffold_1	AUGUSTUS	start_codon	4586580	4586582	.	+	0	transcript_id "g966.t1"; gene_id "g966";
Scaffold_1	AUGUSTUS	CDS	4586580	4586942	0.58	+	0	transcript_id "g966.t1"; gene_id "g966";
Scaffold_1	AUGUSTUS	stop_codon	4586940	4586942	.	+	0	transcript_id "g966.t1"; gene_id "g966";
# protein sequence = [MKFHSHTVHLDIQRSSLSRVLRRGGVGIVVVEVDSVLGCRFAEAQVMSFIVRNVGRGVLQPEGNGGIESKDKMEIVSR
# DNDSDNKLWSKSESASSDGVLGVLVRDDMSVGYSESATLNLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g966
###
# start gene g967
Scaffold_1	AUGUSTUS	gene	4589629	4591811	0.77	+	.	g967
Scaffold_1	AUGUSTUS	transcript	4589629	4591811	0.77	+	.	g967.t1
Scaffold_1	AUGUSTUS	start_codon	4589629	4589631	.	+	0	transcript_id "g967.t1"; gene_id "g967";
Scaffold_1	AUGUSTUS	CDS	4589629	4589957	0.78	+	0	transcript_id "g967.t1"; gene_id "g967";
Scaffold_1	AUGUSTUS	CDS	4590298	4590436	0.99	+	1	transcript_id "g967.t1"; gene_id "g967";
Scaffold_1	AUGUSTUS	CDS	4591413	4591811	0.99	+	0	transcript_id "g967.t1"; gene_id "g967";
Scaffold_1	AUGUSTUS	stop_codon	4591809	4591811	.	+	0	transcript_id "g967.t1"; gene_id "g967";
# protein sequence = [MQNLMELDHGWASLDEAFIFRVVQVLSSPHSLINVCRPATAILKKLVEADPSNTPGPQAGSSKNGPVIVPGSIYRYGF
# TMVFEQMRKEKSLLETIVNRLGSADTAMAQYSYIWDHSKLIEESDEKGQQLKWRKLGFDTEDIELEFNDVGVLGLECLDNSTKYLHYVDSAVKFPVRS
# GLEDLPDRIEIATVSEIATGTCAPPPNVLRDHDDLPPTTPLAPSPLSFSLLSIHEEQGSLADLIAPDQSRWADWTDGLNMLRKDGGHVASKETAGFVQ
# ALTEIGLKIKLLGE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g967
###
# start gene g968
Scaffold_1	AUGUSTUS	gene	4592270	4593950	0.46	-	.	g968
Scaffold_1	AUGUSTUS	transcript	4592270	4593950	0.46	-	.	g968.t1
Scaffold_1	AUGUSTUS	stop_codon	4592270	4592272	.	-	0	transcript_id "g968.t1"; gene_id "g968";
Scaffold_1	AUGUSTUS	CDS	4592270	4592467	0.7	-	0	transcript_id "g968.t1"; gene_id "g968";
Scaffold_1	AUGUSTUS	CDS	4593399	4593950	0.47	-	0	transcript_id "g968.t1"; gene_id "g968";
Scaffold_1	AUGUSTUS	start_codon	4593948	4593950	.	-	0	transcript_id "g968.t1"; gene_id "g968";
# protein sequence = [MGKEEWEAVEGGFVHGIDLVRHIRREYGDYFDIAVAGFPQHQTLPPEERDLEMRYLKEKVDAGVNFIFTQMFYDVDVF
# IDWVNTVRAAGITIPIVPGIAPIQTWNGFQRATSLAQTIIPQTFQDALEPHKANDEKVREIGTKLVADMCRRILNANLGIHGLHFYTMNLEKGTRMLL
# EELNLVPRDEAFELGQQWARVYDPDSPSAKIISELMDSCYLVNVVHNDFHDAGAIFKPFFQAGEEYATQANGH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g968
###
# start gene g969
Scaffold_1	AUGUSTUS	gene	4596277	4597407	0.85	+	.	g969
Scaffold_1	AUGUSTUS	transcript	4596277	4597407	0.85	+	.	g969.t1
Scaffold_1	AUGUSTUS	start_codon	4596277	4596279	.	+	0	transcript_id "g969.t1"; gene_id "g969";
Scaffold_1	AUGUSTUS	CDS	4596277	4597407	0.85	+	0	transcript_id "g969.t1"; gene_id "g969";
Scaffold_1	AUGUSTUS	stop_codon	4597405	4597407	.	+	0	transcript_id "g969.t1"; gene_id "g969";
# protein sequence = [MSDHDLCSTSSFLDNPAVSSMEVELSATTESSQIIDSPYITENPHNNLDRDPKTPRRASEVFGFLAEKRKSRPTEETF
# DKLLSKPPSTFSSPSDKDPSESTALSRFSEDSSMFNHNPPIVTPSRDASSSEFSRHSNSNTYPNPSSNPSSQRPVSRMLFEDGRASRVPQQQLTDQPS
# GPIEEDVREVKVILIAPTKVIVTAPTPLADTSDRPTTRMTRGPRSLHRHRSRNNAKERGYREGLVERSNSSNSSDPFTPIPSRPMKLRSSSGSLSLTY
# MDSKTTHSHGHISNPMPLGKESRSRRHGSTKSLMSAVFDKENSHNHTLGLVATPDIPFTPVRSNSSSRSSLLRAAVTAASFKPPRDMTPSPASSTELS
# PVGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g969
###
# start gene g970
Scaffold_1	AUGUSTUS	gene	4598676	4600483	0.09	+	.	g970
Scaffold_1	AUGUSTUS	transcript	4598676	4600483	0.09	+	.	g970.t1
Scaffold_1	AUGUSTUS	start_codon	4598676	4598678	.	+	0	transcript_id "g970.t1"; gene_id "g970";
Scaffold_1	AUGUSTUS	CDS	4598676	4598789	0.47	+	0	transcript_id "g970.t1"; gene_id "g970";
Scaffold_1	AUGUSTUS	CDS	4598887	4598908	0.97	+	0	transcript_id "g970.t1"; gene_id "g970";
Scaffold_1	AUGUSTUS	CDS	4599125	4599429	0.55	+	2	transcript_id "g970.t1"; gene_id "g970";
Scaffold_1	AUGUSTUS	CDS	4599471	4599566	0.72	+	0	transcript_id "g970.t1"; gene_id "g970";
Scaffold_1	AUGUSTUS	CDS	4599622	4599823	0.6	+	0	transcript_id "g970.t1"; gene_id "g970";
Scaffold_1	AUGUSTUS	CDS	4599873	4600113	0.37	+	2	transcript_id "g970.t1"; gene_id "g970";
Scaffold_1	AUGUSTUS	CDS	4600174	4600483	0.61	+	1	transcript_id "g970.t1"; gene_id "g970";
Scaffold_1	AUGUSTUS	stop_codon	4600481	4600483	.	+	0	transcript_id "g970.t1"; gene_id "g970";
# protein sequence = [MMTNVDMDEENIQYDDDDGAEEAPLIEVVLVGEKDLERFIPCTYNRRKRKTLCTNSSTTACGNYSTISGPKSSVSVST
# ESNSITRKSTSTFEKPKRSDFFAKAKPKEVVKKEKSTKEESSNSKAKITAATSKISEPEEKLSNVGAKEVGREHKREFPPESKEDKIKASSTKGKAPA
# NHRTGHKRKSPDSETEIGSPSVTVKKNVIISDEEEDQSTPKVEHPKGRNKGKQAMRGSDEDVLKMMDVDDDQVIRVSHSRASPDLNTAVGSETEDVEM
# QDHTQHSKPAPQIKKKATKVKTIVPIGRNGLRKKRVMKSKMTVDEKGYMGKGFAYESVEEGVPDSEPAKGKGKPRKDTAGGTNKSNKMETPRSRKVKD
# EEEEKVVQEDIETPSTNLKPAPKPKLKTSTSTSSKGSGASTSQKNIASFFGKSKGSK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/7
# CDS introns: 0/6
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g970
###
# start gene g971
Scaffold_1	AUGUSTUS	gene	4603765	4605921	0.52	+	.	g971
Scaffold_1	AUGUSTUS	transcript	4603765	4605921	0.52	+	.	g971.t1
Scaffold_1	AUGUSTUS	start_codon	4603765	4603767	.	+	0	transcript_id "g971.t1"; gene_id "g971";
Scaffold_1	AUGUSTUS	CDS	4603765	4604362	0.63	+	0	transcript_id "g971.t1"; gene_id "g971";
Scaffold_1	AUGUSTUS	CDS	4604735	4605921	0.66	+	2	transcript_id "g971.t1"; gene_id "g971";
Scaffold_1	AUGUSTUS	stop_codon	4605919	4605921	.	+	0	transcript_id "g971.t1"; gene_id "g971";
# protein sequence = [MQRSPHDRRVKPQSHTGSVTGEDADSSDIEPSEAGSVGGRSSVTGGSSKKRMTMEEREAAYNEARSRIFNEKGRDTDM
# SASSSSISVASSSAGGSSLGDGEDSVNSLATESERSSPSSNRRGNSSIKSSGSRPLRSSAQPFTSSGSGSSRNSRAPSPAFTYASLYEPASSGSFDPN
# SANQQYPSAPFGYPYSAPAPAHPAVIPPTTNNGSAHDGVPGSNNKSLNHRASNGHTKPQTTPLSRPAWSYGPGISMGGTMVTMAGSNSNGSGETTGPR
# LHSMRRQSNTSNGSSSGAYRSSNSDEASSIAVSLTPSHLLQPSLISFLYQSSSTSSSSRRTYTSTASSQHPLPPRPDWAVGLKPDPTLHSTNSSRHHD
# NSSRNSPVSPPRVPNGTGHSNNSHRRPQQTQPLISLQSQDFPPLTAMATPEKRPTAGGVWTNPSRSVMTTPALGVTSSGNALVHHPNAPNIPFTNSEA
# NGFRAEDGFQRPPPRTAELYNPKISKRSNTMQVQGEKNSDGRLNDQIRGLSLVDGPFHTNHTHEATLKCPFLRQDRHNLWKVGFIVCRASYRITLSTS
# AVDNLPLFHPPLHYFSKYVLVMKYLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g971
###
# start gene g972
Scaffold_1	AUGUSTUS	gene	4607054	4607407	0.59	+	.	g972
Scaffold_1	AUGUSTUS	transcript	4607054	4607407	0.59	+	.	g972.t1
Scaffold_1	AUGUSTUS	start_codon	4607054	4607056	.	+	0	transcript_id "g972.t1"; gene_id "g972";
Scaffold_1	AUGUSTUS	CDS	4607054	4607407	0.59	+	0	transcript_id "g972.t1"; gene_id "g972";
Scaffold_1	AUGUSTUS	stop_codon	4607405	4607407	.	+	0	transcript_id "g972.t1"; gene_id "g972";
# protein sequence = [MQPLFLGLDLSTQQLKAVLVREDHSILHESSVRFDQDLPSYETENGALKGPAEGEVTSPVAMWLDAFELLAERMKQAG
# VDFGSIAAISGAGQVYECVSVKRLPSNKSSATWLRFLVI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g972
###
# start gene g973
Scaffold_1	AUGUSTUS	gene	4608265	4608924	0.68	+	.	g973
Scaffold_1	AUGUSTUS	transcript	4608265	4608924	0.68	+	.	g973.t1
Scaffold_1	AUGUSTUS	start_codon	4608265	4608267	.	+	0	transcript_id "g973.t1"; gene_id "g973";
Scaffold_1	AUGUSTUS	CDS	4608265	4608924	0.68	+	0	transcript_id "g973.t1"; gene_id "g973";
Scaffold_1	AUGUSTUS	stop_codon	4608922	4608924	.	+	0	transcript_id "g973.t1"; gene_id "g973";
# protein sequence = [MLCYKNGALAREQVRDKYTDSDWSNYNTLVDSGNPGCDGYMGLYFPLPEIIPPGVKGEFFFRNGRSVPPVQVTEEEVP
# QAFQPRMILESQFLSIRSRIAAILPPDSPPLQRLVVTGGSSANHTIRQLAADLFNMKVYVSTTKEAAGMGGALLAKYAWWKQNGNSKGTFEEMNAMME
# GESTGMKCVAEPREEVAMQYDGLVASYTACEEEVVKIWATKDV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g973
###
# start gene g974
Scaffold_1	AUGUSTUS	gene	4610819	4611328	0.99	+	.	g974
Scaffold_1	AUGUSTUS	transcript	4610819	4611328	0.99	+	.	g974.t1
Scaffold_1	AUGUSTUS	start_codon	4610819	4610821	.	+	0	transcript_id "g974.t1"; gene_id "g974";
Scaffold_1	AUGUSTUS	CDS	4610819	4611328	0.99	+	0	transcript_id "g974.t1"; gene_id "g974";
Scaffold_1	AUGUSTUS	stop_codon	4611326	4611328	.	+	0	transcript_id "g974.t1"; gene_id "g974";
# protein sequence = [MPALGLLLEYPVFTGYNTRIAKKLAPSDPDYREPIDFENYSEEMNSFKQQYIYDNMRSIEDRKGLYVLYFSGFSALTD
# TEKGSTAGIRSIDSYKGNDFLYLNPKGIIPPEAIIKKGERRQDPFRERKVFNLTSFAEDDSEKVQVEELTDEANEDAEESLTKQQLEEAEG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g974
###
# start gene g975
Scaffold_1	AUGUSTUS	gene	4615938	4616297	0.99	+	.	g975
Scaffold_1	AUGUSTUS	transcript	4615938	4616297	0.99	+	.	g975.t1
Scaffold_1	AUGUSTUS	start_codon	4615938	4615940	.	+	0	transcript_id "g975.t1"; gene_id "g975";
Scaffold_1	AUGUSTUS	CDS	4615938	4616297	0.99	+	0	transcript_id "g975.t1"; gene_id "g975";
Scaffold_1	AUGUSTUS	stop_codon	4616295	4616297	.	+	0	transcript_id "g975.t1"; gene_id "g975";
# protein sequence = [MLIKNIDENLVNGSMGRVVRFCDPATYGDHEDPSRTASNSKPVSSSSKPAPTAKVPQLLPVVEFVMPNGSHKEMLVIP
# ESFKVELPNGEIQAARSQVSLIYLTATDTFDDICKFHPSCR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g975
###
# start gene g976
Scaffold_1	AUGUSTUS	gene	4627068	4627934	0.87	+	.	g976
Scaffold_1	AUGUSTUS	transcript	4627068	4627934	0.87	+	.	g976.t1
Scaffold_1	AUGUSTUS	start_codon	4627068	4627070	.	+	0	transcript_id "g976.t1"; gene_id "g976";
Scaffold_1	AUGUSTUS	CDS	4627068	4627934	0.87	+	0	transcript_id "g976.t1"; gene_id "g976";
Scaffold_1	AUGUSTUS	stop_codon	4627932	4627934	.	+	0	transcript_id "g976.t1"; gene_id "g976";
# protein sequence = [MSLALGTPLHPMYRRMLPLLDTLSNDIPDTIIPIVVTSTHAIPSTRFSEAHLPAILSSHLLYLVPSASQNLPPSPSTS
# TIHDATMQPQRPLDSHLHPVDGEEHSPTDDAHRSTFMGMGMPNMDVGKWGWLNFGKNGKKPTKGGQDEAEPNTIDNPDTAREEILRSPDGAVDQSALD
# DAISSKGVMTNDLDATELKYVVDKEYFTTAELDDIESDIIPNPSTPSDSPSPFSLLPQEFTSTIVHLAEDPHSSNTRERKIYYLTVGFSSSLPCLFSP
# SVPRNIPSCSLSST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g976
###
# start gene g977
Scaffold_1	AUGUSTUS	gene	4629408	4630031	0.7	+	.	g977
Scaffold_1	AUGUSTUS	transcript	4629408	4630031	0.7	+	.	g977.t1
Scaffold_1	AUGUSTUS	start_codon	4629408	4629410	.	+	0	transcript_id "g977.t1"; gene_id "g977";
Scaffold_1	AUGUSTUS	CDS	4629408	4630031	0.7	+	0	transcript_id "g977.t1"; gene_id "g977";
Scaffold_1	AUGUSTUS	stop_codon	4630029	4630031	.	+	0	transcript_id "g977.t1"; gene_id "g977";
# protein sequence = [MYQHDPSKIAICWNFLQENCPNTADTCNLSHDPTPERTPLCLHFLNKGRCTRPNCLFPHVNVGARHGVCRDFAVLGYC
# GKGLDCDKQHVRECPDFAEKGGCSTKGCKLPHVIRANRNRKPPSLVSSDGSSSSTVVSGLVDLADSQGESRMQHVAANDAQLGDEYISLTFNESESEE
# ESDSEEEENDEEGVEEGDDPDDVSDMLPVVG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g977
###
# start gene g978
Scaffold_1	AUGUSTUS	gene	4631341	4631677	0.46	+	.	g978
Scaffold_1	AUGUSTUS	transcript	4631341	4631677	0.46	+	.	g978.t1
Scaffold_1	AUGUSTUS	start_codon	4631341	4631343	.	+	0	transcript_id "g978.t1"; gene_id "g978";
Scaffold_1	AUGUSTUS	CDS	4631341	4631343	0.99	+	0	transcript_id "g978.t1"; gene_id "g978";
Scaffold_1	AUGUSTUS	CDS	4631501	4631677	0.46	+	0	transcript_id "g978.t1"; gene_id "g978";
Scaffold_1	AUGUSTUS	stop_codon	4631675	4631677	.	+	0	transcript_id "g978.t1"; gene_id "g978";
# protein sequence = [MDDNAPLVRHDDGTYDVMSVISVSGETPADVGAFVETWESQTISGIVAQWFVGAADCVE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g978
###
# start gene g979
Scaffold_1	AUGUSTUS	gene	4632217	4633524	0.5	+	.	g979
Scaffold_1	AUGUSTUS	transcript	4632217	4633524	0.5	+	.	g979.t1
Scaffold_1	AUGUSTUS	start_codon	4632217	4632219	.	+	0	transcript_id "g979.t1"; gene_id "g979";
Scaffold_1	AUGUSTUS	CDS	4632217	4632749	0.53	+	0	transcript_id "g979.t1"; gene_id "g979";
Scaffold_1	AUGUSTUS	CDS	4632813	4633524	0.87	+	1	transcript_id "g979.t1"; gene_id "g979";
Scaffold_1	AUGUSTUS	stop_codon	4633522	4633524	.	+	0	transcript_id "g979.t1"; gene_id "g979";
# protein sequence = [MTIQDLPSVLDSPTSVSSISSSSTTTISSRKRQRSTSANSATEESLKRGSPRPQIDPLSIGEAKNMVEDSEMDSYMQE
# QGHIGPSSADKLTRIAELQRTPLALNQTWFLVDRAWCCRWRAALGEIDPKSNEATISESQLGPPSTSALIDEFGNLKPGLVEDVDFELFPNEAWSLLV
# SWYGEPPTSLRRNTIARGYNQSTIAVELHPPKFYIFRLTKEDEIDEAYISSPSETSLPATITLSAHATLKDLHRESVSILHTGIASNLPQSRLWRLNE
# SSASHLSRQLPMSKFSAIELLDTTINGSKTLEEALFQSQDSFALEFQDITTREWLVKSEIEETTPEPLFKSNDAFFNRMSGASSSSLFSNSQSNGDAR
# AEVNEKLSVVSKKEKPKEKWIEPGTLGLGNMSVFLDSDSVGH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g979
###
# start gene g980
Scaffold_1	AUGUSTUS	gene	4633558	4634223	0.35	+	.	g980
Scaffold_1	AUGUSTUS	transcript	4633558	4634223	0.35	+	.	g980.t1
Scaffold_1	AUGUSTUS	start_codon	4633558	4633560	.	+	0	transcript_id "g980.t1"; gene_id "g980";
Scaffold_1	AUGUSTUS	CDS	4633558	4634223	0.35	+	0	transcript_id "g980.t1"; gene_id "g980";
Scaffold_1	AUGUSTUS	stop_codon	4634221	4634223	.	+	0	transcript_id "g980.t1"; gene_id "g980";
# protein sequence = [MNSAIQCLGHQKELTEYFLTGVYSRELNPDNPLGMGGAIAEGFGALLTRMWAGSELAHTYGALDKLREGSGGMGAKNK
# VSKFFKNTSNFSNNFGGSGDGATLNPSATSYSPRDFKSQLSRFAPQFSGYQQHDSQELVAFLLDGLHEDLNRVLKKPYVEKPDWFGARPPVLHPFRER
# RTAEIDGEEEDKDECAQRKSMKLRNARSTFRSMGGTKTWKTIKRC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g980
###
# start gene g981
Scaffold_1	AUGUSTUS	gene	4634629	4636905	0.47	+	.	g981
Scaffold_1	AUGUSTUS	transcript	4634629	4636905	0.47	+	.	g981.t1
Scaffold_1	AUGUSTUS	start_codon	4634629	4634631	.	+	0	transcript_id "g981.t1"; gene_id "g981";
Scaffold_1	AUGUSTUS	CDS	4634629	4634645	0.48	+	0	transcript_id "g981.t1"; gene_id "g981";
Scaffold_1	AUGUSTUS	CDS	4634724	4636905	0.86	+	1	transcript_id "g981.t1"; gene_id "g981";
Scaffold_1	AUGUSTUS	stop_codon	4636903	4636905	.	+	0	transcript_id "g981.t1"; gene_id "g981";
# protein sequence = [MHYPKTHHFYKNLDDSILCGEIGDNDTIICFELPCNSQQSRTWKRSDHPNAPWVLPLLLCDAPPTSFSTNAFSKTYGN
# HRLGNNLFGYPTIVVVTAEQAKSVEGIYGAAVERLARWTRQERDLWTWELPDGFPISVIDEKVETVTLNVMDEDGLETVTEISEDGAVVNVTQPVPAR
# QQPTPLLTPEEGDIVDEKSMVLDIGEDTLESGLKSAVPIRLGPKKDIFTLRLSTGQKDYGTSGYTSTPVSWESRIEEAEKTALTNPESAVGGLLKEHD
# VLYCEFDENMKSYYFGEERSFPKYEHALWEIWDEYLHPEYQDSVKSAASKSSRGISLSDCLDEFTKEEQLGADDLWYCPQCKKHQQATKKFDLWSTPD
# VLVVHLKRFSNSRMLRDKIDAFVDFPILGLDMNERVNERRVISSLERMGVDTDSVELLGRGSEGGSGPTSEPLIYDLFAVDEHLGGLGGGHYRAYAFN
# HMNNKWYHFDDSFVSESTADNAVVRLDWCLFVVWYTNPFSLAECKCLSSVLPSSLLVTLGWTKPRTCRAGLRSPTQIVSSTSDDETNDAPSDVIGVSP
# MHTDIQLPTPPSEVDTLPSYLNDSPTSSLGAGFTMTNWQSSQSSHFRSGVPTDDEGEYEQSPFLGIFNDVDISSVLPPSSLADSSPSSSVGVEPDFDT
# DLRSDDLNDLDGEGEDDDDEGPWSSEARARSMTLETEGEVRETSPAWSVSAHSASQRSSEVASPDD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g981
###
# start gene g982
Scaffold_1	AUGUSTUS	gene	4642406	4642834	0.73	-	.	g982
Scaffold_1	AUGUSTUS	transcript	4642406	4642834	0.73	-	.	g982.t1
Scaffold_1	AUGUSTUS	stop_codon	4642406	4642408	.	-	0	transcript_id "g982.t1"; gene_id "g982";
Scaffold_1	AUGUSTUS	CDS	4642406	4642834	0.73	-	0	transcript_id "g982.t1"; gene_id "g982";
Scaffold_1	AUGUSTUS	start_codon	4642832	4642834	.	-	0	transcript_id "g982.t1"; gene_id "g982";
# protein sequence = [MYTTIAFITFITFVVGSNSFYPTSDAACVFSLIPRSTANSLIQQELQILSIAFNLIIIRISAHPSGSDDHSTSVQSAP
# QTFPLRKFSSAPKSTNESTQIESDPYRTGMNKPQQESFLEVEEGNWAQSLTVKPQALDMEITDE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g982
###
# start gene g983
Scaffold_1	AUGUSTUS	gene	4645568	4646975	0.56	-	.	g983
Scaffold_1	AUGUSTUS	transcript	4645568	4646975	0.56	-	.	g983.t1
Scaffold_1	AUGUSTUS	stop_codon	4645568	4645570	.	-	0	transcript_id "g983.t1"; gene_id "g983";
