# This output was generated with AUGUSTUS (version 3.4.0). # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de), # O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff. # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), # Using native and syntenically mapped cDNA alignments to improve de novo gene finding # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 # No extrinsic information on sequences given. # Sources of extrinsic information: M RM # Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ... # saccharomyces version. Using default transition matrix. # Looks like split/input_1/input_1.fa_chunk_0000010 is in fasta format. # We have hints for 0 sequences and for 0 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 5330550, name = Scaffold_5) ----- # # Predicted genes for sequence number 1 on both strands # start gene g1 Scaffold_5 AUGUSTUS gene 11144 12220 0.85 - . g1 Scaffold_5 AUGUSTUS transcript 11144 12220 0.85 - . g1.t1 Scaffold_5 AUGUSTUS stop_codon 11144 11146 . - 0 transcript_id "g1.t1"; gene_id "g1"; Scaffold_5 AUGUSTUS CDS 11144 12220 0.85 - 0 transcript_id "g1.t1"; gene_id "g1"; Scaffold_5 AUGUSTUS start_codon 12218 12220 . - 0 transcript_id "g1.t1"; gene_id "g1"; # protein sequence = [MDELRTAYLPFCASSFASTRHPQSADNLAQCSAASDIARAAPKFPTAMVVSLQPSTDSSESYALNYDWLHSEAFMNLA # HPASPCPAILLASITLTSLGALKVQMENIHEVTHNSALDRIELRVLPLEELYARRRAQGIRNDLGARYGCHIDTAPATPSSVDQKRGPGPELKKKHSL # KDLGKSSPASISPSSVASPSPRRPPLRRSSAHAREKGPARSTTPAPSTPPVLIEGNSTTGPGRYASDEEVAKIIALTFGNCMLGIRGTDKEDTGSGGK # TAKPIKNPFSSELTSPMGPNAPTDGLSTVNTSQHGRAKLSPGQRQVLALSAVLKEREEMKRKAALGSNSQKVVQASMVEGIDFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1 ### # start gene g2 Scaffold_5 AUGUSTUS gene 17381 17788 0.8 + . g2 Scaffold_5 AUGUSTUS transcript 17381 17788 0.8 + . g2.t1 Scaffold_5 AUGUSTUS start_codon 17381 17383 . + 0 transcript_id "g2.t1"; gene_id "g2"; Scaffold_5 AUGUSTUS CDS 17381 17788 0.8 + 0 transcript_id "g2.t1"; gene_id "g2"; Scaffold_5 AUGUSTUS stop_codon 17786 17788 . + 0 transcript_id "g2.t1"; gene_id "g2"; # protein sequence = [MFSLFSYAYYRQLLDPTSAANVVRTPIRAPPSGFPSHYNPAYNASVPSLGYQYGPYGQQPYGQFAPPPGPPPAMDAAD # SKPPGYASGPGYGYEIDDKAKENPFADFDEHVDKAGGSQEEHDVTSRPAPGGRDTFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g2 ### # start gene g3 Scaffold_5 AUGUSTUS gene 20762 21127 0.52 + . g3 Scaffold_5 AUGUSTUS transcript 20762 21127 0.52 + . g3.t1 Scaffold_5 AUGUSTUS start_codon 20762 20764 . + 0 transcript_id "g3.t1"; gene_id "g3"; Scaffold_5 AUGUSTUS CDS 20762 21127 0.52 + 0 transcript_id "g3.t1"; gene_id "g3"; Scaffold_5 AUGUSTUS stop_codon 21125 21127 . + 0 transcript_id "g3.t1"; gene_id "g3"; # protein sequence = [MLLKQKPIERASFDQFFGSTAVAKSKFPRQKADADSDVLPVSSTLSGATSTEGSRNEAEPEKGATWPVRPVTPESHKV # IPPEVLDEKAMIPPSKFNFRRTSTLGEPGSTPPSNDTATPREP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g3 ### # start gene g4 Scaffold_5 AUGUSTUS gene 21422 22216 0.42 + . g4 Scaffold_5 AUGUSTUS transcript 21422 22216 0.42 + . g4.t1 Scaffold_5 AUGUSTUS start_codon 21422 21424 . + 0 transcript_id "g4.t1"; gene_id "g4"; Scaffold_5 AUGUSTUS CDS 21422 22216 0.42 + 0 transcript_id "g4.t1"; gene_id "g4"; Scaffold_5 AUGUSTUS stop_codon 22214 22216 . + 0 transcript_id "g4.t1"; gene_id "g4"; # protein sequence = [MIELESIPRRPLQERRVLPSPSLEDYPPSPVNNQSHDITFPPPPSAISAPPLSSSPSSLASRAASHALNRALSLASKK # LFGTTQTQHHRKSSSTPVTTRPLSSPSSPRRPQILPLGAEERDPLEDDLLRALEELAQKTEVLTHWADEMYDYVKAVPQSAYTVFYLLPTLTLTVIEP # LPDPNKFIKREGEADKIARKRKHADMEAEYNAVTCVAVYMLLMSFSQKGIDKLRNYQEHMSMRHPDGDFMVSEGFDDGTRVKLRVAHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g4 ### # start gene g5 Scaffold_5 AUGUSTUS gene 29791 30501 0.94 - . g5 Scaffold_5 AUGUSTUS transcript 29791 30501 0.94 - . g5.t1 Scaffold_5 AUGUSTUS stop_codon 29791 29793 . - 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_5 AUGUSTUS CDS 29791 30501 0.94 - 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_5 AUGUSTUS start_codon 30499 30501 . - 0 transcript_id "g5.t1"; gene_id "g5"; # protein sequence = [MDLAELSQAIQDMRHDVRGQHKDIRMNDRVGKTMIEFIQSIGGVSKGKNESISAPAPSAKAKGKRRRVSDSNIEEEDE # DYQPRKRSSQLRKAKSQTAIRSRPANTGATSRTDNLAKARAAKAASKSSRSAQRPSPPNPQGLPSPSNVSDAVVKSEPGSGESRTPVPQQSMAQISQP # PIPQLAMPPTPLPVPMNISPELMLLYNQMHPNQLQAMMANLMMGNPSQGMLGMQGMGATQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g5 ### # start gene g6 Scaffold_5 AUGUSTUS gene 30671 31048 0.48 - . g6 Scaffold_5 AUGUSTUS transcript 30671 31048 0.48 - . g6.t1 Scaffold_5 AUGUSTUS stop_codon 30671 30673 . - 0 transcript_id "g6.t1"; gene_id "g6"; Scaffold_5 AUGUSTUS CDS 30671 31048 0.48 - 0 transcript_id "g6.t1"; gene_id "g6"; Scaffold_5 AUGUSTUS start_codon 31046 31048 . - 0 transcript_id "g6.t1"; gene_id "g6"; # protein sequence = [MALTSAEKLHVITTPRARFIRDLLEEFVSETTLGSPNIPWDKSRGSDFRCISQAVYLMDKWPTTKSGAALKHAGSLPL # VEKWLSSTGVDKKSGKSAGGDDDDYGTIPGRICEEGQGSIFTDGRNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g6 ### # start gene g7 Scaffold_5 AUGUSTUS gene 31768 32076 0.54 - . g7 Scaffold_5 AUGUSTUS transcript 31768 32076 0.54 - . g7.t1 Scaffold_5 AUGUSTUS stop_codon 31768 31770 . - 0 transcript_id "g7.t1"; gene_id "g7"; Scaffold_5 AUGUSTUS CDS 31768 32076 0.54 - 0 transcript_id "g7.t1"; gene_id "g7"; Scaffold_5 AUGUSTUS start_codon 32074 32076 . - 0 transcript_id "g7.t1"; gene_id "g7"; # protein sequence = [MYEDEELSELSEEDELANDAQGSSTRKHRGASGGYTIQKALKPPRATTYTAQALYGMWRDNYFLDDTNWTKKTRFITP # ISTLNQNTSEVLVFHLAKLSPDPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g7 ### # start gene g8 Scaffold_5 AUGUSTUS gene 36045 36485 0.46 - . g8 Scaffold_5 AUGUSTUS transcript 36045 36485 0.46 - . g8.t1 Scaffold_5 AUGUSTUS stop_codon 36045 36047 . - 0 transcript_id "g8.t1"; gene_id "g8"; Scaffold_5 AUGUSTUS CDS 36045 36485 0.46 - 0 transcript_id "g8.t1"; gene_id "g8"; Scaffold_5 AUGUSTUS start_codon 36483 36485 . - 0 transcript_id "g8.t1"; gene_id "g8"; # protein sequence = [MDDWKYIYKEESNATVEIPSEKSEDEETYPYPLRRPLAPGEADAAEDPDAGLSKKRGVEWEPQLVLPSPLKHTPNAAL # PTPCDPENPRLFHMFWTGPFTDKPYLALLSFLYTQNTGIHLEEWPKDSPVCRPEFWLWINPGPAAAIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g8 ### # start gene g9 Scaffold_5 AUGUSTUS gene 46890 47750 0.36 - . g9 Scaffold_5 AUGUSTUS transcript 46890 47750 0.36 - . g9.t1 Scaffold_5 AUGUSTUS stop_codon 46890 46892 . - 0 transcript_id "g9.t1"; gene_id "g9"; Scaffold_5 AUGUSTUS CDS 46890 47750 0.36 - 0 transcript_id "g9.t1"; gene_id "g9"; Scaffold_5 AUGUSTUS start_codon 47748 47750 . - 0 transcript_id "g9.t1"; gene_id "g9"; # protein sequence = [MLEMCPNLQHLTILDIPLSREDQNLISDPPRKLSILSLKVSATRLSSQPKLFQATLLSFIAPSLTALTIGLNEYGLLS # KRRKLNFEISALAIELFLARSKCTLTTFTLDGILMTDVDVVNLLECVPSVQELTIRDPPLIGKILKHSPPVSKHLCHSLNPNLSDKNIPILPCLRSLT # LKSRSKNFDSEEFISTVRSRWLPDVDAASKVGIQCLRSIELYFRHPFQGTDYLPLNLIEESGMRVVVKLESEEMRFFEIDSEEEDVNSDAEEENSYED # GSTSELGSDDVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g9 ### # start gene g10 Scaffold_5 AUGUSTUS gene 49936 50913 0.45 + . g10 Scaffold_5 AUGUSTUS transcript 49936 50913 0.45 + . g10.t1 Scaffold_5 AUGUSTUS start_codon 49936 49938 . + 0 transcript_id "g10.t1"; gene_id "g10"; Scaffold_5 AUGUSTUS CDS 49936 50913 0.45 + 0 transcript_id "g10.t1"; gene_id "g10"; Scaffold_5 AUGUSTUS stop_codon 50911 50913 . + 0 transcript_id "g10.t1"; gene_id "g10"; # protein sequence = [MFECITARPPTTLSLKSLKASISPSAPAPALNDTDFTSFSALEPDKMPAAAPAANGKPQQQQSKSDSVEITPSSPPKR # DFGPIGSPPRNTEPVSASPGTPTNKILSSSPYKHSMLRSSSGVGASGTSATARPGLSMNRSTSSGNSGGLTLGAGIPGGKNPSWGSMGNGSDIGSLPS # LPSALLRPLNGVQPHTPLTPASSTAQQSSKDFDLTFEYDEYLGNGPGRATPGRGASSFSEVIVEDDLDGLDDFLPSSLTDLLTPRNVNVDCREATRLH # IRTLIVGSRLLIATAPDVRWVFLLLHVSRETPLQEVVHLATDIHVPSRWVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g10 ### # start gene g11 Scaffold_5 AUGUSTUS gene 51016 51996 0.33 + . g11 Scaffold_5 AUGUSTUS transcript 51016 51996 0.33 + . g11.t1 Scaffold_5 AUGUSTUS start_codon 51016 51018 . + 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_5 AUGUSTUS CDS 51016 51996 0.33 + 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_5 AUGUSTUS stop_codon 51994 51996 . + 0 transcript_id "g11.t1"; gene_id "g11"; # protein sequence = [MVLLVVDYPVLPRRIGNGTPGSFTSASGRLAADDYYPYTGGSGSPGSAALAGIGSLGGMGGLNPSNASAAFLPGYGFG # TAYIKAKREREAAVAAAAANVIGAAQRSVSGGILTNSRMSAGAGMPGTSPGSSGMAFGTPRKEPTGLTTAAPFGVSSRDISGIGSMGMSGVGLGAMNS # LETAVSPSTRSALQSHAPGQSLPQGLAAGLSRIHAKTSQVGSLSSVGSPPAGSIGVSPGVAGLGFYSGPYGTNRMPSHQSQPQVPPGLGLGLGSGYYV # NYQQTASEQPASQPVHHQSQAQSHAQYNSLNPTFNSNSQTPMLGQMVRQSWT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g11 ### # start gene g12 Scaffold_5 AUGUSTUS gene 61744 62478 0.5 + . g12 Scaffold_5 AUGUSTUS transcript 61744 62478 0.5 + . g12.t1 Scaffold_5 AUGUSTUS start_codon 61744 61746 . + 0 transcript_id "g12.t1"; gene_id "g12"; Scaffold_5 AUGUSTUS CDS 61744 61983 0.51 + 0 transcript_id "g12.t1"; gene_id "g12"; Scaffold_5 AUGUSTUS CDS 62035 62478 0.82 + 0 transcript_id "g12.t1"; gene_id "g12"; Scaffold_5 AUGUSTUS stop_codon 62476 62478 . + 0 transcript_id "g12.t1"; gene_id "g12"; # protein sequence = [MIADIAVIWPQMGSQWHTALTKTAAELGPPDSMSLNGQRNRGVEGLGRAAEEDLIADQREGMYRHKSMEAFEEKAKQQ # QEQSSPVTPASDLSGLLNRRDVELPPTGASRTRSESTSSVQNTKQTHDTHMLYSLATAASMDQKMEPGSSLPQPPIPSPTSASTPAPNGYHPGHPAQG # INVLPPTYLPTSENGPNSVPMDWNNFQTDIATLLQNDLSNHLEQGGNGWAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g12 ### # start gene g13 Scaffold_5 AUGUSTUS gene 64711 65697 0.53 + . g13 Scaffold_5 AUGUSTUS transcript 64711 65697 0.53 + . g13.t1 Scaffold_5 AUGUSTUS start_codon 64711 64713 . + 0 transcript_id "g13.t1"; gene_id "g13"; Scaffold_5 AUGUSTUS CDS 64711 65697 0.53 + 0 transcript_id "g13.t1"; gene_id "g13"; Scaffold_5 AUGUSTUS stop_codon 65695 65697 . + 0 transcript_id "g13.t1"; gene_id "g13"; # protein sequence = [MDAYKLFRKALAFPDSAEKLVLRLKVEYVRLQLWGRNSGLDRGYLPLQFQPFEDVVLDLLKRLTMLFQDSAKLREKYG # LMLVDELDKIPENFGTSEAQRTASFFRIKEAWRGIAKLDRVRSGTLLSPTSSKTRHSGKSTGREDNTASMTSRLRWAISSQSQFEALILEIRGFTDSL # NNLLKESQQLTLLRDWDRVQLDMLSRVEDIGSLRLVQDVTEGYYECEGIFDMATRKAIVVADELPTGLSLGDQTVDFADSAQVVNSSRSIAVMQKTDF # DLPDDFPEVARLLVIEIQSIYQVWFSSRKNVILLSFQQNIASYCVSESKLLSTY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g13 ### # start gene g14 Scaffold_5 AUGUSTUS gene 66099 66500 0.68 + . g14 Scaffold_5 AUGUSTUS transcript 66099 66500 0.68 + . g14.t1 Scaffold_5 AUGUSTUS start_codon 66099 66101 . + 0 transcript_id "g14.t1"; gene_id "g14"; Scaffold_5 AUGUSTUS CDS 66099 66500 0.68 + 0 transcript_id "g14.t1"; gene_id "g14"; Scaffold_5 AUGUSTUS stop_codon 66498 66500 . + 0 transcript_id "g14.t1"; gene_id "g14"; # protein sequence = [MDLAQSIYRHPEYQGNQRDRKKYRMAYDVYSFGLMLAEIALWTPLLTIYQERLKRRPTEQSPAFLEPQAMKLREEMVK # IAERQLAFKIGSGYRDVVLWCLKQSQGFMTADNELAAKFYSEVVIPLEAISQTFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g14 ### # start gene g15 Scaffold_5 AUGUSTUS gene 67117 68346 0.5 + . g15 Scaffold_5 AUGUSTUS transcript 67117 68346 0.5 + . g15.t1 Scaffold_5 AUGUSTUS start_codon 67117 67119 . + 0 transcript_id "g15.t1"; gene_id "g15"; Scaffold_5 AUGUSTUS CDS 67117 68346 0.5 + 0 transcript_id "g15.t1"; gene_id "g15"; Scaffold_5 AUGUSTUS stop_codon 68344 68346 . + 0 transcript_id "g15.t1"; gene_id "g15"; # protein sequence = [MRRTSSILTLSRPNTPGVSSSPNPSQGTTGRARSSSVVTSDSDISSASRPSVDTTAPTIPPISPPSAIMMPSPIAESP # AREAAATADEIREELRESKVGPTPLTQVVTTSTDPGTPAETVESSRSEAGRPTILGSADEPHILTEEPDEMSLRAHTVESIRESDPNETREAPAPVAS # APAPELSPAPVLETAPSYFEVPAHPSSQNLSDSASLHKAIIENTMGVISTEEPTPEGMQSDQTTPRPHGPADTENASVFYAFSEMPVPDTTQVSADEK # PNYFPNSAPGDTIPAANPIADLQRENEIVQMPVPEITGDMPAQIPPVTMPASDPIPIPPKRRDADIEPIPTPGTATGASVHHTTEFASQKPQTKSSGI # AIVPYDAGSVEEIWANQSDTQHNQVVVGRQRADSSAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g15 ### # start gene g16 Scaffold_5 AUGUSTUS gene 68892 69464 0.4 + . g16 Scaffold_5 AUGUSTUS transcript 68892 69464 0.4 + . g16.t1 Scaffold_5 AUGUSTUS start_codon 68892 68894 . + 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_5 AUGUSTUS CDS 68892 69464 0.4 + 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_5 AUGUSTUS stop_codon 69462 69464 . + 0 transcript_id "g16.t1"; gene_id "g16"; # protein sequence = [MPSSTSSSIPWPSTKPTPSHSSMPRLHHLGWIEYALPDSTIYYSHPTLRVTTDIDLRSITKLDAVTAYLEHRRLHDGA # GTPPGFELWLREGNFTDGKTTRKKRGLGKTKEFVPVRYWVDHKKRLVTTDPIWDAQGDGSARRHPTGKAVDDCESYFTLTCGIYLICSCSSGHGISVL # GIYGRPPSACHTPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g16 ### # start gene g17 Scaffold_5 AUGUSTUS gene 72043 72849 0.26 - . g17 Scaffold_5 AUGUSTUS transcript 72043 72849 0.26 - . g17.t1 Scaffold_5 AUGUSTUS stop_codon 72043 72045 . - 0 transcript_id "g17.t1"; gene_id "g17"; Scaffold_5 AUGUSTUS CDS 72043 72849 0.26 - 0 transcript_id "g17.t1"; gene_id "g17"; Scaffold_5 AUGUSTUS start_codon 72847 72849 . - 0 transcript_id "g17.t1"; gene_id "g17"; # protein sequence = [MLVALLIVLFQDFAFLQTKSSDMDLFDHCFTSSSARERKPNIGYFRHVLERTGADPARTIFVDDKLDNVLAARSFGMT # GILYDDFENVERTLRNLCFDPTVRGEAFLKQNAGQHLSYTSTGVTIHENFAQLLILEATHDPSLVKYTKYDGPFNFFRGEGELTTSAFPCDADTTSIG # ITCSDHMSPEKKHEVMDAILALRNADGIPQVYFDSSRPRIDPVVCVNVLTLFYKYGRGKQLKECFEWVESVLRYRAFSEGTRYYEPPEAFLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g17 ### # start gene g18 Scaffold_5 AUGUSTUS gene 78118 79536 0.73 + . g18 Scaffold_5 AUGUSTUS transcript 78118 79536 0.73 + . g18.t1 Scaffold_5 AUGUSTUS start_codon 78118 78120 . + 0 transcript_id "g18.t1"; gene_id "g18"; Scaffold_5 AUGUSTUS CDS 78118 78198 0.79 + 0 transcript_id "g18.t1"; gene_id "g18"; Scaffold_5 AUGUSTUS CDS 78355 79536 0.74 + 0 transcript_id "g18.t1"; gene_id "g18"; Scaffold_5 AUGUSTUS stop_codon 79534 79536 . + 0 transcript_id "g18.t1"; gene_id "g18"; # protein sequence = [MDLLEEERAKSLLTDTIQAEKRNKAPRLRGEAFQVQIPKAPPEPSYDPPPPPPPPELPPPPAPSENSPPPPPPPTNSP # PPPPPPTNSPPPPPPPTNSPPPSPPPPPSIATPTGPRILSATSTIPTKTLPTHNAISITLPASRAVPSAATPTPAQIQMQPPPPPPTPRPRSPPKPSQ # PKTYSLPPPPAWPPPVDQLPSDVRAHRVIYDSTVALLPAHDLISKDKDLREKEREAKVARDRALERAALTSGYVKLGVKSQKPVDLGPNPDLDTMMMD # IDFSKGEGTSTGAGTLAGASALGYNGYTSIGRRGKDKSSSSEYFDVLAAAIKRAKNQVSSESYPRITGKGKGKESIIRYEGQVLEDGEWVWVPEEEIA # DFSTNAVSPITPRCLLQFQHRFPCRLQHPHFWLNFAAVKAWQVLLLGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g18 ### # start gene g19 Scaffold_5 AUGUSTUS gene 79617 79784 0.22 + . g19 Scaffold_5 AUGUSTUS transcript 79617 79784 0.22 + . g19.t1 Scaffold_5 AUGUSTUS start_codon 79617 79619 . + 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_5 AUGUSTUS CDS 79617 79784 0.22 + 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_5 AUGUSTUS stop_codon 79782 79784 . + 0 transcript_id "g19.t1"; gene_id "g19"; # protein sequence = [MVKDRDKPVVGEDGAQVIDVEKESQLLWLKDREKKVRSQFYMLDEYEVGLVKVLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g19 ### # start gene g20 Scaffold_5 AUGUSTUS gene 80506 81615 0.15 + . g20 Scaffold_5 AUGUSTUS transcript 80506 81615 0.15 + . g20.t1 Scaffold_5 AUGUSTUS start_codon 80506 80508 . + 0 transcript_id "g20.t1"; gene_id "g20"; Scaffold_5 AUGUSTUS CDS 80506 81615 0.15 + 0 transcript_id "g20.t1"; gene_id "g20"; Scaffold_5 AUGUSTUS stop_codon 81613 81615 . + 0 transcript_id "g20.t1"; gene_id "g20"; # protein sequence = [MRPILDTRDSRERERERERDRDRDRERDRDRDRERDRDRDRSILATPASGSAGPSSAHGGSTPRPNGSSSASAVPLPS # SSSSVLTSKLPNIPSRPSGVTIATSMKANPPPALIKARAHLKRNALLRKPEGEEDPAGLGNGNGTPVQIRLENEAKEREDDRERERDRERGERGRDND # RDRDRDRRRSTDRYGERLPPSQWRADREREREWRSGRSPSPDSRDKYGSGRRDNRNLRRDRDRGDRNRSLSPYDDGRTYIPGNTRYGAGSDRWNHHYR # RHDRSPPPSYSRRDRFLRRSPRASRSPSSARPTRSMGWEKDHGDVLEELGKSKFPHLKLEPDAGGHFPHQVQEEDVKALLASFEIDKVCFTRLEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g20 ### # start gene g21 Scaffold_5 AUGUSTUS gene 81815 83271 0.79 + . g21 Scaffold_5 AUGUSTUS transcript 81815 83271 0.79 + . g21.t1 Scaffold_5 AUGUSTUS start_codon 81815 81817 . + 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_5 AUGUSTUS CDS 81815 82952 0.79 + 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_5 AUGUSTUS CDS 83057 83271 0.81 + 2 transcript_id "g21.t1"; gene_id "g21"; Scaffold_5 AUGUSTUS stop_codon 83269 83271 . + 0 transcript_id "g21.t1"; gene_id "g21"; # protein sequence = [MVLKAKEIITDELKSALQQDILSKYIGPQLKTMINELQNYPSVELGTVKESGVSMVDQINARQLGLVGLSFKKQRKER # KPVVEEIVHEVDVEEEQDEDEEERPPKKKRKKDVVLPKKQRKRVLDDEGESEVESEDGDEDVIPADERFRKRPLSVESESEAEEPVKKKSKKEEIKRK # KKEVKKVGKKDIHDHVVLPDNEYDAPALDLRLTPGADSLIAPSRSVSPLDSRVLTTPPPTPPPVDPTEGVCDDDEDLYYAKLVLSGRVPSDDKIKILS # PPPTQETDEGQSLLRKHVTGSARTEGFYKITHAEKAVYVTQYQARTTNAAAAAAQEILPEESKPQHVTSSRSNRANARRRAQGLEEINQVHGPLLFPK # EKQQVNLQMVIEYVGEVIRAQVAEKREKTYERQGIGSSYLFRIDEDLVVDATKKGNLGFVLLSSPLTITDTDSLQAFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g21 ### # start gene g22 Scaffold_5 AUGUSTUS gene 105589 106371 0.96 + . g22 Scaffold_5 AUGUSTUS transcript 105589 106371 0.96 + . g22.t1 Scaffold_5 AUGUSTUS start_codon 105589 105591 . + 0 transcript_id "g22.t1"; gene_id "g22"; Scaffold_5 AUGUSTUS CDS 105589 106371 0.96 + 0 transcript_id "g22.t1"; gene_id "g22"; Scaffold_5 AUGUSTUS stop_codon 106369 106371 . + 0 transcript_id "g22.t1"; gene_id "g22"; # protein sequence = [MKQLKEIEQSLEGLRKASAPASKFAFKRKAREAVQSSPNVSTPSMKASAAPTSSLTLSSYTMKLVTPDDLPDPETVAP # ELRSELSIHDLDSCILNLINAKQHEISALHIRNVKNSILLLPALDGSVILHDLINCIVVVKCHQVSSESSSPAIVPPTNFGEQFRMHSSKSIDVYLSI # QSNPIIEHCHSIQFAPYPATFSPTIVQHNSDVSVQDFSHIKSTPSPNWNVLDERARKLPEDWQSISAVSATDVERILQKCLPSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g22 ### # start gene g23 Scaffold_5 AUGUSTUS gene 107449 108229 0.34 - . g23 Scaffold_5 AUGUSTUS transcript 107449 108229 0.34 - . g23.t1 Scaffold_5 AUGUSTUS stop_codon 107449 107451 . - 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_5 AUGUSTUS CDS 107449 107475 1 - 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_5 AUGUSTUS CDS 107568 108024 0.85 - 1 transcript_id "g23.t1"; gene_id "g23"; Scaffold_5 AUGUSTUS CDS 108084 108229 0.34 - 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_5 AUGUSTUS start_codon 108227 108229 . - 0 transcript_id "g23.t1"; gene_id "g23"; # protein sequence = [MYASTAATTNRHQPTPTTGGVSASSWPMVSQSPFMYRSDTLGNEFSVLTDFLETLDDNSFFGAPQSVSSALLGSGTSS # FTTNTYTIPTNGSATATTISGTTESASTNSNSNQETSPSSNSDDPSTSEGEKAPETQAPDPATILPAATKTEKFLLTAADQESGSRDERLSWVIRSKY # EAGLLKPYNYVKGYARLSRWMDRKFFYDPNFEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g23 ### # start gene g24 Scaffold_5 AUGUSTUS gene 109750 111264 0.83 - . g24 Scaffold_5 AUGUSTUS transcript 109750 111264 0.83 - . g24.t1 Scaffold_5 AUGUSTUS stop_codon 109750 109752 . - 0 transcript_id "g24.t1"; gene_id "g24"; Scaffold_5 AUGUSTUS CDS 109750 111264 0.83 - 0 transcript_id "g24.t1"; gene_id "g24"; Scaffold_5 AUGUSTUS start_codon 111262 111264 . - 0 transcript_id "g24.t1"; gene_id "g24"; # protein sequence = [MPGGVDMTYMGNIGMNGGLGIGGFGGNFHYQNPYGYNYPEGESVGSENGTVDMGCVQPAMLFSTPSSPQSHPGDGADD # EDADAEFDIDIEDQEKEVSQPVYDVQKGVKKEKVTNKTLSAKATNTKGKGQYTGNPLDDSTTPVASTNTASSGIPVDTAKPVPRIGRPPTGGGGSGLL # QSKPFKCPKPNCNKSYKQANGMFIDLQLISAYVLMFYLEGLKYHITHGSCNFAPPKDMEHVQAILERKRKQQQQQQTPQEDSANVNPSPSASSSGANT # PRSGMATPVTPSSLSSPFTLALSVNTGVVSTGGSNPSSALSSPVAPSSGSHFTGANNFIPTPSSLSTALSSALSLSSPTTATSGYAEGTYQDGEETSL # NRSNSYGQAVSQNRIPNANASSSSLINALTPISTSATSNNTSAADSLTSLRSTLSSLPPSELLAIEAEAERQLKPYACGVGDCPRRYKNMNGLRYHYM # HSGDHGVIGLQWLASGKHECLAQREIRVPVRIKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g24 ### # start gene g25 Scaffold_5 AUGUSTUS gene 122309 123031 0.93 - . g25 Scaffold_5 AUGUSTUS transcript 122309 123031 0.93 - . g25.t1 Scaffold_5 AUGUSTUS stop_codon 122309 122311 . - 0 transcript_id "g25.t1"; gene_id "g25"; Scaffold_5 AUGUSTUS CDS 122309 123031 0.93 - 0 transcript_id "g25.t1"; gene_id "g25"; Scaffold_5 AUGUSTUS start_codon 123029 123031 . - 0 transcript_id "g25.t1"; gene_id "g25"; # protein sequence = [MSFLTNTVGNLSQAAKNVVVSQSADRGQAPQQTNDQTTNESSNLDHKPSSDQPPSSSVDFSPRPQDEPKSSSGFISGI # GKASSTITSTTTSGLTSGINFTSDLAKNGAQLASDTANAGVSISRTVARSGLDMSIGVVGGTADLAGTAIGGIVNTAAETSGKVFEPVASGLKAVEGF # DKLGDGLMAINGLPVGAVQTVGRWTMTVSVERVVSVSWSFELILHVGFEYERQGMFLAPHLHIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g25 ### # start gene g26 Scaffold_5 AUGUSTUS gene 123615 124793 1 + . g26 Scaffold_5 AUGUSTUS transcript 123615 124793 1 + . g26.t1 Scaffold_5 AUGUSTUS start_codon 123615 123617 . + 0 transcript_id "g26.t1"; gene_id "g26"; Scaffold_5 AUGUSTUS CDS 123615 124793 1 + 0 transcript_id "g26.t1"; gene_id "g26"; Scaffold_5 AUGUSTUS stop_codon 124791 124793 . + 0 transcript_id "g26.t1"; gene_id "g26"; # protein sequence = [MNSYIIPLYLLAVAFFAIADIVSTGNSNKHNSYELSRHPSVNQRPHWSSSSNAGTGAGSGDPSVTLDPLQDSELLDIV # LVASVDGKFHALNRTSGHSLWSMPSLAPSQGPGHVKFDFQNLTSPYPSTLAPLVRTTHNQQNNEYLLNDDELPLEDEVYIIEPQSGAIYILPSNPSST # QNPPLRRFPFTMPELVDMSPFSFSDPDGHSRLFVGRKETSMLVVELETGKIKASVGGECPWDPFDDMKDEEDSQDYELDLDELELEETDEKPAKEKIK # PTEVFIAHRCVLALGICGSFSNSDFDITDYHISIHTRPSRTSSGSRLQSPPVQNLSFSTYGPNNQDTLLQSSYSRPKDDSYVQSLPSGELLAFRAHNA # LASSNDKDSLLWFRKFPNPM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g26 ### # start gene g27 Scaffold_5 AUGUSTUS gene 125135 127313 0.74 + . g27 Scaffold_5 AUGUSTUS transcript 125135 127313 0.74 + . g27.t1 Scaffold_5 AUGUSTUS start_codon 125135 125137 . + 0 transcript_id "g27.t1"; gene_id "g27"; Scaffold_5 AUGUSTUS CDS 125135 126277 0.76 + 0 transcript_id "g27.t1"; gene_id "g27"; Scaffold_5 AUGUSTUS CDS 126360 127313 0.9 + 0 transcript_id "g27.t1"; gene_id "g27"; Scaffold_5 AUGUSTUS stop_codon 127311 127313 . + 0 transcript_id "g27.t1"; gene_id "g27"; # protein sequence = [MIDYAPGGMIVSDGVAAAPADAGDENYEDGREFPADIDEVTRRRKLREQREQERKESIERTTNEIPDTCDPASNVFDL # RCLVKLWKLEDSDGDGDGAKGVGSRGQDATKLLDAAPSPSASSRLPSDQVTHSPTIASGTRQSIPTNVHPNPGNGFDTTSEGPFTWKWEILVALLVGF # VGLLSAIAGRHLPSLSSIRHAESQSQTLALSSIPRESISAVEHSASAPPIVDSPLPDTAKPPPSPSFSDIDLPSENISASPIRLDVPELEDSEGEADE # VADASGRKKKIRRKRGKRKKGGAALALSAPPGENGASGIDIGLPIITPISPTVPNLVAPPLQSPMSPWPPAPSLVVIPATPMPLTPAPVHAPPPSTLV # VSETILGESGRSVAVKRLLRDFVTLASREVSILQESDDHPNVIRYYYQETHANFLYIALELCPGSLADVYEGSGDINLAFAGLDACEGIESKEEWREI # RESIIADPKKALKQITSGLRHLHALKLVHRDIKPQNILVAAGPGRNLSTPSSASLSRGQNKSIRGPSYRMLISDFGLCKKLDFDQTSFLPTAQGAMGA # GTFGWRAPEILRGEVKLDNSEDTNSSKGSAGTVNGNPPSVNSSSSTTSSINKPTRLTKSVDIFALGCLFYYMLTGGGHPFGDRFEREINIIKGVKDIT # TLGERYGEEGVDAADLIEKMLNPDSSLRYVLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g27 ### # start gene g28 Scaffold_5 AUGUSTUS gene 129624 132143 0.15 - . g28 Scaffold_5 AUGUSTUS transcript 129624 132143 0.15 - . g28.t1 Scaffold_5 AUGUSTUS stop_codon 129624 129626 . - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_5 AUGUSTUS CDS 129624 130140 0.89 - 1 transcript_id "g28.t1"; gene_id "g28"; Scaffold_5 AUGUSTUS CDS 130365 130893 0.66 - 2 transcript_id "g28.t1"; gene_id "g28"; Scaffold_5 AUGUSTUS CDS 130940 132143 0.45 - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_5 AUGUSTUS start_codon 132141 132143 . - 0 transcript_id "g28.t1"; gene_id "g28"; # protein sequence = [MPTAPSATPAPVIVESRRSRSRSPPIIIAQSRSHSSRSRRRSPSSHGAPIIIPGQPTVIPGQPSGYVSSQYPGTHRTR # RSPSSSRSRSPPYAPVHPSGAPYYEGSRHPSRRSPPIVVPIPSQYHESRRPSRSPTRIMSPRSDRHRRRSRSDSRDYDRPRRHSRDYDRSRRDSRDRP # RRDSRDRPRRDSRDRDRDRSPRRHRRDSRDRDRDRDRSPRGHRRSRSYSDSRSRSPDRDHDRRRRGRDHGRDSRRRSRSYSPTTSVYPGAPPGPTYVP # THPPTHAPTIVSHAPSHTFPEEHLPSRPGTHRPRSVSEEDRPEYVPSRYPSRPGTHRPPSAFEEDRPEQAPSHYPSRPGTHPPRQSMREKRVPHHEQF # VPLLPVASIQALIVVMYLKKHNEFPRSLVSTRSPRTVRDDDGRTVLDDDGFPLRRVPTVRDGDGPPVRRTPTGRTVRMDEPEVVPHGTGPTLRDDDGY # SLLDDDGRPLRAGPPIIPTSRPGTVRPLPSEPSGRGSPSIIETVPPPRARTPRTPAFEDLALAEEQRDRLARLDEAEHRINDVVESARESEQQREAEF # EEKERQREDDVETRARNPGDYRSGTGKNTKEREAAAAERLELEAERNAAIQAAQELKDARIQELEEQVAALRAELEAEKEARQADESDARERERAERE # EHNEFIRSQLMDLTNLMNEQRQVMDEKKELMESRYADKEERRRNKDAETAEMRDMIQRLFEEFQAERDRAETLRMEAEGKPGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g28 ### # start gene g29 Scaffold_5 AUGUSTUS gene 132684 133676 0.7 - . g29 Scaffold_5 AUGUSTUS transcript 132684 133676 0.7 - . g29.t1 Scaffold_5 AUGUSTUS stop_codon 132684 132686 . - 0 transcript_id "g29.t1"; gene_id "g29"; Scaffold_5 AUGUSTUS CDS 132684 133501 1 - 2 transcript_id "g29.t1"; gene_id "g29"; Scaffold_5 AUGUSTUS CDS 133556 133676 0.7 - 0 transcript_id "g29.t1"; gene_id "g29"; Scaffold_5 AUGUSTUS start_codon 133674 133676 . - 0 transcript_id "g29.t1"; gene_id "g29"; # protein sequence = [MTELNLWLGRDVTDRHNEMTAVVQRLEELRASLNDLRNRPYVVTVPGDEGRDEETEGSSEGSPEQQPVFIPGMPPSGQ # AAGPGMPQPVIPGTGPWPPGFVPQGPPPFAPSVIPGGGGPSPYPPFQPVIPGMPPGMPSGPIVVNPPGPAPIIPMDFPHGGGMRMPEPMIPGVAQTGQ # QIPFIPPGPSIVRVPGSSSSSSSDGDSGSSRSGSSDHTRRPSRRPSTASYSRSPTPVPIQILPPTQVPGVVPEGSRGPSPPVVVVQPSEYPPPGSVRH # PDLAGQFQPSQASQGAQPAGPTIINIPGQPQQPTQVPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g29 ### # start gene g30 Scaffold_5 AUGUSTUS gene 134176 135792 0.91 - . g30 Scaffold_5 AUGUSTUS transcript 134176 135792 0.91 - . g30.t1 Scaffold_5 AUGUSTUS stop_codon 134176 134178 . - 0 transcript_id "g30.t1"; gene_id "g30"; Scaffold_5 AUGUSTUS CDS 134176 135792 0.91 - 0 transcript_id "g30.t1"; gene_id "g30"; Scaffold_5 AUGUSTUS start_codon 135790 135792 . - 0 transcript_id "g30.t1"; gene_id "g30"; # protein sequence = [MSVSISTPRGDTPSKRSTLDTVPTPSTSFSGRASPRDVSADIERLAEELRQYDQNRAEENRDLGDALRDLREELLGLS # DSLHHPIPSQEPPQTPSYPRYPRQPQYPHQPQYPHQPQYPQQPQYPQQPYPHYAEERVGSSRAMSADENRSLSLAPSSLNRTPSSASSVSFLSSHHSD # DWLLYPTPQPPGSPVSRRSIRPDSPMPTLPDIDESELSSESSSPLSTPMLSSSSTSGPYPGSSGPSSSPTPTPPPSTVTPISVSPGSPATTATTIRPS # PPNPLPLLNEIRDQVRALWDGQLSTNHLLDEIRGLRSDSQSNEVLDRMRRVENLLEGLLNQGVPVQPPPMPVPEPSLPPASPSMSSSSAGLSRYESLI # NDYRRQNPPIAPVCTTTCLRHDPCPTARRYISQGIQPQLRQAVPPEPLQPFDYAPLPRAHADSPIGEVRLPPPRATSQPIPFPYPDPRRTRVRRHPHR # PVDESPTSRFAPTAPSGPSSERPDYQMGDAGRQPLSPPPPPPPGRRPTNIPPPQPVVRHFHKFSINPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g30 ### # start gene g31 Scaffold_5 AUGUSTUS gene 135858 137536 0.13 - . g31 Scaffold_5 AUGUSTUS transcript 135858 137536 0.13 - . g31.t1 Scaffold_5 AUGUSTUS stop_codon 135858 135860 . - 0 transcript_id "g31.t1"; gene_id "g31"; Scaffold_5 AUGUSTUS CDS 135858 136617 0.81 - 1 transcript_id "g31.t1"; gene_id "g31"; Scaffold_5 AUGUSTUS CDS 136706 136844 0.44 - 2 transcript_id "g31.t1"; gene_id "g31"; Scaffold_5 AUGUSTUS CDS 136984 137536 0.17 - 0 transcript_id "g31.t1"; gene_id "g31"; Scaffold_5 AUGUSTUS start_codon 137534 137536 . - 0 transcript_id "g31.t1"; gene_id "g31"; # protein sequence = [MTYTSTLLWMLGSTPMPSDPSSSSDSDRELSSDGENLVTASQRSSDYLTTRTPSSEASFKSLPSIPSEYITASEGSIA # YKTISEPITEPTTAYSTAEMCPSKLETIPSEEETPKAYSEHLPELEELPSVLLSAHLSRPFFCTTIYSLVAPPSIPHLHHHVPRLHHHLFPRICFSSY # LSIPHLLLRVPLPSSAASELSELDLSLTPTSESDLPLPPSTALSTSVPTPSSVHCSSGTLQLPTTLPSSTMSSLTISSESSLTPSMPVTTLPSLTLPS # IPPSSSPSSLPLPPSPQPWATETNISYESSLLAPSPSATSVALIQDPDTSFETSFLRPSGSWSSFDRMSTIPETPTAITSTHPPSFPALSPVPPFPPT # DESSSVRTPSSLIFSDTSVGSSSLGSLLSLPRTPSTISSSSAVSSTSVITSIVDSESDLEPEPELEHQEDDDARSIPESQISTEPSLLSSIATPRASR # IVSLACFPLYILD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g31 ### # start gene g32 Scaffold_5 AUGUSTUS gene 137989 139026 0.44 - . g32 Scaffold_5 AUGUSTUS transcript 137989 139026 0.44 - . g32.t1 Scaffold_5 AUGUSTUS stop_codon 137989 137991 . - 0 transcript_id "g32.t1"; gene_id "g32"; Scaffold_5 AUGUSTUS CDS 