Scaffold_1	AUGUSTUS	CDS	4645568	4646684	0.99	-	1	transcript_id "g983.t1"; gene_id "g983";
Scaffold_1	AUGUSTUS	CDS	4646737	4646975	0.56	-	0	transcript_id "g983.t1"; gene_id "g983";
Scaffold_1	AUGUSTUS	start_codon	4646973	4646975	.	-	0	transcript_id "g983.t1"; gene_id "g983";
# protein sequence = [MEFYLVDDLECDLIVFHPYRTLLALCNKDFGNSNSSSDSPAEEAEAGELGTGIGADDGPRYWGTGQGQLELSEGGLQT
# AWFIINDTYRSELCLIYPPHLIAVTAIYLTLVLHTPTQNSIAHLLPYSPAFNSDSSNSGEPSQTTPHPRRSSRTSDSSSKHANQQDPIDFLANLNVSL
# SAIATIAQEIISMYSLWNRYREDVTAEEMRNMNANANMGKRNAAGNFKSTMKGARVSQSMQSQKNLPRNVSASAATTSDMEWQLERQRFHGAIQLQAH
# LKKQGYASAPLPPQHMINGPYFMPQHPQQMQHRYPPALVPVSLGSLSPTKRSATGLRSRSGSRAGTPNSVGGGGGRMEDLFGDGTSSGSPASHTSHAA
# GVGPRAGSTPLGNTPGSIGGADDTANSPINPWPFGQGRIVTAIFLSSMLNTMREARMNDMAHPSSGRPVVVNRMLERTW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g983
###
# start gene g984
Scaffold_1	AUGUSTUS	gene	4648671	4649126	0.67	+	.	g984
Scaffold_1	AUGUSTUS	transcript	4648671	4649126	0.67	+	.	g984.t1
Scaffold_1	AUGUSTUS	start_codon	4648671	4648673	.	+	0	transcript_id "g984.t1"; gene_id "g984";
Scaffold_1	AUGUSTUS	CDS	4648671	4649126	0.67	+	0	transcript_id "g984.t1"; gene_id "g984";
Scaffold_1	AUGUSTUS	stop_codon	4649124	4649126	.	+	0	transcript_id "g984.t1"; gene_id "g984";
# protein sequence = [MTFGYGAGAMPDGYSDLVLETQEAEDCLIPMGITSENVAADYNISREAQDTFAALSFQKAAAAQKAHLFDPEILPIRV
# KQVSPDGGKQFLVDADDGIRDGVTVQSLGKLKPAFKKDGSTHAGNASQVSDGAAAVLFGKEERCEEAWVADCG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g984
###
# start gene g985
Scaffold_1	AUGUSTUS	gene	4666502	4666902	0.43	+	.	g985
Scaffold_1	AUGUSTUS	transcript	4666502	4666902	0.43	+	.	g985.t1
Scaffold_1	AUGUSTUS	start_codon	4666502	4666504	.	+	0	transcript_id "g985.t1"; gene_id "g985";
Scaffold_1	AUGUSTUS	CDS	4666502	4666653	0.5	+	0	transcript_id "g985.t1"; gene_id "g985";
Scaffold_1	AUGUSTUS	CDS	4666743	4666902	0.46	+	1	transcript_id "g985.t1"; gene_id "g985";
Scaffold_1	AUGUSTUS	stop_codon	4666900	4666902	.	+	0	transcript_id "g985.t1"; gene_id "g985";
# protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTGSAKEWFVPDILDPDLDSLPAWTSSFK
# ALVKELQDNFGVYDAQGEAEDSLGN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g985
###
# start gene g986
Scaffold_1	AUGUSTUS	gene	4670359	4670793	0.81	+	.	g986
Scaffold_1	AUGUSTUS	transcript	4670359	4670793	0.81	+	.	g986.t1
Scaffold_1	AUGUSTUS	start_codon	4670359	4670361	.	+	0	transcript_id "g986.t1"; gene_id "g986";
Scaffold_1	AUGUSTUS	CDS	4670359	4670793	0.81	+	0	transcript_id "g986.t1"; gene_id "g986";
Scaffold_1	AUGUSTUS	stop_codon	4670791	4670793	.	+	0	transcript_id "g986.t1"; gene_id "g986";
# protein sequence = [MDFIEQLPMSNGYSYLVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKAL
# SMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g986
###
# start gene g987
Scaffold_1	AUGUSTUS	gene	4675854	4676488	0.39	+	.	g987
Scaffold_1	AUGUSTUS	transcript	4675854	4676488	0.39	+	.	g987.t1
Scaffold_1	AUGUSTUS	start_codon	4675854	4675856	.	+	0	transcript_id "g987.t1"; gene_id "g987";
Scaffold_1	AUGUSTUS	CDS	4675854	4676142	0.52	+	0	transcript_id "g987.t1"; gene_id "g987";
Scaffold_1	AUGUSTUS	CDS	4676226	4676488	0.69	+	2	transcript_id "g987.t1"; gene_id "g987";
Scaffold_1	AUGUSTUS	stop_codon	4676486	4676488	.	+	0	transcript_id "g987.t1"; gene_id "g987";
# protein sequence = [MPPKTRAQSRANSEENTFSPQPNHLPHSLTLFAIGQPCRRNRGFGPATVPTMLTLPEAMEEDQQFEYSTLYTGDGQPV
# QVLTPHRGQPPWSLRLGAESPRDPPPHFDLDAGDHDDQDPPVDPEDPGADNNNDDLDDDSGGLPRGEPGDPGVPADLVVLVPHSLWHPQRATCYVGTS
# LGIQGFH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g987
###
# start gene g988
Scaffold_1	AUGUSTUS	gene	4684711	4686459	0.22	-	.	g988
Scaffold_1	AUGUSTUS	transcript	4684711	4686459	0.22	-	.	g988.t1
Scaffold_1	AUGUSTUS	stop_codon	4684711	4684713	.	-	0	transcript_id "g988.t1"; gene_id "g988";
Scaffold_1	AUGUSTUS	CDS	4684711	4685279	0.36	-	2	transcript_id "g988.t1"; gene_id "g988";
Scaffold_1	AUGUSTUS	CDS	4685880	4686459	0.22	-	0	transcript_id "g988.t1"; gene_id "g988";
Scaffold_1	AUGUSTUS	start_codon	4686457	4686459	.	-	0	transcript_id "g988.t1"; gene_id "g988";
# protein sequence = [MSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAED
# INLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVK
# WKGYDAGHNSWEPAANLKEDDGESHIYDPEWENAMQAQVPATIDNDILQEIDTCNDISQEALDIIEATAQRGFYKGEFDSSSQKQLQNSYLNCTHVAT
# LLNKEAAENSINNIMREKECLIKRRLEDAIRKPNSQLHHCLPTSHIPSPFATELNREIEHAQELFMKFHPNSSAWDELKFSQQLAIALIHKYKFNDAS
# IWKTKHCDLW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g988
###
# start gene g989
Scaffold_1	AUGUSTUS	gene	4688094	4689527	0.81	-	.	g989
Scaffold_1	AUGUSTUS	transcript	4688094	4689527	0.81	-	.	g989.t1
Scaffold_1	AUGUSTUS	stop_codon	4688094	4688096	.	-	0	transcript_id "g989.t1"; gene_id "g989";
Scaffold_1	AUGUSTUS	CDS	4688094	4689527	0.81	-	0	transcript_id "g989.t1"; gene_id "g989";
Scaffold_1	AUGUSTUS	start_codon	4689525	4689527	.	-	0	transcript_id "g989.t1"; gene_id "g989";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE
# LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS
# ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL
# VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM
# VREVLTG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g989
###
# start gene g990
Scaffold_1	AUGUSTUS	gene	4689578	4690744	0.91	-	.	g990
Scaffold_1	AUGUSTUS	transcript	4689578	4690744	0.91	-	.	g990.t1
Scaffold_1	AUGUSTUS	stop_codon	4689578	4689580	.	-	0	transcript_id "g990.t1"; gene_id "g990";
Scaffold_1	AUGUSTUS	CDS	4689578	4690744	0.91	-	0	transcript_id "g990.t1"; gene_id "g990";
Scaffold_1	AUGUSTUS	start_codon	4690742	4690744	.	-	0	transcript_id "g990.t1"; gene_id "g990";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g990
###
# start gene g991
Scaffold_1	AUGUSTUS	gene	4693966	4694643	0.67	+	.	g991
Scaffold_1	AUGUSTUS	transcript	4693966	4694643	0.67	+	.	g991.t1
Scaffold_1	AUGUSTUS	start_codon	4693966	4693968	.	+	0	transcript_id "g991.t1"; gene_id "g991";
Scaffold_1	AUGUSTUS	CDS	4693966	4694643	0.67	+	0	transcript_id "g991.t1"; gene_id "g991";
Scaffold_1	AUGUSTUS	stop_codon	4694641	4694643	.	+	0	transcript_id "g991.t1"; gene_id "g991";
# protein sequence = [MLLEQLSTSSRKIAELTTTLLYQQGIVDESNALATRQRVRLEELQEEVHRSRGCAAFVEQMIQEYPDEGFYEVVLPPL
# SELEGELVNIRADLRRVATLAHRLYRSDPATVLHHHDRYIGAIIEAVVAFLRRGLDSDDPDVAAHNFRLALDYMQSARGIHGDLYMRSISSIQWFFHN
# AVDQDEGLYRLVLEHSRFDNDGPFLTASQHAGFVAPPPTRWSLLFTAAC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g991
###
# start gene g992
Scaffold_1	AUGUSTUS	gene	4696768	4697855	0.18	-	.	g992
Scaffold_1	AUGUSTUS	transcript	4696768	4697855	0.18	-	.	g992.t1
Scaffold_1	AUGUSTUS	stop_codon	4696768	4696770	.	-	0	transcript_id "g992.t1"; gene_id "g992";
Scaffold_1	AUGUSTUS	CDS	4696768	4697514	0.94	-	0	transcript_id "g992.t1"; gene_id "g992";
Scaffold_1	AUGUSTUS	CDS	4697586	4697855	0.18	-	0	transcript_id "g992.t1"; gene_id "g992";
Scaffold_1	AUGUSTUS	start_codon	4697853	4697855	.	-	0	transcript_id "g992.t1"; gene_id "g992";
# protein sequence = [MPPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEESHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISP
# LGVSMDPEKVKAEVHRQLLGNHQGVHEAPPKRFSVELDPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFH
# ARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPK
# KGASRDQALAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALGGLHATRRNVWRKG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g992
###
# start gene g993
Scaffold_1	AUGUSTUS	gene	4725275	4726318	0.42	+	.	g993
Scaffold_1	AUGUSTUS	transcript	4725275	4726318	0.42	+	.	g993.t1
Scaffold_1	AUGUSTUS	start_codon	4725275	4725277	.	+	0	transcript_id "g993.t1"; gene_id "g993";
Scaffold_1	AUGUSTUS	CDS	4725275	4726318	0.42	+	0	transcript_id "g993.t1"; gene_id "g993";
Scaffold_1	AUGUSTUS	stop_codon	4726316	4726318	.	+	0	transcript_id "g993.t1"; gene_id "g993";
# protein sequence = [MRTACRGGESSEGEGEGEGAEESSDNDSDPSRRPSPRIREEDEDDDEDNPIAATSISGIGSDRKAGIGIGFSKAGATS
# STIKASSFTSSKGGIGSRTSVTHTPSSDPPSAFTSQTRSASFVRDSTPTVRPAAPLSYAEQAHFAKLSGSFGARILGKMGWKAGQGLGATGEGIVTPI
# ESKMRPEKSGIAFRGFKEKTEQSKMEARRRGEVVSDDEDPKIRKAKKKEREVKEKKAEAWRKPRKVKTKIQHKTYEEILAEAGTETSTSAGIGQIIDA
# TGAVVSENISGSVSIHSDLHSSLEKSVLWPTSQSTHGLPQWTLHESPKYGIMFVSSRNRARPISMVWHGKVNF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g993
###
# start gene g994
Scaffold_1	AUGUSTUS	gene	4727359	4728141	0.24	+	.	g994
Scaffold_1	AUGUSTUS	transcript	4727359	4728141	0.24	+	.	g994.t1
Scaffold_1	AUGUSTUS	start_codon	4727359	4727361	.	+	0	transcript_id "g994.t1"; gene_id "g994";
Scaffold_1	AUGUSTUS	CDS	4727359	4728141	0.24	+	0	transcript_id "g994.t1"; gene_id "g994";
Scaffold_1	AUGUSTUS	stop_codon	4728139	4728141	.	+	0	transcript_id "g994.t1"; gene_id "g994";
# protein sequence = [MQVFDANDWDSMLLKYIVPKLGATLRSDLRINPRNQSMEPIHYVLQWSSILRPSILSQLFETEFFPKWIEVLHLWLIQ
# PKVSFEEVAQWYSFWKGSFPENIQSVSGISRGFTRGLQLMNQAIELGPDAPSQLPKPDYRAEQAQHALTNSPYPRLSNNGGRAKTNASSSLRPSARTQ
# EITFRSIVEEYTASHDLLFVPTGRAHEKSRMPLFRITPSMDGKGGLLVYILDDAVWAALEGAGGPAEEYRAISLDEVVLRATKS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g994
###
# start gene g995
Scaffold_1	AUGUSTUS	gene	4731762	4732718	0.31	+	.	g995
Scaffold_1	AUGUSTUS	transcript	4731762	4732718	0.31	+	.	g995.t1
Scaffold_1	AUGUSTUS	start_codon	4731762	4731764	.	+	0	transcript_id "g995.t1"; gene_id "g995";
Scaffold_1	AUGUSTUS	CDS	4731762	4732074	0.56	+	0	transcript_id "g995.t1"; gene_id "g995";
Scaffold_1	AUGUSTUS	CDS	4732228	4732549	0.48	+	2	transcript_id "g995.t1"; gene_id "g995";
Scaffold_1	AUGUSTUS	CDS	4732697	4732718	0.44	+	1	transcript_id "g995.t1"; gene_id "g995";
Scaffold_1	AUGUSTUS	stop_codon	4732716	4732718	.	+	0	transcript_id "g995.t1"; gene_id "g995";
# protein sequence = [MTFLTDLATNGTEKGVGFVFFSGNDDSLIAHRGTEGAYYFTMLLSISRVPESVFSGDHSCHSGEAQSYEYSSKLNSSS
# TFDTSAEYYVRRYSRLHAEARYPLDRCQVFLQQFVFGTNTTGLVTGSTVTGGEDPELAEDVMPGSDPIFYGSLSTESSTIWPEATRAAWTSFIQTETA
# SVTTTPISTSIAVSSTSGAVRRTVPCYIFTGLTMLFEKTFAR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g995
###
# start gene g996
Scaffold_1	AUGUSTUS	gene	4734073	4734369	0.54	+	.	g996
Scaffold_1	AUGUSTUS	transcript	4734073	4734369	0.54	+	.	g996.t1
Scaffold_1	AUGUSTUS	start_codon	4734073	4734075	.	+	0	transcript_id "g996.t1"; gene_id "g996";
Scaffold_1	AUGUSTUS	CDS	4734073	4734369	0.54	+	0	transcript_id "g996.t1"; gene_id "g996";
Scaffold_1	AUGUSTUS	stop_codon	4734367	4734369	.	+	0	transcript_id "g996.t1"; gene_id "g996";
# protein sequence = [MLFKSLAALASLSLLSLASAWEIFMYETTAGGDPENCNGGGTTVSGTGSVCQLAAPNTVAMQVINDPEGCECKSKPRY
# HVAYIIDDGIYVIVEVFTGT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g996
###
# start gene g997
Scaffold_1	AUGUSTUS	gene	4738140	4739125	0.77	-	.	g997
Scaffold_1	AUGUSTUS	transcript	4738140	4739125	0.77	-	.	g997.t1
Scaffold_1	AUGUSTUS	stop_codon	4738140	4738142	.	-	0	transcript_id "g997.t1"; gene_id "g997";
Scaffold_1	AUGUSTUS	CDS	4738140	4738616	0.82	-	0	transcript_id "g997.t1"; gene_id "g997";
Scaffold_1	AUGUSTUS	CDS	4738748	4739125	0.78	-	0	transcript_id "g997.t1"; gene_id "g997";
Scaffold_1	AUGUSTUS	start_codon	4739123	4739125	.	-	0	transcript_id "g997.t1"; gene_id "g997";
# protein sequence = [MKVGWNPKLSARASNYGTRIDYILATPGLLPWIKVADIEPTIKGSDHCPVWIDLQDKISLSGRGNSTLKLRDVMSCPT
# PDKPDREPLRLATRFWDEYSGKQRLLASFFNTGSAGDKIKPKVVAAKAPVSMSSSLISIAYVSSFPTSSGASTPTSTSSQSNSLKKRKTPPPSTSSST
# AGTSSSSSAIQTKPKKPKGDVQNVKDLKKPRQSKLSSFFVAPPTTQDTSNSTAKNSITSKIKPRRSESITNLADTGTQVIVDLTASNDKDDKYPVAQT
# VQEVEEEVID]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g997
###
# start gene g998
Scaffold_1	AUGUSTUS	gene	4740370	4742032	0.64	+	.	g998
Scaffold_1	AUGUSTUS	transcript	4740370	4742032	0.64	+	.	g998.t1
Scaffold_1	AUGUSTUS	start_codon	4740370	4740372	.	+	0	transcript_id "g998.t1"; gene_id "g998";
Scaffold_1	AUGUSTUS	CDS	4740370	4740882	0.64	+	0	transcript_id "g998.t1"; gene_id "g998";
Scaffold_1	AUGUSTUS	CDS	4740971	4742032	0.98	+	0	transcript_id "g998.t1"; gene_id "g998";
Scaffold_1	AUGUSTUS	stop_codon	4742030	4742032	.	+	0	transcript_id "g998.t1"; gene_id "g998";
# protein sequence = [MELALRRKKILVASPLPTSLTTALPTALTTALTTALSTALTTALRPHHDRTHDPTPDRTHDRTPDRTHDRTPNRTPNR
# APNCPHDFAPNRTHDFAPNRTHDFAPNRTHDFAPNRACNFAPNCAHNSTPNWAHELHSQSAYDSTPNRARNPSTTPLTPPILTPSTTTLTEPREAARE
# AAYDCRGHVSTPSRSHISDCESSYEHPLNSSQASVYSSTHARYLCDSQDTAQDPALKSNEAFPNDQGEAEEGLLLANTIFPSPSEADDESLLDHDTLL
# ADSHQQDADDPNPLLDELLEELLNDNRHYQEKMILCSDLDAAILSLLEDEGSRPLVNSPTHQTGFSPSHFATSNEDPGSRKRRRLRDSLGEEVQVEVV
# EPRVAQANPFDPRPDCNRNGASASRKRPRVNHLLNLDFGEEEEQLGGEEENTGPQFLYEASDRPHAPPKEVTDASLGLMLRLTGGAGWGTDVWAEDIR
# RIVACVDWEEASGALSSYSLLHLAQRCSRAEKIDTGATFIRMIYELFLAAKVNR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g998
###
# start gene g999
Scaffold_1	AUGUSTUS	gene	4742172	4743192	0.35	+	.	g999
Scaffold_1	AUGUSTUS	transcript	4742172	4743192	0.35	+	.	g999.t1
Scaffold_1	AUGUSTUS	start_codon	4742172	4742174	.	+	0	transcript_id "g999.t1"; gene_id "g999";
Scaffold_1	AUGUSTUS	CDS	4742172	4742227	0.36	+	0	transcript_id "g999.t1"; gene_id "g999";
Scaffold_1	AUGUSTUS	CDS	4742694	4743192	0.8	+	1	transcript_id "g999.t1"; gene_id "g999";
Scaffold_1	AUGUSTUS	stop_codon	4743190	4743192	.	+	0	transcript_id "g999.t1"; gene_id "g999";
# protein sequence = [MHNWLNAGSRWGRLASAGKASFNLDRQQEIWEPILSFLPEEGEDPISFNELGTRYLTQSSGFEDFEALELGLESDSDY
# LKKVEEFSTLENQFASTYVGNSEEGTILQLKSWFREDSIPKSNPFPAKISSRKTWTEEKRAAASKAISPENLEELAEKVSLYWALPDLFADFNLADGS
# IRQSLRKD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g999
###
# start gene g1000
Scaffold_1	AUGUSTUS	gene	4747322	4748004	0.15	+	.	g1000
Scaffold_1	AUGUSTUS	transcript	4747322	4748004	0.15	+	.	g1000.t1
Scaffold_1	AUGUSTUS	start_codon	4747322	4747324	.	+	0	transcript_id "g1000.t1"; gene_id "g1000";
Scaffold_1	AUGUSTUS	CDS	4747322	4747514	0.8	+	0	transcript_id "g1000.t1"; gene_id "g1000";
Scaffold_1	AUGUSTUS	CDS	4747573	4747693	0.25	+	2	transcript_id "g1000.t1"; gene_id "g1000";
Scaffold_1	AUGUSTUS	CDS	4747890	4748004	0.44	+	1	transcript_id "g1000.t1"; gene_id "g1000";
Scaffold_1	AUGUSTUS	stop_codon	4748002	4748004	.	+	0	transcript_id "g1000.t1"; gene_id "g1000";
# protein sequence = [MAKKDRKGKGKALFFLASDSGSSESSNELEPESPPALSSTQKLKRKRSSVDDEALEERNSKRHKTKEYVEISDLDEND
# AKVRFTDSEDQEASSEGGKDQGTVQFFSGSSSGSSTASSEQDVAKDKDNEDDDDDEEDSWDNWT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1000
###
# start gene g1001
Scaffold_1	AUGUSTUS	gene	4754228	4756536	0.59	-	.	g1001
Scaffold_1	AUGUSTUS	transcript	4754228	4756536	0.59	-	.	g1001.t1
Scaffold_1	AUGUSTUS	stop_codon	4754228	4754230	.	-	0	transcript_id "g1001.t1"; gene_id "g1001";
Scaffold_1	AUGUSTUS	CDS	4754228	4755487	1	-	0	transcript_id "g1001.t1"; gene_id "g1001";
Scaffold_1	AUGUSTUS	CDS	4755555	4755698	0.6	-	0	transcript_id "g1001.t1"; gene_id "g1001";
Scaffold_1	AUGUSTUS	CDS	4756213	4756536	1	-	0	transcript_id "g1001.t1"; gene_id "g1001";
Scaffold_1	AUGUSTUS	start_codon	4756534	4756536	.	-	0	transcript_id "g1001.t1"; gene_id "g1001";
# protein sequence = [MHITRQRNTDWKTFAPSALPGSETFAAQSSLPKLPVPELSGTLSYLKESLKPIAWNEAEYRAVVSKIDEFGARIGPEL
# QKRLLKRQAETDHWLERWWDDGAYLGYRESRGELTQNHVVEFINQAHPSQIKYIYENTTQSYSGVGILTASNRDVWAKDYAELVTSEHNSDILDTIHS
# SAFIICLEEGAPSSPEQNSRVLWHGHFSNGQAVGLQNRWVDKPCQFIVYDNMYAGFMGEHSIMDGTPTVRLCDEVLDALASPSFDHGVKPSGQPAIPP
# TPLDWEISAATAQAIMTANAAALDLINSQVLSYYLTPYGKDEIKKFGVSPDSWAQMIIQLAYRRTIGNENRKGGTYEAATTRKFYKGRTEAIRVVTSE
# SDAWVESMDNPNASNATRKELFNLATKKHVALAKLCGAGQGIDRHILGMLLLPVFEDISRNSAGLKKLLAESEETPALFSDPVFTRSSYWVLSTSAIF
# SKHFNAYGWGEVVPDGFGVAYMTGHNGLFCTLAYFTVITDRLDFLNFIPQIVCSTLLHLGRKCLTPNLLMRLLQQLGTYTTYTKPLARRKRNYRYIDR
# ITCSCCI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1001
###
# start gene g1002
Scaffold_1	AUGUSTUS	gene	4757145	4758343	0.33	+	.	g1002
Scaffold_1	AUGUSTUS	transcript	4757145	4758343	0.33	+	.	g1002.t1
Scaffold_1	AUGUSTUS	start_codon	4757145	4757147	.	+	0	transcript_id "g1002.t1"; gene_id "g1002";
Scaffold_1	AUGUSTUS	CDS	4757145	4757760	0.44	+	0	transcript_id "g1002.t1"; gene_id "g1002";
Scaffold_1	AUGUSTUS	CDS	4757811	4758343	0.59	+	2	transcript_id "g1002.t1"; gene_id "g1002";
Scaffold_1	AUGUSTUS	stop_codon	4758341	4758343	.	+	0	transcript_id "g1002.t1"; gene_id "g1002";
# protein sequence = [MGPRQPPAPDKRNAAYESIFGRPSASHHHQSPVPTVQPPYPPQTNYYYQQQPQSYQQNAVDRRTSFQQYHHSPSLYTN
# PTYNSSNIPPNAYPRYTPSSYNYTPSLAPPSVSIRARSIHSSTNGPGIIAPKPEEPPDPSLEALTKSGLTPAQAYQAQIYRNSTPSSLPAVESDDGRL
# GIDFAAESNSSDQSTDDSSELPWARKESPRTMSSLPQRNSTTNISHNRHSHASTNHSLHVDTASAQSIRSSVASTSPSSFSLADNNSLSMETATTSTG
# RRSSESAHIHRVTGNARREKSAQDRSMSMSAATNSMRAVLASRVPIPGLPEGASLMVIYEACSTPIDLIHRAPFSHLYQNSHTQNANSLPSVAFTSRG
# SVSGPHSTRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1002
###
# start gene g1003
Scaffold_1	AUGUSTUS	gene	4759901	4760712	0.29	+	.	g1003
Scaffold_1	AUGUSTUS	transcript	4759901	4760712	0.29	+	.	g1003.t1
Scaffold_1	AUGUSTUS	start_codon	4759901	4759903	.	+	0	transcript_id "g1003.t1"; gene_id "g1003";
Scaffold_1	AUGUSTUS	CDS	4759901	4760026	0.29	+	0	transcript_id "g1003.t1"; gene_id "g1003";
Scaffold_1	AUGUSTUS	CDS	4760095	4760712	0.84	+	0	transcript_id "g1003.t1"; gene_id "g1003";
Scaffold_1	AUGUSTUS	stop_codon	4760710	4760712	.	+	0	transcript_id "g1003.t1"; gene_id "g1003";
# protein sequence = [MIYKGPLNKRDGELQVYLFDHALLFTKVVKTKQHEFYKVYRPPIPLELLLVSASDDASPNGNGHNTLRGNRRQGLVKK
# NSFSRDSRSSPNFTVPPVHVKTDAKGQFWINFVHLGRKYYNLVLWANSNLNQKKWLENIYKQQQAIKERSNIFETVSLSEGFFNNPNKVNCAAPFSKW
# IIRFIALEESGLIGSTCLGGGRKIAYGTDDGVYFSDLREVNKDPVKVLGLMDVTQIDVLEDYQLLIVLSGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1003
###
# start gene g1004
Scaffold_1	AUGUSTUS	gene	4762398	4763687	0.6	+	.	g1004
Scaffold_1	AUGUSTUS	transcript	4762398	4763687	0.6	+	.	g1004.t1
Scaffold_1	AUGUSTUS	start_codon	4762398	4762400	.	+	0	transcript_id "g1004.t1"; gene_id "g1004";
Scaffold_1	AUGUSTUS	CDS	4762398	4762770	0.97	+	0	transcript_id "g1004.t1"; gene_id "g1004";
Scaffold_1	AUGUSTUS	CDS	4762933	4763180	0.99	+	2	transcript_id "g1004.t1"; gene_id "g1004";
Scaffold_1	AUGUSTUS	CDS	4763289	4763402	0.62	+	0	transcript_id "g1004.t1"; gene_id "g1004";
Scaffold_1	AUGUSTUS	CDS	4763457	4763687	1	+	0	transcript_id "g1004.t1"; gene_id "g1004";
Scaffold_1	AUGUSTUS	stop_codon	4763685	4763687	.	+	0	transcript_id "g1004.t1"; gene_id "g1004";
# protein sequence = [MKLQPFTVLLAITAANATKINPLHIKRQATASSSVSTATSATVAASSVSSSSGTSATPSSTTGISTGTTTAVGAPASA
# TWGTSYPPLSQISSGMPSEVTQAVTTTYTAGASPTYYSGADPLPTPCSSEVQEWMEELDGWDIPDLSPTVDGTCVSDPANVANASARGWWTCGGYTRD
# TDITVCPGKPMTWGTRYGQIHFHQSFGLYFINIKATFFDVGSRCIENPNVLIDEYMSGHEIAVHTWSHPHLTTLTTEQIVAELGWTRKAIKTILGVTP
# TTMRPPYGDIDDRVRAISLAMGMVPIIWTRTPSGVSFDTFGMFHGSQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1004
###
# start gene g1005
Scaffold_1	AUGUSTUS	gene	4774363	4775676	0.65	-	.	g1005
Scaffold_1	AUGUSTUS	transcript	4774363	4775676	0.65	-	.	g1005.t1
Scaffold_1	AUGUSTUS	stop_codon	4774363	4774365	.	-	0	transcript_id "g1005.t1"; gene_id "g1005";
Scaffold_1	AUGUSTUS	CDS	4774363	4775676	0.65	-	0	transcript_id "g1005.t1"; gene_id "g1005";
Scaffold_1	AUGUSTUS	start_codon	4775674	4775676	.	-	0	transcript_id "g1005.t1"; gene_id "g1005";
# protein sequence = [MLVLQDFEALTPNLLARTVETVEGGGLIVLLLKSMNSLRQLYTMGMDVHARYRTESSGEVKPRFNERFILSLAACPDC
# LFLDDELNVLPLSKGKDIEPLPEQNGKGTTRSQENAELRELKNSLEGSVPAGPLVALAKTTDQARALLTFVNSLITPSDPSSSSNPSSSLSSALNTTT
# TLLAARGRGKSSALGLALAAAVHTGYANIFLTSPAPENLQTAWEFLFKGLDALGWEEHLDYDILQATHDLSSFGNGVDEAAESNPTLGKGDGGKKPIV
# RVNIFRNPTHRQTIQYIDPRDAHVLGQAELLIIDEAAAIPLPVVRNLLGPAMAKGSASAGGYAVWLASTVNGYEGTGRSLSLKLIQQLRDNSSSGPPT
# KGDSGKGNSSHGNRTLNEVKLSTPIRYAPGDEVEKWLNTLLCLDVSSSSGKILIVSSISEADAIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1005
###
# start gene g1006
Scaffold_1	AUGUSTUS	gene	4776201	4778604	0.27	+	.	g1006
Scaffold_1	AUGUSTUS	transcript	4776201	4778604	0.27	+	.	g1006.t1
Scaffold_1	AUGUSTUS	start_codon	4776201	4776203	.	+	0	transcript_id "g1006.t1"; gene_id "g1006";
Scaffold_1	AUGUSTUS	CDS	4776201	4776280	0.74	+	0	transcript_id "g1006.t1"; gene_id "g1006";
Scaffold_1	AUGUSTUS	CDS	4776447	4776620	0.94	+	1	transcript_id "g1006.t1"; gene_id "g1006";
Scaffold_1	AUGUSTUS	CDS	4776694	4777099	0.84	+	1	transcript_id "g1006.t1"; gene_id "g1006";
Scaffold_1	AUGUSTUS	CDS	4777157	4777453	0.97	+	0	transcript_id "g1006.t1"; gene_id "g1006";
Scaffold_1	AUGUSTUS	CDS	4777627	4778604	0.44	+	0	transcript_id "g1006.t1"; gene_id "g1006";
Scaffold_1	AUGUSTUS	stop_codon	4778602	4778604	.	+	0	transcript_id "g1006.t1"; gene_id "g1006";
# protein sequence = [MASNKPNKLAFLSMPAPASYVAGLGRGEAQARRGEEAEVDPEQFQDPDNEYGLFAGTAYEQDDEEADKIYEAVDAAMD
# ARRKARREAQEQAQLAKHRAERPKIQQQFADLKRGLSAVTDEEWESIPEVGNLTKRKRPKYERTYAVSDSILAGDRSRGEYENSLDSLQQQVRIQVSW
# ISHRDDSNLVAQTGGLVTPAEAGPTNFVEIGQARDKILSLKLDQVSGTSTSSGLSTSIDPKGYLTSLNSVVLKSDAEIGDIKRARMLFDSLIKSNPKH
# APGWIAAACLEEHAGRMVAARKLIKQGCEQCSKNEDVWLEAARLHKGYVPSQIPVFWVELINRPALEHIPNSVRLWKETVNLESSASDARVLLSRAVE
# VIPLSVELWLALAQLETLDKAKAVLNKARKAIPTSHEIWIAAGRLLEQEASMMGAEKTKAEKKKALDLVDKTIEAGVRELRRHGVLLTREQWLKEAEK
# CETQGSVLTSESIVKATIAMDIEEEDRLDTWIDDAEGALSRNMVGTARAVLAYALKVFPDKKNLWIRAAGLEKAHGTSESLDAILTEAVKHCPQAEVL
# WLMAAKERWLAGNVQGARDVLATAFDANKESEKIWLAAVKLEAENGHLDVARELLIRARSTADTERVYHPYLYLHL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1006
###
# start gene g1007
Scaffold_1	AUGUSTUS	gene	4778730	4779296	0.41	+	.	g1007
Scaffold_1	AUGUSTUS	transcript	4778730	4779296	0.41	+	.	g1007.t1
Scaffold_1	AUGUSTUS	start_codon	4778730	4778732	.	+	0	transcript_id "g1007.t1"; gene_id "g1007";
Scaffold_1	AUGUSTUS	CDS	4778730	4779296	0.41	+	0	transcript_id "g1007.t1"; gene_id "g1007";
Scaffold_1	AUGUSTUS	stop_codon	4779294	4779296	.	+	0	transcript_id "g1007.t1"; gene_id "g1007";
# protein sequence = [MVQGQIYQSQNKFPAARASFAAGFKACPKEPILWILASRLEETDGKSIKARALLDKARQVNPSNELIWAEAVGVEERS
# GGAAQAKAMLARGLQDCPTSGLLWTMSIWLEPRPQRKTRALDALKKSNDNPLIICTVARLFWAERKIEKARQWFQRAVPPRPDDSVDTGADIGDLWGW
# WLKFERQHGTEV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1007
###
# start gene g1008
Scaffold_1	AUGUSTUS	gene	4782710	4783543	0.92	+	.	g1008
Scaffold_1	AUGUSTUS	transcript	4782710	4783543	0.92	+	.	g1008.t1
Scaffold_1	AUGUSTUS	start_codon	4782710	4782712	.	+	0	transcript_id "g1008.t1"; gene_id "g1008";
Scaffold_1	AUGUSTUS	CDS	4782710	4783543	0.92	+	0	transcript_id "g1008.t1"; gene_id "g1008";
Scaffold_1	AUGUSTUS	stop_codon	4783541	4783543	.	+	0	transcript_id "g1008.t1"; gene_id "g1008";
# protein sequence = [MVAKAKVMAELESSQHDNEDINMIDPDIKPEESDHEEDNLAEPMEDVEEGQGQGEGSENVQEHDDDDDGDRHGHDHDE
# DEDHHEDDSPPAQGGMPGGLDDAAAALAIFGDYRQFGSYMMSLSSRLKTMLNNIKSTADPTTRLVTLQELSELLSISTEDTLAGSFQVEAFVRELVKI
# LGGRGADRDEDDDEGDEEEERDEDAALAAALAMSTGGTYTGDENLEAQVLACRCLANLMEALPGVAHTVVYHGAIPVLCSKLIEISYIDLAEQTLSVR
# ARY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1008
###
# start gene g1009
Scaffold_1	AUGUSTUS	gene	4784342	4785394	0.62	+	.	g1009
Scaffold_1	AUGUSTUS	transcript	4784342	4785394	0.62	+	.	g1009.t1
Scaffold_1	AUGUSTUS	start_codon	4784342	4784344	.	+	0	transcript_id "g1009.t1"; gene_id "g1009";
Scaffold_1	AUGUSTUS	CDS	4784342	4784642	0.62	+	0	transcript_id "g1009.t1"; gene_id "g1009";
Scaffold_1	AUGUSTUS	CDS	4784910	4785394	0.99	+	2	transcript_id "g1009.t1"; gene_id "g1009";
Scaffold_1	AUGUSTUS	stop_codon	4785392	4785394	.	+	0	transcript_id "g1009.t1"; gene_id "g1009";
# protein sequence = [MMKAKAKADKAAARAAVQAPLVAALLITPPSAPSPTPEEQPASEHTATTSNVSSNTTADRTELLRSKPAVVGRFMQLT
# VPILIDVYAASVNTPVRVKTLTETLAARSLASSKLKEKERADKDKDKDKDTSDTGTPDASASTTTSVSSSSSAPIIPGYKRLSSIAYDPEDAITLRAR
# IMKFKYLSGDDQAESDHTLQSLKELVDRISPPNASEQELSEALWDLTTLFAAPHTSVSSFELLQSGLVDGLLKFATDTDRKGTFL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1009
###
# start gene g1010
Scaffold_1	AUGUSTUS	gene	4785852	4786652	0.99	+	.	g1010
Scaffold_1	AUGUSTUS	transcript	4785852	4786652	0.99	+	.	g1010.t1
Scaffold_1	AUGUSTUS	start_codon	4785852	4785854	.	+	0	transcript_id "g1010.t1"; gene_id "g1010";
Scaffold_1	AUGUSTUS	CDS	4785852	4786652	0.99	+	0	transcript_id "g1010.t1"; gene_id "g1010";
Scaffold_1	AUGUSTUS	stop_codon	4786650	4786652	.	+	0	transcript_id "g1010.t1"; gene_id "g1010";
# protein sequence = [MLAALAASGFPGSSRVSGSSGEPSRSESSPSAPPPAPEASTSQDGSSSSTITRRRSQRLSAKKLGSASGVDDASTNAL
# AAATDDSVMQSTNTAADEPEMPPPLPAAAESASETLVDSEMQAEFSDEELDAEVFDEEEVDPDNSISDKTVTLSVAEDGSKIEAQTPDGTRVATPNPN
# ISVNQGASSKPSTSSRPSYASALRAKPTDWHLEFAMDDHVLPLDLTIYGAIHQHEMRKKTGSVPPSLFWQGVYTIKFKKVPGPTPASESK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1010
###
# start gene g1011
Scaffold_1	AUGUSTUS	gene	4790678	4791514	0.73	-	.	g1011
Scaffold_1	AUGUSTUS	transcript	4790678	4791514	0.73	-	.	g1011.t1
Scaffold_1	AUGUSTUS	stop_codon	4790678	4790680	.	-	0	transcript_id "g1011.t1"; gene_id "g1011";
Scaffold_1	AUGUSTUS	CDS	4790678	4791395	0.97	-	1	transcript_id "g1011.t1"; gene_id "g1011";
Scaffold_1	AUGUSTUS	CDS	4791495	4791514	0.75	-	0	transcript_id "g1011.t1"; gene_id "g1011";
Scaffold_1	AUGUSTUS	start_codon	4791512	4791514	.	-	0	transcript_id "g1011.t1"; gene_id "g1011";
# protein sequence = [MALVTVPSQVTSSVQLQPTSSSTSTFSSFVSSFSTNSNPDSNTIITPTTTFSSSISSSSDSDSHIGAIIGGAVGGLIA
# LNIAIIALVLIYRLKRRSKQQFVEAFDLNGNFEPNRPSRKSTRDEISTRAGEHLAVTEMSAGAQPRGVTSYPFSSSTPVPPVMTALDGGLGTAADAHG
# ETSVARSTAPTEGGFGGRSTRNVFIHQDGGRVEMASQDRLEEGEQEEIPPTYESLIRSIRSGEFWSREK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1011
###
# start gene g1012
Scaffold_1	AUGUSTUS	gene	4795388	4796523	0.95	-	.	g1012
Scaffold_1	AUGUSTUS	transcript	4795388	4796523	0.95	-	.	g1012.t1
Scaffold_1	AUGUSTUS	stop_codon	4795388	4795390	.	-	0	transcript_id "g1012.t1"; gene_id "g1012";
Scaffold_1	AUGUSTUS	CDS	4795388	4795727	0.95	-	1	transcript_id "g1012.t1"; gene_id "g1012";
Scaffold_1	AUGUSTUS	CDS	4795805	4796523	0.98	-	0	transcript_id "g1012.t1"; gene_id "g1012";
Scaffold_1	AUGUSTUS	start_codon	4796521	4796523	.	-	0	transcript_id "g1012.t1"; gene_id "g1012";
# protein sequence = [MTSITHGLFIITSAVTLSFALELTLPFGLPTLSLPIGLPPPSLPTGLPPIGSVSTFVPDTSSTPTVVEATSATQPHKS
# TTSSIFIFSSSSSSIPSSSRSFSSRSPHSAIITSITTSASSFSFFSSSSSVSSSSSSLSYSTTVTGTSSFPTSSNYSSNSNSHKSAIVGGVVGGGVAV
# IIIVIAIVVYSSKRRPRKQFSRVFDGDRTSGTNEPRVSEGGGIGGHITAAGTWFRLTHSSDPVILRLNSHSGSLGHPEIAARFIKGFDSASRGSCGGT
# STAGSMTSPTGVSSRRYTSDRAYSVDAETSSPSREELDVGEQEHVSDEIPPTYESLVPQTGGPGIRNEGSGNVMRGWK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1012
###
# start gene g1013
Scaffold_1	AUGUSTUS	gene	4803190	4806577	0.17	+	.	g1013
Scaffold_1	AUGUSTUS	transcript	4803190	4806577	0.17	+	.	g1013.t1
Scaffold_1	AUGUSTUS	start_codon	4803190	4803192	.	+	0	transcript_id "g1013.t1"; gene_id "g1013";
Scaffold_1	AUGUSTUS	CDS	4803190	4803305	0.47	+	0	transcript_id "g1013.t1"; gene_id "g1013";
Scaffold_1	AUGUSTUS	CDS	4803431	4803821	0.9	+	1	transcript_id "g1013.t1"; gene_id "g1013";
Scaffold_1	AUGUSTUS	CDS	4803904	4804244	0.92	+	0	transcript_id "g1013.t1"; gene_id "g1013";
Scaffold_1	AUGUSTUS	CDS	4805025	4805379	0.38	+	1	transcript_id "g1013.t1"; gene_id "g1013";
Scaffold_1	AUGUSTUS	CDS	4805477	4806577	0.89	+	0	transcript_id "g1013.t1"; gene_id "g1013";
Scaffold_1	AUGUSTUS	stop_codon	4806575	4806577	.	+	0	transcript_id "g1013.t1"; gene_id "g1013";
# protein sequence = [MLELLSGFKGSIETLGTVLAASAALLTALNPRARSRSQSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGV
# YDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIEMARLPEPATLADYRQEVLRIDNRYWKREETRSVRLPSGSSAP
# FTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEE
# ESENYPQLLACKDAGMEPILLRAIHSEVAARAADRSSTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKEL
# VALKDFIDKQLATGAITPSSSPHGAPVLFISLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSD
# MLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYR
# RFIYNYSDIVVPTRLTRKGAPGSGTAAVKRPSKISKSLSLLRRYWPIGSRIAHLSWTDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHD
# KELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPQLPS
# YLY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1013
###
# start gene g1014
Scaffold_1	AUGUSTUS	gene	4809376	4809558	0.79	-	.	g1014
Scaffold_1	AUGUSTUS	transcript	4809376	4809558	0.79	-	.	g1014.t1
Scaffold_1	AUGUSTUS	stop_codon	4809376	4809378	.	-	0	transcript_id "g1014.t1"; gene_id "g1014";
Scaffold_1	AUGUSTUS	CDS	4809376	4809558	0.79	-	0	transcript_id "g1014.t1"; gene_id "g1014";
Scaffold_1	AUGUSTUS	start_codon	4809556	4809558	.	-	0	transcript_id "g1014.t1"; gene_id "g1014";
# protein sequence = [MSASRTTTTTISATAGPSRSRPVPPPPPPPPSDSAAQEEEDLEDEDEDDIIRRAHARVDG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1014
###
# start gene g1015
Scaffold_1	AUGUSTUS	gene	4816997	4818064	0.67	-	.	g1015
Scaffold_1	AUGUSTUS	transcript	4816997	4818064	0.67	-	.	g1015.t1
Scaffold_1	AUGUSTUS	stop_codon	4816997	4816999	.	-	0	transcript_id "g1015.t1"; gene_id "g1015";
Scaffold_1	AUGUSTUS	CDS	4816997	4818064	0.67	-	0	transcript_id "g1015.t1"; gene_id "g1015";
Scaffold_1	AUGUSTUS	start_codon	4818062	4818064	.	-	0	transcript_id "g1015.t1"; gene_id "g1015";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLDETEADASNLDANRYPLRDPRHSPYSQTNPSKSRPDPNICSCTRSCYSEPP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1015
###
# start gene g1016
Scaffold_1	AUGUSTUS	gene	4831747	4832124	0.97	-	.	g1016
Scaffold_1	AUGUSTUS	transcript	4831747	4832124	0.97	-	.	g1016.t1
Scaffold_1	AUGUSTUS	stop_codon	4831747	4831749	.	-	0	transcript_id "g1016.t1"; gene_id "g1016";
Scaffold_1	AUGUSTUS	CDS	4831747	4832124	0.97	-	0	transcript_id "g1016.t1"; gene_id "g1016";
Scaffold_1	AUGUSTUS	start_codon	4832122	4832124	.	-	0	transcript_id "g1016.t1"; gene_id "g1016";
# protein sequence = [MFLKLEAKPGTLVQTADCAGTGEGVPGAGGEIEIESGMHEEFAAVGTNGGGGSPRRHARFGVATPYLLKYHLGRLAPI
# LSPPRTLTAQQMALEVFVDGEKEEEEKSLIILWFLLLHMLQVMASPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1016
###
# start gene g1017
Scaffold_1	AUGUSTUS	gene	4833806	4834453	0.75	+	.	g1017
Scaffold_1	AUGUSTUS	transcript	4833806	4834453	0.75	+	.	g1017.t1
Scaffold_1	AUGUSTUS	start_codon	4833806	4833808	.	+	0	transcript_id "g1017.t1"; gene_id "g1017";