137989 139026 0.44 - 0 transcript_id "g32.t1"; gene_id "g32"; Scaffold_5 AUGUSTUS start_codon 139024 139026 . - 0 transcript_id "g32.t1"; gene_id "g32"; # protein sequence = [MSMDSNSSVSSTASSGTGSRSTVYVPPMSDIPDIPELSMAEDDLYASESDGTRGHSSSSGTGRYHSLLSSPSVSSSGS # GARLRPSTLISSYHSRTVDDTVIDGDEYVYPGDSRAIPSRRTSTRMSLRRSGSMTDLGSDALQSNRSSGLNDESDDQFFTAGTSSSAPRNSVYSSADS # YSSQTGTGTGTRTFTGLTSSGITGTGTTDTYTRTGTWTAGGSGTESGTRVTESTRYTGYSRTTGTGVGTYTSYSGSGSYTRTGSDSYAVSGTNSENRS # ATTGVTGTGRTFTTDYESRTGYGSGSYSGSPYTGLVSGPYPHDDLQTNTKSLYRTGSIYSPYTERQDRLTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g32 ### # start gene g33 Scaffold_5 AUGUSTUS gene 139715 140929 1 - . g33 Scaffold_5 AUGUSTUS transcript 139715 140929 1 - . g33.t1 Scaffold_5 AUGUSTUS stop_codon 139715 139717 . - 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_5 AUGUSTUS CDS 139715 140929 1 - 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_5 AUGUSTUS start_codon 140927 140929 . - 0 transcript_id "g33.t1"; gene_id "g33"; # protein sequence = [MERRAASPSSNSFSDTDSYEESNSIDEVEATLNNLDDELDETEQALSTWSSQTPSTGYGSHTGTGSGTYTGYTGSGTY # TPSGTFAGTNTVTQTGQGSYTGSPSFVSLPSLFSPTAGSSSLQSSYPPPSNAPWMRLSHITERTEGTESRPVSGVSYATSVPVRPRSAFLSSGAGRHS # RSSTDPSDLPPPGRANQLIGLFESGSSSRSPSPTKSTSSFTRSQTPSNLSYSTLLSPPDRPFTATGSSYTPSTFTNTQSTFTQSTFSPSAFTTTQTGT # GTVTGITGSSEQTQTTPTSSSLRRPTKPEGSPRSPLTNVRNIVSLWKERTPTRNDGPKNSRGGVVAPSVSPTPDARGRREGQPQRGSGGADNGGLFEL # RRRASGKRASAESLGGSEGERTSNGTMEVVLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g33 ### # start gene g34 Scaffold_5 AUGUSTUS gene 143889 144878 0.76 - . g34 Scaffold_5 AUGUSTUS transcript 143889 144878 0.76 - . g34.t1 Scaffold_5 AUGUSTUS stop_codon 143889 143891 . - 0 transcript_id "g34.t1"; gene_id "g34"; Scaffold_5 AUGUSTUS CDS 143889 144567 0.76 - 1 transcript_id "g34.t1"; gene_id "g34"; Scaffold_5 AUGUSTUS CDS 144706 144878 0.82 - 0 transcript_id "g34.t1"; gene_id "g34"; Scaffold_5 AUGUSTUS start_codon 144876 144878 . - 0 transcript_id "g34.t1"; gene_id "g34"; # protein sequence = [MVRDRILIENILECAKRWKDTLNPSIDRTSWSATEVRFQINLEACFNALDRTRYYLRPITRGNGGLDLLPKLSPSPTS # SLETSPAPCSSSSSSTSPMTPHLSLPGGSTPAFWPSPSFDIDLNELSWPSMETQGYRSTLETLSLDDLFTLPPIKYPSSPSMSQTQNASTSTDPHKVH # VPESSKQDLPLLASSMMTPFDGTSSFLFSNNAQHSSNSSTKALKLYGSPHSASTQQVQIILHEKNILYELIDLDIMSDPEIQDLIRQPSSAPVIASLC # QFLLPSVIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g34 ### # start gene g35 Scaffold_5 AUGUSTUS gene 154164 154661 0.87 + . g35 Scaffold_5 AUGUSTUS transcript 154164 154661 0.87 + . g35.t1 Scaffold_5 AUGUSTUS start_codon 154164 154166 . + 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_5 AUGUSTUS CDS 154164 154661 0.87 + 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_5 AUGUSTUS stop_codon 154659 154661 . + 0 transcript_id "g35.t1"; gene_id "g35"; # protein sequence = [MSTATTTLTEALDANFSRLSLSASPVPFVYLFLHGKRHHQPKRKWNGLIILTVDLSLYETNKPKLIETVQTALQRDGF # FYVIGHGIDVEEVSTGMPKSKCANMETEMQSTFQLNRQFDIGQVAFDQVPREEKEEHRAQIKEKGSFMGYKVCRLRAFGRYIANFEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g35 ### # start gene g36 Scaffold_5 AUGUSTUS gene 159849 160634 0.41 - . g36 Scaffold_5 AUGUSTUS transcript 159849 160634 0.41 - . g36.t1 Scaffold_5 AUGUSTUS stop_codon 159849 159851 . - 0 transcript_id "g36.t1"; gene_id "g36"; Scaffold_5 AUGUSTUS CDS 159849 160634 0.41 - 0 transcript_id "g36.t1"; gene_id "g36"; Scaffold_5 AUGUSTUS start_codon 160632 160634 . - 0 transcript_id "g36.t1"; gene_id "g36"; # protein sequence = [MIKQMISLDPLSRPTFDSLMQASRGTVFPESFFSFFHNYVSSNNEISGISPFAPNGTNIPNPGDLTPSFSATALRSGT # LTSTPAPGGNSLNAMSSGDVLPNDSDNRMERLWADFESVEPYLVVDSAEEITMDVKIDYHSTTTSVSRPFQDILPIELQIPNRVSKLNSILQPKSRAT # LDGPALIILAIVTANIRNCYLPSSKVRALDVFLALSSHLTDEAKLDRMVPYIVDLLHDEAAIVRLAAIRTLVQVVSITPNSSNSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g36 ### # start gene g37 Scaffold_5 AUGUSTUS gene 165003 165625 0.66 - . g37 Scaffold_5 AUGUSTUS transcript 165003 165625 0.66 - . g37.t1 Scaffold_5 AUGUSTUS stop_codon 165003 165005 . - 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_5 AUGUSTUS CDS 165003 165487 0.82 - 2 transcript_id "g37.t1"; gene_id "g37"; Scaffold_5 AUGUSTUS CDS 165580 165625 0.66 - 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_5 AUGUSTUS start_codon 165623 165625 . - 0 transcript_id "g37.t1"; gene_id "g37"; # protein sequence = [MNPSQLMDVLAHMKVFSHPQFAYALFQALLLNKIVDQSILQRMLAATVGSTAPPSAPTPANVPPQQYYPPGGNYGASS # HMPPFPPNMATPMFAPPPVSMPPPNYYRPTPPPGMTPSSQMQHPSSGSSTPVLQQPSPVQANMYQRTQPQANNVAALNNISESHKASHFLSVPILYLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g37 ### # start gene g38 Scaffold_5 AUGUSTUS gene 171459 171812 0.97 - . g38 Scaffold_5 AUGUSTUS transcript 171459 171812 0.97 - . g38.t1 Scaffold_5 AUGUSTUS stop_codon 171459 171461 . - 0 transcript_id "g38.t1"; gene_id "g38"; Scaffold_5 AUGUSTUS CDS 171459 171812 0.97 - 0 transcript_id "g38.t1"; gene_id "g38"; Scaffold_5 AUGUSTUS start_codon 171810 171812 . - 0 transcript_id "g38.t1"; gene_id "g38"; # protein sequence = [MQKSYILTTEFRFVLAATDHLHRKLAKFEARMHSLEDALTIAQTTYNLEPHPLLSDREDIYTDTQELKPMPEASEDEA # DLTPYISGSLHVNGSGLSRFFGPSGAPEVRVIMIVQVED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g38 ### # start gene g39 Scaffold_5 AUGUSTUS gene 172993 173733 0.83 - . g39 Scaffold_5 AUGUSTUS transcript 172993 173733 0.83 - . g39.t1 Scaffold_5 AUGUSTUS stop_codon 172993 172995 . - 0 transcript_id "g39.t1"; gene_id "g39"; Scaffold_5 AUGUSTUS CDS 172993 173733 0.83 - 0 transcript_id "g39.t1"; gene_id "g39"; Scaffold_5 AUGUSTUS start_codon 173731 173733 . - 0 transcript_id "g39.t1"; gene_id "g39"; # protein sequence = [MLKLGYETYMGQGGDWGSFILRSVALQHPSSLVGLHINFPVTLPPKPLANPTTLFWLAIRYFSPEESKRLKRMQWFLK # NESGYSQIQRTKPQTISYALQDSPIGMLAWIREKIHLATEEDYVWDTDIVLTWTMLYLISGSAGSARIYKEAISEVGGTTFVLGTKISKEVAVGVSSF # PKDVGYATKWWAEATLAEKIVTWRENDKGGHFPSVECPDTLITDVQEWVKAVKKTSTRSKWDALLQAGRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g39 ### # start gene g40 Scaffold_5 AUGUSTUS gene 173957 174346 0.75 - . g40 Scaffold_5 AUGUSTUS transcript 173957 174346 0.75 - . g40.t1 Scaffold_5 AUGUSTUS stop_codon 173957 173959 . - 0 transcript_id "g40.t1"; gene_id "g40"; Scaffold_5 AUGUSTUS CDS 173957 174346 0.75 - 0 transcript_id "g40.t1"; gene_id "g40"; Scaffold_5 AUGUSTUS start_codon 174344 174346 . - 0 transcript_id "g40.t1"; gene_id "g40"; # protein sequence = [MSSPKPYKLDVSSDFLSWVTDRVNTARIIPDITHPAGEEWEYGIPTAAMEPLVEYWKSNFDWRKMEKQINETFNMYTI # DLEEAGEVISLHFVHHRSDRPNAIPLIFAHGWPGNFTEVRINYETTQNHSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g40 ### # start gene g41 Scaffold_5 AUGUSTUS gene 176959 178460 0.39 - . g41 Scaffold_5 AUGUSTUS transcript 176959 178460 0.39 - . g41.t1 Scaffold_5 AUGUSTUS stop_codon 176959 176961 . - 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_5 AUGUSTUS CDS 176959 177489 0.42 - 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_5 AUGUSTUS CDS 177847 177978 0.39 - 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_5 AUGUSTUS CDS 178047 178460 0.47 - 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_5 AUGUSTUS start_codon 178458 178460 . - 0 transcript_id "g41.t1"; gene_id "g41"; # protein sequence = [MSKKKGPAATLRAQDSSVSTPADDSSAPPTPARDRKKESSEAPSRQSPSASGRAAREVDRVMSPISSSSSASEPPLSQ # RVKLTNGVTASPRKSPSPSRTSKPADMEESRKDSAKIDSLTSSPPRTTAQSPPTSPAKSWPPSWLTTTMHSTQTKYPNDKFDVVWRKVGEGSEWRIKC # VDCPGKAWSKVLTTSTLFGVANRQYVLQTRPSSRTAVILSRPLSQTGFGNPARRPYRGRINRIPVVKYGSLHTSCHVSFPNSAMESTPGHDLPSGSFV # DHTRPDLFYHLLEPPTPLSPDVPVYALSFLPSAPPVPNSATIIGWLPASTESQTEQDAGLNDFKENSACLSFFLSRCTESAGLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g41 ### # start gene g42 Scaffold_5 AUGUSTUS gene 178576 180259 0.31 - . g42 Scaffold_5 AUGUSTUS transcript 178576 180259 0.31 - . g42.t1 Scaffold_5 AUGUSTUS stop_codon 178576 178578 . - 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_5 AUGUSTUS CDS 178576 180159 0.49 - 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_5 AUGUSTUS CDS 180242 180259 0.31 - 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_5 AUGUSTUS start_codon 180257 180259 . - 0 transcript_id "g42.t1"; gene_id "g42"; # protein sequence = [MELERYSVVEDYQLAPSYHSTIVKNIQEQLSDYKAHSALYDGEGGEYLGDDNDPAVVEKGVLNEEDATFWENWRKRLR # TEYGFVKAGHDLKAKRKRKVPGVKEEPAEDADIEDAADPDSLPDEKSMAVEEFEFDEAKMTEDMRIVIKVGGQLIHAPVLLYAYNTAAMLTRLFYLQL # DIIVGSMKLDDQFEWDIDNVRASPEQFAEIYTRDLGLSGEFRCVDLEIMQTQKLTYTSMYSSAIAHSIREQVQTYHKSLFLVGRPSDGSYIQDEELRS # AFLPSLAEGARAMDQVQFFTPLLNYLSDGEIERNEKERDKDVNRRRKRNTRGRRGVNLPDREPIRTHRTPAIGFPELDAATLALAAAANAPVSRRAAA # AAASLTIANMVASENGTPLTPLSLPAVPQPAATAVVKEKKVKGLFKAPQIPPSVFRPRAKVTAPTPSTAADISSLPAPLENDPPPSINTPDRRFLRPL # STRKPKDSEREAKEKEYAEGQHANYIDGVWHCSNCGCPESIAVGRRKGPLGNKSQCGDCGKTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g42 ### # start gene g43 Scaffold_5 AUGUSTUS gene 180418 183577 0.3 - . g43 Scaffold_5 AUGUSTUS transcript 180418 183577 0.3 - . g43.t1 Scaffold_5 AUGUSTUS stop_codon 180418 180420 . - 0 transcript_id "g43.t1"; gene_id "g43"; Scaffold_5 AUGUSTUS CDS 180418 181794 0.49 - 0 transcript_id "g43.t1"; gene_id "g43"; Scaffold_5 AUGUSTUS CDS 182025 182248 0.49 - 2 transcript_id "g43.t1"; gene_id "g43"; Scaffold_5 AUGUSTUS CDS 182308 183577 0.51 - 0 transcript_id "g43.t1"; gene_id "g43"; Scaffold_5 AUGUSTUS start_codon 183575 183577 . - 0 transcript_id "g43.t1"; gene_id "g43"; # protein sequence = [MNNNMNNMTMSGMGMNNMGGGLPMGGGGLGMNGALGNGAMGGMGGMNAMNMGMNSMGAGGMGMNMGMGNMSGNTGSSR # AGGGINPSQLMGLGAGNSGIGVGGGVNPGLNSMNPMSGMGGLNPTQLLQSQHQRDRDQMSALQQSHMQQQQQHSGGSSIGLGGGGFGMNNMNGMGGMN # NMGMSNNYGSINPTGMSSSPASSSMGMGMMGGEATQRSGPMGNLGMMGSQNHLGIQQPPNSMNSHSSPSNTPHNPMSHSSNPNLSSSSGLGPNIPPQM # LHAMGISPQRFQAMSPQEKAMVAQKAALAFRNNSNANGHPQQNPSSPSSSGPHGMHGQSNPPSSGTGYYDRDGLQPRDQGRVFGEQQRPSAIHGGSGT # PGMESLGRPGSSTGLAGFPGDMIGMGGGMGNMMPPPPRPSTAMSNRSASGMGLSTAQSNMGMNNMAGMNMNNGMNGVNSMGNMNGMGNMSGMSLGNNM # NNMNMASGLSRPGTAMGMRTGNMNGMNMNLNMPRNSSNLPSVGGGTTGPSGAPGSPGPGSGGMRPPSRAMSVSSNGVRIGNDGPIVNGYPMPPSTPKH # PQTPGTPQMGHGLLQHQLPGSSSSLPSTPYPHPQHLHQVSPPPNRPPSAAPGSPSMNGAALARRGSPMSAQPGMGINAGGRGTPNPLKRKASGLESPK # VGPPSGTSPEAMERPGSAMQNGISGKASFNNMNIGMEMTRPGTASGFSPPASGGPRPQRESTSSSGPPLLTPSDSLLPLNNSSHKDESNPFSISRPTG # SIPPNSSVNIPTEISGTTATSQAAAGLVSSNNLNGPVKVVPKLPPLPANVNLNPLVTEVKIVPVAGSDKTIPLLTSDEIEDIKRWQKVDSTYEEMYKA # MREKMELELKGDPRALPRDFLALLDAGEFGGLGGKGGVLGNASIKWWEKGSYSVNPGARFRQRREGFDIKYPGKSRRESHGRSKKGIKREGFRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g43 ### # start gene g44 Scaffold_5 AUGUSTUS gene 187420 188181 0.69 - . g44 Scaffold_5 AUGUSTUS transcript 187420 188181 0.69 - . g44.t1 Scaffold_5 AUGUSTUS stop_codon 187420 187422 . - 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_5 AUGUSTUS CDS 187420 188181 0.69 - 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_5 AUGUSTUS start_codon 188179 188181 . - 0 transcript_id "g44.t1"; gene_id "g44"; # protein sequence = [MTRQISPLVFNRMTSSPSSTERDGSGDGDGYREYVPEEDYSRNVIETGTVQIAEQEESSSLSHLNSMYSEQSVHSVYS # DSPSVFYTAVPIPRAVGATTSAPSQTSPPPAPQTLSYSALDLTFDSDLKFPASISDTPSAPVASDSQFSTSTSQPESTSTLPQLAPGWVFPRIQPRLS # QLPLPKTDRQMDIYDRKVRLQGKLIGLQGWGNVTVSESQKAEMKEVSEQIGRLETLENSDWALGRSNEVPIWGLGLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g44 ### # start gene g45 Scaffold_5 AUGUSTUS gene 190595 191095 0.24 + . g45 Scaffold_5 AUGUSTUS transcript 190595 191095 0.24 + . g45.t1 Scaffold_5 AUGUSTUS start_codon 190595 190597 . + 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_5 AUGUSTUS CDS 190595 190696 0.24 + 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_5 AUGUSTUS CDS 190790 191095 0.65 + 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_5 AUGUSTUS stop_codon 191093 191095 . + 0 transcript_id "g45.t1"; gene_id "g45"; # protein sequence = [MAREKQDWGLARLALDKCMQGIEGEAGEVPTDWRFSFVSDSDAIRLNSNSPEALCLRGLVLMLSGKLPQALQHVQSAL # RLDPSHLPAQQLRKRVKDIERLKDEGNIAFKAGKLQEAVAKYTDTLEVGNGSLRHHE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g45 ### # start gene g46 Scaffold_5 AUGUSTUS gene 199394 199789 0.93 - . g46 Scaffold_5 AUGUSTUS transcript 199394 199789 0.93 - . g46.t1 Scaffold_5 AUGUSTUS stop_codon 199394 199396 . - 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_5 AUGUSTUS CDS 199394 199789 0.93 - 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_5 AUGUSTUS start_codon 199787 199789 . - 0 transcript_id "g46.t1"; gene_id "g46"; # protein sequence = [MSATPKEFLDFVDNNADAFIKRLSEAVSIKSWVTPTISLEIILSRSDSVSGDAAYRSEVFKMSDWISQQFKAVGVEIQ # QVDLGKHIMDGQELQLPKAVLGRLGNNPNKKTILVYGHFDVQPVLINCSQNHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g46 ### # start gene g47 Scaffold_5 AUGUSTUS gene 200071 200544 0.52 + . g47 Scaffold_5 AUGUSTUS transcript 200071 200544 0.52 + . g47.t1 Scaffold_5 AUGUSTUS start_codon 200071 200073 . + 0 transcript_id "g47.t1"; gene_id "g47"; Scaffold_5 AUGUSTUS CDS 200071 200544 0.52 + 0 transcript_id "g47.t1"; gene_id "g47"; Scaffold_5 AUGUSTUS stop_codon 200542 200544 . + 0 transcript_id "g47.t1"; gene_id "g47"; # protein sequence = [MAQGVRIVFQYLLKCTNPKLNSNREAAAPMPTFIVSSSAMASPPPIAAFQPAFKILKRPVNSSEGSSSPPFSPPKDSL # EDREARYQVARNRIFGVTTSPTASSSDTNSIHLVAKKDVVVIRNPRGPDETPSTDTTPSKGFNDRRSKTPPSSASMENQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g47 ### # start gene g48 Scaffold_5 AUGUSTUS gene 201602 202369 0.66 - . g48 Scaffold_5 AUGUSTUS transcript 201602 202369 0.66 - . g48.t1 Scaffold_5 AUGUSTUS stop_codon 201602 201604 . - 0 transcript_id "g48.t1"; gene_id "g48"; Scaffold_5 AUGUSTUS CDS 201602 202369 0.66 - 0 transcript_id "g48.t1"; gene_id "g48"; Scaffold_5 