Scaffold_1	AUGUSTUS	CDS	4833806	4834453	0.75	+	0	transcript_id "g1017.t1"; gene_id "g1017";
Scaffold_1	AUGUSTUS	stop_codon	4834451	4834453	.	+	0	transcript_id "g1017.t1"; gene_id "g1017";
# protein sequence = [MKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREA
# GKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGG
# KHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1017
###
# start gene g1018
Scaffold_1	AUGUSTUS	gene	4835839	4838502	0.26	+	.	g1018
Scaffold_1	AUGUSTUS	transcript	4835839	4838502	0.26	+	.	g1018.t1
Scaffold_1	AUGUSTUS	start_codon	4835839	4835841	.	+	0	transcript_id "g1018.t1"; gene_id "g1018";
Scaffold_1	AUGUSTUS	CDS	4835839	4837121	0.26	+	0	transcript_id "g1018.t1"; gene_id "g1018";
Scaffold_1	AUGUSTUS	CDS	4837317	4838502	0.97	+	1	transcript_id "g1018.t1"; gene_id "g1018";
Scaffold_1	AUGUSTUS	stop_codon	4838500	4838502	.	+	0	transcript_id "g1018.t1"; gene_id "g1018";
# protein sequence = [MPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYL
# GYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLI
# VETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLH
# QFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVAGLELA
# KDPSNERWSLGSDKLLRLDDRIYVLITAIFAFKSFATSMIIHFRPFRPEPHSRSCTYPRRVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPN
# HVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITV
# RPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDY
# LRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDDSLGLLLMNYMLTNLYRRSTPDTLT
# NLDLDHKNHFIPFPFSPRSAEVYFVRLEGKHDDSKLSVYLSLNCLILSFIYYSLIFQN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1018
###
# start gene g1019
Scaffold_1	AUGUSTUS	gene	4840708	4842024	0.62	-	.	g1019
Scaffold_1	AUGUSTUS	transcript	4840708	4842024	0.62	-	.	g1019.t1
Scaffold_1	AUGUSTUS	stop_codon	4840708	4840710	.	-	0	transcript_id "g1019.t1"; gene_id "g1019";
Scaffold_1	AUGUSTUS	CDS	4840708	4841087	0.84	-	2	transcript_id "g1019.t1"; gene_id "g1019";
Scaffold_1	AUGUSTUS	CDS	4841391	4842024	0.63	-	0	transcript_id "g1019.t1"; gene_id "g1019";
Scaffold_1	AUGUSTUS	start_codon	4842022	4842024	.	-	0	transcript_id "g1019.t1"; gene_id "g1019";
# protein sequence = [MFLITAIFAFKSSATFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPV
# RPWDSISMDFIEQLPMSNGLYSYSVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFSGLSVKRSPWNFTIPLDIIR
# KPMGKLSVSIRLSSSTSGSIVPTNKMTGRLYFRSPKKYLGPFKVISRPGTLSYELKLPTIFADSPGFPRLTAGAGYAESFPNRTQSPPPPIEVDGEEE
# YNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPLKPGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1019
###
# start gene g1020
Scaffold_1	AUGUSTUS	gene	4844879	4846173	0.61	-	.	g1020
Scaffold_1	AUGUSTUS	transcript	4844879	4846173	0.61	-	.	g1020.t1
Scaffold_1	AUGUSTUS	stop_codon	4844879	4844881	.	-	0	transcript_id "g1020.t1"; gene_id "g1020";
Scaffold_1	AUGUSTUS	CDS	4844879	4845330	0.91	-	2	transcript_id "g1020.t1"; gene_id "g1020";
Scaffold_1	AUGUSTUS	CDS	4845630	4846173	0.62	-	0	transcript_id "g1020.t1"; gene_id "g1020";
Scaffold_1	AUGUSTUS	start_codon	4846171	4846173	.	-	0	transcript_id "g1020.t1"; gene_id "g1020";
# protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP
# VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG
# DPSGPAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIK
# DEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFCSEPEEGFLGLQDWFY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1020
###
# start gene g1021
Scaffold_1	AUGUSTUS	gene	4848177	4850212	0.62	-	.	g1021
Scaffold_1	AUGUSTUS	transcript	4848177	4850212	0.62	-	.	g1021.t1
Scaffold_1	AUGUSTUS	stop_codon	4848177	4848179	.	-	0	transcript_id "g1021.t1"; gene_id "g1021";
Scaffold_1	AUGUSTUS	CDS	4848177	4848916	0.91	-	2	transcript_id "g1021.t1"; gene_id "g1021";
Scaffold_1	AUGUSTUS	CDS	4848976	4850212	0.62	-	0	transcript_id "g1021.t1"; gene_id "g1021";
Scaffold_1	AUGUSTUS	start_codon	4850210	4850212	.	-	0	transcript_id "g1021.t1"; gene_id "g1021";
# protein sequence = [MDAQPHFTRARARATRPEDDDPAPRQRASLRQSILGPPPASADENPALSDGFADLPATPPPTQAQPFVQPAWILPRPN
# GEAAVRAREAIRASRSRTQVSADFPSASPPQLNAPVDHPSRPPSAAFGLPMAQDPVDSDEEWFGVAASALYEPNDAYATSGEEGSEHHIHSRSRSAFS
# SPGDDNFHRLPPPVELSLSGELVPFLRASAQGLSCQFCPFRTNFLPFPVALEDFVELPPRLASSVPVNRSIHASSRGPFRDPASAPVPDFSNVTRGLQ
# PAPTIHVHGGAPAAQRGRTYESTRRSRPRARTREPSPGPDFGAHLRHSSRSLSPVTHYAPARFDSSSLRSSHNRDRPDNDPYAMHPLSYAQNLRAMEQ
# RVPVKNGRRFRDPRQGEISSSVPAAMLNQVNPLVISALRTEFRLSSGRTWDVDEAGQVKFKTKRLKELSFESISRRDWDSIAKNMPRALKDYFIPPGE
# CGIRSELACEIAQMFKRFFDMLSDQPDFYEAYESYVEYAHKIYSFWFSHLEMNLRIDIFRLSFFDRIWARNVHRNKRWASNLTDTGDTSQASKPKKFQ
# KGSSTSSSNVTKSNANVCHICGSDQHNWSRHEHTGNEFLAKSDSGHWILKDSKKGVCIGFNGLNGCARVIHTVGISPSSHPKKAEIIVRF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1021
###
# start gene g1022
Scaffold_1	AUGUSTUS	gene	4856445	4857638	0.78	-	.	g1022
Scaffold_1	AUGUSTUS	transcript	4856445	4857638	0.78	-	.	g1022.t1
Scaffold_1	AUGUSTUS	stop_codon	4856445	4856447	.	-	0	transcript_id "g1022.t1"; gene_id "g1022";
Scaffold_1	AUGUSTUS	CDS	4856445	4857638	0.78	-	0	transcript_id "g1022.t1"; gene_id "g1022";
Scaffold_1	AUGUSTUS	start_codon	4857636	4857638	.	-	0	transcript_id "g1022.t1"; gene_id "g1022";
# protein sequence = [MQSTPAPMKSYTSTIHRLFTINPTVSPIAHLQAWDLFSHMRYVAHPVPDAILYTEMIRACASSSVNGTSDPERALDLF
# TEMRLDHNIAPLQRTWDSLILACARTSGSLSRRQKYVNEAFRLAREMLDSYRDAYGRPKYTPDKKTFCALLEGAKRIGDLGRVRWILAEMVRGKGVNV
# EVDEEVMMHVFHAYAAYRPPFKRSLARVVEESGNSSVSSEGDVPSAQTPSTNSESVSNASIRTPLSHTDAFSAFSHVPPQTSSEVITEVDILFDRILD
# ERSETKDDDILSGKFSSVKPTTRLLNSYLSVYYNHHQSLEAVRSRLGGVFHQMTDVQPDARTYVEALERCAISKKHERGVALRFAEEVFEKWEGIENK
# VGVGAVVSPRIIERAHVAWIRMLTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1022
###
# start gene g1023
Scaffold_1	AUGUSTUS	gene	4858049	4858854	0.69	-	.	g1023
Scaffold_1	AUGUSTUS	transcript	4858049	4858854	0.69	-	.	g1023.t1
Scaffold_1	AUGUSTUS	stop_codon	4858049	4858051	.	-	0	transcript_id "g1023.t1"; gene_id "g1023";
Scaffold_1	AUGUSTUS	CDS	4858049	4858597	0.88	-	0	transcript_id "g1023.t1"; gene_id "g1023";
Scaffold_1	AUGUSTUS	CDS	4858849	4858854	0.69	-	0	transcript_id "g1023.t1"; gene_id "g1023";
Scaffold_1	AUGUSTUS	start_codon	4858852	4858854	.	-	0	transcript_id "g1023.t1"; gene_id "g1023";
# protein sequence = [MSDTELDPPVFSEEDLLTLYEEVLAHPDIHVQEEGDKKDMQIKTNEFGLELEFGNDPESQHGQDLDVLVKADSRLSSH
# AGMKQQLQHTRFAAALLRESRLNEAPPKSTDTSTTSMTPVYQRVLNHTAHILQDIERVEESLISQPRNAEENSTTKLPIPLLSKQEWDALIRATVCFN
# PFFVSAQD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1023
###
# start gene g1024
Scaffold_1	AUGUSTUS	gene	4870161	4871521	0.35	+	.	g1024
Scaffold_1	AUGUSTUS	transcript	4870161	4871521	0.35	+	.	g1024.t1
Scaffold_1	AUGUSTUS	start_codon	4870161	4870163	.	+	0	transcript_id "g1024.t1"; gene_id "g1024";
Scaffold_1	AUGUSTUS	CDS	4870161	4870572	0.84	+	0	transcript_id "g1024.t1"; gene_id "g1024";
Scaffold_1	AUGUSTUS	CDS	4870628	4871077	0.61	+	2	transcript_id "g1024.t1"; gene_id "g1024";
Scaffold_1	AUGUSTUS	CDS	4871220	4871521	0.61	+	2	transcript_id "g1024.t1"; gene_id "g1024";
Scaffold_1	AUGUSTUS	stop_codon	4871519	4871521	.	+	0	transcript_id "g1024.t1"; gene_id "g1024";
# protein sequence = [MALNSTTPKLLMRKISYPSSFQLKDSVDTNSSVPVQVQARESIVKFKAAALRVLQHMAQSSQQQARKDAFYKIAAMLE
# ELKDDAEGLELEDGRNSARDNLDRAAWMADVLVGSVLGQGVRASASGNEGENEDWADKLTLLSTSNSLPRLQLATMILTKLHTKLEVTSRIANAVDES
# LSKQQKEFFLRQQLRAIEKELKELQQTTSTSGNTNPSNGNNRHSGDLDLDSNESDDTELMDIRRKLEAMTPGSEERKAGVREWRRLKRLLGAGGAGGG
# GGSVEGGVIRGWVEARAQLDSDHYGLDKVKKRLIEYLAVVKLKELAELAEERRLALEAHKPEAAEALEEVAGAADTDGQEKELQVVLRQAQPAIENLP
# AKVQKSKGVKGPILL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1024
###
# start gene g1025
Scaffold_1	AUGUSTUS	gene	4872284	4872799	0.38	+	.	g1025
Scaffold_1	AUGUSTUS	transcript	4872284	4872799	0.38	+	.	g1025.t1
Scaffold_1	AUGUSTUS	start_codon	4872284	4872286	.	+	0	transcript_id "g1025.t1"; gene_id "g1025";
Scaffold_1	AUGUSTUS	CDS	4872284	4872799	0.38	+	0	transcript_id "g1025.t1"; gene_id "g1025";
Scaffold_1	AUGUSTUS	stop_codon	4872797	4872799	.	+	0	transcript_id "g1025.t1"; gene_id "g1025";
# protein sequence = [MYPLVLNCPAVLSLSRYTREAGVRTLERSIGSVVRFKAVEWAECLDAVEAQEGKIVVNEASPHSPSTDLSVINLDHPS
# KTALYKPLVEESELEAILGIARWEDGDESLAERNRGSRRGVVYGLVVMGQGEGGILPVETIVVPTGNKSGSGDGGRLRLTGSLGDVRISLHFS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1025
###
# start gene g1026
Scaffold_1	AUGUSTUS	gene	4873886	4874212	0.37	-	.	g1026
Scaffold_1	AUGUSTUS	transcript	4873886	4874212	0.37	-	.	g1026.t1
Scaffold_1	AUGUSTUS	stop_codon	4873886	4873888	.	-	0	transcript_id "g1026.t1"; gene_id "g1026";
Scaffold_1	AUGUSTUS	CDS	4873886	4874212	0.37	-	0	transcript_id "g1026.t1"; gene_id "g1026";
Scaffold_1	AUGUSTUS	start_codon	4874210	4874212	.	-	0	transcript_id "g1026.t1"; gene_id "g1026";
# protein sequence = [MHTNATVSVSSDGTKATLTIDGDEMIVSILSPSSGATFTTSAAVRFDTDPIPPEADQPNPGVTVLIIEMDAGTTNLQV
# LFSPQWKDGTSSVTPPSVDLANWSLTSHNT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1026
###
# start gene g1027
Scaffold_1	AUGUSTUS	gene	4874355	4876419	0.37	-	.	g1027
Scaffold_1	AUGUSTUS	transcript	4874355	4876419	0.37	-	.	g1027.t1
Scaffold_1	AUGUSTUS	stop_codon	4874355	4874357	.	-	0	transcript_id "g1027.t1"; gene_id "g1027";
Scaffold_1	AUGUSTUS	CDS	4874355	4875404	0.74	-	0	transcript_id "g1027.t1"; gene_id "g1027";
Scaffold_1	AUGUSTUS	CDS	4875601	4875985	0.47	-	1	transcript_id "g1027.t1"; gene_id "g1027";
Scaffold_1	AUGUSTUS	CDS	4876127	4876419	0.46	-	0	transcript_id "g1027.t1"; gene_id "g1027";
Scaffold_1	AUGUSTUS	start_codon	4876417	4876419	.	-	0	transcript_id "g1027.t1"; gene_id "g1027";
# protein sequence = [MAYHDANNQNFSSQNLNSPYAAGDPYYNQSSGFITPPNGEKSKGKGVSKWIKIGIPLAILVIVGVVVGAVVGTKKSKD
# SIAVVLPLNLLLLLLAPPPQPTPQFLLLLPLLPPPKLLLRGPAIHSPLPLLLPPLFVQTDPRLIAPQYKWDVLTDHIAADPYLSYWNETIFGNATDWY
# NDEPVVYFFDGGNGILDIARQFKQRAKAFSYAYRMTNDTKWADRLWVEIQKAAIRFTLIEYGLSFGLQAYNNASSYIGWWKTNTTGNWNCVCNGGLTL
# GSLAILGDDDTGSASQLLALTVPNALENCAAGPTSDGTWSETQDYWYFGTTGYAEMTSALITATGSDYGMLNDAYTLTGYSHMYGQGLTQLFAVGDTG
# PNKFSSTANGLFFFASEFNEPTIALYQRDQADAADPWSMFWYDASVQGAFWDGLPLDRNFDNEIDQWVSMRSTWTDINGTYIGMKAGMNQGRQTHNDL
# DCGDFVLDAMGHRWAGELGDGNYNALDYFSNDTQSSARWYYYRKMTEGQNTILINKSNQNVLARPTILGYDTTNDTQGSSTVYEVASGSTAYWYADIT
# SAYFSDT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1027
###
# start gene g1028
Scaffold_1	AUGUSTUS	gene	4882848	4883318	0.92	-	.	g1028
Scaffold_1	AUGUSTUS	transcript	4882848	4883318	0.92	-	.	g1028.t1
Scaffold_1	AUGUSTUS	stop_codon	4882848	4882850	.	-	0	transcript_id "g1028.t1"; gene_id "g1028";
Scaffold_1	AUGUSTUS	CDS	4882848	4883318	0.92	-	0	transcript_id "g1028.t1"; gene_id "g1028";
Scaffold_1	AUGUSTUS	start_codon	4883316	4883318	.	-	0	transcript_id "g1028.t1"; gene_id "g1028";
# protein sequence = [MSGSPLNEELFKRRAQLFQTTPIVPSQPTTKRSSDVPNFNTGPNKKIKCEFVLASSSAVSDSTTFNTSQSSHDLNLGT
# QTYTQNNQAMRKVDVNDPQVYMERQDKYIEGLRKELMVLQQGRDDFITRERNEVSPLSLQGRSCVPFDEFLCRPSNNN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1028
###
# start gene g1029
Scaffold_1	AUGUSTUS	gene	4894008	4895072	0.3	+	.	g1029
Scaffold_1	AUGUSTUS	transcript	4894008	4895072	0.3	+	.	g1029.t1
Scaffold_1	AUGUSTUS	start_codon	4894008	4894010	.	+	0	transcript_id "g1029.t1"; gene_id "g1029";
Scaffold_1	AUGUSTUS	CDS	4894008	4894169	0.38	+	0	transcript_id "g1029.t1"; gene_id "g1029";
Scaffold_1	AUGUSTUS	CDS	4894262	4894497	0.34	+	0	transcript_id "g1029.t1"; gene_id "g1029";
Scaffold_1	AUGUSTUS	CDS	4894694	4895072	0.72	+	1	transcript_id "g1029.t1"; gene_id "g1029";
Scaffold_1	AUGUSTUS	stop_codon	4895070	4895072	.	+	0	transcript_id "g1029.t1"; gene_id "g1029";
# protein sequence = [MFKYDSVHGRFKGTVETKGGKLIVDGKEISVFGEKDAGAIPWSSVGAEYIVESTASAHLKGGAKKVIISAPSADAPMY
# VCGVNLDSYDSQHAVVSMTGPPSFSQSSDHTLDLQCFLHDELPRTSRQGYPRQIRYLTNDTADVAFFLSFSGLAFRVPTLDVSVVDLVCRTEKSATYD
# EIKAAVKEASEGPLKGILGYTEDHVVSTDFIGDNHSSIFDATAGIQLNKNFVKLIAWYDNEWGYSGRVVDLLVFAAKKDGAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1029
###
# start gene g1030
Scaffold_1	AUGUSTUS	gene	4895477	4896811	1	-	.	g1030
Scaffold_1	AUGUSTUS	transcript	4895477	4896811	1	-	.	g1030.t1
Scaffold_1	AUGUSTUS	stop_codon	4895477	4895479	.	-	0	transcript_id "g1030.t1"; gene_id "g1030";
Scaffold_1	AUGUSTUS	CDS	4895477	4896811	1	-	0	transcript_id "g1030.t1"; gene_id "g1030";
Scaffold_1	AUGUSTUS	start_codon	4896809	4896811	.	-	0	transcript_id "g1030.t1"; gene_id "g1030";
# protein sequence = [MTLRSSSPFRHPKPKRSSRDRLRTTSGREGERERDRDRERDPGSDRDHRHRGDRDRYRDRNRDRDRDSRDRDKDRDRD
# RERDRNSRDRDRDRDRDKERGRNSREREASRERTRDIRRSPRSSSRYDHYHRYSPEGKTYSPRNLGNLGQPPVPAPPHPVLSAPPAPVIPSNIPPIYA
# RFANGHKYEYDNNADLEPLQPPVLPFVTERMERRREAREQKGRSPQDQNPDYRRGQPPPSSYPLPTSSYHPQNPQIIPPSDGRGRGRDRSNRSAHRRA
# GYNGYEDYTYSSTSTPVIPVMATLPNSSSDPINTNIVIPAPSSTRHLSRSRYPPPSSKATRSPYLHTREEYGYKNDHGYNGYNGYNDYNGYNDYNGYG
# RDGRTGAEYQGDGGHRYEPNSNVRNGRSSRSPRTHYPPSPQPTRNPRSPKSPLIMRSKFKENFSVLQSESGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1030
###
# start gene g1031
Scaffold_1	AUGUSTUS	gene	4898641	4899907	0.75	-	.	g1031
Scaffold_1	AUGUSTUS	transcript	4898641	4899907	0.75	-	.	g1031.t1
Scaffold_1	AUGUSTUS	stop_codon	4898641	4898643	.	-	0	transcript_id "g1031.t1"; gene_id "g1031";
Scaffold_1	AUGUSTUS	CDS	4898641	4899336	0.75	-	0	transcript_id "g1031.t1"; gene_id "g1031";
Scaffold_1	AUGUSTUS	CDS	4899404	4899907	0.75	-	0	transcript_id "g1031.t1"; gene_id "g1031";
Scaffold_1	AUGUSTUS	start_codon	4899905	4899907	.	-	0	transcript_id "g1031.t1"; gene_id "g1031";
# protein sequence = [MKESETRIAELELERQYSLSEISRLESNVKQRDADVGTYSSRVVDLEKEIETLRERLSNINRDHARVMNEQERALQAA
# TEHDGETTEQMKDLLKRQGEQNAELRMNKDKVNNLQAELDRLRRQVHTLQQESADKEVKIVQLSKQHDHAKEDLMQMNMALDSKQQELELLKRRHNVR
# GTAGSTSSTPAPSRVSRRDSAVFSTPSTSRPSSVISIGSDKESNTGKSTVTKERKLSSESVPPKMNTLAKSTRMNGPGPTANVSMGPPSTTKPRLAGT
# MGPPRMSMGTPTPIARVASLSRSTTTKPALVSSSTSSGAIAHHRRSSALAGGSGSSTTAGSMKQPSSMPSVPTTLPSAPVTPLPISNLANLMEEKENL
# DTLHNLDATPAKADRGDRRRSMIPTPA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1031
###
# start gene g1032
Scaffold_1	AUGUSTUS	gene	4899939	4901663	0.5	-	.	g1032
Scaffold_1	AUGUSTUS	transcript	4899939	4901663	0.5	-	.	g1032.t1
Scaffold_1	AUGUSTUS	stop_codon	4899939	4899941	.	-	0	transcript_id "g1032.t1"; gene_id "g1032";
Scaffold_1	AUGUSTUS	CDS	4899939	4901663	0.5	-	0	transcript_id "g1032.t1"; gene_id "g1032";
Scaffold_1	AUGUSTUS	start_codon	4901661	4901663	.	-	0	transcript_id "g1032.t1"; gene_id "g1032";
# protein sequence = [MTSTPYRGPARLKGKESAPQDSVQSSVDVVDESIFHSKEKSPKLPSILHDRSHSFSFGQTVFFSMADASKRSSTSSAV
# PSLTSTDTKSSPSPVSLHSSDSPSQSSIRSRSRALSDTVFHSMLRSSPINSKPPEADINDESSSELVVYDPAKPEPDPFSATANTYYTPQTMIPVTPP
# RGLPNHARKTSREDSIIVSLQTQLALQSELCGQYETDLRARDEMVQILGQKVNDLEKEELKRKGILRAWKKKVAELERTCRFLEEEVEGSRQESMDRS
# IMDEASGEALRMLHRQIASLERDKGDMARREEALRDEVQALENIVQDRSEEILSLKETVWSRDESQRELQQGLREAQEQIEQIGNISMVTMDLASVVG
# DGKNDDEKEEERERHRLAEVEWEKQRTEMIMTTEKAKAETVALEGQNEKLRQQLKTTDDELTMLKNELEAQWGHSEKASERIDALEEEKREIEKERHA
# LSGDVEELQERLGVVEGQKTDLENECQSLTATIEQLEERIGNMEVEWEESENRRADLEDAKKALEDEMHQVTEELQQQLQSVSTCHIFLFHVLIFSAG
# ERPSPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1032
###
# start gene g1033
Scaffold_1	AUGUSTUS	gene	4901734	4902726	0.41	-	.	g1033
Scaffold_1	AUGUSTUS	transcript	4901734	4902726	0.41	-	.	g1033.t1
Scaffold_1	AUGUSTUS	stop_codon	4901734	4901736	.	-	0	transcript_id "g1033.t1"; gene_id "g1033";
Scaffold_1	AUGUSTUS	CDS	4901734	4902726	0.41	-	0	transcript_id "g1033.t1"; gene_id "g1033";
Scaffold_1	AUGUSTUS	start_codon	4902724	4902726	.	-	0	transcript_id "g1033.t1"; gene_id "g1033";
# protein sequence = [MWRKLTSALKHGEQDTTSTSTVSQGDVMGKVLEQHPNLSMFHPGPQENAPNSSSPPPSPTKSRRSMFKRGSRMPSDDD
# ERAPSPSLPKLSLGIPKKVKSSLSLAGNRKSLFDQLQNATEIFPESQSSLSRASGKNTLSAATAEANRGLSLDLLRSPSSPNAAFDSIRSSPPEFHQR
# PSIDTLRTLNADADDIRPLTPGILQGSVRSILRDPNTPGTGRNVRFFSRDAYQAVTPEQSTDNEYPPLSVPPVIPTGSAVDLSEPSTLSSVIIRPSSS
# PKNARPSVTEVFSPMRQDSENTSSASPPVPEKDTSNLLDMSQDIQFICILASWFRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1033
###
# start gene g1034
Scaffold_1	AUGUSTUS	gene	4905209	4906009	0.91	-	.	g1034
Scaffold_1	AUGUSTUS	transcript	4905209	4906009	0.91	-	.	g1034.t1
Scaffold_1	AUGUSTUS	stop_codon	4905209	4905211	.	-	0	transcript_id "g1034.t1"; gene_id "g1034";
Scaffold_1	AUGUSTUS	CDS	4905209	4906009	0.91	-	0	transcript_id "g1034.t1"; gene_id "g1034";
Scaffold_1	AUGUSTUS	start_codon	4906007	4906009	.	-	0	transcript_id "g1034.t1"; gene_id "g1034";
# protein sequence = [MKPSTVSPRPILKRSPSACPENDSELPFYGIQEVHFPPSPSLSRFYNAHPSSIYDRSPIVVSANTCALPERGCPGRTY
# TLDERNSSTSQPPIISSALSPRGGHFHPRALMNQRPAQHLQNAIPPHCPPLIPDLSSESEESDGFISPPPEASFASLGPHAYSHRADKYPFQLSLDNA
# VYFTTRLDNIQLPSPADSKRKSHRDRDRIRSPTGPGEVAADDPGYDDDRDVPASSTRSISPKKNRCRKNLSSRARAGSDDAADGGCLGGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1034
###
# start gene g1035
Scaffold_1	AUGUSTUS	gene	4912911	4913687	0.5	-	.	g1035
Scaffold_1	AUGUSTUS	transcript	4912911	4913687	0.5	-	.	g1035.t1
Scaffold_1	AUGUSTUS	stop_codon	4912911	4912913	.	-	0	transcript_id "g1035.t1"; gene_id "g1035";
Scaffold_1	AUGUSTUS	CDS	4912911	4913687	0.5	-	0	transcript_id "g1035.t1"; gene_id "g1035";
Scaffold_1	AUGUSTUS	start_codon	4913685	4913687	.	-	0	transcript_id "g1035.t1"; gene_id "g1035";
# protein sequence = [MDQIDEFEYGVVNTDSACMNDDFVNPLYNETTVSYYPQPPAQPGPDKKENHAAGLLNTEKLYTFSPSSPLLENFYSPV
# TQPVRSPVTHPTSSLYPSPRAPTSAFSKPASGRNRSKSRGPSLSATGTRRDITPASMVPLDAPTQTRNYVLPSSTSRKVNPIHAQKRSYSQAFGDQEQ
# DELVGESPPGPNATEIEHIEWKRRQNTIAARKTRRRKLEYLQRVEAENVVLRDERDKWKVRCGVLEDIVKAHGVAVPVWDDD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1035
###
# start gene g1036
Scaffold_1	AUGUSTUS	gene	4917679	4919986	0.15	-	.	g1036
Scaffold_1	AUGUSTUS	transcript	4917679	4919986	0.15	-	.	g1036.t1
Scaffold_1	AUGUSTUS	stop_codon	4917679	4917681	.	-	0	transcript_id "g1036.t1"; gene_id "g1036";
Scaffold_1	AUGUSTUS	CDS	4917679	4918094	0.73	-	2	transcript_id "g1036.t1"; gene_id "g1036";
Scaffold_1	AUGUSTUS	CDS	4918790	4919062	0.28	-	2	transcript_id "g1036.t1"; gene_id "g1036";
Scaffold_1	AUGUSTUS	CDS	4919199	4919226	0.79	-	0	transcript_id "g1036.t1"; gene_id "g1036";
Scaffold_1	AUGUSTUS	CDS	4919320	4919465	0.63	-	2	transcript_id "g1036.t1"; gene_id "g1036";
Scaffold_1	AUGUSTUS	CDS	4919599	4919986	0.86	-	0	transcript_id "g1036.t1"; gene_id "g1036";
Scaffold_1	AUGUSTUS	start_codon	4919984	4919986	.	-	0	transcript_id "g1036.t1"; gene_id "g1036";
# protein sequence = [MSKVTPTNAGENVYKKSAFLYNRCPLDLPWYTTTGEQDSISAPLGKTLFTLCIRVRFKFFTDYSSDSEFAAGPVKPME
# KGSGKRRNTKSKRESIRPAKKRKVVWSDSEDEEWMTSFDSSVNATSESMVNHAVEIDHGSEDDADDEMQIEDDIDIDEDRQSGEDEDPAHIPKTMAAF
# LPRDLSTLPLFSSIKKADSSHTEDDSDIGMSLRTIVTCKSIIIRTIELEIEKGDYFSQNRNESDKEMDSPVSAIDHTMSEPALISRIVADKSEAWIPI
# TRIVMLTSFDIALKDIDLLDNLQWSCIFVDEVHRVKNLSSQISLALHRFECLRRFGLTGTAIQNSYDELHAILHWTDPGRLGMTKHWKSLISQPLRRG
# QSSTATDAEKAKALVIISILAEVMLSHSDGHEDYFRYISSKIIA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1036
###
# start gene g1037
Scaffold_1	AUGUSTUS	gene	4939257	4941359	0.21	+	.	g1037
Scaffold_1	AUGUSTUS	transcript	4939257	4941359	0.21	+	.	g1037.t1
Scaffold_1	AUGUSTUS	start_codon	4939257	4939259	.	+	0	transcript_id "g1037.t1"; gene_id "g1037";
Scaffold_1	AUGUSTUS	CDS	4939257	4939675	0.48	+	0	transcript_id "g1037.t1"; gene_id "g1037";
Scaffold_1	AUGUSTUS	CDS	4939733	4940061	0.21	+	1	transcript_id "g1037.t1"; gene_id "g1037";
Scaffold_1	AUGUSTUS	CDS	4940221	4941359	0.81	+	2	transcript_id "g1037.t1"; gene_id "g1037";
Scaffold_1	AUGUSTUS	stop_codon	4941357	4941359	.	+	0	transcript_id "g1037.t1"; gene_id "g1037";
# protein sequence = [MGEFSHSTTEAISSANDLLAAHSALVSRVRQSQQNHRRKLQSIQPPPSLELIRLPTIRSPLPSPSSSSSPTENSPIQS
# YNNALPLRLDLPPAKRARVARYKNYVPEEETIRNDYSQRYVDGGEWPQNWVLGADPEHRFEEYPKQQRLLNLKKASVANYSLPPSYLAFSELNSLTPS
# KFDVILLDPPFSSSFTWDHLQELPIPALAADPSFVFLWVGSGAGGGLERGREVLAKWGYRRCEDVVWVKTNLTTGSFTATLVSLDFHPLTSYLVRGTG
# SLFPFFLPVLDTDVIIWEGDPCDPTRKPPEMYTLIENFCLGIRRLEIFGRASSSIRRGWVTVLGQVEEDQLHRTHGVGENVFVDDAEGGEATKWVREI
# WETRIKEMVNGGKPVVPMTADIDALRPKSPFRPGAAGTPHNGPGGNNVGGTMGPGGVTMGMSNSAAVGPRMNISGGNRGVFNPHGSGVMSAPGQNQLM
# GSQPLSGGRMGMNVNMHALGMEMGNGLSMEGMIGAWPGMMGGMSNMGGLGNLGTMGNMGIGNMPGLSTSGMGNMGGGMGMGTNNSLVDIGGMGLHAQP
# GGHVSMNGMNMFNPVMGNMGWGEQGLGMDNNTWDDNMMNVNMNTLGMNMGGSMPGMGQWG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1037
###
# start gene g1038
Scaffold_1	AUGUSTUS	gene	4942912	4944495	0.45	+	.	g1038
Scaffold_1	AUGUSTUS	transcript	4942912	4944495	0.45	+	.	g1038.t1
Scaffold_1	AUGUSTUS	start_codon	4942912	4942914	.	+	0	transcript_id "g1038.t1"; gene_id "g1038";
Scaffold_1	AUGUSTUS	CDS	4942912	4943269	0.45	+	0	transcript_id "g1038.t1"; gene_id "g1038";
Scaffold_1	AUGUSTUS	CDS	4943414	4944495	0.77	+	2	transcript_id "g1038.t1"; gene_id "g1038";
Scaffold_1	AUGUSTUS	stop_codon	4944493	4944495	.	+	0	transcript_id "g1038.t1"; gene_id "g1038";
# protein sequence = [MPPIRSNDHSDIPIISSDDEESTLVPSTQASTPGLFVNSALSPLTEIEDDDDDSASQLPVKQARFSRSSRKFYRESLP
# APIRARRKPSMSDPSSPQSETITVNGHVLTPTIVFDTFWRWYQILCNTYRVLDKTSQYIITQVIQKGSQEPVEIVFRVVLFNIFTKIETWQWLEKRLG
# SITWKDYNQESYMNVLEERAQTHTLYTGAFQSPGPKWDYPETYKNHLLLLETLMDNDIAGKLQKFKSMEKAYAFIASFPSMGDFKSYQLLLNLSYSSV
# INFSGNDFVVPGIGAVSGLGKMFGKSIENAAKVDPNIRIAVIRYMMETQQQHFRRLGLQLSGLGPNRLPMELADIEHAICEVDKYARKAHPWIVDNKN
# GRSELRRKWTPSSEPYPATPVLPQAWSHARRNITRRCNRMPSVQKRWAVEKIVTHRVVRGRIECNVHWYGYSAKDDTWEPVETLFEDIPEVVDDYWKK
# YFGKSYSVA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1038
###
# start gene g1039
Scaffold_1	AUGUSTUS	gene	4945410	4946462	0.22	-	.	g1039
Scaffold_1	AUGUSTUS	transcript	4945410	4946462	0.22	-	.	g1039.t1
Scaffold_1	AUGUSTUS	stop_codon	4945410	4945412	.	-	0	transcript_id "g1039.t1"; gene_id "g1039";
Scaffold_1	AUGUSTUS	CDS	4945410	4946048	0.86	-	0	transcript_id "g1039.t1"; gene_id "g1039";
Scaffold_1	AUGUSTUS	CDS	4946128	4946374	0.4	-	1	transcript_id "g1039.t1"; gene_id "g1039";
Scaffold_1	AUGUSTUS	CDS	4946458	4946462	0.27	-	0	transcript_id "g1039.t1"; gene_id "g1039";
Scaffold_1	AUGUSTUS	start_codon	4946460	4946462	.	-	0	transcript_id "g1039.t1"; gene_id "g1039";
# protein sequence = [MCPYGRAYDYAHPNHPDLYHPHPSKPQVFNRDFTPDQTSRRYSNPQLSFDNQSSSVMPTNEQYGFGTVKTEEWDTFQL
# PPSDVSPDCGVCYGSVYSSSQAPPNTALSIYNNNDENGVIDAWIKQVYDPIPSNKTPPSRPMYAEPRPMFYNANGAYTPYPGRIRTSDELSNTFEETE
# LVDIKPSLNPGLLGYSSEFNRSEYNPGLQFGNVPNSSSLNSRLGMGSLSAEFAGVGMNRTRSGSTSTSEASTSESEASERSGLSRGGVPVSMYYQQVG
# TRTGATESVYSSYAPCSSGLVA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1039
###
# start gene g1040
Scaffold_1	AUGUSTUS	gene	4949381	4949767	0.95	+	.	g1040
Scaffold_1	AUGUSTUS	transcript	4949381	4949767	0.95	+	.	g1040.t1
Scaffold_1	AUGUSTUS	start_codon	4949381	4949383	.	+	0	transcript_id "g1040.t1"; gene_id "g1040";
Scaffold_1	AUGUSTUS	CDS	4949381	4949767	0.95	+	0	transcript_id "g1040.t1"; gene_id "g1040";
Scaffold_1	AUGUSTUS	stop_codon	4949765	4949767	.	+	0	transcript_id "g1040.t1"; gene_id "g1040";
# protein sequence = [MAPHNTSSTEQNFRNNLSQFAWARGSTNDLQPSQQQQSQPRQSGNPFARFYNAVAGDYIPLRSNERSNEDEAWLALSR
# WERCRSICALCLELFPMITQGYWDSERVFLGLLYVFSSRLSPCYGKEMQF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1040
###
# start gene g1041
Scaffold_1	AUGUSTUS	gene	4951363	4955880	0.37	-	.	g1041
Scaffold_1	AUGUSTUS	transcript	4951363	4955880	0.37	-	.	g1041.t1
Scaffold_1	AUGUSTUS	stop_codon	4951363	4951365	.	-	0	transcript_id "g1041.t1"; gene_id "g1041";
Scaffold_1	AUGUSTUS	CDS	4951363	4951707	0.64	-	0	transcript_id "g1041.t1"; gene_id "g1041";
Scaffold_1	AUGUSTUS	CDS	4951799	4952082	0.55	-	2	transcript_id "g1041.t1"; gene_id "g1041";
Scaffold_1	AUGUSTUS	CDS	4952145	4955880	0.67	-	0	transcript_id "g1041.t1"; gene_id "g1041";
Scaffold_1	AUGUSTUS	start_codon	4955878	4955880	.	-	0	transcript_id "g1041.t1"; gene_id "g1041";
# protein sequence = [MLYSFIGLLYSSLPAEAALQFWGAGSQVEPNRTNYLEYLETTAGRLPAFLQWTVWSTQTQDLNMTMALYDMLAGLSKG
# QQCSELAYNFMARGGGEVVPGSSLPSGGSSVSWDVVFGLLESWATGTSARSPIASQGYSQGILGGSSTLMPQSTRSQEMQIGPQDVLLAQSFLRLLSM
# VVTHSVAVRLTISGHAHFRAIPTLVSLIPLRVPLELKGMVFETLAAFCTPGAGIPGVEICRAVWTLMERLEVINVRSGTTVSFGSSFVSVKGVEVELE
# EVEATHGLYPATIPFLKLLSTLIHTPKRIALKDRVSDQASINTIPESLGQPYRLPGIGPFVAFVIDNIFSKISSREYRRPSERWQMNDLCLAFIERVL
# ASYDMESLLAIAEEGSLKENTVVQYLVHPGYEVLKRMLTASNLQTSVLSYVVEGLIGLEKGFAEEEPFFENTITRVLRIVHRVLEIQDIFLDVLVPLT
# LEFDSAPLIGTIHPRSYFIKFDQALSFSADYVPAIAAYVAYPSHFEIVLLSVKIIDLLSASSAFSNLAALIARSDDSDRILGGYLQILSVESTEDISI
# AEATAEQITGAGSPDIEDIPVSLEQATRTAVLDMLIHNTEPRRSYPNTAHYLLFGETNFEQGIQDPHALGSRDACVHVLLQLVNAGIPTNKGKRHDIS
# ATPLFITLPALAERCYHVIYQLCVHPRTSSSMMRYLRTREDFFTRHLSAIPSQVPQMLQEPTIEIQYKDGSRVITTVPTLSSFLRLRSWIFDLVALDL
# HVLTGKGRSRNISEVLDILFGNESVLEESASWQDEVFKPFHEVGQSHLKIIEFVQSLTFEWGDSLATKPVDLQLLAEVNLQVCLRKDAAGCEIIDRSA
# LLMLLTASRRALFAQNKIITSVQVQQLEAETSYILESSAIENHRRQVVHAISTGFEAWRRVLDITLTRCFDYLPQDHRENMLFDILHVLPPIIKSEDI
# HESTAVLLSEVVLSSITKLYEDRRHQIILQSAGGDPHSDLLPAERLYLILRSILECIIGSNHIELVRGNLYAALINYVNLVSSSEDSTSKSQSLAVSV
# FGSTREASPFSSSLSVVPHIPLSQNSQLQANSLALLKTGLERLLITISRDAIDGTEVWRTVAFMLLDSLIQLSALEKQHPVLLQLTRHGILSNFVQGV
# KESDSLLQCVLKPDPGNIISLSRCFRSLKLSLSLDDLNPLYVYESKMSFFIRVAETRTGAEQLLDVRLIPTLAQCDFLDSRPEADASFVDHDSFLPSA
# IQRYHNLFMPSLQIINAMLATLGSKHATASNQVRIETSDSQIMLTISERPWILYRGTVQQSSFSSKMKRRTFRWLYLKKSIYLSRFASTHSGFGAING
# AILALSTKCLGRGTWTDAIKPQTDSEILRASVLASGRIATFFPSICVECLLIGSSSDSNFDIEVRRKERLLRKALIAYAGATSEFTGMHILIPRRYLS
# AYTW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1041
###
# start gene g1042
Scaffold_1	AUGUSTUS	gene	4958990	4959667	0.99	+	.	g1042
Scaffold_1	AUGUSTUS	transcript	4958990	4959667	0.99	+	.	g1042.t1
Scaffold_1	AUGUSTUS	start_codon	4958990	4958992	.	+	0	transcript_id "g1042.t1"; gene_id "g1042";
Scaffold_1	AUGUSTUS	CDS	4958990	4959667	0.99	+	0	transcript_id "g1042.t1"; gene_id "g1042";
Scaffold_1	AUGUSTUS	stop_codon	4959665	4959667	.	+	0	transcript_id "g1042.t1"; gene_id "g1042";
# protein sequence = [MAKFTTPDLADVVVPHRPQFVHHTSSSLSKANSISEEQHISTRRQLPLPPTQGIHDASASGFGYRDVHDLQSYLQPDL
# THEESYISLPNPYSTRHSHRSYSESSVSRSVTPSHNIHSTSFVHSDATPFVSSVNPTSEDFSPSEVSGYGFSFTPTRQIQRTTPADGEYSSDSDIKQR
# QGQFFVLSVDGMTVSPLVHTDSGIRLLHRPRNDVYPELQPELPPMYTVE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1042
###
# start gene g1043
Scaffold_1	AUGUSTUS	gene	4962663	4962989	0.98	-	.	g1043
Scaffold_1	AUGUSTUS	transcript	4962663	4962989	0.98	-	.	g1043.t1
Scaffold_1	AUGUSTUS	stop_codon	4962663	4962665	.	-	0	transcript_id "g1043.t1"; gene_id "g1043";
Scaffold_1	AUGUSTUS	CDS	4962663	4962989	0.98	-	0	transcript_id "g1043.t1"; gene_id "g1043";
Scaffold_1	AUGUSTUS	start_codon	4962987	4962989	.	-	0	transcript_id "g1043.t1"; gene_id "g1043";
# protein sequence = [MLSRTETRALAAIAKIRKELDSELKPELEYIKFDLLSLKSAKEAAEEFMRREKRLDILVNNAGIVNTKFVNLYSRLIF
# QTSVCRWLPHMSLALMELKYKPATGLVTSH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1043
###
# start gene g1044
Scaffold_1	AUGUSTUS	gene	4968741	4969322	0.39	-	.	g1044
Scaffold_1	AUGUSTUS	transcript	4968741	4969322	0.39	-	.	g1044.t1
Scaffold_1	AUGUSTUS	stop_codon	4968741	4968743	.	-	0	transcript_id "g1044.t1"; gene_id "g1044";
Scaffold_1	AUGUSTUS	CDS	4968741	4969322	0.39	-	0	transcript_id "g1044.t1"; gene_id "g1044";
Scaffold_1	AUGUSTUS	start_codon	4969320	4969322	.	-	0	transcript_id "g1044.t1"; gene_id "g1044";
# protein sequence = [MGGSSAPASAVSPITTSLNDSYSEVRSLGPGIGYGRASSLSSSSGDSPSSQGASPSGRRVPVSNFTTSSSFNSVTLSI
# PRSSLRSESVFSESERSSSLEEEDEAGEEDYPMNEYHDHEFELDVDGDDVLDIPGRRRDVYAFSGRGDLEKKNFDEYGFEYEVGLGMGVPKTKVATPM
# GLDSMKEEDWEMEMDMD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1044
###
# start gene g1045
Scaffold_1	AUGUSTUS	gene	4973064	4974803	0.91	-	.	g1045
Scaffold_1	AUGUSTUS	transcript	4973064	4974803	0.91	-	.	g1045.t1
Scaffold_1	AUGUSTUS	stop_codon	4973064	4973066	.	-	0	transcript_id "g1045.t1"; gene_id "g1045";
Scaffold_1	AUGUSTUS	CDS	4973064	4974803	0.91	-	0	transcript_id "g1045.t1"; gene_id "g1045";
Scaffold_1	AUGUSTUS	start_codon	4974801	4974803	.	-	0	transcript_id "g1045.t1"; gene_id "g1045";
# protein sequence = [MKESRHPNIVLFLGLSRAPEPDNRIFIVSEFIDNGNLRHYIHDKNKPFPWRLRLSFATDIARALAYLHARKCIHRDLK
# GENLLVTANGRLKITDFGFARIAARSEDESKRLTFCGTDSYMSPEILLGEEFDLPTDIFSFGIILCEISARRLADDHHFKRAAPSFSIDADEIRSLAN
# PGCPPDLISLCIECCSSNPAARPTTRQILEKLRVIEAEVLSRPNEGEDVNVGSIKFMTGHKRPGPQLRIPSFGMGVGKDIRNSGSSTDDSDDEDELME
# AVQGLSGVGLNSDWTEAPNGKSQFSNPRPNWNSILLTGKEPLLNGNASAISEYSTTVVRAHPNHDGNGTQPPSLSSILTIRASPDPNAINNQVLPGSD
# HSPEASTIMAEHPANGSDLLGHSSILSIDSLDSYHTAAGSSIISSTMATEGGSTIKSLHGNYSAPLVHRFTILKPGAKPTKKSGNSTPPTNAPVAEPL
# SWNPFDLFFSGGSLVSKCDVCSKRFGPWKPILECDDCGLKYVPLLNSAPCFSSYPELMLNAVTMHQSTVVCALYVLEYIISPATRWESSSLERARRQL
# VHPGDNMLRAQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1045
###
# start gene g1046
Scaffold_1	AUGUSTUS	gene	4986639	4987229	0.57	-	.	g1046
Scaffold_1	AUGUSTUS	transcript	4986639	4987229	0.57	-	.	g1046.t1
Scaffold_1	AUGUSTUS	stop_codon	4986639	4986641	.	-	0	transcript_id "g1046.t1"; gene_id "g1046";
Scaffold_1	AUGUSTUS	CDS	4986639	4987229	0.57	-	0	transcript_id "g1046.t1"; gene_id "g1046";
Scaffold_1	AUGUSTUS	start_codon	4987227	4987229	.	-	0	transcript_id "g1046.t1"; gene_id "g1046";
# protein sequence = [MSLSTSYVSQYPRISGPALAALSSLSASDILWIKSLPKAELHAHLNGCVPIEVLYEIAGSSLNDFSSDPPTGTEALNK
# SVLTRTEILSGLETLSNFALDDIHEFFGAFRTIYALISTRKTLGAATRAVLQGFLDAPNKRKGNNISGLEGGLTPDDYPECTYLELRTTPRRTPTLSP
# KEYLETVLDEVGSTQGTGLH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1046
###
# start gene g1047
Scaffold_1	AUGUSTUS	gene	4993240	4994138	0.38	+	.	g1047
Scaffold_1	AUGUSTUS	transcript	4993240	4994138	0.38	+	.	g1047.t1
Scaffold_1	AUGUSTUS	start_codon	4993240	4993242	.	+	0	transcript_id "g1047.t1"; gene_id "g1047";
Scaffold_1	AUGUSTUS	CDS	4993240	4993683	0.38	+	0	transcript_id "g1047.t1"; gene_id "g1047";
Scaffold_1	AUGUSTUS	CDS	4993734	4994138	1	+	0	transcript_id "g1047.t1"; gene_id "g1047";
Scaffold_1	AUGUSTUS	stop_codon	4994136	4994138	.	+	0	transcript_id "g1047.t1"; gene_id "g1047";
# protein sequence = [MNVHNSLDLLRKTAFTFPAIDNHAHPLLRSQYRGKVPFETIISETSSELALQQEATQMIACFRAAAQLSKVLGVEQVI
# GQSLWQQVKQRRDAMDYDELCDTFMKACGIQSILLDDGLGGVSEWCEDWKWHRRFGCDTKRIVRIEIEAEKILLPLLQPLLASESALQNPSESIGSGL
# RNQLQSILVEFFQQLNTSLTDSARKPEVVSFKSIACYRGGLNIRPRVELGISVAQTEHNYDYVVDSLFQVLFHIKNTGSVRLAHGTINEWIVHWALRV
# AGENNIPG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1047
###
# start gene g1048
Scaffold_1	AUGUSTUS	gene	5003218	5004771	0.75	+	.	g1048
Scaffold_1	AUGUSTUS	transcript	5003218	5004771	0.75	+	.	g1048.t1
Scaffold_1	AUGUSTUS	start_codon	5003218	5003220	.	+	0	transcript_id "g1048.t1"; gene_id "g1048";
Scaffold_1	AUGUSTUS	CDS	5003218	5004771	0.75	+	0	transcript_id "g1048.t1"; gene_id "g1048";
Scaffold_1	AUGUSTUS	stop_codon	5004769	5004771	.	+	0	transcript_id "g1048.t1"; gene_id "g1048";
# protein sequence = [MGQLAGAITTPSLEELNVDIDLGRGGISHTMAPNGAANGVQHFSYIEEVVHALLHRGSPAPADKLKALSIAFGFGNGR
# RATKERDSDPYLQALKFAQACPCAGTTFLPPGHYATPTPSVVHISWQFLASLPALQSLKVGLGGHAGPVWPSNVNTSVNNIPYTGGSVDIEHFLSSLC
# VPDEDYMTGSATLGIHGPIPGPPAGNNVVTFTVGFNHQPTLNNHNNAAALNAIFAGGIPPPPPIHINQQFNPGNLGLPPLPPPPGGPAYIPPHHMIIP
# MGGGPGPNPAQIPTNGWLLPNLTELGVKAGSTIFSPATTGGINALFSSSSSAHSYGVMYPPIMPSYNSWSSLDDSSNIPGAGYVRRLLELIEGRNPKT
# GQGQNIDGVVPERLKSLEIVLNVAGIPARGVGHANGLFTKNGNKGVPKKKAAKDKESEMPSTAALENSEGSVQEIVAAISASASGLSNVPAKEKVLKS
# RNTNAATARTLIGSDSATWIEERIEEVSVRCECMLGESGGMGMPRMW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1048
###
# start gene g1049
Scaffold_1	AUGUSTUS	gene	5007552	5008229	0.94	-	.	g1049
Scaffold_1	AUGUSTUS	transcript	5007552	5008229	0.94	-	.	g1049.t1
Scaffold_1	AUGUSTUS	stop_codon	5007552	5007554	.	-	0	transcript_id "g1049.t1"; gene_id "g1049";
Scaffold_1	AUGUSTUS	CDS	5007552	5008229	0.94	-	0	transcript_id "g1049.t1"; gene_id "g1049";
Scaffold_1	AUGUSTUS	start_codon	5008227	5008229	.	-	0	transcript_id "g1049.t1"; gene_id "g1049";
# protein sequence = [MSELQDELTQDLSKLEINSRSKDSGAKSPEAKPVESIEFVLCDTEASFSSAVSLLEPSSSLIIDCEGLDLGVNGGALS
# LVCIRSMAPQISQNFLFDFVALSALRCSLQPLFSLLTSPTILKILYDGRMDFSALYHGYNMELVNVIDLELVDIKSRFTRGETPEKHKQRLMRCFSYK
# QVNNVRSAYKYKDVHVFQGLGSCLIEHGCKATSPKKHGKQSIDSYIART]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1049
###
# start gene g1050
Scaffold_1	AUGUSTUS	gene	5008944	5009429	0.42	+	.	g1050
Scaffold_1	AUGUSTUS	transcript	5008944	5009429	0.42	+	.	g1050.t1
Scaffold_1	AUGUSTUS	start_codon	5008944	5008946	.	+	0	transcript_id "g1050.t1"; gene_id "g1050";
Scaffold_1	AUGUSTUS	CDS	5008944	5009429	0.42	+	0	transcript_id "g1050.t1"; gene_id "g1050";
Scaffold_1	AUGUSTUS	stop_codon	5009427	5009429	.	+	0	transcript_id "g1050.t1"; gene_id "g1050";
# protein sequence = [MMVIVLMPQTYAQTRDASPDNAYNAYAHPLTLTSGDVYGQMGTIHPEDNIHLMNGMSEVGGDAFMQTLATQLSPAYVY
# DLNLNSASYASQNQSQNRSQASHLSHLLNEESVDPIASRAQSTSQPKGKGKPCAVDDDEAQEERGQHNEEQVKREITEEEKRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1050
###
# start gene g1051
Scaffold_1	AUGUSTUS	gene	5010489	5012480	0.33	-	.	g1051
Scaffold_1	AUGUSTUS	transcript	5010489	5012480	0.33	-	.	g1051.t1
Scaffold_1	AUGUSTUS	stop_codon	5010489	5010491	.	-	0	transcript_id "g1051.t1"; gene_id "g1051";
Scaffold_1	AUGUSTUS	CDS	5010489	5010598	0.97	-	2	transcript_id "g1051.t1"; gene_id "g1051";
Scaffold_1	AUGUSTUS	CDS	5010648	5010961	1	-	1	transcript_id "g1051.t1"; gene_id "g1051";
Scaffold_1	AUGUSTUS	CDS	5011018	5011221	0.99	-	1	transcript_id "g1051.t1"; gene_id "g1051";
Scaffold_1	AUGUSTUS	CDS	5011303	5011505	0.83	-	0	transcript_id "g1051.t1"; gene_id "g1051";
Scaffold_1	AUGUSTUS	CDS	5011605	5012155	0.93	-	2	transcript_id "g1051.t1"; gene_id "g1051";
Scaffold_1	AUGUSTUS	CDS	5012215	5012328	0.8	-	2	transcript_id "g1051.t1"; gene_id "g1051";
Scaffold_1	AUGUSTUS	CDS	5012420	5012480	0.39	-	0	transcript_id "g1051.t1"; gene_id "g1051";
Scaffold_1	AUGUSTUS	start_codon	5012478	5012480	.	-	0	transcript_id "g1051.t1"; gene_id "g1051";
# protein sequence = [MDDQDIARDIKHWPFEVREKDDVQTPEEISAMVLTKMKETAEAYLGEKVTHAVVTVPAYFNDAQRQATKDAGTIAGLQ
# VLRIINEPTAAAIAYGLNKKGGESQIIVYDLGGGTFDVSLLSIDDGVFEVLATAGDTHLGGEDFDNRVIDYLVKSYKKKTGTDVSKNLRALGKLKREV
# EKAKRILSSQQSTRIEIESFEDGNDFSETLTRAKFEELNMDLFRKTMKPVEQVLKDANVKKDDIDELLKEYFGGKEPSKGINPDEAVAYGAAVQGGIL
# SGAEGTADVVLVDVCPLTLGIETTGGVMTKLIPRKLFSTAADNQPTVLIQVFEGERTLTKDNNLLGKFELSSIPPAPRGVPQIEVTFEIDANGIMKVG
# AADKATGKSESITITNEKGRLSQEEIDRMVADAEKFASEDEAQRKRIESLNSLSTFVYGLRTQVNDEEGMGGKISAEDKKTLLATIKETTEWIDENGV
# SATAEDLEEKLAEVQGIVNPITTKMYSGGGPSYGEDDDDEATRDHDEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/7
# CDS introns: 0/6
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1051
###
# start gene g1052
Scaffold_1	AUGUSTUS	gene	5014948	5015304	0.47	+	.	g1052
Scaffold_1	AUGUSTUS	transcript	5014948	5015304	0.47	+	.	g1052.t1
Scaffold_1	AUGUSTUS	start_codon	5014948	5014950	.	+	0	transcript_id "g1052.t1"; gene_id "g1052";
Scaffold_1	AUGUSTUS	CDS	5014948	5015304	0.47	+	0	transcript_id "g1052.t1"; gene_id "g1052";
Scaffold_1	AUGUSTUS	stop_codon	5015302	5015304	.	+	0	transcript_id "g1052.t1"; gene_id "g1052";
# protein sequence = [MDHTGPMTRTCFDNALLLKALAGKDNIDDRCIATPSPSEIPDYPAILDEVKGAAKPLEGFKIGLLTEGFSDIPCEQGA
# MNDARVSRKVRDAADKWKEMGASVEDVSIPVSNHPKYFQL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1052
###
# start gene g1053
Scaffold_1	AUGUSTUS	gene	5016638	5017042	0.76	-	.	g1053
Scaffold_1	AUGUSTUS	transcript	5016638	5017042	0.76	-	.	g1053.t1
Scaffold_1	AUGUSTUS	stop_codon	5016638	5016640	.	-	0	transcript_id "g1053.t1"; gene_id "g1053";
Scaffold_1	AUGUSTUS	CDS	5016638	5017042	0.76	-	0	transcript_id "g1053.t1"; gene_id "g1053";
Scaffold_1	AUGUSTUS	start_codon	5017040	5017042	.	-	0	transcript_id "g1053.t1"; gene_id "g1053";
# protein sequence = [MAFAPRGFHFDLKTVLSDPNPHIDLDIPVYEETLQNFLKAVNNYKNRSITAITDKRTKDAAEKKKLHDRAQKIEAEIS
# KCKVQEIELMASECFAWSTASPTQHVTSYSFRERAGGKERCRGSGDRIQTTNHIPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1053
###
# start gene g1054
Scaffold_1	AUGUSTUS	gene	5026784	5027173	0.51	+	.	g1054
Scaffold_1	AUGUSTUS	transcript	5026784	5027173	0.51	+	.	g1054.t1
Scaffold_1	AUGUSTUS	start_codon	5026784	5026786	.	+	0	transcript_id "g1054.t1"; gene_id "g1054";
Scaffold_1	AUGUSTUS	CDS	5026784	5027173	0.51	+	0	transcript_id "g1054.t1"; gene_id "g1054";
Scaffold_1	AUGUSTUS	stop_codon	5027171	5027173	.	+	0	transcript_id "g1054.t1"; gene_id "g1054";
# protein sequence = [MKNVSGNSRYDFHKLHNVTKTVTFNLNRIIDRNFYPVVEARRSNTRNRPIGIGVQGLADTFMALKMPFDSAEAKQLNV
# SIFETIYHGACEASCEIAMTDGPYATWEDSPAQQGKLQFDLWGVSPTDLWD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1054
###
# start gene g1055
Scaffold_1	AUGUSTUS	gene	5027446	5028084	0.45	+	.	g1055
Scaffold_1	AUGUSTUS	transcript	5027446	5028084	0.45	+	.	g1055.t1
Scaffold_1	AUGUSTUS	start_codon	5027446	5027448	.	+	0	transcript_id "g1055.t1"; gene_id "g1055";
Scaffold_1	AUGUSTUS	CDS	5027446	5028084	0.45	+	0	transcript_id "g1055.t1"; gene_id "g1055";
Scaffold_1	AUGUSTUS	stop_codon	5028082	5028084	.	+	0	transcript_id "g1055.t1"; gene_id "g1055";
# protein sequence = [MMLMADHGSVQNIPAIPDDVKAVYKTVWEIPQKTILDFAVDRGAFICQSQSLNIHLASPSVGQLTSMHFYGWRKGLKT
# GMYYLRTTSAARPIQITVDNAISKEMKNRRSDFGFNSVVNFTTTESAAISSTQADGCSFLSTDLVSSTRMSHMSSMPIDDSLISSVCNADESNEADEV
# EIEDSATTCSHLQQRSVQFGNTNSFVNEVPCEMCSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1055
###
# start gene g1056
Scaffold_1	AUGUSTUS	gene	5038871	5039378	0.47	+	.	g1056
Scaffold_1	AUGUSTUS	transcript	5038871	5039378	0.47	+	.	g1056.t1
Scaffold_1	AUGUSTUS	start_codon	5038871	5038873	.	+	0	transcript_id "g1056.t1"; gene_id "g1056";
Scaffold_1	AUGUSTUS	CDS	5038871	5038895	0.5	+	0	transcript_id "g1056.t1"; gene_id "g1056";
Scaffold_1	AUGUSTUS	CDS	5038939	5039378	0.47	+	2	transcript_id "g1056.t1"; gene_id "g1056";
Scaffold_1	AUGUSTUS	stop_codon	5039376	5039378	.	+	0	transcript_id "g1056.t1"; gene_id "g1056";
# protein sequence = [MAGKEFNCTSSLIVAFQSHAVASSSADHMNISKADILNPDSDELSSSTNPAVKLAFAETHILNETKAYLESNGVVLVS
# FSSSGTVRADTTILVKNICYGTSDIEIRELFEPHGTVSRVLVSPAGTIAVVEFEKPDKASRGFRAVGYRQSGKSVI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1056
###
# start gene g1057
Scaffold_1	AUGUSTUS	gene	5043178	5043630	0.68	-	.	g1057
Scaffold_1	AUGUSTUS	transcript	5043178	5043630	0.68	-	.	g1057.t1
Scaffold_1	AUGUSTUS	stop_codon	5043178	5043180	.	-	0	transcript_id "g1057.t1"; gene_id "g1057";
Scaffold_1	AUGUSTUS	CDS	5043178	5043630	0.68	-	0	transcript_id "g1057.t1"; gene_id "g1057";
Scaffold_1	AUGUSTUS	start_codon	5043628	5043630	.	-	0	transcript_id "g1057.t1"; gene_id "g1057";
# protein sequence = [MVTTKQRGKSDVCTRRGQLGGNISPQEEKKFRRNCNNSVELIYHVTADIPDIAYPQSHDISVPLNCYNSVERNFFSSR
# GETSVLCSGTLTPSMFSTFDSSPASIIDNGIGYYSSHSQNHPKDPVDLNLDEKIPENENNTEGSLVTLDGLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1057
###
# start gene g1058
Scaffold_1	AUGUSTUS	gene	5061388	5062371	0.81	+	.	g1058
Scaffold_1	AUGUSTUS	transcript	5061388	5062371	0.81	+	.	g1058.t1
Scaffold_1	AUGUSTUS	start_codon	5061388	5061390	.	+	0	transcript_id "g1058.t1"; gene_id "g1058";
Scaffold_1	AUGUSTUS	CDS	5061388	5062371	0.81	+	0	transcript_id "g1058.t1"; gene_id "g1058";
Scaffold_1	AUGUSTUS	stop_codon	5062369	5062371	.	+	0	transcript_id "g1058.t1"; gene_id "g1058";
# protein sequence = [MVVFEQNPGKFHIIINHSYPQSDLPCPSEICSLLPDSLIVDPSKISINSLINSDDYPCDWGTFADYYLQVTVAPKGTQ
# VAVFDVDAAFRNMPLHRSTRRFIALFIDNLIFLDLCLNFSKRSAPGIRGQITDVMVKILCKHGVEALLEWVNDFIFLRFPKSCNSDGSFTYSYNETLV
# WAVTAKLGWPWAPKEFVSFSFSFLYIDFLWVLSAKTVQLPLEKKVKYATCVLPCTEPDALMTLDKAEELTGTLNHVCLVLPTARTHLVSLYKFSAGFK
# HSRSNMAAHRISFLLREDLTWWLQTFEANFVGMSIFTLPDYIDISLYVDASTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1058
###
# start gene g1059
Scaffold_1	AUGUSTUS	gene	5073110	5073743	0.5	-	.	g1059
Scaffold_1	AUGUSTUS	transcript	5073110	5073743	0.5	-	.	g1059.t1
Scaffold_1	AUGUSTUS	stop_codon	5073110	5073112	.	-	0	transcript_id "g1059.t1"; gene_id "g1059";
Scaffold_1	AUGUSTUS	CDS	5073110	5073495	0.55	-	2	transcript_id "g1059.t1"; gene_id "g1059";
Scaffold_1	AUGUSTUS	CDS	5073662	5073743	0.5	-	0	transcript_id "g1059.t1"; gene_id "g1059";
Scaffold_1	AUGUSTUS	start_codon	5073741	5073743	.	-	0	transcript_id "g1059.t1"; gene_id "g1059";
# protein sequence = [MTKALTIKLAQAAPEIIIQAQAGFVPGLQALYKDAYTTTIVNGQKSETPFKVTRGLRQGDPLSCLLFDIAIDPLRELL
# RKSNLKGYQIPGYAERLIATFFTDNPTVYLSKEDDFGELQLILDEWCTASGARFNINKTEIIPIGSQITKKTCAKHG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1059
###
# start gene g1060
Scaffold_1	AUGUSTUS	gene	5078737	5079480	0.59	-	.	g1060
Scaffold_1	AUGUSTUS	transcript	5078737	5079480	0.59	-	.	g1060.t1
Scaffold_1	AUGUSTUS	stop_codon	5078737	5078739	.	-	0	transcript_id "g1060.t1"; gene_id "g1060";
Scaffold_1	AUGUSTUS	CDS	5078737	5079480	0.59	-	0	transcript_id "g1060.t1"; gene_id "g1060";
Scaffold_1	AUGUSTUS	start_codon	5079478	5079480	.	-	0	transcript_id "g1060.t1"; gene_id "g1060";
# protein sequence = [MLNETWPTSIVPYIYMNAPTSTTNSSGIPHTDPNNCFSVEYFVCELLRRSSTSSMVFFTAICYVEAVRSKVQGVFTSD
# DYHVYVELNIAAKRTCTDIRSDVLYQNQLFFSTNTTSDKNQLRNSSFDIANEECIDGTAADIEILDNKEVIEKTMSEMVVHRRMESPNLFSVQPLPSP
# LLCPRRTFIASLVLASKFNDDKPISNGTWSKLCNLPPLEIGRCERALGIALDWRLWVGKPNRRVDNSVIHI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1060
###
# start gene g1061
Scaffold_1	AUGUSTUS	gene	5092831	5093064	0.69	+	.	g1061
Scaffold_1	AUGUSTUS	transcript	5092831	5093064	0.69	+	.	g1061.t1
Scaffold_1	AUGUSTUS	start_codon	5092831	5092833	.	+	0	transcript_id "g1061.t1"; gene_id "g1061";
Scaffold_1	AUGUSTUS	CDS	5092831	5093064	0.69	+	0	transcript_id "g1061.t1"; gene_id "g1061";
Scaffold_1	AUGUSTUS	stop_codon	5093062	5093064	.	+	0	transcript_id "g1061.t1"; gene_id "g1061";
# protein sequence = [MDFENLENIHDLETCEGRKPSDSSEPEEESSSIDGSDDNEDEDDPDHSDNSEISNSLGRIDKFLTFTSESKPLGKKQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1061
###
# start gene g1062
Scaffold_1	AUGUSTUS	gene	5099629	5100215	0.94	+	.	g1062
Scaffold_1	AUGUSTUS	transcript	5099629	5100215	0.94	+	.	g1062.t1
Scaffold_1	AUGUSTUS	start_codon	5099629	5099631	.	+	0	transcript_id "g1062.t1"; gene_id "g1062";
Scaffold_1	AUGUSTUS	CDS	5099629	5099706	0.94	+	0	transcript_id "g1062.t1"; gene_id "g1062";
Scaffold_1	AUGUSTUS	CDS	5099763	5100215	1	+	0	transcript_id "g1062.t1"; gene_id "g1062";
Scaffold_1	AUGUSTUS	stop_codon	5100213	5100215	.	+	0	transcript_id "g1062.t1"; gene_id "g1062";
# protein sequence = [MAFTASTAYVTEIRLEGLIVLRDVIQIFAKSPDPAFEDALLLKQHQSPITAALTPAFSTDSTPEILASAVHACVTFVG
# CGVVKHVSSMGRILKLLTVALEQSKGVDNSLQRFYCLQAAPDSGMVSLGETGELSPNGSAMLRISALSAWPQLERLAISRPTSLTSSNHIDQYWQLCG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1062
###
# start gene g1063
Scaffold_1	AUGUSTUS	gene	5107686	5108149	0.45	+	.	g1063
Scaffold_1	AUGUSTUS	transcript	5107686	5108149	0.45	+	.	g1063.t1
Scaffold_1	AUGUSTUS	start_codon	5107686	5107688	.	+	0	transcript_id "g1063.t1"; gene_id "g1063";
Scaffold_1	AUGUSTUS	CDS	5107686	5107832	0.45	+	0	transcript_id "g1063.t1"; gene_id "g1063";
Scaffold_1	AUGUSTUS	CDS	5107919	5108149	0.95	+	0	transcript_id "g1063.t1"; gene_id "g1063";
Scaffold_1	AUGUSTUS	stop_codon	5108147	5108149	.	+	0	transcript_id "g1063.t1"; gene_id "g1063";
# protein sequence = [MIEEQKKEMPHVTTGDLTGKTIMITGANSGIGFQAAKHFASMNPTRLIVMIEEIEADTVYKGAEPMALKLSSFHLSNK
# TLDRLDIIDENAAISTNYEYITTNDGTFTSSRYIHPTVNVLGPPRTY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1063
###
# start gene g1064
Scaffold_1	AUGUSTUS	gene	5111109	5112141	0.62	+	.	g1064
Scaffold_1	AUGUSTUS	transcript	5111109	5112141	0.62	+	.	g1064.t1
Scaffold_1	AUGUSTUS	start_codon	5111109	5111111	.	+	0	transcript_id "g1064.t1"; gene_id "g1064";
Scaffold_1	AUGUSTUS	CDS	5111109	5111244	0.89	+	0	transcript_id "g1064.t1"; gene_id "g1064";
Scaffold_1	AUGUSTUS	CDS	5111498	5112141	0.62	+	2	transcript_id "g1064.t1"; gene_id "g1064";
Scaffold_1	AUGUSTUS	stop_codon	5112139	5112141	.	+	0	transcript_id "g1064.t1"; gene_id "g1064";
# protein sequence = [MSFTSPSTPNPVSPPVSPPPHPNSAEMTVDAPIDELASTIEEPPLVFACRFLEVHGDSGQRTHFTLPSEQWRNIAEKI
# EASTNSTVALIKLNALDEQDQQELDQLELGEFLRKQPQLPGPSASSSLPLPSPSVMATRRMPAKRRKRSVQQEEGGSSWHKHPVEEVSELDVVPKAHN
# CKRKHPVGGRRDAEIPDYCRVVVDLRPHFVDTPALATLSGGPINETMHLRELGDSLGLFRREVKAYIGSYRQLERQQMRVKRN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1064
###
# start gene g1065
Scaffold_1	AUGUSTUS	gene	5116730	5117798	0.36	+	.	g1065
Scaffold_1	AUGUSTUS	transcript	5116730	5117798	0.36	+	.	g1065.t1
Scaffold_1	AUGUSTUS	start_codon	5116730	5116732	.	+	0	transcript_id "g1065.t1"; gene_id "g1065";
Scaffold_1	AUGUSTUS	CDS	5116730	5116786	0.36	+	0	transcript_id "g1065.t1"; gene_id "g1065";
Scaffold_1	AUGUSTUS	CDS	5116887	5117798	0.62	+	0	transcript_id "g1065.t1"; gene_id "g1065";
Scaffold_1	AUGUSTUS	stop_codon	5117796	5117798	.	+	0	transcript_id "g1065.t1"; gene_id "g1065";
# protein sequence = [MDFIEQLPMSNGYTAILVVHGVPNHVTSDRSSEFVLAFFRALGKALSMELHYTSGYHPEADWQSERVNQTLKQYIRIY
# CSYQQDDWSPLLPIAEFAYNNAPNAPTGITPFFANKGYHPNITVWPKINMKSDLARDFVVNLNELHVFLREEILLAHSHYKEQADRKRISHPEFPIGS
# KVFVLAKHIRSTRPTEKFSEKYLGPFKIISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEQYNIAEILDSKLNRRY
# KRCPLRYYIRWAGYEGTDNESSWVAADELHADELVPAFHARYPLKPGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1065
###
# start gene g1066
Scaffold_1	AUGUSTUS	gene	5132560	5133123	0.89	-	.	g1066
Scaffold_1	AUGUSTUS	transcript	5132560	5133123	0.89	-	.	g1066.t1
Scaffold_1	AUGUSTUS	stop_codon	5132560	5132562	.	-	0	transcript_id "g1066.t1"; gene_id "g1066";
Scaffold_1	AUGUSTUS	CDS	5132560	5133123	0.89	-	0	transcript_id "g1066.t1"; gene_id "g1066";
Scaffold_1	AUGUSTUS	start_codon	5133121	5133123	.	-	0	transcript_id "g1066.t1"; gene_id "g1066";
# protein sequence = [MKVWPALGYASSFPSSSFNPFADDEELLGPLQDNDSDNETDSFSNAPSTPAATIVVPRSSYLKSTSPYQSKCSPRVEM
# EITEMRSTFDIGEDGKLSGVREASVRLKALAPKALNQIDLKDDDDRLIDVVAINDVDRFLSRTATPTWSWEQDPKRSSLEKLKQLVYTRYSHKREEAE
# SLRAFKYGSCF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1066
###
# start gene g1067
Scaffold_1	AUGUSTUS	gene	5136039	5136339	0.37	+	.	g1067
Scaffold_1	AUGUSTUS	transcript	5136039	5136339	0.37	+	.	g1067.t1
Scaffold_1	AUGUSTUS	start_codon	5136039	5136041	.	+	0	transcript_id "g1067.t1"; gene_id "g1067";
Scaffold_1	AUGUSTUS	CDS	5136039	5136041	0.37	+	0	transcript_id "g1067.t1"; gene_id "g1067";
Scaffold_1	AUGUSTUS	CDS	5136112	5136339	0.52	+	0	transcript_id "g1067.t1"; gene_id "g1067";
Scaffold_1	AUGUSTUS	stop_codon	5136337	5136339	.	+	0	transcript_id "g1067.t1"; gene_id "g1067";
# protein sequence = [MYNRHSSTNVSIAENSGQLGVNQNHPQPADISPMSSLTSTSNMSQLYIRHQDGGRGTSPRALPERDNSGRGSGASA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1067
###
# start gene g1068
Scaffold_1	AUGUSTUS	gene	5137371	5139063	0.5	+	.	g1068
Scaffold_1	AUGUSTUS	transcript	5137371	5139063	0.5	+	.	g1068.t1
Scaffold_1	AUGUSTUS	start_codon	5137371	5137373	.	+	0	transcript_id "g1068.t1"; gene_id "g1068";
Scaffold_1	AUGUSTUS	CDS	5137371	5138679	0.51	+	0	transcript_id "g1068.t1"; gene_id "g1068";
Scaffold_1	AUGUSTUS	CDS	5138813	5139063	0.79	+	2	transcript_id "g1068.t1"; gene_id "g1068";
Scaffold_1	AUGUSTUS	stop_codon	5139061	5139063	.	+	0	transcript_id "g1068.t1"; gene_id "g1068";
# protein sequence = [MIATPWLSYCTVCRDHDKPRAAFCGLCLRESQSYEAELQINPTFHVGCIENEDHELWPNVQATCRSCRAEWLWRKACS
# ANVREAVGGRRFRIDDWEAKSTLDGFIDLSEGRVSDVILVARERYWIRTYTKLADMLSQALAASRYEGREERLTAAAAGEDTEMDLSDEDDDEDDLEL
# AQLTEDGGIRELALGDWARNRILDGFWISPADQWYNHIQPDLPWDVRAVHPCPWTVESDDSAPQGDSEQAAEEEHPRDSTVHAPIPPSHPLCEQTFNA
# HQKQMRILLLPAMKNIVRRIVIESSADAADPAIRAARMTLEDVMKELRDEATWFDGVDWLERRRNARHDAAAREEATSDDHSTSSGSSKSSDESFTIT
# SPVLSTTTLQTTPSPPPIEDKSAGADSKNVYRAVTIAVSPVLDPPRLIHPIPHVPVMAAHLPHFTQAAASEAAAVAAGVANRNQPPADVQEHPAQEIK
# DDVVEIKLGEADGEGEEEIDYLEYEDDVFDSDEVESRYESRSRSRSHQD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1068
###
# start gene g1069
Scaffold_1	AUGUSTUS	gene	5139915	5140328	0.4	-	.	g1069
Scaffold_1	AUGUSTUS	transcript	5139915	5140328	0.4	-	.	g1069.t1
Scaffold_1	AUGUSTUS	stop_codon	5139915	5139917	.	-	0	transcript_id "g1069.t1"; gene_id "g1069";
Scaffold_1	AUGUSTUS	CDS	5139915	5140328	0.4	-	0	transcript_id "g1069.t1"; gene_id "g1069";
Scaffold_1	AUGUSTUS	start_codon	5140326	5140328	.	-	0	transcript_id "g1069.t1"; gene_id "g1069";
# protein sequence = [MWSAQFAPSENEVSAYRIFLHDWVARPITPPSMSIASSSNSTNAVVYAWWNGATEVTAWKLMGSTDSMPLAAEALNVV
# DKVDFETTLTYTGIRHYTFFQVAALNARGEILEYSGFTALNGTSFAKADNQTATASPLN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1069
###
# start gene g1070
Scaffold_1	AUGUSTUS	gene	5146079	5146291	0.45	+	.	g1070
Scaffold_1	AUGUSTUS	transcript	5146079	5146291	0.45	+	.	g1070.t1
Scaffold_1	AUGUSTUS	start_codon	5146079	5146081	.	+	0	transcript_id "g1070.t1"; gene_id "g1070";
Scaffold_1	AUGUSTUS	CDS	5146079	5146291	0.45	+	0	transcript_id "g1070.t1"; gene_id "g1070";
Scaffold_1	AUGUSTUS	stop_codon	5146289	5146291	.	+	0	transcript_id "g1070.t1"; gene_id "g1070";
# protein sequence = [MDTNEMVSDTSSVSSSADSPVSPISSTDSLDTADNFEEGSQTNPIHVDDGSGEDKNLIEDEESLGTGVSE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1070
###
# start gene g1071
Scaffold_1	AUGUSTUS	gene	5147709	5147993	0.98	-	.	g1071
Scaffold_1	AUGUSTUS	transcript	5147709	5147993	0.98	-	.	g1071.t1
Scaffold_1	AUGUSTUS	stop_codon	5147709	5147711	.	-	0	transcript_id "g1071.t1"; gene_id "g1071";
Scaffold_1	AUGUSTUS	CDS	5147709	5147993	0.98	-	0	transcript_id "g1071.t1"; gene_id "g1071";
Scaffold_1	AUGUSTUS	start_codon	5147991	5147993	.	-	0	transcript_id "g1071.t1"; gene_id "g1071";
# protein sequence = [MPLRIIPEAALEALALVLLLDDALVPEDEVTDADVDPSPDVLEELDEELEEGKEVIEKEIEVLVLASAQNWFVNPSAV
# ASSLAQLDCMQDMRAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1071
###
# start gene g1072
Scaffold_1	AUGUSTUS	gene	5152912	5154706	0.75	-	.	g1072
Scaffold_1	AUGUSTUS	transcript	5152912	5154706	0.75	-	.	g1072.t1
Scaffold_1	AUGUSTUS	stop_codon	5152912	5152914	.	-	0	transcript_id "g1072.t1"; gene_id "g1072";
Scaffold_1	AUGUSTUS	CDS	5152912	5153359	0.9	-	1	transcript_id "g1072.t1"; gene_id "g1072";
Scaffold_1	AUGUSTUS	CDS	5153415	5154706	0.76	-	0	transcript_id "g1072.t1"; gene_id "g1072";
Scaffold_1	AUGUSTUS	start_codon	5154704	5154706	.	-	0	transcript_id "g1072.t1"; gene_id "g1072";
# protein sequence = [MDGLLDQDIKVLSYFSDGTEVERVVQRDFAASAGHYVDINLPNPHDESQEGLHIRVPIYRGVPIVMGQDSKHCLKTFR
# NNLFTGARLLTLGNHAAFYELIREMAFAENSPLFHRDVEKLDRQDDNAAARLFSAPALQYLADHYPDQLGVIVYLFVFGEVCDAYQNRHIPHEERIRI
# ALRTHYFVCMWQKFIDDLPCYRQDRYCISRESVNILKYLVEALISLVVIHRDYYPDIPLLLWLHSTEICEHVFGISRRDIKDFGLLDFHQMIPKLNVQ
# IREAIFNAHLTETNERMKARASGYHHTYSNLASLNIMALGHYPSDLVIHTINVQASDQADSLWALLGVSPMSLHDSAIQAPLPGITAFESADDDMDDS
# EFDHDDIFDEDFDHEMEELQWLIHLSESNRHSLTTEQQERLECLTNAAVALSIEDRTRLNALEDEMDVDEMYDTFVAEDRQILDDVRAMQIDIPNINT
# DQDTSVVIADDDLDDITLQSLISLRERHQTNHAARSVRTRSQTQNQVDSKQSLRQQITRRFYDELKTAQVQGITSGEGRGIRWYGSGTKTTLGNAANA
# ATVAKATATKV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1072
###
# start gene g1073
Scaffold_1	AUGUSTUS	gene	5156603	5158102	0.52	-	.	g1073
Scaffold_1	AUGUSTUS	transcript	5156603	5158102	0.52	-	.	g1073.t1
Scaffold_1	AUGUSTUS	stop_codon	5156603	5156605	.	-	0	transcript_id "g1073.t1"; gene_id "g1073";
Scaffold_1	AUGUSTUS	CDS	5156603	5158102	0.52	-	0	transcript_id "g1073.t1"; gene_id "g1073";
Scaffold_1	AUGUSTUS	start_codon	5158100	5158102	.	-	0	transcript_id "g1073.t1"; gene_id "g1073";
# protein sequence = [MSIDIGEEERIVFDPSVWIHKGKTWDNPPLHVFHARDTAFELPLQMKKLLPAPDLPIVDFLQLKFPIQSHSLNIYSLD
# SWFSHDSPDTSDQACVDMLWRRSIPSVELLKDLRVARGQKWLDGAKSIRDPRYNRGNDLFPLWALTLWQTLGEMGDDQEQWKLGLETIRQDTVTAAHG
# FTTAARIFGQRGWNSDVRSGRFVFSSLTFLSLLCPTMINDDVTQAMTYHLQCRMEEDCNVNSKKHFLAASRFASVLKAAAGKGTYTSKKALPQSLLDI
# EELVEENPKIHVWFPVLLNQHEVAFCINFGEKTIAYGELNGLDSIGLRNKSLIHQMYVGDSLKIMPPPKEVIKNVQKWLQARFGGTFREEGNTITHGD
# QCDSISCIPITMNTIAHGIFGDSIWIHENRFLDRLWWFQQLVPDGIETVSTFRYIEQVVSTHHISQSNPSLKMRNKAPVKPTLANILNPPSSEEESLN
# DLMTFLCDEVEIDMREVQSEVLVGRIRQK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1073
###
# start gene g1074
Scaffold_1	AUGUSTUS	gene	5166429	5170254	0.08	-	.	g1074
Scaffold_1	AUGUSTUS	transcript	5166429	5170254	0.08	-	.	g1074.t1
Scaffold_1	AUGUSTUS	stop_codon	5166429	5166431	.	-	0	transcript_id "g1074.t1"; gene_id "g1074";
Scaffold_1	AUGUSTUS	CDS	5166429	5169055	0.96	-	2	transcript_id "g1074.t1"; gene_id "g1074";
Scaffold_1	AUGUSTUS	CDS	5169151	5169318	0.56	-	2	transcript_id "g1074.t1"; gene_id "g1074";
Scaffold_1	AUGUSTUS	CDS	5169388	5170116	0.24	-	2	transcript_id "g1074.t1"; gene_id "g1074";
Scaffold_1	AUGUSTUS	CDS	5170212	5170254	0.4	-	0	transcript_id "g1074.t1"; gene_id "g1074";
Scaffold_1	AUGUSTUS	start_codon	5170252	5170254	.	-	0	transcript_id "g1074.t1"; gene_id "g1074";
# protein sequence = [MFSGSTKPTQDDYAPNLNSYADNVPIVAVEYFQKGSNRNAEGVSVHDDLNDDGTEEGTCVFTVHGIVGPSIKNMTRDQ
# MIGIAAMHLDNEGKFMRTSHAENPESLWNNPQLYPKMFPWLFPFGLGGIGTSNIKSFSESSHLNFLLLYHDKRFQLDPNFPLIAFSHQQVKASSSQSY
# LLAESNKFDEVSNRFLSIDKSVLQNIATRMANGEHVKPANDSEIQCFKLLGDLSHAGAKTQGSISSKKNMQSEIWSLINHIDTKEKFDVPLRTSSECR
# LLISNNPVAGARFFHLLVNLFLKHVVDIESSEGGLFGPTNPASSFQSQLISFLESVRIGEFLTGSHAYVKETVALQSKSNINYISPERTLPTPPPPYC
# DCGITDCHKCSTFQHWFEEFKCTVDDLLLKSNVHDCFRGISPDGSVLNQDKFETSCLNNAHKKCKARFPRECFQQTSVDPDNGHIDLKKLEEWLNDIS
# PGLTYLVRGNTDVTSILSGTAIKSAVIYIADYITKTGLKTHVVFDSIKTIFDKSTEIIDGSFSTKEKSRRLISRIVNLLSTKLELGSPMISLYLLKNP
# DHYTSHNFIPFYWKTYVSTARSFFGENDSTSEPKLILTKRWDKIVGLSSSLDYTHRPVQHVNYNLYNWVCSFYKVAKRKSKDEVLSDHETELKSSKSV
# KSTKGLPFLVGHPLVETHVISTRRNSSMTVPNFIGALPRPNKDDREYYCCTMLTLFCPWRTGEDLKKKDQSWHEAFEAYDFCEQSQLYMKNMNIRFEC
# LDARDDFRAQLKSGKLDVTKLPSSIPIQLHADLVNKLDGSHSDMNSSDIEDIGHNYDQYTEDKKGNFFLRRESAMRAMKDMLFNIGWVIPLTGSVQSK
# SITTCSPILLPKEKPQHWDLILKGMRDQVLATRDKDRGLPPSNNNENINDPGKYRPNIVEICDKHYFDKLGIDYGSIKELTLNIKCHNLNNEQERAFR
# IIAQHSAGLVSEPLYIYIGGMGGTGKSQVIKAVLQFFADRNSSFAIVTSAPTGNAAALLGGSTYHFLLGLNNKVEEVGRGTMAQVCARLEHVQYMILD
# EVSMLSCSDLYRISVQLCGAKNKHDIAFGGMNMIFAGDFAQLPPVGGESVSLYSYRRPTDANKYNGQCAAMGKSLWHNVTHVVILRKNMRNTGSSKAD
# ISFRLALDNMRYSCTKEDIGFLKYIGFLQISW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1074
###
# start gene g1075
Scaffold_1	AUGUSTUS	gene	5175258	5176423	0.59	-	.	g1075
Scaffold_1	AUGUSTUS	transcript	5175258	5176423	0.59	-	.	g1075.t1
Scaffold_1	AUGUSTUS	stop_codon	5175258	5175260	.	-	0	transcript_id "g1075.t1"; gene_id "g1075";
Scaffold_1	AUGUSTUS	CDS	5175258	5175921	0.92	-	1	transcript_id "g1075.t1"; gene_id "g1075";
Scaffold_1	AUGUSTUS	CDS	5176002	5176423	0.59	-	0	transcript_id "g1075.t1"; gene_id "g1075";
Scaffold_1	AUGUSTUS	start_codon	5176421	5176423	.	-	0	transcript_id "g1075.t1"; gene_id "g1075";
# protein sequence = [MSLSPPKNLTSIVVNGRTYYASDDPNFINLVSSPSSSLHGGTPVRSVVADVVSSQMDFPSSPPSPQVDDDSFDLCYPP
# KSPKNAMSPIPAPPSSHSLSIEDYDNMDIDLPANFRSIRALRTPSPDLPSNPLEGWIPTPRSSAGHAPLMIPYGTSPSPPRSLISSPSHSNSDTSTVN
# TSPSKTSASGSPSSRLKGKDLRFHPFSHSKRTAPTTLVMGTTPVKSLSKPSAAGKNYRDDIIHRALTDASFPPSTLPIEVDKKASSSPLRKSRKELIY
# EALSEDAPMDLVDSSDVEEQYRGPQDVAPYIDNNLGENGVLNAEWIDPRFAASFRSVVNLPLVFLSILHSCFANVFCFVTVPSQLGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1075
###
# start gene g1076
Scaffold_1	AUGUSTUS	gene	5183077	5183538	0.98	-	.	g1076
Scaffold_1	AUGUSTUS	transcript	5183077	5183538	0.98	-	.	g1076.t1
Scaffold_1	AUGUSTUS	stop_codon	5183077	5183079	.	-	0	transcript_id "g1076.t1"; gene_id "g1076";
Scaffold_1	AUGUSTUS	CDS	5183077	5183538	0.98	-	0	transcript_id "g1076.t1"; gene_id "g1076";
Scaffold_1	AUGUSTUS	start_codon	5183536	5183538	.	-	0	transcript_id "g1076.t1"; gene_id "g1076";
# protein sequence = [MENASLPPPEDILPEGADFQYGDPTELPFIPSPTSTSMVLDPTVNPCTPEPQAPALFIPDSPISSIASSSPLPSSPHY
# ITADVELRQMDIESPFNKTLSNVAYAASIPILPVLQCDSMTNLLRSSSVMSVMYSKNMTTSVNSDIHCPICVNKN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1076
###
# start gene g1077
Scaffold_1	AUGUSTUS	gene	5184474	5185439	0.58	-	.	g1077
Scaffold_1	AUGUSTUS	transcript	5184474	5185439	0.58	-	.	g1077.t1
Scaffold_1	AUGUSTUS	stop_codon	5184474	5184476	.	-	0	transcript_id "g1077.t1"; gene_id "g1077";
Scaffold_1	AUGUSTUS	CDS	5184474	5185219	1	-	2	transcript_id "g1077.t1"; gene_id "g1077";
Scaffold_1	AUGUSTUS	CDS	5185274	5185439	0.58	-	0	transcript_id "g1077.t1"; gene_id "g1077";
Scaffold_1	AUGUSTUS	start_codon	5185437	5185439	.	-	0	transcript_id "g1077.t1"; gene_id "g1077";
# protein sequence = [MAADLAAKLPATTNAEEAMHATIYRAVGINHPLLKGLDGLLAVEKLFRIESQNALLHVKSHYGKSGRELRKELYQQHG
# TTHPSRKHPRGAAKERRRGRREGNPPFWQLKKSSSSLKRHRLVRASTKRPISHSGSDSSSSEHLPPYPHHSHVIPSSDDSDNEPAKTANELHKAQQKI
# QLMSPTKLNARPSQPDFGPIKSTTTSELPSAKWDRNSCWLDSSMEVLFCAMAFHNTFKEFENLVLTEKTKATPAPNLLPVSGIQIPARPGSQQISSSL
# SWRSFRDYRGSELISANLAYYKSCEWKSW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1077
###
# start gene g1078
Scaffold_1	AUGUSTUS	gene	5185798	5186820	0.45	-	.	g1078
Scaffold_1	AUGUSTUS	transcript	5185798	5186820	0.45	-	.	g1078.t1
Scaffold_1	AUGUSTUS	stop_codon	5185798	5185800	.	-	0	transcript_id "g1078.t1"; gene_id "g1078";
Scaffold_1	AUGUSTUS	CDS	5185798	5186820	0.45	-	0	transcript_id "g1078.t1"; gene_id "g1078";
Scaffold_1	AUGUSTUS	start_codon	5186818	5186820	.	-	0	transcript_id "g1078.t1"; gene_id "g1078";
# protein sequence = [MATKRLAVQWATKSNTTRSRNSSVGSSTIAGGKILNKKCLGVLICTVEGCQFIGRPQVESAGLQKQLSARCHCGGQLK
# HDHCSSRSYLITWGQQDGDISTTQYRYINGTAHTHSRLPGVVRTTAAEDQRFRTVYENRPNATSTQLMVGAPAPQGFGPSAADLGQKFSQRAYTSYRL
# NQEKKKDGNGPTSAFGNLQNLQKWKGKHSTVLCKDYVSSDIVCISLQTEWMQQQTLPDMSDVGDPLHGLLSDAAHKYWEDPNGRLIVTSIYSPLIEKW
# VPVLFTYANGATIAHYEYHFLILIEGIAATALQKNIPITDSLFASVSAIFFSNDISFTKDINTIAC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1078
###
# start gene g1079
Scaffold_1	AUGUSTUS	gene	5193531	5193875	0.46	+	.	g1079
Scaffold_1	AUGUSTUS	transcript	5193531	5193875	0.46	+	.	g1079.t1
Scaffold_1	AUGUSTUS	start_codon	5193531	5193533	.	+	0	transcript_id "g1079.t1"; gene_id "g1079";
Scaffold_1	AUGUSTUS	CDS	5193531	5193875	0.46	+	0	transcript_id "g1079.t1"; gene_id "g1079";
Scaffold_1	AUGUSTUS	stop_codon	5193873	5193875	.	+	0	transcript_id "g1079.t1"; gene_id "g1079";
# protein sequence = [MLYPMNGGDKDMNQRLTNNRRKKQVSDLRVLVIPIISLPSLPYVDCPPIMTPAHKIIPCYTVVYGRKIFSSPIDDVDV
# DNLGALVNNEDVSDNVVTKEIKAKVSYKVRTSDNLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1079
###
# start gene g1080
Scaffold_1	AUGUSTUS	gene	5193883	5194368	0.97	-	.	g1080
Scaffold_1	AUGUSTUS	transcript	5193883	5194368	0.97	-	.	g1080.t1
Scaffold_1	AUGUSTUS	stop_codon	5193883	5193885	.	-	0	transcript_id "g1080.t1"; gene_id "g1080";
Scaffold_1	AUGUSTUS	CDS	5193883	5194368	0.97	-	0	transcript_id "g1080.t1"; gene_id "g1080";
Scaffold_1	AUGUSTUS	start_codon	5194366	5194368	.	-	0	transcript_id "g1080.t1"; gene_id "g1080";
# protein sequence = [MGNNNAGVYSVASFDSSFARLFPPSIAAQNIDSSRLLVKVLKQIDDDMVAEVKALTIVGQFVASGLLRLPIAKSNDVG
# RIKRSIKIREVRGVGDTLPNDDDLFELKPVIVMLQMPGKPLTHIPEFMSEKNLETKRQMMGDTLKLMCDRVGELALEHRFVHR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1080
###
# start gene g1081
Scaffold_1	AUGUSTUS	gene	5199414	5200655	0.94	+	.	g1081
Scaffold_1	AUGUSTUS	transcript	5199414	5200655	0.94	+	.	g1081.t1
Scaffold_1	AUGUSTUS	start_codon	5199414	5199416	.	+	0	transcript_id "g1081.t1"; gene_id "g1081";
Scaffold_1	AUGUSTUS	CDS	5199414	5200655	0.94	+	0	transcript_id "g1081.t1"; gene_id "g1081";
Scaffold_1	AUGUSTUS	stop_codon	5200653	5200655	.	+	0	transcript_id "g1081.t1"; gene_id "g1081";
# protein sequence = [MFRGTVYDLQSLSSPGSAVPAGIHDIDEDIMKHRGKPLPVADSELMRRGLRKESSLGATSLLGYASNLSLPMRQDSND
# SYHGEPGLGRRPSAASAVLLGGTGPVGTRNITAINNGNRSTTYHPDLDDVIDVRGDSDEEREAEMDLADVAEEENFQGAEALPTPVSGGVITGVSPYR
# MSEAFTSLEGHGLSSPGPLGSDRFPYAVSNHASHPSTSTIATSLYPHTITTKGGSSSLGFGLSNPYASTSTVYLGSLGHLTRPSLDTERETGQDINSS
# MRHGRPSLSIESAVDKRGRRMSRGSTLATTYEGFEGENTLVYESPISPGGSYPYSPTSTSYTHDTRAQAKNWQRQSSFLGSESHGYGAGYGFKKAIII
# SWDWTMSMLLMRRCRCQDTLIRGKMVMGVIRRSMRCPRRGQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1081
###
# start gene g1082
Scaffold_1	AUGUSTUS	gene	5215762	5216313	0.82	+	.	g1082
Scaffold_1	AUGUSTUS	transcript	5215762	5216313	0.82	+	.	g1082.t1
Scaffold_1	AUGUSTUS	start_codon	5215762	5215764	.	+	0	transcript_id "g1082.t1"; gene_id "g1082";
Scaffold_1	AUGUSTUS	CDS	5215762	5216313	0.82	+	0	transcript_id "g1082.t1"; gene_id "g1082";
Scaffold_1	AUGUSTUS	stop_codon	5216311	5216313	.	+	0	transcript_id "g1082.t1"; gene_id "g1082";
# protein sequence = [MERYPDYSVDGSAPGTPLPPGEADRFLEQPRASFLESNTGNSVQSTPNNSSPLLVANKHETDHELQQAKPGSGTKRGR
# LVILTLVGLGVLAVIVLAVVLPVYFKVIKPRQNQDNLTSGSSASGSSAGSGSVGSGSGNPASPSGATSGGDGSEIIVDGGANFTYKNPFGGYCEFPGI
# SITFSST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1082
###
# start gene g1083
Scaffold_1	AUGUSTUS	gene	5217594	5218523	0.79	+	.	g1083
Scaffold_1	AUGUSTUS	transcript	5217594	5218523	0.79	+	.	g1083.t1
Scaffold_1	AUGUSTUS	start_codon	5217594	5217596	.	+	0	transcript_id "g1083.t1"; gene_id "g1083";
Scaffold_1	AUGUSTUS	CDS	5217594	5218523	0.79	+	0	transcript_id "g1083.t1"; gene_id "g1083";
Scaffold_1	AUGUSTUS	stop_codon	5218521	5218523	.	+	0	transcript_id "g1083.t1"; gene_id "g1083";
# protein sequence = [MQEVFGLLRLAMLGDPTLTLGKVFDGKLTTILIHILSDSRSDFGVTIAGEFSNGYNDCGLFLKGTSSYTPSYGGDCNL
# WQDASTWNDTVIDGVKAFALASMDATQNWFFWTWKIGNSTANNRVESPLWSYQLGLEGGWIPTDPREAVGACAAQGVSQPWNQTFQSWQTGGVGAGTI
# AATATAEFGVWPPAQISGVAVDQMAFVPTYTPTGSVATLPPPTLTATTKSISEGNGWFDSSDTTSAATAIAGCSYPNAWDAISATVPATVCGGGVVTT
# STAAAASTVISASTTGVISVPATTSTTADDTTITQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1083
###
# start gene g1084
Scaffold_1	AUGUSTUS	gene	5221644	5224379	0.42	+	.	g1084
Scaffold_1	AUGUSTUS	transcript	5221644	5224379	0.42	+	.	g1084.t1
Scaffold_1	AUGUSTUS	start_codon	5221644	5221646	.	+	0	transcript_id "g1084.t1"; gene_id "g1084";
Scaffold_1	AUGUSTUS	CDS	5221644	5224379	0.42	+	0	transcript_id "g1084.t1"; gene_id "g1084";
Scaffold_1	AUGUSTUS	stop_codon	5224377	5224379	.	+	0	transcript_id "g1084.t1"; gene_id "g1084";
# protein sequence = [MSIDIGEEERIVFDPSVWIHKGKTWDNPPLHVFHARDTAFELPLQMKKLLPAPDLPIVDFLQLKFPIQSHSLNIYSLD
# SWFSHDSPDTSDQACVDMLWRRSIPSVELLKDLRVARGQKWLDGAKSIRDPRYNRGNDLFPLWALTLWQTLGEMGDDQEQWKLGLETIRQDTVTAAHG
# FTTAARIFGQRGWNSDVRSGRFVFSSLTFLSLLCPTMINDDVTQAMTYHLQCRMEEDCNVNSKKHFLAASRFASVLKAAAGKGTYTSKKALPQSLLDI
# EELVEENPKIHVWFPVLLNQHEVAFCINFGEKTIAYGELNGLDSIGLRNKSLIHQMYVGDSLKIMPPPKEVIKNVQKWLQARFGGTFREEGNTITHGD
# QCDSISCIPITMNTIAHGIFGDSIWIHENRFLDRLWWFQQLVPDGIETVSTFRYIEQVVSTHHISQSNPSLKMRNKAPVKPTLANILNPPSSEEESLN
# DLMTFLCDEVEIDMREVQSEVLVGKDSTEVKTSVAVIGVDIKESEKVRGKVETDTSPKEPPCPPAKPLVNAWSFLDGMGNSKSGRLKSATGSSKKKRP
# ASPTEHECDAEAKRLRKELGGSKSATSERNARTRVDAGDFDAVKQEAFKQEVRDLVRQISGNSHLMPTFYDDKPRVVHCPNCCRDQIVQKPYKSKRFR
# DHFVKCIESQYHTQKSKSATARTPKLTSETVRRKWDIFATRLVLPSGKPKPRSCPGLTETNHPRISIYLRRSAATGGGARSCTRIAKELFNSLYRHLS
# RSEKAEVNLMQVHEQRWKNDHQNLRVFSVECLHFSPTLDRGQRSLPCAECTALLKMNEFNNILRKEMPADENYKFTNHAYQNEVLGKHLAKCKGLRDL
# FTAAVCAFYFLYHLTKVANRNRMPKTPSLSNLFKASSRESMLTMRFSLV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1084
###
# start gene g1085
Scaffold_1	AUGUSTUS	gene	5225909	5226833	0.47	+	.	g1085
Scaffold_1	AUGUSTUS	transcript	5225909	5226833	0.47	+	.	g1085.t1
Scaffold_1	AUGUSTUS	start_codon	5225909	5225911	.	+	0	transcript_id "g1085.t1"; gene_id "g1085";
Scaffold_1	AUGUSTUS	CDS	5225909	5226330	0.48	+	0	transcript_id "g1085.t1"; gene_id "g1085";
Scaffold_1	AUGUSTUS	CDS	5226386	5226833	0.94	+	1	transcript_id "g1085.t1"; gene_id "g1085";
Scaffold_1	AUGUSTUS	stop_codon	5226831	5226833	.	+	0	transcript_id "g1085.t1"; gene_id "g1085";
# protein sequence = [MKARASGYHHTYSNLASLNIMALGHYPSDLVIHTINVQASDQADSLWALLGVSPMSLHDSAIQAPLPGITAFESADDD
# MDDSEFDHDDIFDEDFDHEMEELQWLIHLSESNRHSLTTEQQERLECLTNAAVALSIEDRTRLNALEDEMDVDEMYDTFVAEDRQILDDVRAMQIDIP
# NINTDQDTSVVIADDDLDDITLQSLISLRERHQTNHAARSVRTRSQTQNQVDSKQSLRQQITRRFYDELKTAQVQGITSGEGRGIRWYGSGTKTTLGN
# AANAATVAKATATKV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1085
###
# start gene g1086
Scaffold_1	AUGUSTUS	gene	5229876	5230400	0.5	-	.	g1086
Scaffold_1	AUGUSTUS	transcript	5229876	5230400	0.5	-	.	g1086.t1
Scaffold_1	AUGUSTUS	stop_codon	5229876	5229878	.	-	0	transcript_id "g1086.t1"; gene_id "g1086";
Scaffold_1	AUGUSTUS	CDS	5229876	5230400	0.5	-	0	transcript_id "g1086.t1"; gene_id "g1086";
Scaffold_1	AUGUSTUS	start_codon	5230398	5230400	.	-	0	transcript_id "g1086.t1"; gene_id "g1086";
# protein sequence = [MFRSLAQLGAKGNSTEKKSISPTLRSDIYTTIDQYKAWLAGTRGQAGDGVSYAPMLHTIQKHFPNVAIGLEALGQIEA
# EVGVIVGGITNMVLEMSKWEALGGGMAMRTWVDTIVNVYAMIPHGSKKEIIARGIVRGINQHTDYSLMTKEFAARIQIISCLKSRKHSNYLLRHRV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1086
###
# start gene g1087
Scaffold_1	AUGUSTUS	gene	5231231	5231757	0.63	-	.	g1087
Scaffold_1	AUGUSTUS	transcript	5231231	5231757	0.63	-	.	g1087.t1
Scaffold_1	AUGUSTUS	stop_codon	5231231	5231233	.	-	0	transcript_id "g1087.t1"; gene_id "g1087";
Scaffold_1	AUGUSTUS	CDS	5231231	5231448	0.63	-	2	transcript_id "g1087.t1"; gene_id "g1087";
Scaffold_1	AUGUSTUS	CDS	5231502	5231757	0.72	-	0	transcript_id "g1087.t1"; gene_id "g1087";
Scaffold_1	AUGUSTUS	start_codon	5231755	5231757	.	-	0	transcript_id "g1087.t1"; gene_id "g1087";
# protein sequence = [MSGRRIRFVPLILILRREIVGLTRSSGYLSFGRQAVRSKLISSGVLENDAYVVIAGPANTYAHYVATLEEYSVQRYEG
# ASTIFGQYTLDAYIDKYTSLVPFIADTVTGTPASDAPPAEQTSKAISLQVSLLSIIDCPGTDHRHIAVTCCVRLGSFWF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1087
###
# start gene g1088
Scaffold_1	AUGUSTUS	gene	5234956	5235473	0.97	-	.	g1088
Scaffold_1	AUGUSTUS	transcript	5234956	5235473	0.97	-	.	g1088.t1
Scaffold_1	AUGUSTUS	stop_codon	5234956	5234958	.	-	0	transcript_id "g1088.t1"; gene_id "g1088";
Scaffold_1	AUGUSTUS	CDS	5234956	5235294	1	-	0	transcript_id "g1088.t1"; gene_id "g1088";
Scaffold_1	AUGUSTUS	CDS	5235351	5235473	0.97	-	0	transcript_id "g1088.t1"; gene_id "g1088";
Scaffold_1	AUGUSTUS	start_codon	5235471	5235473	.	-	0	transcript_id "g1088.t1"; gene_id "g1088";
# protein sequence = [MLDQYIRQAHAKGLADKMSCVCTELKGVEGELDGAKFDVVTCVMAYHHFGSVTEITSILVRFLKPNGMLVVVDIEAPS
# IPGKAPTDVNSLVVEGLQDLGHVAHKRGFKVTEMKELFEGAGLVSFDMKHLTHVKVEGKFEVDTFLAVGFRPVEK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1088
###
# start gene g1089
Scaffold_1	AUGUSTUS	gene	5238296	5238688	0.78	+	.	g1089
Scaffold_1	AUGUSTUS	transcript	5238296	5238688	0.78	+	.	g1089.t1
Scaffold_1	AUGUSTUS	start_codon	5238296	5238298	.	+	0	transcript_id "g1089.t1"; gene_id "g1089";
Scaffold_1	AUGUSTUS	CDS	5238296	5238688	0.78	+	0	transcript_id "g1089.t1"; gene_id "g1089";
Scaffold_1	AUGUSTUS	stop_codon	5238686	5238688	.	+	0	transcript_id "g1089.t1"; gene_id "g1089";
# protein sequence = [MRASMEPFPLSSDTISSIINNPSLLKQSSYLAQFGISTSQADYILVEGYNKGFKNIFILNAALTTLAFVASVVLIGHK
# ELLRGDEEQLKKEAKEALRERAGKDAVGIVEDQSLKMGAQPEDIEMGSMASP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1089
###
# start gene g1090
Scaffold_1	AUGUSTUS	gene	5259485	5260453	0.65	-	.	g1090
Scaffold_1	AUGUSTUS	transcript	5259485	5260453	0.65	-	.	g1090.t1
Scaffold_1	AUGUSTUS	stop_codon	5259485	5259487	.	-	0	transcript_id "g1090.t1"; gene_id "g1090";
Scaffold_1	AUGUSTUS	CDS	5259485	5260453	0.65	-	0	transcript_id "g1090.t1"; gene_id "g1090";
Scaffold_1	AUGUSTUS	start_codon	5260451	5260453	.	-	0	transcript_id "g1090.t1"; gene_id "g1090";
# protein sequence = [MALNRRGYAGSTPYNPYEKSIITNEQVHSDEDKRQFFEQRGIEILRFIDQIIQRFDLPPISNFEGHQVGGIALLGWSL
# GIAFTLAAIANVDSDSISDETRKRLNAHLRAHILLGTAIFSLRSSISPTPQTSEPAVITIGLNLPKDFWAPTHDPLIPASARASLFIHLITCYYDYDK
# ETISARDQAGILSTVAPSPSRIPSMFTFTDEERTEIVTPLPQDMHFSHVLQEPLREWYLKACFDEKLRSSLALKNMTVWHVSGDRSYPFIWPAYWLVQ
# EDDRKAGQGESGRFVRFKLMEGCNHFVSCFTVHTTRQKFLMLVLDALG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1090
###
# start gene g1091
Scaffold_1	AUGUSTUS	gene	5262827	5265562	0.46	+	.	g1091
Scaffold_1	AUGUSTUS	transcript	5262827	5265562	0.46	+	.	g1091.t1
Scaffold_1	AUGUSTUS	start_codon	5262827	5262829	.	+	0	transcript_id "g1091.t1"; gene_id "g1091";
Scaffold_1	AUGUSTUS	CDS	5262827	5265562	0.46	+	0	transcript_id "g1091.t1"; gene_id "g1091";
Scaffold_1	AUGUSTUS	stop_codon	5265560	5265562	.	+	0	transcript_id "g1091.t1"; gene_id "g1091";
# protein sequence = [MSIDIGEEERIVFDPSVWIHKGKTWDNPPLHVFHARDTAFELPLQMKKLLPAPDLPIVDFLQLKFPIQSHSLNIYSLD
# SWFSHDSPDTSDQACVDMLWRRSIPSVELLKDLRVARGQKWLDGAKSIRDPRYNRGNDLFPLWALTLWQTLGEMGDDQEQWKLGLETIRQDTVTAAHG
# FTTAARIFGQRGWNSDVRSGRFVFSSLTFLSLLCPTMINDDVTQAMTYHLQCRMEEDCNVNSKKHFLAASRFASVLKAAAGKGTYTSKKALPQSLLDI
# EELVEENPKIHVWFPVLLNQHEVAFCINFGEKTIAYGELNGLDSIGLRNKSLIHQMYVGDSLKIMPPPKEVIKNVQKWLQARFGGTFREEGNTITHGD
# QCDSISCIPITMNTIAHGIFGDSIWIHENRFLDRLWWFQQLVPDGIETVSTFRYIEQVVSTHHISQSNPSLKMRNKAPVKPTLANILNPPSSEEESLN
# DLMTFLCDEVEIDMREVQSEVLVGKDSTEVKTSVAVIGVDIKESEKVRGKVETDTSPKEPPCPPAKPLVNAWSFLDGMGNSKSGRLKSATGSSKKKRP
# ASPTEHECDAEAKRLRKELGGSKSATSERNARTRVDAGDFDAVKQEAFKQEVRDLVRQISGNSHLMPTFYDDKPRVVHCPNCCRDQIVQKPYKSKRFR
# DHFVKCIESQYHTQKSKSATARTPKLTSETVRRKWDIFATRLVLPSGKPKPRSCPGLTETNHPRISIYLRRSAATGGGARSCTRIAKELFNSLYRHLS
# RSEKAEVNLMQVHEQRWKNDHQNLRVFSVECLHFSPTLDRGQRSLPCAECTALLKMNEFNNILRKEMPADENYKFTNHAYQNEVLGKHLAKCKGLRDL
# FTAAVCAFYFLYHLTKVANRNRMPKTPSLSNLFKASSRESMLTMRFSLV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1091
###
# start gene g1092
Scaffold_1	AUGUSTUS	gene	5266224	5268018	0.81	+	.	g1092
Scaffold_1	AUGUSTUS	transcript	5266224	5268018	0.81	+	.	g1092.t1
Scaffold_1	AUGUSTUS	start_codon	5266224	5266226	.	+	0	transcript_id "g1092.t1"; gene_id "g1092";
Scaffold_1	AUGUSTUS	CDS	5266224	5267515	0.82	+	0	transcript_id "g1092.t1"; gene_id "g1092";
Scaffold_1	AUGUSTUS	CDS	5267571	5268018	0.94	+	1	transcript_id "g1092.t1"; gene_id "g1092";
Scaffold_1	AUGUSTUS	stop_codon	5268016	5268018	.	+	0	transcript_id "g1092.t1"; gene_id "g1092";
# protein sequence = [MDGLLDQDIKVLSYFSDGTEVERVVQRDFAASAGHYVDINLPNPHDESQEGLHIRVPIYRGVPIVMGQDSKHCLKTFR
# NNLFTGARLLTLGNHAAFYELIREMAFAENSPLFHRDVEKLDRQDDNAAARLFSAPALQYLADHYPDQLGVIVYLFVFGEVCDAYQNRHIPHEERIRI
# ALRTHYFVCMWQKFIDDLPCYRQDRYCISRESVNILKYLVEALISLVVIHRDYYPDIPLLLWLHSTEICEHVFGISRRDIKDFGLLDFHQMIPKLNVQ
# IREAIFNAHLTETNERMKARASGYHHTYSNLASLNIMALGHYPSDLVIHTINVQASDQADSLWALLGVSPMSLHDSAIQAPLPGITAFESADDDMDDS
# EFDHDDIFDEDFDHEMEELQWLIHLSESNRHSLTTEQQERLECLTNAAVALSIEDRTRLNALEDEMDVDEMYDTFVAEDRQILDDVRAMQIDIPNINT
# DQDTSVVIADDDLDDITLQSLISLRERHQTNHAARSVRTRSQTQNQVDSKQSLRQQITRRFYDELKTAQVQGITSGEGRGIRWYGSGTKTTLGNAANA
# ATVAKATATKV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1092
###
# start gene g1093
Scaffold_1	AUGUSTUS	gene	5269424	5269962	0.53	+	.	g1093
Scaffold_1	AUGUSTUS	transcript	5269424	5269962	0.53	+	.	g1093.t1
Scaffold_1	AUGUSTUS	start_codon	5269424	5269426	.	+	0	transcript_id "g1093.t1"; gene_id "g1093";
Scaffold_1	AUGUSTUS	CDS	5269424	5269473	1	+	0	transcript_id "g1093.t1"; gene_id "g1093";
Scaffold_1	AUGUSTUS	CDS	5269578	5269962	0.53	+	1	transcript_id "g1093.t1"; gene_id "g1093";
Scaffold_1	AUGUSTUS	stop_codon	5269960	5269962	.	+	0	transcript_id "g1093.t1"; gene_id "g1093";
# protein sequence = [MSKENEANTQLHYANSFHHLVNLLERKSHGLRDEKISVQPATATKTTPNPEDIRAKITLVGVDHVGGDYGYDGIPEPV
# RGSGEGDTTRTDLDRENFTNANPSGGTPSRCKEENVDRDEGDLSIDSSNVIGDCVARSVEMGFFKI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1093
###
# start gene g1094
Scaffold_1	AUGUSTUS	gene	5279479	5279955	0.72	+	.	g1094
Scaffold_1	AUGUSTUS	transcript	5279479	5279955	0.72	+	.	g1094.t1
Scaffold_1	AUGUSTUS	start_codon	5279479	5279481	.	+	0	transcript_id "g1094.t1"; gene_id "g1094";
Scaffold_1	AUGUSTUS	CDS	5279479	5279955	0.72	+	0	transcript_id "g1094.t1"; gene_id "g1094";
Scaffold_1	AUGUSTUS	stop_codon	5279953	5279955	.	+	0	transcript_id "g1094.t1"; gene_id "g1094";
# protein sequence = [MIPCPCGLEEHARYSFQKLNTLNKQIPHPGSDASEWADLPSNKQTENPPASPIPSPIPTLLDERITEDAPPHDTPQPP
# SQPSTSSIETQTSSTANPSGGEELPSPLDSLRSAMGQLNDTNMVEEDSQKVTEAEPTVEGRKLLVAWMVGQSARSIEVCL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1094
###
# start gene g1095
Scaffold_1	AUGUSTUS	gene	5292264	5292826	0.51	+	.	g1095
Scaffold_1	AUGUSTUS	transcript	5292264	5292826	0.51	+	.	g1095.t1
Scaffold_1	AUGUSTUS	start_codon	5292264	5292266	.	+	0	transcript_id "g1095.t1"; gene_id "g1095";
Scaffold_1	AUGUSTUS	CDS	5292264	5292438	0.51	+	0	transcript_id "g1095.t1"; gene_id "g1095";
Scaffold_1	AUGUSTUS	CDS	5292516	5292826	1	+	2	transcript_id "g1095.t1"; gene_id "g1095";
Scaffold_1	AUGUSTUS	stop_codon	5292824	5292826	.	+	0	transcript_id "g1095.t1"; gene_id "g1095";
# protein sequence = [MKHSTTTTGELLSEQDKRNLAATDEKAAGCSTLPRLTPGISEHTHIVSTSPHNDRQQRLIHETTETTETTETTETTET
# TETTETTETNETTETNETNETNETNETNETNETNETNETNETNETNETNETNETNVTYLPDTSSLFAPESYLLGTSSLFAPES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1095
###
# start gene g1096
Scaffold_1	AUGUSTUS	gene	5303122	5304633	0.51	-	.	g1096
Scaffold_1	AUGUSTUS	transcript	5303122	5304633	0.51	-	.	g1096.t1
Scaffold_1	AUGUSTUS	stop_codon	5303122	5303124	.	-	0	transcript_id "g1096.t1"; gene_id "g1096";
Scaffold_1	AUGUSTUS	CDS	5303122	5304459	0.85	-	0	transcript_id "g1096.t1"; gene_id "g1096";
Scaffold_1	AUGUSTUS	CDS	5304529	5304633	0.54	-	0	transcript_id "g1096.t1"; gene_id "g1096";
Scaffold_1	AUGUSTUS	start_codon	5304631	5304633	.	-	0	transcript_id "g1096.t1"; gene_id "g1096";
# protein sequence = [MVSKGQLEQIYATSYTKSTGPPFFNLETQSTDGWPSDVDGDAYLLFLLTGQHVLEDHQAVVDARRNTLNDDHSIGASR
# DYDSLIGIADEILVDAAISVYPAPNPAEVLSTSIHVKIRLPSGDVSTNAFKYNSQFTFCSQNHKLVPIHRIPNFQFAVWGNRCQIHIFFPGIASRGPE
# DLARQLSKEEKTTFYEIGLRPAIAALLPEDISDWPPTYDGELFRARKQSGHMSYQTKIIPALEVHNVVDRIRKNLEDANIDWAESFFFTHTVRGFKHG
# TQHEMNEDEAQLALDVLLSHADLSRDATERGEWWIDVGLELCSDIQSCLQWATTSHYHIVKEVLKISDANASRITSMGSSKYQRDIVSHIMDVAGCRI
# EPGSRAQGEYEAAYFQLYTTDKAITYNPEGRHHGKAISTNLAMGPTQPPAFISGLFELFTDAMTRNSSNARIEVRVPIRHATRVLLTIDVDLVRRNLL
# AFPSTLVYVK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1096
###
# start gene g1097
Scaffold_1	AUGUSTUS	gene	5307236	5308526	0.51	+	.	g1097
Scaffold_1	AUGUSTUS	transcript	5307236	5308526	0.51	+	.	g1097.t1
Scaffold_1	AUGUSTUS	start_codon	5307236	5307238	.	+	0	transcript_id "g1097.t1"; gene_id "g1097";
Scaffold_1	AUGUSTUS	CDS	5307236	5307421	0.73	+	0	transcript_id "g1097.t1"; gene_id "g1097";
Scaffold_1	AUGUSTUS	CDS	5307701	5307890	0.71	+	0	transcript_id "g1097.t1"; gene_id "g1097";
Scaffold_1	AUGUSTUS	CDS	5307994	5308526	0.94	+	2	transcript_id "g1097.t1"; gene_id "g1097";
Scaffold_1	AUGUSTUS	stop_codon	5308524	5308526	.	+	0	transcript_id "g1097.t1"; gene_id "g1097";
# protein sequence = [MTLPVTLNLVSRLDLTDSLSGKLIIVDESEDSAIVAEEVEGSKTRRQAKGSKAKAKAKHAPQDEAIHSSGAQVDDTDA
# SAAQSFIDETDSGWNSRVETDDADGDGFRDGELNECSTVFVEARSNIYLEYHDDDENFFAAAVATDSSGYDLPASNRKKSKRRKRATPQVVGAASRSV
# EENLSTTAVSPVPSTNYSSRTTLLGEIAARTGSMPSTPPLKRKKAESHSDLDGIEISEVSPVLSKRHRRAETESPSRIPTKAKSRFIDLNALNASTRD
# PQSHSSSKPDAQVVPLPHSSKVELRIPD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1097
###
# start gene g1098
Scaffold_1	AUGUSTUS	gene	5308873	5309532	0.96	+	.	g1098
Scaffold_1	AUGUSTUS	transcript	5308873	5309532	0.96	+	.	g1098.t1
Scaffold_1	AUGUSTUS	start_codon	5308873	5308875	.	+	0	transcript_id "g1098.t1"; gene_id "g1098";
Scaffold_1	AUGUSTUS	CDS	5308873	5309532	0.96	+	0	transcript_id "g1098.t1"; gene_id "g1098";
Scaffold_1	AUGUSTUS	stop_codon	5309530	5309532	.	+	0	transcript_id "g1098.t1"; gene_id "g1098";
# protein sequence = [MHESNAEAFSDKTSAPSPARTAVPTSSRAHSFAPSSSRNDMHESNAEAFSDKTSAPSPARTAVPTSSRAHSFAPSSSR
# SDMRESSLKPSSSKIATSSSVRTAVVTSTRGRSFAPSSSRTPMHDSNAEASSSKIAASSSVRTAGGSSSRNNSFAALNRNIFTTSPKSRATSKSRCGH
# YWRMDIIDVAFSRRNPRIEDESDEEDHSPPRHITQTKKSWTRK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1098
###
# command line:
# augustus --species=saccharomyces split/input_1/input_1.fa_chunk_0000014