AUGUSTUS start_codon 202367 202369 . - 0 transcript_id "g48.t1"; gene_id "g48"; # protein sequence = [MLAQLVADVRIVPQNPVAGSIMPAALPPAEPSTSPMHPDVPPNLSLSIKGHDGSSPVDKTTAEDLLKGFMSPSHISPS # RAISDSLTPRSPFLFDRPGTNIWSTSRDEKPLRHLASGPQMTLMPQTRQHNFSGSQDITSQQSIWTHPANQNSQRQLFGILPSSTIASHPTYPLTNPG # HQRALSTSLDAPLLPHTLPQNSSVAYSGSSGMLPSSYLLSEPPVLESAQNSTRHLSFHDPAIYSSQAMPSMSSIWGTNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g48 ### # start gene g49 Scaffold_5 AUGUSTUS gene 203556 204425 0.51 - . g49 Scaffold_5 AUGUSTUS transcript 203556 204425 0.51 - . g49.t1 Scaffold_5 AUGUSTUS stop_codon 203556 203558 . - 0 transcript_id "g49.t1"; gene_id "g49"; Scaffold_5 AUGUSTUS CDS 203556 204425 0.51 - 0 transcript_id "g49.t1"; gene_id "g49"; Scaffold_5 AUGUSTUS start_codon 204423 204425 . - 0 transcript_id "g49.t1"; gene_id "g49"; # protein sequence = [MLTSHIFISEYKQRLTRIDRAIQRSAQGQQSNTQSRHGPVEYRKLLQRFRQFLAEEDKFWTQFVIRYHRSFELIEAHD # TLVTLGILSEDAGAGDEITPNNGRNHFQFPTSTFSPPPTAADRDSRLTILSKALVCLGDIARYREQYNEAGGRSKVGSNDGARKSKRGNSNSDIPRPR # NFEKARTCYEQAKFLTPHDGNPSHQLAIIASYEKDSFTSLVHYYRSLCVTHPYETASENMISLLGKALEQRNTPGRDIPSELAHVPKVQIEEFKRKNC # CSTCIMVARRRKVCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g49 ### # start gene g50 Scaffold_5 AUGUSTUS gene 207493 208041 0.34 - . g50 Scaffold_5 AUGUSTUS transcript 207493 208041 0.34 - . g50.t1 Scaffold_5 AUGUSTUS stop_codon 207493 207495 . - 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_5 AUGUSTUS CDS 207493 208041 0.34 - 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_5 AUGUSTUS start_codon 208039 208041 . - 0 transcript_id "g50.t1"; gene_id "g50"; # protein sequence = [MRRRRARDKLGPRPLKPTNVNKQTQPLPRSKPSQTTKTMAYPSNAFFSGAGSEPYETNVKTLDEDEQKDGEEVVVPDF # KEDEHRFISPADAEKALRDLMGGAMNQDVDVEINPDDATVKGFKDEFKLLDHQVIGRKWMRDREDPKLKRMGGILADDNGVSTCCFHILPHLHCDVAL # GKRYRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g50 ### # start gene g51 Scaffold_5 AUGUSTUS gene 209740 210992 0.64 + . g51 Scaffold_5 AUGUSTUS transcript 209740 210992 0.64 + . g51.t1 Scaffold_5 AUGUSTUS start_codon 209740 209742 . + 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_5 AUGUSTUS CDS 209740 210273 0.64 + 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_5 AUGUSTUS CDS 210329 210493 0.98 + 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_5 AUGUSTUS CDS 210549 210992 0.98 + 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_5 AUGUSTUS stop_codon 210990 210992 . + 0 transcript_id "g51.t1"; gene_id "g51"; # protein sequence = [MRLPVKSSALLAIGFSLVAAASTSLSVDSQASVVVIPSTVRNGLTEAQFISSTHGLDGPKLSNINSTAFGEVWYFDAV # SEDGKYSVVAFFWASPSPSLTAQLQNEKILSAQVIVREDDDIYSANSVFAETAEIFTSAKGTSGLWIGTGCSFSGSQSLSTYSVNFSSPFEITGSIIL # ESVAPAHYKCSPAEAGVDTQILPNFGWVNAVPDAQTTVDLKINAKNIKFKGIGYHDLTWSNAPFFSKAKGSLFTEYQWAHGRIGPYSIVWLVITGSNG # TDLTSGYVSRDGKVLGTPCSNVSVIPQFNTSTRQIRRFFAQIDLGHEGTLYAQLDVGGILINDAGFVAGSGELSGGLSGETFRHAGVASFEYYKSVQL # PEMLSGPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g51 ### # start gene g52 Scaffold_5 AUGUSTUS gene 213327 215588 0.15 + . g52 Scaffold_5 AUGUSTUS transcript 213327 215588 0.15 + . g52.t1 Scaffold_5 AUGUSTUS start_codon 213327 213329 . + 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_5 AUGUSTUS CDS 213327 213394 0.85 + 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_5 AUGUSTUS CDS 214264 214490 0.96 + 1 transcript_id "g52.t1"; gene_id "g52"; Scaffold_5 AUGUSTUS CDS 214535 214854 0.51 + 2 transcript_id "g52.t1"; gene_id "g52"; Scaffold_5 AUGUSTUS CDS 214907 215167 0.28 + 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_5 AUGUSTUS CDS 215247 215356 0.52 + 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_5 AUGUSTUS CDS 215411 215588 0.52 + 1 transcript_id "g52.t1"; gene_id "g52"; Scaffold_5 AUGUSTUS stop_codon 215586 215588 . + 0 transcript_id "g52.t1"; gene_id "g52"; # protein sequence = [MGDKPIPVELQSDPDEGKAYGFSEVADEEGFDLSDQIEISKFLKAKANALIEKAQDEWQERNAEIVREGGEELKPMLP # LIRLKVDTTGVSEMSNPIRFVFHRTKKSARSAASKISADEPELSIDDPDLSVSEKLAKVRVATLVKEYLSAQELQLLGENGMSDAIQMFVEKDDIHAI # QSHVNRSLKMMLKAVQANEDLQEEDLEDKLTNIKEQQDKDYVAGKTKSNAKGKGKAKANDSDAQSEDSMMMDVDTRGGGSEFDEPDSEEEPPKKKAAV # KKPVPAKKAPAKKATKAPDSDSDEIIEIPDDDEEDEEVVVVTKPTKRTNRAAVLSQSQPKKAPAKKKATAAPKQSQLAFHPAATGRSSRAAASKARGR # MVVRISISLHYLKDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g52 ### # start gene g53 Scaffold_5 AUGUSTUS gene 223056 224278 0.54 - . g53 Scaffold_5 AUGUSTUS transcript 223056 224278 0.54 - . g53.t1 Scaffold_5 AUGUSTUS stop_codon 223056 223058 . - 0 transcript_id "g53.t1"; gene_id "g53"; Scaffold_5 AUGUSTUS CDS 223056 223681 0.54 - 2 transcript_id "g53.t1"; gene_id "g53"; Scaffold_5 AUGUSTUS CDS 223789 224278 0.55 - 0 transcript_id "g53.t1"; gene_id "g53"; Scaffold_5 AUGUSTUS start_codon 224276 224278 . - 0 transcript_id "g53.t1"; gene_id "g53"; # protein sequence = [MTAWTSPIGVPTAEEKETVSTLLAMIGGTEAQTAEVLEVYRRNGGNADKAAEVLLSGGLGASSSGWGDDTGSSSTSMA # LVPIIKAPRARPNTPEDIPDLVDLTKDDRMAVDDEDFEMKRAIEMSMESAREDLGGELGGDIATNDQEVVMENDQEEVEDLEELIPLLLQALFHVPQV # RNRLTTVSILEESSVSEDSDPVILSRIIELFGNLDLANLARLECDGVCKALDVLPVTASTGVTDSTKILYEKLTGIFEAAVASQPDPAPLLTFTSAQV # DIEPGQREEFKTSQVSNHTYVSLDLSASSGGALGEPFGNDLLTRLARDLSKPVPDIQGGPSGSTNTVITTPSEVVAFVLTSSNSSFSLRGVIRGTSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g53 ### # start gene g54 Scaffold_5 AUGUSTUS gene 227741 228748 0.77 - . g54 Scaffold_5 AUGUSTUS transcript 227741 228748 0.77 - . g54.t1 Scaffold_5 AUGUSTUS stop_codon 227741 227743 . - 0 transcript_id "g54.t1"; gene_id "g54"; Scaffold_5 AUGUSTUS CDS 227741 228748 0.77 - 0 transcript_id "g54.t1"; gene_id "g54"; Scaffold_5 AUGUSTUS start_codon 228746 228748 . - 0 transcript_id "g54.t1"; gene_id "g54"; # protein sequence = [MTTDHPPIDAPFGSWVTDRILSDMQPSRPIHWVGHGYVSVFEEKYVYKVFHDEDPSQPLLIRPKVEHELRMMLIAGSD # SVQLIGRLFDDTKQKLIGFIMPYEQALAPGVNIGGEPGERAKFSNEEKREIIDKLCRLIKRLQARQIIHGDVKPSNLLLCSDGQVRLCDWALGSVNGD # NFIAYAVSDHYASSRRCCLPQEPLSLEEDLYATGVSIWEIWMEKVPFEEVEEDIVDELVMGGIRPDVQAVDDPEIAALIESFLDAGPVSPNKPGQTRT # VCTQVDVTFNNCRTTPAHVETRIVKCYHCQDPDAQQCAKPFRLPNVQVDTSSPVCPKCNPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g54 ### # start gene g55 Scaffold_5 AUGUSTUS gene 229331 230674 0.68 - . g55 Scaffold_5 AUGUSTUS transcript 229331 230674 0.68 - . g55.t1 Scaffold_5 AUGUSTUS stop_codon 229331 229333 . - 0 transcript_id "g55.t1"; gene_id "g55"; Scaffold_5 AUGUSTUS CDS 229331 230674 0.68 - 0 transcript_id "g55.t1"; gene_id "g55"; Scaffold_5 AUGUSTUS start_codon 230672 230674 . - 0 transcript_id "g55.t1"; gene_id "g55"; # protein sequence = [MKETANWKSTFEVRVLFVIWMLSSDHISHLALAKYEYKKFFDRHALVASKLGPSRSTSTILPRKPNPTSTTPAGISAR # PSTASLPSSSAPMAQARSVSQPVPSSLSSAPLQPASRQQQQQQPQQSQQSGPMSASANGTGVWNDLVSLQAPSANSSLPLQYQPPNTANLGPTNPFGA # MTGIMNSSMPTGMSGISGMNGNGMGMNGMGYNLANSNTGMGMGPNGLSINPGPPMGLGVNSPFSAGVPSSTNPFQQTQLSATNPFAQQQQPMSANYPL # SASLPFSAVPTGLSTSFMTQQSQQSPLYQSQPSPMIPHVQMQMQSLQSPTPMFSPSPQNPNPIQQQQQNQFQFSGSMQQGGHSPQPQMSTTPQPPMSS # TPQLQGQQFMSPSPQLQMGVGAGPGMGTGMGVGYGMGMNGQSMQQTQMFTAGGPWAQQQSTMFATPGQAQRWGGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g55 ### # start gene g56 Scaffold_5 AUGUSTUS gene 237050 238696 0.55 + . g56 Scaffold_5 AUGUSTUS transcript 237050 238696 0.55 + . g56.t1 Scaffold_5 AUGUSTUS start_codon 237050 237052 . + 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_5 AUGUSTUS CDS 237050 237065 0.56 + 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_5 AUGUSTUS CDS 237213 238696 0.55 + 2 transcript_id "g56.t1"; gene_id "g56"; Scaffold_5 AUGUSTUS stop_codon 238694 238696 . + 0 transcript_id "g56.t1"; gene_id "g56"; # protein sequence = [MTVVLSSKSQLSLFSNRSALWLLSNPHVARRFKSSGKPSKRAKTLHNGNSIGVHRTQKHRPSTSAYKWSRNAVIERPE # LHLSLDDHIGIVRYFEENVEHWSKQKVLHSRLESFGIPTESIHPLLQLFVSEVLSGNLSNNDSYDKYTLDRFARSTPEDLPQTYADIVYTGIFYAWAA # DPASRDAVERTIGPATLLSIQRLFHAARLEHPADDFLEARRTRRKIIMHVGPTNSGKTHHALRALAAAPTGVYAGPLRLLAHEIWERLNLGQIVPAGV # EEDVMPASLPIDSALDVDVTAADTTPAVLSQGNSKFARACNMITGEEHKIVDPEAALESATVEMLSMTKKYDLAVIDEIQMIADVGRGYAWTSAVLGI # NAKEVHLCGEETAVPIVQALLAETHDELEVRRYKRLTPLQIDKSLDKDLSKVQKGDCVVAFSRSSIFWLKNSIEKATGMKCAVVYGKLPPEIRSGQAD # LFNDPNSGYDVIVGSDAIGMGLNLYVCCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g56 ### # start gene g57 Scaffold_5 AUGUSTUS gene 243173 243526 0.64 + . g57 Scaffold_5 AUGUSTUS transcript 243173 243526 0.64 + . g57.t1 Scaffold_5 AUGUSTUS start_codon 243173 243175 . + 0 transcript_id "g57.t1"; gene_id "g57"; Scaffold_5 AUGUSTUS CDS 243173 243526 0.64 + 0 transcript_id "g57.t1"; gene_id "g57"; Scaffold_5 AUGUSTUS stop_codon 243524 243526 . + 0 transcript_id "g57.t1"; gene_id "g57"; # protein sequence = [MSSSTPEVWRPEDTVPPVPETPGSEIFRPDILDEIEKKIEEMSKELNVLSLDIHGTHLSQPIYKNPNKTLLYLYQAHP # ELKYEEAYATHQIYFTHSQPIHTIIDQQTNSRRSNILYV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g57 ### # start gene g58 Scaffold_5 AUGUSTUS gene 245605 245841 0.77 + . g58 Scaffold_5 AUGUSTUS transcript 245605 245841 0.77 + . g58.t1 Scaffold_5 AUGUSTUS start_codon 245605 245607 . + 0 transcript_id "g58.t1"; gene_id "g58"; Scaffold_5 AUGUSTUS CDS 245605 245841 0.77 + 0 transcript_id "g58.t1"; gene_id "g58"; Scaffold_5 AUGUSTUS stop_codon 245839 245841 . + 0 transcript_id "g58.t1"; gene_id "g58"; # protein sequence = [MTKAEPKGFAYACIRWDVGSVVNDVVDPLVEASTDIVSNCTRAELDSITFQTECSELKEEKSIDPPTPVEAIAKLVLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g58 ### # start gene g59 Scaffold_5 AUGUSTUS gene 257080 257646 0.94 - . g59 Scaffold_5 AUGUSTUS transcript 257080 257646 0.94 - . g59.t1 Scaffold_5 AUGUSTUS stop_codon 257080 257082 . - 0 transcript_id "g59.t1"; gene_id "g59"; Scaffold_5 AUGUSTUS CDS 257080 257646 0.94 - 0 transcript_id "g59.t1"; gene_id "g59"; Scaffold_5 AUGUSTUS start_codon 257644 257646 . - 0 transcript_id "g59.t1"; gene_id "g59"; # protein sequence = [MQLPPTVLSLDRRRKQQTKGASASSSKSQTKTSNGKSKVKPNLAKNATPIRPSPSESRKDEENAGNGSGDDVKGEMAI # EDSKSPSTPDSGTEEESAGSGSDDNAKSETVVANTKTRSKMPILRPSRSLETTLFDRLESMYGSGIKRMLNVQYRCVDGLAFPTSITYTYLSGCTIKS # VHFHPGPSTRIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g59 ### # start gene g60 Scaffold_5 AUGUSTUS gene 262160 263097 0.18 - . g60 Scaffold_5 AUGUSTUS transcript 262160 263097 0.18 - . g60.t1 Scaffold_5 AUGUSTUS stop_codon 262160 262162 . - 0 transcript_id "g60.t1"; gene_id "g60"; Scaffold_5 AUGUSTUS CDS 262160 262712 0.76 - 1 transcript_id "g60.t1"; gene_id "g60"; Scaffold_5 AUGUSTUS CDS 262832 263097 0.18 - 0 transcript_id "g60.t1"; gene_id "g60"; Scaffold_5 AUGUSTUS start_codon 263095 263097 . - 0 transcript_id "g60.t1"; gene_id "g60"; # protein sequence = [MSEYWISKKKYFCKYCEIYIADDAPSRQHHENGLRHQGNRERFIRGIYKDGEKKGREREEEKREMGRVELAAQAAYSQ # DISAGLAKASGKCSCRGGLAAEPGYSGEWQVVESKTTPLKRTADEQQPLDYDDDARSFKLRKKTLRSGLGEVYDPGVISLKPKPKPQQNVEEVVKKEE # EEEDKPKWSTVKWKRATEASSLAEPANNDNDPTQKIEIKSEPSESSTTTKTEEKRDEVITPPPSTLAPTPSMFPQTQSNLRERQSGEDGKRENSPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g60 ### # start gene g61 Scaffold_5 AUGUSTUS gene 269398 270552 0.33 - . g61 Scaffold_5 AUGUSTUS transcript 269398 270552 0.33 - . g61.t1 Scaffold_5 AUGUSTUS stop_codon 269398 269400 . - 0 transcript_id "g61.t1"; gene_id "g61"; Scaffold_5 AUGUSTUS CDS 269398 270552 0.33 - 0 transcript_id "g61.t1"; gene_id "g61"; Scaffold_5 AUGUSTUS start_codon 270550 270552 . - 0 transcript_id "g61.t1"; gene_id "g61"; # protein sequence = [MVLSSPDEGADAYQAPIYLRKKSCPHCRATVRDPPVEVWAVKNMVNSLVGTGLLVGIPPIPMSDGQPVASSSNGRQPG # SGTEPSKEGLWKNIFYPHRDTLLSLASREDAGIRDDEDGGVYRCVDCMHEITGGFCTNCHRVYRAHRGIDFGDDSEGNEDVEPFFRLAFDDRLEGADY # EEDDEEDDDYYEDVFFDLAYHLPLPRRTLGRRARVERNRALDVEILGSDSEEDEVDRMDGFIDDDSDIQELEDVQEIPRDRNVEEVDLDYDGVGAINS # SHGPSEVIEVTDEEDDDDSLGPARPVRRRVNRAQTTINLLSDDEDEGEEESIHLSDDDSEEIDDDSKYSDIDDNEVNYQDGIHSGDDDDPDLESAYFV # DLDDEQGDIYRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g61 ### # start gene g62 Scaffold_5 AUGUSTUS gene 271773 272432 0.62 - . g62 Scaffold_5 AUGUSTUS transcript 271773 272432 0.62 - . g62.t1 Scaffold_5 AUGUSTUS stop_codon 271773 271775 . - 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_5 AUGUSTUS CDS 271773 272019 0.93 - 1 transcript_id "g62.t1"; gene_id "g62"; Scaffold_5 AUGUSTUS CDS 272062 272432 0.62 - 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_5 AUGUSTUS start_codon 272430 272432 . - 0 transcript_id "g62.t1"; gene_id "g62"; # protein sequence = [MSHVRKANTNSDRNESDNSPATAGLAKEKRREYYCEYWCGRPNDLMELGIRLDHIPKKDDRKRTGTVTSCKDTLLTTM # LIAYRTLNARRTVVSFFFNLGGTKTWKRANTAPPKLPKSAWMAVRVVKPRLKKKYSVSQNGRESVKDVLDGDGNECDVGEGRRELGLDFMAREGQESN # RKAQHEKHVMNDRQGLASALWTRDALHLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g62 ### # start gene g63 Scaffold_5 AUGUSTUS gene 281167 282020 0.69 + . g63 Scaffold_5 AUGUSTUS transcript 281167 282020 0.69 + . g63.t1 Scaffold_5 AUGUSTUS start_codon 281167 281169 . + 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_5 AUGUSTUS CDS 281167 281226 0.69 + 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_5 AUGUSTUS CDS 281346 282020 1 + 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_5 AUGUSTUS stop_codon 282018 282020 . + 0 transcript_id "g63.t1"; gene_id "g63"; # protein sequence = [MALPGSIPTLQAHNTGNYTRIPTVDERERWNWAKVDWEEFTGRLEEELRKLEPPKEIETEEIFWSALGNFDTAIQQVI # KEVVPKAKPSPHQRRWWNSTLTVMKKKTGTLSSKSHKKRFNPEHPIHEEFRRMRQAYDVEIKKAKMEKWVEYLEYADTSSVWEVGRLMENGYSDGGRA # RVPGLKVNQPGNTERVIEDNVGKDTSSEMLSSLLLPKPPTSQRTQNTQTSPGISHHPPTDRSQPQSGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g63 ### # start gene g64 Scaffold_5 AUGUSTUS gene 290832 291746 0.95 - . g64 Scaffold_5 AUGUSTUS transcript 290832 291746 0.95 - . g64.t1 Scaffold_5 AUGUSTUS stop_codon 290832 290834 . - 0 transcript_id "g64.t1"; gene_id "g64"; Scaffold_5 AUGUSTUS CDS 290832 291746 0.95 - 0 transcript_id "g64.t1"; gene_id "g64"; Scaffold_5 AUGUSTUS start_codon 291744 291746 . - 0 transcript_id "g64.t1"; gene_id "g64"; # protein sequence = [METTPATSSTQQTFNSSGPGIRDNQYSRKHRTRKKPDETNTRDNPNKPDHNADDQNRGVRKPQKPPIQRRDGDTKKPI # STSRRDNKKLGKAVVEGERKIAETLKTPTAPNFEHSRSNRDDKKGETREGETVELPDTPSRLPTQSSSRRFGKTKFNAGLTSDVSNNGSDHPPPRRRK # NNIHIIPNVADAGDLTSNLIRELSTRPYPDCLICFSPIHPQQPTWSCSPLIPMLEAEAAHQSQYCWTTFHLKCIREWAGKNYKEVKAAWEAREEFGKG # GEWRCPGCQGRRNQLINGYVYVVPCLASMI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g64 ### # start gene g65 Scaffold_5 AUGUSTUS gene 292109 293717 0.8 - . g65 Scaffold_5 AUGUSTUS transcript 292109 293717 0.8 - . g65.t1 Scaffold_5 AUGUSTUS stop_codon 292109 292111 . - 0 transcript_id "g65.t1"; gene_id "g65"; Scaffold_5 AUGUSTUS CDS 292109 292841 0.81 - 1 transcript_id "g65.t1"; gene_id "g65"; Scaffold_5 AUGUSTUS CDS 292999 293717 0.98 - 0 transcript_id "g65.t1"; gene_id "g65"; Scaffold_5 AUGUSTUS start_codon 293715 293717 . - 0 transcript_id "g65.t1"; gene_id "g65"; # protein sequence = [MSTRKKSQRKRIPAALHSELTEYSSLLRSLRTNDNLDVTSQLTRYFNHKGKEKAQIYDDDDSECINDGDVDFKDVGSD # VEEELVSDVEAGSSCRTNKSSTKRKQASWPQSLATEDIMSTKTNPSTHETWTRWPLLAQDVPYPEWTLQDEVAHITAFLLRDTSSSPSDVDSDPNSSN # SSLISTLTLSSSRYLDSILASLAAIIPKRSVSMINRLAPAGWQSVLAAAQLQAASQASGGFSTNKRAANTETTSSNVPATSTLPLSSSAVASSNTQTS # NSSTLPSNSHLLSSHRIQTLHASSSKLSTAFTSYGASPSDLYTLDFGYPGIGFSLPEGWAKDWFANREQEKINAAKEQKKGKRRRKKEGNKNQVSEET # LNNPRRSNRNRKVKQVGTEGDEAQSNGVSLHEQQFLNGDGDGEVLDEEGWEREGRTLSKRGKRKRSEEDEEGNDGRDGLIPSKKKRKPVRGKSQTPSR # KKFKSAESVVDCD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g65 ### # start gene g66 Scaffold_5 AUGUSTUS gene 293903 295540 0.44 + . g66 Scaffold_5 AUGUSTUS transcript 293903 295540 0.44 + . g66.t1 Scaffold_5 AUGUSTUS start_codon 293903 293905 . + 0 transcript_id "g66.t1"; gene_id "g66"; Scaffold_5 AUGUSTUS CDS 293903 294509 0.73 + 0 transcript_id "g66.t1"; gene_id "g66"; Scaffold_5 AUGUSTUS CDS 294561 295540 0.44 + 2 transcript_id "g66.t1"; gene_id "g66"; Scaffold_5 AUGUSTUS stop_codon 295538 295540 . + 0 transcript_id "g66.t1"; gene_id "g66"; # protein sequence = [MSSRPGGQKLVIRFPVASKVEASPSPAPSAEASALSEPEAEPIDVDGNDGDGDNASVDIDEDQEPATYVPTKRGRGRP # RGSLTRGGMGRAGSGTPIPRARGRGRGRGRGRGRGRGASSITIKLPKKDDGEEDDDNEGDGAGDETDEMNIDAEEDNSKKAPVGGGKPFRKIQGQVYI # IEGDEFVTDDDPKGDEKIDKFGNLLGGRRFKAATFLLPNRHPERQYMLAIDAARTSGFRDSLYYFRRNPLTFKLNATQPEKEYLISEGKLGPHLKTRS # VTLVTARSAFKLHGSKMLLDGRWVTDDYYEDKALAAIAELGVKPGDLVGDLVDPNAEAESRAEKASRTLGNDRDYSASGGGGGSMYRPGGPTTIFAGH # GFGPFYEPLNPVRKALLNRDGVSEENWMWMMASRVREADDRWRKCRSGAISGAGVKPGAGIGPEANANVANSTWDVSPNVVPVDISTTTNHSRSLKGK # ERADPNSSMEIKETAVSVKKKRKVTFDPETGGEMLPLGVYEPHTGAVFCASNWTTLLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g66 ### # start gene g67 Scaffold_5 AUGUSTUS gene 298712 300259 0.86 + . g67 Scaffold_5 AUGUSTUS transcript 298712 300259 0.86 + . g67.t1 Scaffold_5 AUGUSTUS start_codon 298712 298714 . + 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_5 AUGUSTUS CDS 298712 300259 0.86 + 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_5 AUGUSTUS stop_codon 300257 300259 . + 0 transcript_id "g67.t1"; gene_id "g67"; # protein sequence = [MDLKKSDMGVSDLFETYYFTYYDEPYLDSDDEDDLFKFTSMPDRPLQALRLIRDHLPEEVIHWEGTIASGLLFHLRLL # DLRIEQGGYACRLSPRFTVIGRPPEPGIYTGLEAELKRIEKEDVGAQRARRRPLDSFHFSTLVLRMVEAAAAYQALSGKANSPQDINLDSIPNTAQDF # LGVTPTQICKDILPEYRVVHIESIIRKDLSRRFLDFQDRLRSKLMFRPLNELRKFVPPDQRYVRTDHPEDYVEYIVKPKVTFHGTRPDLVPSIVQYGF # LKPGSTHPRTGTSLPVRCGSTYGRGIYSSPNSAFSLAYSGTQCQATKPGGIPGLKLLVCATIMGRHAQMTRGDNWRDQSKPYPGSDSHIANNGQEYIV # FDNAQILPCYVVHLDWESSSEANDFVSEQLGRSGKRPRIDNNDVSSPGDRQRLKENRLAQARKFFAYGFGPVSGSSIVIEDIADIEDDEEDYGEYQAD # RLDDVKKVDIWTYKLAGETDKDEYRSQRKAHYRRSRTVKDEKFLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g67 ### # start gene g68 Scaffold_5 AUGUSTUS gene 300423 300785 0.92 - . g68 Scaffold_5 AUGUSTUS transcript 300423 300785 0.92 - . g68.t1 Scaffold_5 AUGUSTUS stop_codon 300423 300425 . - 0 transcript_id "g68.t1"; gene_id "g68"; Scaffold_5 AUGUSTUS CDS 300423 300785 0.92 - 0 transcript_id "g68.t1"; gene_id "g68"; Scaffold_5 AUGUSTUS start_codon 300783 300785 . - 0 transcript_id "g68.t1"; gene_id "g68"; # protein sequence = [MLDYQKYYSYDVLYPGHGPVVKEGAKLIDTYIQHRLEREAQILEVLQKAPPSPDVNESSGSARWSTWTIVSKIYQGYP # ESLWTPASHSINLHMKKLEADGIVKKLGGEGVNTKWALNSKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g68 ### # start gene g69 Scaffold_5 AUGUSTUS gene 301778 302346 0.71 + . g69 Scaffold_5 AUGUSTUS transcript 301778 302346 0.71 + . g69.t1 Scaffold_5 AUGUSTUS start_codon 301778 301780 . + 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_5 AUGUSTUS CDS 301778 301831 0.73 + 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_5 AUGUSTUS CDS 301897 302346 0.73 + 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_5 AUGUSTUS stop_codon 302344 302346 . + 0 transcript_id "g69.t1"; gene_id "g69"; # protein sequence = [MADVDMDNGDSLKRRGMPTKYPASSRRRSTSPRISKVDFAKVNDADPARRAERERQLAARVAAMELEKSNNTKEKAPD # QEYDAKAEFAKLLSTRSGGVYMPPARLRALQEAAAGDKLVKNSNDFLGRSTEIYYRYRKQVNINNIKLIVPELFSENLIRDVVCFPGAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g69 ### # start gene g70 Scaffold_5 AUGUSTUS gene 309169 309933 1 + . g70 Scaffold_5 AUGUSTUS transcript 309169 309933 1 + . g70.t1 Scaffold_5 AUGUSTUS start_codon 309169 309171 . + 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_5 AUGUSTUS CDS 309169 309933 1 + 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_5 AUGUSTUS stop_codon 309931 309933 . + 0 transcript_id "g70.t1"; gene_id "g70"; # protein sequence = [MPQITLSGGTGPTGNALIREALRRGHTIVVFARSPDKLDSELRDSARISVIQGSFCFFLLHVPNKTEYESQRLFNLGT # LDSYPAIQRSLHNSAAVFVLLTPSDGLPGWAGGSSSPLTMTTGYRNIIRAMSELSVKRLIGIGTPSHVEPQDGFNFGLKLTVPMLRLLAPKVFEDVVE # TGELLKGLGDDEKIDWTWFRVSLLYDGPAPSDKKYQLGFTGQGGRFLLPSLFREELAKALLDEMEDGKWVRGMPFCWT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g70 ### # start gene g71 Scaffold_5 AUGUSTUS gene 311653 312657 0.61 + . g71 Scaffold_5 AUGUSTUS transcript 311653 312657 0.61 + . g71.t1 Scaffold_5 AUGUSTUS start_codon 311653 311655 . + 0 transcript_id "g71.t1"; gene_id "g71"; Scaffold_5 AUGUSTUS CDS 311653 312657 0.61 + 0 transcript_id "g71.t1"; gene_id "g71"; Scaffold_5 AUGUSTUS stop_codon 312655 312657 . + 0 transcript_id "g71.t1"; gene_id "g71"; # protein sequence = [MFEPNMDEYLDEETEVVKPTFEAICKGWDQQASERHNNLGDVSARFLTSHNPSQVKRNVLASFTSVLLLPVTIVPRTV # GAVGGALVSGGTAVGGAAAQGIAMLNPQRWGGAGGGGWGISNVPEGYQKHRGQGNETMFEIGSDEDDEDEQEEKEKAEVFDEKHGGLSLAPPPSAAPL # SAGTLHTASTSLDQMDQMDTLLSLDVALELIHTSRESLKRLETFAAYPDRIGDRVRDTIEEVFILMLQALGDGHVKRGFSRCVPLHIYIFLISYFQRA # TARMTSYKPAEHEETTSVAPLLQFFELVHIGDTIQSMVQVYFDKEMVPHLVCRVLAFILI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g71 ### # start gene g72 Scaffold_5 AUGUSTUS gene 325735 326040 0.6 + . g72 Scaffold_5 AUGUSTUS transcript 325735 326040 0.6 + . g72.t1 Scaffold_5 AUGUSTUS start_codon 325735 325737 . + 0 transcript_id "g72.t1"; gene_id "g72"; Scaffold_5 AUGUSTUS CDS 325735 326040 0.6 + 0 transcript_id "g72.t1"; gene_id "g72"; Scaffold_5 AUGUSTUS stop_codon 326038 326040 . + 0 transcript_id "g72.t1"; gene_id "g72"; # protein sequence = [MTSPGSPSIYYSASKSPQFEYPVQNADLSNEYCSENFTLDPLPAKYPDDDDDSDDLGTDSDGSSSIAFHEVVSYAVTG # FLVGTVITLCLLSSQRRTMLYVT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g72 ### # start gene g73 Scaffold_5 AUGUSTUS gene 329678 330226 1 - . g73 Scaffold_5 AUGUSTUS transcript 329678 330226 1 - . g73.t1 Scaffold_5 AUGUSTUS stop_codon 329678 329680 . - 0 transcript_id "g73.t1"; gene_id "g73"; Scaffold_5 AUGUSTUS CDS 329678 330226 1 - 0 transcript_id "g73.t1"; gene_id "g73"; Scaffold_5 AUGUSTUS start_codon 330224 330226 . - 0 transcript_id "g73.t1"; gene_id "g73"; # protein sequence = [MNSNTSLPWTNSDIFALSAGQFNAASGSNTGMELGVGETGTRGRESDSSIADLYYRFLNYLASKEGAQNSAGPAISTP # LTTSTMSIFPNSTSSSWTGSSVGPFPIPSGEDHNMFFESLMGSGPPFGTGTLNDQENNIGSYSHRLDPSSPLWNLNLDMDNASTSDPAWTAFMRDLAK # SASEGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g73 ### # start gene g74 Scaffold_5 AUGUSTUS gene 330312 331335 0.3 - . g74 Scaffold_5 AUGUSTUS transcript 330312 331335 0.3 - . g74.t1 Scaffold_5 AUGUSTUS stop_codon 330312 330314 . - 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_5 AUGUSTUS CDS 330312 330749 0.61 - 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_5 AUGUSTUS CDS 330815 331127 0.43 - 1 transcript_id "g74.t1"; gene_id "g74"; Scaffold_5 AUGUSTUS CDS 331229 331335 0.38 - 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_5 AUGUSTUS start_codon 331333 331335 . - 0 transcript_id "g74.t1"; gene_id "g74"; # protein sequence = [MTVGTVVKRSPNSSIAKSALNDLGQALNLFEKCASSLKENADRAYTQYLTRAKGSVSASISKTTAANDTSSSTSTSSQ # VVGDAQGELDPSSFSKTPIGTDDNELAIWGGKTSLLNGLGKKKKVKTKDTQNTSSLNGSSPDWREETNVNTNSFPPPPASFHSDNSWNDAIDAQMDFD # ANIDLSLMLAMNSTTAFPSQMPSQSSSTTMDVNMTDSLLSDFGDVDFGFKLGVGFGAGTTGSRGLLMDMTLEDIGPVGHDQPASSYHHPKHFTSQAAA # SENQLVLMRVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g74 ### # start gene g75 Scaffold_5 AUGUSTUS gene 333334 333600 0.65 - . g75 Scaffold_5 AUGUSTUS transcript 333334 333600 0.65 - . g75.t1 Scaffold_5 AUGUSTUS stop_codon 333334 333336 . - 0 transcript_id "g75.t1"; gene_id "g75"; Scaffold_5 AUGUSTUS CDS 333334 333600 0.65 - 0 transcript_id "g75.t1"; gene_id "g75"; Scaffold_5 AUGUSTUS start_codon 333598 333600 . - 0 transcript_id "g75.t1"; gene_id "g75"; # protein sequence = [MSSRIRALEDALAIFQASVSSERHPLLEDELLKIKFGSEVKDSEDDPVILDSPGKKSTTAGVTTSLNRSVDTTTLDAF # GTLTLGRKGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g75 ### # start gene g76 Scaffold_5 AUGUSTUS gene 346442 346924 0.85 + . g76 Scaffold_5 AUGUSTUS transcript 346442 346924 0.85 + . g76.t1 Scaffold_5 AUGUSTUS start_codon 346442 346444 . + 0 transcript_id "g76.t1"; gene_id "g76"; Scaffold_5 AUGUSTUS CDS 346442 346757 0.85 + 0 transcript_id "g76.t1"; gene_id "g76"; Scaffold_5 AUGUSTUS CDS 346833 346924 0.86 + 2 transcript_id "g76.t1"; gene_id "g76"; Scaffold_5 AUGUSTUS stop_codon 346922 346924 . + 0 transcript_id "g76.t1"; gene_id "g76"; # protein sequence = [MDVDFLVSGATHAVQAVEYDGRFFLNPGTATGAWTGAWNSSKPGFAVSSNEGVKAAGPHGDPIPSFALLDIQGTVVVT # YVYQFIDGDVKVERRKPDGYGVDERVGAKTPITPGVGSVMPQSIPSPTPMSPQNAGW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g76 ### # start gene g77 Scaffold_5 AUGUSTUS gene 353274 353726 0.7 + . g77 Scaffold_5 AUGUSTUS transcript 353274 353726 0.7 + . g77.t1 Scaffold_5 AUGUSTUS start_codon 353274 353276 . + 0 transcript_id "g77.t1"; gene_id "g77"; Scaffold_5 AUGUSTUS CDS 353274 353726 0.7 + 0 transcript_id "g77.t1"; gene_id "g77"; Scaffold_5 AUGUSTUS stop_codon 353724 353726 . + 0 transcript_id "g77.t1"; gene_id "g77"; # protein sequence = [MFQPKTPSRHRTRSDVGKTPKTPLTPSVLSGLGNISLGGSPTKKRTGKTHAKASSSSGPFDTTNPFIQPSISRSRPNS # RPSSRPASPVKFTTGAIPISEDLKGQAGGGLIRKGGVELSRLDVVSRDYIPPKPELKRSRSTPAAVSKHPLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g77 ### # start gene g78 Scaffold_5 AUGUSTUS gene 353837 354649 0.78 + . g78 Scaffold_5 AUGUSTUS transcript 353837 354649 0.78 + . g78.t1 Scaffold_5 AUGUSTUS start_codon 353837 353839 . + 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_5 AUGUSTUS CDS 353837 354649 0.78 + 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_5 AUGUSTUS stop_codon 354647 354649 . + 0 transcript_id "g78.t1"; gene_id "g78"; # protein sequence = [MHLNPKSASPGHTARLVAATGVPLNRRILGYHEPPPAASSDTSLAQQREFAKPLYARPGTLPTSTGSSTNKSRRIPTQ # PERVLDAPGMVDDFYLNLISWSCQNTVAVALEASTYIWHADTGSVNQIGEAPEGSYVSSVDFSNDGMFLGIGIGQGDVELWDVETGQKLRTMSGHQAQ # IATLSWNQHILTSGCGDGSIWHHDVRIPRHKVMELLGHSGEICGLKWRSDGELLASGGNDNVVNIWDGRLGDVGEGARGSAKWTKRNHTAAVKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g78 ### # start gene g79 Scaffold_5 AUGUSTUS gene 359203 360273 0.93 - . g79 Scaffold_5 AUGUSTUS transcript 359203 360273 0.93 - . g79.t1 Scaffold_5 AUGUSTUS stop_codon 359203 359205 . - 0 transcript_id "g79.t1"; gene_id "g79"; Scaffold_5 AUGUSTUS CDS 359203 360273 0.93 - 0 transcript_id "g79.t1"; gene_id "g79"; Scaffold_5 AUGUSTUS start_codon 360271 360273 . - 0 transcript_id "g79.t1"; gene_id "g79"; # protein sequence = [MGLREWLFCSRYTHLFSYIFTSKGLTFYTDLSQLASTLESTVKEFVERRTREREALVRQLEVEKRLSSGGAVSVSQRG # SGPPPLPPPPPSSAPDNSNDLSASLAGMKISKPPPPTPSLYASSYASQQTPNQTQWRNTPTPPVSQSPHQQHQTQSYIPPSSSQPPPQPPYSPYSQPY # SSYVSSPAIAASPQQQPQRQQYGNFPPPPSLPSPPLLDPYASLDMLNSISPPALPPSSQPQRQQTYGNEFPPPPPGPQAPQQQGYSGQGSYGRYSSPP # PPPPPSHQGYGGYQSPPSHPAPPPQQQQGYGGYGSPHQPPPTQQQQSYQGYQGFPPPPPQSQQQNYPGYQDPRGYSSYGSGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g79 ### # start gene g80 Scaffold_5 AUGUSTUS gene 360658 362675 0.67 - . g80 Scaffold_5 AUGUSTUS transcript 360658 362675 0.67 - . g80.t1 Scaffold_5 AUGUSTUS stop_codon 360658 360660 . - 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_5 AUGUSTUS CDS 360658 361926 1 - 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_5 AUGUSTUS CDS 361977 362675 0.67 - 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_5 AUGUSTUS start_codon 362673 362675 . - 0 transcript_id "g80.t1"; gene_id "g80"; # protein sequence = [MANQSPMISIPLKSTEEVDWTTPIRHLISQSYGESPDNYSSECASLQRCRQDAVRGAGSDSTARDLLYKYFGQLELLE # LRFAEIRVTFPWKDAFTAKLTTQTSIAFEKASILFQIASVHSSLAASQSRSDPEGIKRAFYYFRTCAGMLTYINDNFLHAPSTDLSREVIKFLVALIL # AQATEVFLEKCTEEKKGSGLVSKVAAQTAGMYTALTEQVKEFMGKGIFDRNWVMLIQIKAKYLSSLAQYHRSLADRALSKHGDALARLTLAETLAKES # QYLASSFNPSVSPTLPADAASTLSDRLKAHLSLCTNAKSTAQHENDLIYNAVLPNPDSLPQIETTSVASVAAPISIQEVYGAPEVQKVIGQDIFLKLI # PLSVHESASVYSEEKAKLVRGEVERVELAESQVRSAIETMGVKEGVAKFKAILKEAVGDIDDDVDAIPPNARKWTDEIISLESRDPLTSLLSQLTQRK # SNVQSTLSHISSNLSQESHTTETLRVQYGVKFTQEPSASLTRDMRRELKELQDHSGQAEGSDRQVEMLWDGVRADVGVLLGWGGEGELEELFRRAMDV # VNDQGTHVAQSLLDIDEGVNNDEEANERAVIAELVSEIDERFGRLSKISRERGEVLKDLKEKVGSRVEYYPIRSLQTDLSFLPDTNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g80 ### # start gene g81 Scaffold_5 AUGUSTUS gene 364502 365920 0.31 - . g81 Scaffold_5 AUGUSTUS transcript 364502 365920 0.31 - . g81.t1 Scaffold_5 AUGUSTUS stop_codon 364502 364504 . - 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_5 AUGUSTUS CDS 364502 365920 0.31 - 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_5 AUGUSTUS start_codon 365918 365920 . - 0 transcript_id "g81.t1"; gene_id "g81"; # protein sequence = [MSCCSVNNPSYPDLKSPSEDLNNLVRRHISSVVSSTPSKALSTLESDTAELLSSGMVTLNAKLSGIEDDKLISRVVEL # WGFFWDQVLTYVEGVLLPLQIDPLLSSLYRGPKRPSSPSRQTSGNKQSKPSLSISSSLGMSSYHIDVRTVALCSFRDKIILPLSPRLYARLSATSNMS # LNKNSHQEPLQETPPRMQQMLLVLSAQSRPRPQTLSLGIAGGSSNASNLSTGEAAIADLLRVVRSASRLHYQSTFNRPSGGRPIPGSSVSSRQYHPGI # NNRMGISSGVGIGENSVRAPNFLSEGGPGDRRGRVADKKLTIRGRLNITPALGGDEYLNGGDLDTPRNNTGMDIGMFGFTEIERQRERDFFLDSLKSP # DLPPGTPTGSSTTATVTAPRASIGGWGLGAGNEPGEGGDEDEPLDWDQAQAVVERMVGMTSSHQETNGQPALSANSNNSHFPSAGNSVSPAPPVARRR # MT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g81 ### # start gene g82 Scaffold_5 AUGUSTUS gene 379856 383648 0.31 + . g82 Scaffold_5 AUGUSTUS transcript 379856 383648 0.31 + . g82.t1 Scaffold_5 AUGUSTUS start_codon 379856 379858 . + 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_5 AUGUSTUS CDS 379856 381953 0.31 + 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_5 AUGUSTUS CDS 382006 383648 0.76 + 2 transcript_id "g82.t1"; gene_id "g82"; Scaffold_5 AUGUSTUS stop_codon 383646 383648 . + 0 transcript_id "g82.t1"; gene_id "g82"; # protein sequence = [MIQMSLMLFNEAIVYARAPPSFQSRYFQFRPNLATSPSPSQSPIPGSSALSLTLSFEQERLLQVSQLSRSPSPSIRNS # PVPSTMTTKDGVVVTRLHTTITPALFSNELEYLYTGQGFGEAFEFLFDSTGDASLGGGEAEAQEIRLDKLRKDLVFMWRSRLYSDVKISLMVNPTDNF # STSSSGNKEHENTTAVFSTHRFILVSRSAYFRSLLLPNPLKSLTLASSLSSTPSPQTLTLPSPPFTPASLHFTLGYLYTGTLAFSHRTYDLTTALHIY # LSSLPAHLHLPRLLDEIRGRIVMELCHGLFHAFLEFPEYEALIKGRWGGNTGGCRCRQCARRAPRVLEFAVRPEVNDPYLDRGARRALVGLLGDGWVT # SEWAGLPARLRESVLKGVKKRMIPPTDEKSKGVNVNVWSMLFAVESALGVGGKLAKAVKAAEKMMNTDDVDEIRRNSNPNWHETVRMDLLHAREAIDE # CLADRVTECFTPPPSVTTGMEEEEDFPPSEWHDILLRASPFYQPPSWPDRQGHRKLASIVSSLAPSTLTPTLTPSNASEVSVPVPLSFANHKSMGPSP # STAYEDANRVSAILASLLRGLKPSNAPLVYQTLLSNILLLPASHDPNISQSSSNQYQSIYDTDDMFGGNNALLLPPTSHVRIQVEEARIEVLRWIRDK # GRWREVREAGGFIGIDGKQGASMEGWALQEIADYIQVPLDDLLLPPANHTSTPSRDRLKPRSDTDSVSIHSTNSLTPSMRVSILSRNLPQKSSGLKSS # ASSVRSVSTVGSTNTIGRRRVATAGKATSSIGGDRPDSKLTPHSTPMSAYLSILRDEDGTLNEAEEQDGDDEDVSMKSSTPPRSRVVSPSPSVSSSLV # KKLGNLKSTPSSPVGTGRRLASNTSLASSRSSVRSTRTVSSTTSSVSPRAAAAAKQAASQPRPRSAASTRSTFSTRSTVSTASKSSKVSTSTVRRQTK # SGGLQVPPVPMPRPISASTSGTSTASGTSGTSGTSDFHTAPTSGSVAGTPRQRQRTVSATSTGSVRSARSTRSTATNATAGTTTGRTTGKVPSTRRPP # SVTSIATSVKSNKGTSPADKARAQAKATLVAAGSGAGTASSKGKTLSKKGSSDTIKGERASGSKSKYSSNKKTASIPPLPRSSVSGSIPPTVPDPGPS # SPPDDETSPYPTHLGATLSIGIPCIVSSKRKRFRAFARYIGEVEGELGPWVGVEVPVNDDRGRDKDVVMGNTEDSRQWNDGTWRVYGISI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g82 ### # start gene g83 Scaffold_5 AUGUSTUS gene 389321 389791 0.93 + . g83 Scaffold_5 AUGUSTUS transcript 389321 389791 0.93 + . g83.t1 Scaffold_5 AUGUSTUS start_codon 389321 389323 . + 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_5 AUGUSTUS CDS 389321 389791 0.93 + 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_5 AUGUSTUS stop_codon 389789 389791 . + 0 transcript_id "g83.t1"; gene_id "g83"; # protein sequence = [MSHSNSNSFTIRCELANHTVWKALSSRAIPRTSSVVILPTLKGLSEQLSVPEILPSGVSSGSRADLKTADQQAMVERD # LIDALCKMKGLKHFTWRHDAGPVLHEELWSTLKDLGVSSLRFIDRKACDFVGDSGYYRSIFESPTARTIIPNPLPLLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g83 ### # start gene g84 Scaffold_5 AUGUSTUS gene 389972 390643 0.62 + . g84 Scaffold_5 AUGUSTUS transcript 389972 390643 0.62 + . g84.t1 Scaffold_5 AUGUSTUS start_codon 389972 389974 . + 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_5 AUGUSTUS CDS 389972 390643 0.62 + 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_5 AUGUSTUS stop_codon 390641 390643 . + 0 transcript_id "g84.t1"; gene_id "g84"; # protein sequence = [MSHNLLQAFNLSFRDPDALVDVTSILSQVTFTRLREITFRRASCTPQSLSKFLSGHPSIVSLSLSPMMAGRRWEQLSV # SADSLPNLMHLNCSPFHAGKILDGSESSPRPLFCLTGIDVRQTIKLSDYFDVDKQDAYADDEEIAEIDTYEAEQLITAPWKDELFSKLKSSKQITHVA # LNETDGPKDLEVLAELMPQIRWIDVGTKRKDAAASKVRSYKNLTTKC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g84 ### # start gene g85 Scaffold_5 AUGUSTUS gene 393579 394052 0.81 + . g85 Scaffold_5 AUGUSTUS transcript 393579 394052 0.81 + . g85.t1 Scaffold_5 AUGUSTUS start_codon 393579 393581 . + 0 transcript_id "g85.t1"; gene_id "g85"; Scaffold_5 AUGUSTUS CDS 393579 394052 0.81 + 0 transcript_id "g85.t1"; gene_id "g85"; Scaffold_5 AUGUSTUS stop_codon 394050 394052 . + 0 transcript_id "g85.t1"; gene_id "g85"; # protein sequence = [MYRSSADAVPVSEWINLLAAASALKFNRAREHAIAAISDVSQRPNAIDMIVMAEKYGITKWLRPAYISFCKRTEPLQL # NEAERIGLDKVVKLIQAREEFLREGLGVNGLRAVSPLPSPYPWPPSNRVQGLTQRTPTPTQTVDEAARIVDRIFFSDIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g85 ### # start gene g86 Scaffold_5 AUGUSTUS gene 394130 394924 0.97 - . g86 Scaffold_5 AUGUSTUS transcript 394130 394924 0.97 - . g86.t1 Scaffold_5 AUGUSTUS stop_codon 394130 394132 . - 0 transcript_id "g86.t1"; gene_id "g86"; Scaffold_5 AUGUSTUS CDS 394130 394924 0.97 - 0 transcript_id "g86.t1"; gene_id "g86"; Scaffold_5 AUGUSTUS start_codon 394922 394924 . - 0 transcript_id "g86.t1"; gene_id "g86"; # protein sequence = [MKFVSSHSDDPLVRWARKHSNEPFSAGKRWVVEHFQFGSCMFDPSGLKDRYTNLVSSRSLFWVNYWTMTAPRSSNDAS # HSAGTESDRQQLLDNNDEALIGAGIANPSENPLGSFQSFIEPSPSSGNSILPDIVPEAPVVLGPKTKSENKAYVKAAEKELRMQQKERKKEMKEIQKN # QKVAQKERDTHAKAATKDKAKGERHFVVLPTGLGAILGGGDHWEQVVIGGVDDEVAAHCGLFIPEQNIGYAKLVERVGLRIIEWCHKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g86 ### # start gene g87 Scaffold_5 AUGUSTUS gene 400878 402844 0.35 - . g87 Scaffold_5 AUGUSTUS transcript 400878 402844 0.35 - . g87.t1 Scaffold_5 AUGUSTUS stop_codon 400878 400880 . - 0 transcript_id "g87.t1"; gene_id "g87"; Scaffold_5 AUGUSTUS CDS 400878 402502 0.98 - 2 transcript_id "g87.t1"; gene_id "g87"; Scaffold_5 AUGUSTUS CDS 402641 402675 0.95 - 1 transcript_id "g87.t1"; gene_id "g87"; Scaffold_5 AUGUSTUS CDS 402729 402844 0.36 - 0 transcript_id "g87.t1"; gene_id "g87"; Scaffold_5 AUGUSTUS start_codon 402842 402844 . - 0 transcript_id "g87.t1"; gene_id "g87"; # protein sequence = [MIIIWAQSSTPQAATYGSDLTPEELLNEKEFWKVRVMVRCTTMQVYDLAWTDHTHFVQGVSWDPLNEFIATQSSDRAM # HVHRVIHNNQAGGLEVHAVGKNSHMNMHTGSHVRQGRSHSRRKHGRTQSNVSNTSHAESGRESSRPRISRRESATSDAESVFEESILFSTSSSAIAEG # NKDSKEFKDPTPLSLNLPLTPSTSVASTPVRASSVALSSATPALPPISTSTFSSNMFPPPATPIEKEKQTSSRRSSFSGASTAGGGPASPAFSVTSRF # GRSPSPMPALPAIRTALPNYSHRSSSPWRSTEQWKNIGLYGDESFTNFFRRLSFSPDGALLVTPAGQFEDPEVVILPTPSSEEGSTPARGRTKRSEEP # SGPGISADKSNSSSCVYIYTRANFARPPIATLPGHKKASVAVRFSPILVDLRDGLSGRDETTGNESAPKTGVIGNELNEMNVDVVGALPSSSFSDRGM # GITVLSNNQKERASSTQIVSPTPQPALGDASVRPPTPAASKPSTPIPYGLQTPILTATNLSSSTGSIFALPYRMLFAVVTMDAVVIYDTQQSTPVCML # SKLHYDEFTDASWCVFTRLLEYP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g87 ### # start gene g88 Scaffold_5 AUGUSTUS gene 406389 406841 0.75 - . g88 Scaffold_5 AUGUSTUS transcript 406389 406841 0.75 - . g88.t1 Scaffold_5 AUGUSTUS stop_codon 406389 406391 . - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_5 AUGUSTUS CDS 406389 406841 0.75 - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_5 AUGUSTUS start_codon 406839 406841 . - 0 transcript_id "g88.t1"; gene_id "g88"; # protein sequence = [MRDPTGNEWSALLDPPLEGPGGNNGLNHDITISYQGNATIRNGNIVVSINLGIISFFRVEPNGSTTLLTKEYTDTKAI # APRFYTQDFRSSSFQSQFDFASDPNEQFYGAGQQACCLDHSVNKKGQVVDLINFNSHVTLPVYMSNKVGLIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g88 ### # start gene g89 Scaffold_5 AUGUSTUS gene 407835 409574 0.29 + . g89 Scaffold_5 AUGUSTUS transcript 407835 409574 0.29 + . g89.t1 Scaffold_5 AUGUSTUS start_codon 407835 407837 . + 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_5 AUGUSTUS CDS 407835 408132 0.4 + 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_5 AUGUSTUS CDS 408246 408749 0.78 + 2 transcript_id "g89.t1"; gene_id "g89"; Scaffold_5 AUGUSTUS CDS 408863 408959 0.75 + 2 transcript_id "g89.t1"; gene_id "g89"; Scaffold_5 AUGUSTUS CDS 409016 409574 0.77 + 1 transcript_id "g89.t1"; gene_id "g89"; Scaffold_5 AUGUSTUS stop_codon 409572 409574 . + 0 transcript_id "g89.t1"; gene_id "g89"; # protein sequence = [MSLFGTSATPASGTSLFGAVNSNPGATTNPPAGGSIFGGFGAQSTNNNANPQQSTPSLFGSSTNTNSVAQQPSGNPLF # GGSNTNTGTGSSIFGNNAAGNNAPAATGGNSLFGPGTAQPAGSSGSSFFATPPGGQQQQNPNQPKPGLFGNTNTNTNPLFGGASTTNTNTSGSIFGSG # STSNPLFGGSSTGQQSGTGTGSLFGSANAAPVNATSGSMLGGNSTLGVSTLGASALGKPLGGLVSSTVGSHNQSADAQVQFARLQEKIERNFEPSQVN # LYGRPPNAVNEALWQKAVRENPDPSCLVPVLAIGFDDLRGRVDAQVSQSAAHKEKLLELQQKLRTLSTNHSTLTVPRLQRYSALQTQLTHRLLRLVQH # LHLLIPSVRSSAINENEEALRGVLEEVVAEVGVGASNAGLRSNGEGFGKGRLKSKLGELWAVVGALKAREQSLNATFGGSSEWRVVDEEGLARIAQVN # ILLTLIVDSVVDPPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g89 ### # start gene g90 Scaffold_5 AUGUSTUS gene 427087 427566 0.35 + . g90 Scaffold_5 AUGUSTUS transcript 427087 427566 0.35 + . g90.t1 Scaffold_5 AUGUSTUS start_codon 427087 427089 . + 0 transcript_id "g90.t1"; gene_id "g90"; Scaffold_5 AUGUSTUS CDS 427087 427566 0.35 + 0 transcript_id "g90.t1"; gene_id "g90"; Scaffold_5 AUGUSTUS stop_codon 427564 427566 . + 0 transcript_id "g90.t1"; gene_id "g90"; # protein sequence = [MGLPMAGKLGVATNANDILARFWKTGRYEKADSSPLDDSPSMQPAAGSSDGKQATQDNSGVKETLSPAMDILVSSNFE # RLLWYLAYVNVPEDESDRRGKAGEIVAGWMNQMKSDGKVEVPASVLETARQDFCAERVSDEQVGFYIFGVNVCLMTVILRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g90 ### # start gene g91 Scaffold_5 AUGUSTUS gene 430800 431399 0.99 + . g91 Scaffold_5 AUGUSTUS transcript 430800 431399 0.99 + . g91.t1 Scaffold_5 AUGUSTUS start_codon 430800 430802 . + 0 transcript_id "g91.t1"; gene_id "g91"; Scaffold_5 AUGUSTUS CDS 430800 431399 0.99 + 0 transcript_id "g91.t1"; gene_id "g91"; Scaffold_5 AUGUSTUS stop_codon 431397 431399 . + 0 transcript_id "g91.t1"; gene_id "g91"; # protein sequence = [MPNLSTFISYGKAAAKPKGFNALRHFDSPNSPHHPYASPDIVHITPTQSLQSNEDEEDAAQLPFQSPSSSQLAPARPS # TPPRKLDVELPSGSMSDWIPSHLLDERMYNGRLSHQSPGAGSSKLPPEEHTITQEGLTSKEDEELLDDDDESVYDDDDYSSSSSNDSNIVANLEAMNV # SICRSSFMLLLKITSKGFKLCQD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g91 ### # start gene g92 Scaffold_5 AUGUSTUS gene 431531 432451 0.99 + . g92 Scaffold_5 AUGUSTUS transcript 431531 432451 0.99 + . g92.t1 Scaffold_5 AUGUSTUS start_codon 431531 431533 . + 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_5 AUGUSTUS CDS 431531 432451 0.99 + 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_5 AUGUSTUS stop_codon 432449 432451 . + 0 transcript_id "g92.t1"; gene_id "g92"; # protein sequence = [MHGPKVQIIRSSGGSKGTWHSPSRPESIHSGDEYSASAVSGTTLARALIGNTFVLSTDERDERAARYRSWGSVLTRTD # SATLPRDENPFLSPPMSHGTPDTNHSLVPLPPNADSVYIPPKNPRRLSDARRKRQSISNSIPRSDSEGEILARSNSIGAPLPSDAQQSHISETDTAVV # NNKPSLLNDESIAPSAPDTAQSPYLSPNYARPVSHASSDGGSSNRPTSSTSSGKGYDTMLDDYYSNADLTSPASPDPVVSGGHIPMTLDNPHFRPPFS # PITEESSSQLSPPSPYRRDSKRSTGSTGSPNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g92 ### # start gene g93 Scaffold_5 AUGUSTUS gene 432895 434372 0.5 + . g93 Scaffold_5 AUGUSTUS transcript 432895 434372 0.5 + . g93.t1 Scaffold_5 AUGUSTUS start_codon 432895 432897 . + 0 transcript_id "g93.t1"; gene_id "g93"; Scaffold_5 AUGUSTUS CDS 432895 433847 0.51 + 0 transcript_id "g93.t1"; gene_id "g93"; Scaffold_5 AUGUSTUS CDS 433973 434372 0.93 + 1 transcript_id "g93.t1"; gene_id "g93"; Scaffold_5 AUGUSTUS stop_codon 434370 434372 . + 0 transcript_id "g93.t1"; gene_id "g93"; # protein sequence = [MASPGIPGPSERRSEDQILIAVPPTPMTGAGEPMPALAHHMLARAASSVRGARHTRQLSNNRARTVATHTHASNPADI # QSSSPSVALDPEPEVKEDEGSKRKAAYPSWITQKVPNSDDEPSPSLKSDTVSPTGSHHSQAASSILREDSAGEVTVRKDELVNNSSQLSLTVRGLPPL # PPSPSLYSPLPGQPPGLHQVASTTSLVVPAQSDIASPPEDSTLSQSTVSGSAAPPSPHPFPSFPASQHTNYTPGSAGSSAETETDMENTASIPSLGSP # PPYYTLVFDQGPGHGNSTPTSGGSNLVTPNTPPSSRADSSRQSINASKLLRTTSSAPHSPRFQSPAPKWRGYTMDAAKWTFTSAQLQAIVSRAIRQSA # EASAIRLLRLETVDQDIPTELHRLELQRTDIKTRYKRLTRRRTEMLATLTSYCDGTFHEDATSSLRVINELRDVTRHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g93 ### # start gene g94 Scaffold_5 AUGUSTUS gene 435640 437616 0.46 - . g94 Scaffold_5 AUGUSTUS transcript 435640 437616 0.46 - . g94.t1 Scaffold_5 AUGUSTUS stop_codon 435640 435642 . - 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_5 AUGUSTUS CDS 435640 436217 0.88 - 2 transcript_id "g94.t1"; gene_id "g94"; Scaffold_5 AUGUSTUS CDS 437089 437389 0.99 - 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_5 AUGUSTUS CDS 437443 437616 0.53 - 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_5 AUGUSTUS start_codon 437614 437616 . - 0 transcript_id "g94.t1"; gene_id "g94"; # protein sequence = [MWKSRRLLSIAGVSTSTEDVQDREQLINQRDSHVDKLIEYAVGTQVQGNGIVEGVKRVAFKNLLDLYVLFLSAPPNDA # ENTLPSLTMTMNDEVQWRCAGYIQAEVERYADAVNHSHNEDSNTEDDQTDDSQSEGDAEGQSKKNKKATKKTDSRENDSEASVRKARSGKKKKDVGLS # TDGEETEVEKLVDEEHPLSDNEVPLEQPPRPRPRPRRATKKRAPEPAGSDSDPEPTSTHLHPKAVHNPSAAASDSPNVGSPVTIGKRPRADTDEETQD # NETTPRPSHKRSRREGQIEESELQERDEEVEEQSPIPNGNVFDTLGVADLLPVQSSLSGETGHDTLVPKRKKRIRH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g94 ### # start gene g95 Scaffold_5 AUGUSTUS gene 438374 439726 0.71 - . g95 Scaffold_5 AUGUSTUS transcript 438374 439726 0.71 - . g95.t1 Scaffold_5 AUGUSTUS stop_codon 438374 438376 . - 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_5 AUGUSTUS CDS 438374 439726 0.71 - 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_5 AUGUSTUS start_codon 439724 439726 . - 0 transcript_id "g95.t1"; gene_id "g95"; # protein sequence = [MSIATATTSLMVIYFSVFIHRYRDLDPLIRTECISSLSTFFETLPSHFCTGSDYLRYVGWVLSDPAASVRLAAVKALQ # VVYEGAGAGSGSKKKKGGGEAVVIPALRHFTTRFLPRLLEIARFDVDIGVRVAVMNVLGSVDELGRCSLRRSQVYLLKLPLALLPEDDRNRLGTLVFS # DENRVRKGVGRFVSGVWEEWVEEKLGEVEAQPSRPHASNGRGRGRGRGGAVGNKGRNASTSDVDRDKIGIKGLARLLVRWGRALDHEHRKKSASQEEQ # EEDEEDGSSEEQNPDVGDIGIGLGASDTRGIAPALVTHPGKTSDVTTRGRLGLAVEALWDDMDVVRDWAGILDMLILDHSASGPNDASDKIRSTRKAG # KMSSMKKRGKQMNGNAEQQDGSGDDDDDDDDSTSTSTRVDQSWRLSEAEEGALLEVLVASLRRTRKDVSDGSLQTCCC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g95 ### # start gene g96 Scaffold_5 AUGUSTUS gene 440212 441086 0.71 - . g96 Scaffold_5 AUGUSTUS transcript 440212 441086 0.71 - . g96.t1 Scaffold_5 AUGUSTUS stop_codon 440212 440214 . - 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_5 AUGUSTUS CDS 440212 440870 0.94 - 2 transcript_id "g96.t1"; gene_id "g96"; Scaffold_5 AUGUSTUS CDS 441023 441086 0.72 - 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_5 AUGUSTUS start_codon 441084 441086 . - 0 transcript_id "g96.t1"; gene_id "g96"; # protein sequence = [MSQQRAVRTFIKHSFESSRRTLTEPSTTSRKRKHADTDNEELVGASDHPPGQDDDSDANEVNMEGSDSSMDEDERPRK # SLKRKKGALAKRPRTAASSTRKPKAPRVPKDSAATNSRKRANVAPNAPFDPASITKVTNISSDNPLFNAILNPNAALQGTVEDYLESLHQDENQALAE # LVNMILRCCACNDTIDGDTAVDYDGVVDRLDDMAEELKKVGHVVEERLQSFTFYRLLPPLEHIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g96 ### # start gene g97 Scaffold_5 AUGUSTUS gene 443577 443822 0.34 - . g97 Scaffold_5 AUGUSTUS transcript 443577 443822 0.34 - . g97.t1 Scaffold_5 AUGUSTUS stop_codon 443577 443579 . - 0 transcript_id "g97.t1"; gene_id "g97"; Scaffold_5 AUGUSTUS CDS 443577 443822 0.34 - 0 transcript_id "g97.t1"; gene_id "g97"; Scaffold_5 AUGUSTUS start_codon 443820 443822 . - 0 transcript_id "g97.t1"; gene_id "g97"; # protein sequence = [MSTKKLVLIIGATGIQGRPCVSAMLARQDDGTPSPYSVRVLTRDPTSEQAKGLASLGAELFQGSCFHATLMDISAQSE # YFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g97 ### # start gene g98 Scaffold_5 AUGUSTUS gene 445781 446164 0.56 + . g98 Scaffold_5 AUGUSTUS transcript 445781 446164 0.56 + . g98.t1 Scaffold_5 AUGUSTUS start_codon 445781 445783 . + 0 transcript_id "g98.t1"; gene_id "g98"; Scaffold_5 AUGUSTUS CDS 445781 446164 0.56 + 0 transcript_id "g98.t1"; gene_id "g98"; Scaffold_5 AUGUSTUS stop_codon 446162 446164 . + 0 transcript_id "g98.t1"; gene_id "g98"; # protein sequence = [MWPWFTTTAAVEATREILLRMGVPLPPESNNDGDGDEEDEDENDSKAETGGCNAENDSRSGFEALRMGSAPAFWTCRG # AKEGWTGIKAEEQEQEQEMSTPWKKDKDVEFVDGWDWAGAEGRWMYALS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g98 ### # start gene g99 Scaffold_5 AUGUSTUS gene 448051 449163 0.8 + . g99 Scaffold_5 AUGUSTUS transcript 448051 449163 0.8 + . g99.t1 Scaffold_5 AUGUSTUS start_codon 448051 448053 . + 0 transcript_id "g99.t1"; gene_id "g99"; Scaffold_5 AUGUSTUS CDS 448051 449163 0.8 + 0 transcript_id "g99.t1"; gene_id "g99"; Scaffold_5 AUGUSTUS stop_codon 449161 449163 . + 0 transcript_id "g99.t1"; gene_id "g99"; # protein sequence = [MRQEVLKWMKDLNWVEQYKKNATGRADSTLRNVCARGLKDALREIDQIWRLEQRAIPGQQLLRLSIDDDADSGEESAV # EDLRLDIGGENLPILKPKSKKVDACVLDGATFLLHPFDHLPKGVTAPTKCPRPNWSPVHQIQTPSASPDFPLKSSSWANARSSSSKSKIVSAKSNVSS # KDFYQALNSTADQFPTDPKPCDYMNYLLSSNEPISVIRATIHEKATRMSLQIATLGAADEEAIPDDELLTNEEWDMLQRTEEEQEQLQEYWDNVPGLM # DRMKKNAERAKKRKYEHLSKEEEDDRYTANEGGDDAEVKKFKLLSNNDLGVSDWGADSFEGDFFEQSLGLGLRLDMKSITKFFSNDVDSDEDCKST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g99 ### # start gene g100 Scaffold_5 AUGUSTUS gene 456205 457380 0.36 + . g100 Scaffold_5 AUGUSTUS transcript 456205 457380 0.36 + . g100.t1 Scaffold_5 AUGUSTUS start_codon 456205 456207 . + 0 transcript_id "g100.t1"; gene_id "g100"; Scaffold_5 AUGUSTUS CDS 456205 457380 0.36 + 0 transcript_id "g100.t1"; gene_id "g100"; Scaffold_5 AUGUSTUS stop_codon 457378 457380 . + 0 transcript_id "g100.t1"; gene_id "g100"; # protein sequence = [MMPECSRRSTDLDSIASSIAFSWLRTKVLHQPSVSLLRMDRDDLNLRAENLHALALAGVSRPKDQLLFVTDVTNYHPF # PSHKFALVDHNRLSSAFTPEGQPLVVAIVDHHADENLYVDSAEPRIITPSGSCASHIVTLLSSLTVEIPPELATLLLSAILIDTDGLKPGGKAIDVDR # KAADFLLPRSTFTSSVNMLETTDAAPSGPVFNPEFIQSLSDELSTKKNDVSHLGPRDLLRRDYKEYEFVLPWHAAEPQIRAGLSTVPVKLEDWAVDGK # LETEGEAWMKERGLHILGVLTAYRGATKGKRKREMAWIIRTDTPPTDGFDFDALTERLWSGLEADSVLELKEHKNFAHGTQGPISVPELRVRCYIQNP # HATRKVTAPVLKAIMEAET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g100 ### # start gene g101 Scaffold_5 AUGUSTUS gene 460118 461221 0.98 + . g101 Scaffold_5 AUGUSTUS transcript 460118 461221 0.98 + . g101.t1 Scaffold_5 AUGUSTUS start_codon 460118 460120 . + 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_5 AUGUSTUS CDS 460118 461221 0.98 + 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_5 AUGUSTUS stop_codon 461219 461221 . + 0 transcript_id "g101.t1"; gene_id "g101"; # protein sequence = [MIPEYVHPSLHKTISTLLNELTLISDDPPMDKVIAFPQYPLPPNNTSPLPGVDPVPSILTYWKYRASRSIRTVPATTQ # GRTRLMATLNVTPDSFSDGSTHNTLPTALAYVHEAVRVSVDILDIGGYSTRPGAAFVSVEEEIDRVVPFIQAMRSVDPATTEDDGEENRMVRDMPISI # DTFRWEVAENAILAGANCINDVYAFTGPQNYPYPASGAAKEQTTEYMRQMKDVARKFAVPVVLMHSRGDAGMNKDYSVYDYSDDGRVLEGVRVELGVK # VDEIVKGRGCIRRWNVIIDPGIGFSKTVEGNLELLRQGAAVTADILIGSGEIYQLHTLSKTILYVLQGPMRRKGIHSRVFPNLSELQRSLFLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g101 ### # start gene g102 Scaffold_5 AUGUSTUS gene 470618 474210 0.3 + . g102 Scaffold_5 AUGUSTUS transcript 470618 474210 0.3 + . g102.t1 Scaffold_5 AUGUSTUS start_codon 470618 470620 . + 0 transcript_id "g102.t1"; gene_id "g102"; Scaffold_5 AUGUSTUS CDS 470618 470679 0.43 + 0 transcript_id "g102.t1"; gene_id "g102"; Scaffold_5 AUGUSTUS CDS 470728 470844 0.6 + 1 transcript_id "g102.t1"; gene_id "g102"; Scaffold_5 AUGUSTUS CDS 472680 474210 0.84 + 1 transcript_id "g102.t1"; gene_id "g102"; Scaffold_5 AUGUSTUS stop_codon 474208 474210 . + 0 transcript_id "g102.t1"; gene_id "g102"; # protein sequence = [MIGGNSILDDVTTGFAGSRGRKTTGKTTGKNTGKASPDFKAILSQKRGSSRLGMNYSINLDLHSLNNRLIQVEATLAQ # LTSGQFTPSYPFSAPSSSNGPPPPSSSLNTILSPPTIQHSSLAIPLEEIGGTWLNEIDLGFNLPAGFTAPPKEGTFSNVKVEPHSLDIHNSLSGEFGD # FDMTDRPSTSSSSSSSVNQITIASPNLASLSISSSNGHVQLPPTSEYYPSSPSFPSTSNKPQLTPALIALLPSLNTYTSNRQSSQQTTLLSYLDLAEE # SSAYTYPFLNWKTLRERALELLMNARPNASSPAANARDKEMAREKEREKERDKKEREAKQARQLFMGSAASRTRPIFGTSASSIGDVTMEDMHLQSSR # SPYLGASEDQSDRPSTSRIVEGVPFFAVLCVAIALGAHEAERRTPKAPGGDDNKKGGGRPRSKSNSSPESVYWYSLSVQAIGIWEAAVAVTPVSNETS # STQVESQDGDQKRQTTEDQQHEMDYISACLLQLAFLSKEGLNVSGTVVDNSKTSEKTKDNLRKRSPGLAKDSSKMQSSKGVAAFMFPLVSRMIVKSNL # H] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g102 ### # start gene g103 Scaffold_5 AUGUSTUS gene 476273 477024 0.34 + . g103 Scaffold_5 AUGUSTUS transcript 476273 477024 0.34 + . g103.t1 Scaffold_5 AUGUSTUS start_codon 476273 476275 . + 0 transcript_id "g103.t1"; gene_id "g103"; Scaffold_5 AUGUSTUS CDS 476273 476327 0.34 + 0 transcript_id "g103.t1"; gene_id "g103"; Scaffold_5 AUGUSTUS CDS 476438 477024 0.54 + 2 transcript_id "g103.t1"; gene_id "g103"; Scaffold_5 AUGUSTUS stop_codon 477022 477024 . + 0 transcript_id "g103.t1"; gene_id "g103"; # protein sequence = [MSVSSASPQDATTPEMHIAAVEAFNTTGNNSFDTRPDTYPSSASSPYGTAGATNGAMSVSDSSYTNTNGIPVFSPQGH # QPSTSFSQKGSVPNPRQSQGYYTATGMYEGYSNPTSENQAGILHEDMIQSVIPGAMDTMMFDQVSYDVKPSMEELNEQHRQHTYQAYNSDTRPQSQLH # HAVPSSQVWPQQGHAPDSAAPYWGDPNIPTDNQVFYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g103 ### # start gene g104 Scaffold_5 AUGUSTUS gene 482916 484373 0.28 + . g104 Scaffold_5 AUGUSTUS transcript 482916 484373 0.28 + . g104.t1 Scaffold_5 AUGUSTUS start_codon 482916 482918 . + 0 transcript_id "g104.t1"; gene_id "g104"; Scaffold_5 AUGUSTUS CDS 482916 484373 0.28 + 0 transcript_id "g104.t1"; gene_id "g104"; Scaffold_5 AUGUSTUS stop_codon 484371 484373 . + 0 transcript_id "g104.t1"; gene_id "g104"; # protein sequence = [MDTQQQAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREM # LAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRINTQADALSRMAAHQVLDNEDNRQQTVLKPNHFTK # IAASILRNPLEDRIRKASQREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFW # WPTLRSFVEKYVEGCETCARKKIQRHPRAVTQPLDVPLGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHALPCTSSITAEGVADIYYKEIFRLH # GLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLP # LFNIPVGQRRDSSCR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g104 ### # start gene g105 Scaffold_5 AUGUSTUS gene 489362 490517 0.56 + . g105 Scaffold_5 AUGUSTUS transcript 489362 490517 0.56 + . g105.t1 Scaffold_5 AUGUSTUS start_codon 489362 489364 . + 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_5 AUGUSTUS CDS 489362 489471 0.59 + 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_5 AUGUSTUS CDS 489638 489663 0.61 + 1 transcript_id "g105.t1"; gene_id "g105"; Scaffold_5 AUGUSTUS CDS 490039 490517 0.96 + 2 transcript_id "g105.t1"; gene_id "g105"; Scaffold_5 AUGUSTUS stop_codon 490515 490517 . + 0 transcript_id "g105.t1"; gene_id "g105"; # protein sequence = [MAVYTRWGIIKTIDFSSFPSRRAQTPVWLPIFMIGSCNHNDSCVLCSSKSIGASISRALAAQGASVVINYAKDSSAEE # VAQQINLSLNSTSVSLPLTSIDHQGDGRNDVEVPRQQQQAIAVKADSSTISGGHYLLQETLRIFGRLDILVLNAGLMGSRTLSEIDESFFNAHFDFNV # KAPLFLVKEAAEVMVRRELFHSSSCMFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g105 ### # start gene g106 Scaffold_5 AUGUSTUS gene 494865 496575 0.28 + . g106 Scaffold_5 AUGUSTUS transcript 494865 496575 0.28 + . g106.t1 Scaffold_5 AUGUSTUS start_codon 494865 494867 . + 0 transcript_id "g106.t1"; gene_id "g106"; Scaffold_5 AUGUSTUS CDS 494865 495865 0.28 + 0 transcript_id "g106.t1"; gene_id "g106"; Scaffold_5 AUGUSTUS CDS 496233 496575 0.72 + 1 transcript_id "g106.t1"; gene_id "g106"; Scaffold_5 AUGUSTUS stop_codon 496573 496575 . + 0 transcript_id "g106.t1"; gene_id "g106"; # protein sequence = [MTERTILPRQMSVPQSASNNAESESTMIVTVAPEPNQGHVPSRSPTTAKRGRKPASNASGLSRSAREAQRKLNHSIIE # KARRTKINEALAELARLGATVEVLHSGGSLKDAEASVSRLAERPTPDLVEDHDVDADVDDDDDKDGDYGVPSSSRTRNGGSTSKIKSSNSSQDHISAS # KGKEKFKLDILVKTVENMQHLLERVRSLEAQVENVRISPFGVSEDFECRKCAERTLADLPPLTSTTNKRKRHTSAESDAASNEKHLEDFSRDPDDRIQ # PRDQRRRKVMHTNPSIEHTDEHTSNTNPILPTLPSISSWLSDYNLSAYSIHFPEILSLLSATATIASTAATGRIDTIHTVRTPEDESAASLLLHMKSS # PPVFMTPRARRDSILEIDPLPLTMSSSPEMPKSAVNVSDIREDVFALVSHTDSNGQSVMIAQTPSSILGLGPRSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g106 ### # start gene g107 Scaffold_5 AUGUSTUS gene 498051 498422 1 - . g107 Scaffold_5 AUGUSTUS transcript 498051 498422 1 - . g107.t1 Scaffold_5 AUGUSTUS stop_codon 498051 498053 . - 0 transcript_id "g107.t1"; gene_id "g107"; Scaffold_5 AUGUSTUS CDS 498051 498422 1 - 0 transcript_id "g107.t1"; gene_id "g107"; Scaffold_5 AUGUSTUS start_codon 498420 498422 . - 0 transcript_id "g107.t1"; gene_id "g107"; # protein sequence = [MGFIEDAAGVNTLAAKETDTGGVYFVTAFSGLLAPYWDPGAGGLLIGVSQYTNPAHIARATLEANAFQTRAIIESMKL # DSGNDLQLLKVDGGMTNGDLAMSILADIGGFTVVRPEMRECVYSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g107 ### # start gene g108 Scaffold_5 AUGUSTUS gene 501391 501868 0.31 + . g108 Scaffold_5 AUGUSTUS transcript 501391 501868 0.31 + . g108.t1 Scaffold_5 AUGUSTUS start_codon 501391 501393 . + 0 transcript_id "g108.t1"; gene_id "g108"; Scaffold_5 AUGUSTUS CDS 501391 501397 0.38 + 0 transcript_id "g108.t1"; gene_id "g108"; Scaffold_5 AUGUSTUS CDS 501483 501868 0.78 + 2 transcript_id "g108.t1"; gene_id "g108"; Scaffold_5 AUGUSTUS stop_codon 501866 501868 . + 0 transcript_id "g108.t1"; gene_id "g108"; # protein sequence = [MMIRRGTAPFEDVAPDAVEPRRGSPTEAETEPLDVADDDREVENLEEDAIVAVADELPAVDDDVVIVPTVTVDRTPVS # LYALDPVSEDGIGIEDVAEATDEEKEPVILLRLITVISRWEVLLTMYIMIRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g108 ### # start gene g109 Scaffold_5 AUGUSTUS gene 504673 505341 0.36 + . g109 Scaffold_5 AUGUSTUS transcript 504673 505341 0.36 + . g109.t1 Scaffold_5 AUGUSTUS start_codon 504673 504675 . + 0 transcript_id "g109.t1"; gene_id "g109"; Scaffold_5 AUGUSTUS CDS 504673 505341 0.36 + 0 transcript_id "g109.t1"; gene_id "g109"; Scaffold_5 AUGUSTUS stop_codon 505339 505341 . + 0 transcript_id "g109.t1"; gene_id "g109"; # protein sequence = [MLDGLAPYLPLPPASERPLRVQIFTECVSIMTQTDLLILTASHRRPESMIAPYLTALHARMKKQKADIQVGSYPVLGK # GVFVSLIGRDRNMGLPGQGVLLNSEQRPQPGAQPSEVQEPPARVWLAQIACEVEKEINGRIVSDEEVKILKEGGVGEVRRRMEDGDIVPDTKVNSSST # STSFASPRVSSPASIACDSASVVEPDVDVDVTVEVKKPKLGEAGWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g109 ### # start gene g110 Scaffold_5 AUGUSTUS gene 505744 506196 0.9 - . g110 Scaffold_5 AUGUSTUS transcript 505744 506196 0.9 - . g110.t1 Scaffold_5 AUGUSTUS stop_codon 505744 505746 . - 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_5 AUGUSTUS CDS 505744 506196 0.9 - 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_5 AUGUSTUS start_codon 506194 506196 . - 0 transcript_id "g110.t1"; gene_id "g110"; # protein sequence = [MAFSALFSMASMTGTFNSSVSAEIAGQSTAPIGGSTTGSIAATTSAASSSAKVAAASTTSSSKSTTASAAASSNGAVG # SVVANVWIQCCCSGVDAVKCMAVGICCVATRKLVLQFNSYDILFLISDSPYWLPVLSRVSVSPDLAVAWTFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g110 ### # start gene g111 Scaffold_5 AUGUSTUS gene 511165 511875 0.82 - . g111 Scaffold_5 AUGUSTUS transcript 511165 511875 0.82 - . g111.t1 Scaffold_5 AUGUSTUS stop_codon 511165 511167 . - 0 transcript_id "g111.t1"; gene_id "g111"; Scaffold_5 AUGUSTUS CDS 511165 511875 0.82 - 0 transcript_id "g111.t1"; gene_id "g111"; Scaffold_5 AUGUSTUS start_codon 511873 511875 . - 0 transcript_id "g111.t1"; gene_id "g111"; # protein sequence = [MISSVVTHGSRSKVAPAALFELKSACELFEQAARHGGRAVKFLVSIAVVPISISLILQLKPIVQRLLGKAQKVYYDTC # NGIPPAISNDIFRPSNTGSDEISVFSGKTHTVATKAPRTPSARSPGSNGSARSSQSPNGSPSQSHLTTNPSFAEVHPTLVQELNGFEGHISAQLQNAY # NNPNFNELLMGPYASQEISGQHHMKRNIWHDNNTSSKDVNSNSRNRKNRNDRSGSIWSNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g111 ### # start gene g112 Scaffold_5 AUGUSTUS gene 513079 514169 0.93 - . g112 Scaffold_5 AUGUSTUS transcript 513079 514169 0.93 - . g112.t1 Scaffold_5 AUGUSTUS stop_codon 513079 513081 . - 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_5 AUGUSTUS CDS 513079 513732 1 - 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_5 AUGUSTUS CDS 513912 514169 0.93 - 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_5 AUGUSTUS start_codon 514167 514169 . - 0 transcript_id "g112.t1"; gene_id "g112"; # protein sequence = [MSDRIRSLEDALIILHSTTGVQEPHPLLDRDLLKIKSSLELHAAIQSDSKVKEEEMEDSQYLDAFGTLAIREDGASTF # YGRSAGSEGETVSTPLDGRDPHSTTQVNGQSLNGVQTIREWQQQAAQARGLPTVLSNLSHSFPLPASQPIPDLDYLVDTFLPPWQEASRLCELYLEQA # PWFFGAVTQRQLVEEILPMWYTEAPRPAVAPSLNQEGVSVGDRGVDTPPLARSGLGVGTMSSSSPLGTNPNPPADFHQSSSTSAVHNARTGGAHDLAL # LFMVFCFGALTDVNLPAARITCSLNVTTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g112 ### # start gene g113 Scaffold_5 AUGUSTUS gene 518144 518644 0.78 - . g113 Scaffold_5 AUGUSTUS transcript 518144 518644 0.78 - . g113.t1 Scaffold_5 AUGUSTUS stop_codon 518144 518146 . - 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_5 AUGUSTUS CDS 518144 518171 0.8 - 1 transcript_id "g113.t1"; gene_id "g113"; Scaffold_5 AUGUSTUS CDS 518232 518644 0.84 - 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_5 AUGUSTUS start_codon 518642 518644 . - 0 transcript_id "g113.t1"; gene_id "g113"; # protein sequence = [MLPATSNLESTELFEMYPTLSSHVLSEESNLIDDLDSRPEGRFFDSPELNRYHVQSSSDDRKLMRKLGASFFLFGLIN # NGVYVERLSSESDVEASSNLTVLYVIILSAALDLVPSSTPKGIIAFCNIAPALVAKVGWPSLGMLVRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g113 ### # start gene g114 Scaffold_5 AUGUSTUS gene 520476 520904 1 - . g114 Scaffold_5 AUGUSTUS transcript 520476 520904 1 - . g114.t1 Scaffold_5 AUGUSTUS stop_codon 520476 520478 . - 0 transcript_id "g114.t1"; gene_id "g114"; Scaffold_5 AUGUSTUS CDS 520476 520904 1 - 0 transcript_id "g114.t1"; gene_id "g114"; Scaffold_5 AUGUSTUS start_codon 520902 520904 . - 0 transcript_id "g114.t1"; gene_id "g114"; # protein sequence = [MAPLKPSKSSRLGTVTKRKLAESSASKPAKATKKLRVNPQLSSDPQIQYSNSEGDAEEKDDEDEQSGEEEEEEGMLHG # FSTDEDDSSDEEIDGPPVDITKLPTIAKDDETVQKRLERAKKQPVLHQRCVPWCSLICECLYRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g114 ### # start gene g115 Scaffold_5 AUGUSTUS gene 525413 525991 0.56 - . g115 Scaffold_5 AUGUSTUS transcript 525413 525991 0.56 - . g115.t1 Scaffold_5 AUGUSTUS stop_codon 525413 525415 . - 0 transcript_id "g115.t1"; gene_id "g115"; Scaffold_5 AUGUSTUS CDS 525413 525991 0.56 - 0 transcript_id "g115.t1"; gene_id "g115"; Scaffold_5 AUGUSTUS start_codon 525989 525991 . - 0 transcript_id "g115.t1"; gene_id "g115"; # protein sequence = [MDTEQSTYRILSSSRVTKLFEQAKIYRMTCDPESAIRVITSGLEERQSDAEGEHSKGCKQGDSLVSPLLLWLIIWVFT # EKIGLVQLLFELAWIRLSQRHYMESAAAFLKLTELTGWSHGTYYFIAAGCHISLALSDNVLPYEKENHLNKAQGLLDAIPSLLDKRKIGGKELPTEVL # IKKKCMFEGSVSVRNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g115 ### # start gene g116 Scaffold_5 AUGUSTUS gene 528349 529827 0.43 - . g116 Scaffold_5 AUGUSTUS transcript 528349 529827 0.43 - . g116.t1 Scaffold_5 AUGUSTUS stop_codon 528349 528351 . - 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_5 AUGUSTUS CDS 528349 529109 0.98 - 2 transcript_id "g116.t1"; gene_id "g116"; Scaffold_5 AUGUSTUS CDS 529209 529827 0.43 - 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_5 AUGUSTUS start_codon 529825 529827 . - 0 transcript_id "g116.t1"; gene_id "g116"; # protein sequence = [MNRRLLADGVEAVGTSLVSNLRPGAGGHLTPGTQKVYTDREIKPLRKSFGVHAVQKEIQQKFEKAHQDQFDGMESIAG # YLDRKNNSSLVGKAPVGTSSSIESVQVGKKRKSSAIDDGRHAPAKRPSTRVISNTRRTVPGGFGEEDEDEEAPVGKKPRVEFSGKDDTGVKEVDQSAL # EKSEKERDAIRRKLEMNRARRRSSAANGRASKLPPKQAVSKSRFGFLSNAAKSIVKGVWGGGKKTPAVVPPKPVSKAPSSSTSTAKPVPSTGVTEAKA # KVAPSGTQRKFSATDSGTSPRNRDVSNAGTMNSLGSVATMIHSSRSRSPLPSFAAPTKSSSVRSSATGTTFTRNSSIANSSRVSRTSTTSTTSSRVSS # LGVRGTLDPNRVSSTTSSRLLAPTASSLAKAASLNKLKSDTLNVPTETPFASSPSSSKIFSKPLVVPKGSDCLLQFEVEDHRLLLER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g116 ### # start gene g117 Scaffold_5 AUGUSTUS gene 544817 546627 0.19 - . g117 Scaffold_5 AUGUSTUS transcript 544817 546627 0.19 - . g117.t1 Scaffold_5 AUGUSTUS stop_codon 544817 544819 . - 0 transcript_id "g117.t1"; gene_id "g117"; Scaffold_5 AUGUSTUS CDS 544817 544925 0.41 - 1 transcript_id "g117.t1"; gene_id "g117"; Scaffold_5 AUGUSTUS CDS 544983 545019 0.29 - 2 transcript_id "g117.t1"; gene_id "g117"; Scaffold_5 AUGUSTUS CDS 545436 546627 0.4 - 0 transcript_id "g117.t1"; gene_id "g117"; Scaffold_5 AUGUSTUS start_codon 546625 546627 . - 0 transcript_id "g117.t1"; gene_id "g117"; # protein sequence = [MPLMLYWGSINNWSIPTTLNRLISAPDSALINTLISQQTPYPPPPSPIEQRLTREFPIYKPRLRLPRIDGGTLPRPNE # NLFAFIQRREDHRLKVIASETSTERQSRLQREANADKDRPPGRKGARVYYWDLVEGTRVRTPVGRSNYEDIWERYGSRQRRYDSVADEWEVCTDFDPN # DAPDDYGYYSDDDDSDCFISVGAHINEETYHNDGAMSSQAYLTRLQSPNKLPHSSIEFHEAIEDVAYHRFGFLKQPIVQNRDFILKSKAWKKVLGVFG # CGRRHAAVEIDDHLKLQLCDFITRILDAVDLRHAPDGYDLSARSLMQPSVPFEVDTLSSYNGRYFMIQAKDATDDEEYVIALRSASTVMEIARRKWGP # QTEDIIKCLIEEGIPFNTLMASHPPRSTTNRDQVLVASRLVPKSFGPNSKVYGASSFDDQSGMAWEIEVSEGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g117 ### # start gene g118 Scaffold_5 AUGUSTUS gene 555653 555952 0.98 + . g118 Scaffold_5 AUGUSTUS transcript 555653 555952 0.98 + . g118.t1 Scaffold_5 AUGUSTUS start_codon 555653 555655 . + 0 transcript_id "g118.t1"; gene_id "g118"; Scaffold_5 AUGUSTUS CDS 555653 555952 0.98 + 0 transcript_id "g118.t1"; gene_id "g118"; Scaffold_5 AUGUSTUS stop_codon 555950 555952 . + 0 transcript_id "g118.t1"; gene_id "g118"; # protein sequence = [MDSYDSVPQSPDAGEDDPMPLAPLNPQTMPQMAPQVPQAFFQSITTSASDPTSADPTSADSTSADSTSQTPPPQTPPP # QTPPPRPTSADSTSADSTSTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g118 ### # start gene g119 Scaffold_5 AUGUSTUS gene 563668 564096 0.62 + . g119 Scaffold_5 AUGUSTUS transcript 563668 564096 0.62 + . g119.t1 Scaffold_5 AUGUSTUS start_codon 563668 563670 . + 0 transcript_id "g119.t1"; gene_id "g119"; Scaffold_5 AUGUSTUS CDS 563668 564096 0.62 + 0 transcript_id "g119.t1"; gene_id "g119"; Scaffold_5 AUGUSTUS stop_codon 564094 564096 . + 0 transcript_id "g119.t1"; gene_id "g119"; # protein sequence = [MLIDLAAYARTLDDKLYRTPSPLSATSRASSLPTSHEALHEDIESCDSRNDMEYLATRIHGLSLDSSGVSKFNQVKLL # QTALDIRDEMYGADTNTIVLQKRPEFWEQAPVGCFSVRDPATFIDPFVSSVECRRRTVVHLSRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g119 ### # start gene g120 Scaffold_5 AUGUSTUS gene 570168 571118 0.97 - . g120 Scaffold_5 AUGUSTUS transcript 570168 571118 0.97 - . g120.t1 Scaffold_5 AUGUSTUS stop_codon 570168 570170 . - 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_5 AUGUSTUS CDS 570168 571118 0.97 - 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_5 AUGUSTUS start_codon 571116 571118 . - 0 transcript_id "g120.t1"; gene_id "g120"; # protein sequence = [MFGLDHTLFYRVQAIVTRCCRLLVIHNPVNAARRLSIYYGHGALESRSYSNIFAEVFTPWGKEALLISEEIFVSFQEL # LERIDRDESYVQFLASTPDYFFHLIQLAGVFLISFKFMVFNARRCVLPGSSDLLLESIIQRLKLLQVPRKHPALTCADLLRGLLELWMHREELLPSVQ # LPSVQSQPQQHQQIPARSNRVDSLVQGQLRHTVEGHGREQLGDKEPEVTSVNEPPNATAIAASPTEYLSASSISAREIRQLSQNVMMQTDLDLSSMCS # SMPNAITVGMIDNPQVGDEFSDIFQDVQFWQNLSMHQPMSGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g120 ### # start gene g121 Scaffold_5 AUGUSTUS gene 575172 575735 0.28 - . g121 Scaffold_5 AUGUSTUS transcript 575172 575735 0.28 - . g121.t1 Scaffold_5 AUGUSTUS stop_codon 575172 575174 . - 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_5 AUGUSTUS CDS 575172 575735 0.28 - 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_5 AUGUSTUS start_codon 575733 575735 . - 0 transcript_id "g121.t1"; gene_id "g121"; # protein sequence = [MRNAALEASRKEDAGKKKGGKIGSDPSTSSSAPPPSSKKALNKKAVSNANNTSGPASTPAAGGPSAKSGGPPSKFSKA # SRQQLSQPQTRTQPSVQPPTKLLTHNPPVAPSNSESQSKTDPSSSTAPTPAPRRVRPMLGLASRQFEAALSGAGVNAAERKSRKEREKNERQPRRIRI # KNIVLKNKHLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g121 ### # start gene g122 Scaffold_5 AUGUSTUS gene 578174 579751 0.91 - . g122 Scaffold_5 AUGUSTUS transcript 578174 579751 0.91 - . g122.t1 Scaffold_5 AUGUSTUS stop_codon 578174 578176 . - 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_5 AUGUSTUS CDS 578174 579751 0.91 - 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_5 AUGUSTUS start_codon 579749 579751 . - 0 transcript_id "g122.t1"; gene_id "g122"; # protein sequence = [MQLLVENAHERLSGQDVKDHPFFESISNSWNEVAALEHPPLPGPPTTSLDPDISLGIALSPRICSSTYDDRSLVASLS # QSTGNEGRSLHECNQLNLPSSLNITWSVPSEGLLVDDPIDSSLVAPDRSSNDENTDIAHNLRETVSTSVNTLDEESFLFVHYDEEANQGGEEEEATED # GMSNQISPLQSFPSTASLHFVFPAPEQVNQDLGLDSVEHESQPVMNANSEAEMGVDDDEENADDVEVWNPWNPRPFDGLLDPTDSFPSVLPNPYSPRP # ILVYGPESAHEFQSLHGVASLDSQSKTDFHVTSAESAKPSVTGDTRRETGDESIPTGDTSTPGRNMDNHDTENSRLKSNTIDITSVSSLAVKEVREGE # DILFFSANIQPRRKSISIPLDKKTRGKRSFSRFSLSVRLPNHKFTEHSSVNTTINSPRSVVEGGNPFECPLIDTRSNARKKRFSFPASFSGSESEGRR # GRRRRQSGRNSAVSALLITQEDDFLPHSLSRLEVLPAPSTQPKLTSGKNHTSYQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g122 ### # start gene g123 Scaffold_5 AUGUSTUS gene 581524 582053 0.44 + . g123 Scaffold_5 AUGUSTUS transcript 581524 582053 0.44 + . g123.t1 Scaffold_5 AUGUSTUS start_codon 581524 581526 . + 0 transcript_id "g123.t1"; gene_id "g123"; Scaffold_5 AUGUSTUS CDS 581524 581700 0.46 + 0 transcript_id "g123.t1"; gene_id "g123"; Scaffold_5 AUGUSTUS CDS 581763 582053 0.45 + 0 transcript_id "g123.t1"; gene_id "g123"; Scaffold_5 AUGUSTUS stop_codon 582051 582053 . + 0 transcript_id "g123.t1"; gene_id "g123"; # protein sequence = [MVSSTQFEEATTAIVEPTESPERDPTEDEDMESTESEAGSSKMTIEERKAKMDQLRKRLVASSRANRQSLIEESTKLK # VTARDTARLERQRKLAETLREKADAEERGEDVNRAKNWEYTIEENDAWEKKLARKKRRADFEFHGEIKLNHIPFLHC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g123 ### # start gene g124 Scaffold_5 AUGUSTUS gene 582910 583635 0.73 + . g124 Scaffold_5 AUGUSTUS transcript 582910 583635 0.73 + . g124.t1 Scaffold_5 AUGUSTUS start_codon 582910 582912 . + 0 transcript_id "g124.t1"; gene_id "g124"; Scaffold_5 AUGUSTUS CDS 582910 583635 0.73 + 0 transcript_id "g124.t1"; gene_id "g124"; Scaffold_5 AUGUSTUS stop_codon 583633 583635 . + 0 transcript_id "g124.t1"; gene_id "g124"; # protein sequence = [MSSSTSATSSQPRKSQATTCQECRRLKISERFTSQAREASYLIDGFPECDRVFPCAACIRRGCGNLCRECLIVNRELF # FSCQLYITANGTLEKGKRGFLKRLEQALPPSLNKAGSDGAGPLSEVAMFVSRDAAMAKRIKDLEAALVEAGVEVPGLPRTTHSNTNKRIRAGGNPSET # EIWEINNDSSSSVSDYNDVAVGFGTLTIDPKNRSRYIGLSSGSAYLDSDMWGSRGKEVQPQDYVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g124 ### # start gene g125 Scaffold_5 AUGUSTUS gene 584489 584965 0.49 + . g125 Scaffold_5 AUGUSTUS transcript 584489 584965 0.49 + . g125.t1 Scaffold_5 AUGUSTUS start_codon 584489 584491 . + 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_5 AUGUSTUS CDS 584489 584965 0.49 + 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_5 AUGUSTUS stop_codon 584963 584965 . + 0 transcript_id "g125.t1"; gene_id "g125"; # protein sequence = [MPTTSDCPLPSDSDSSNSTWSHTRWHTYKFRWAEVLGGIMDNVFSVKKPPTYSAIMQYDQQINEFYFSLPQWILSPYV # MYPVDRALWAQLYPEGANGQTRYDPYEEGGFKGLGKPEDQTQCSQMNSLATMIFTATLHLHRGPFCRALMRASENAQVSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g125 ### # start gene g126 Scaffold_5 AUGUSTUS gene 586575 587630 0.45 - . g126 Scaffold_5 AUGUSTUS transcript 586575 587630 0.45 - . g126.t1 Scaffold_5 AUGUSTUS stop_codon 586575 586577 . - 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_5 AUGUSTUS CDS 586575 587630 0.45 - 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_5 AUGUSTUS start_codon 587628 587630 . - 0 transcript_id "g126.t1"; gene_id "g126"; # protein sequence = [MARTPRNTARTTRARTGTFNADSDIPESATRSSEDLNVALNKTANQLASKMQEAVLLEDTLAMHICARAQCTAPRGKA # WHRSCLIRDQAPSEKGVEGGAEDLADKDETLLHLESWILRDARRRGRTHSISSPSFDHVMARWKAMGHSRQLEVERMLQLLCTIPPGYEHPSIGNEGM # YEFPILFAVGIPSIAKPSAEGKSAASGKRKARTSEQEELEVSADLLEVNLDKGSKSPKKQRRSLRVSDADKLNIEPESAPRYSKDDDEEDYIPRIMHT # LSSLLAPELICLASQPMVRGGVPSISSLSSRNHSLAFAGTSPIFSSESLFGEALRTTITGNISEVGSRPDCSVQGLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g126 ### # start gene g127 Scaffold_5 AUGUSTUS gene 588975 589858 0.33 - . g127 Scaffold_5 AUGUSTUS transcript 588975 589858 0.33 - . g127.t1 Scaffold_5 AUGUSTUS stop_codon 588975 588977 . - 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_5 AUGUSTUS CDS 588975 589726 0.62 - 2 transcript_id "g127.t1"; gene_id "g127"; Scaffold_5 AUGUSTUS CDS 589780 589858 0.33 - 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_5 AUGUSTUS start_codon 589856 589858 . - 0 transcript_id "g127.t1"; gene_id "g127"; # protein sequence = [MSEYHDRHTISRLIGAAPGYVGFEEGGQLTEAVRRKPYAVILLDELEKAHKDVAMILLQILDEGSVTDSQGRKVDFKN # TIICLTSNLGASLPPIFLQRNSHIFKFLATGSDILAHKSACNEDGVVLPDARDEVLQRTQEYFPPELLNRLDSMLVFNKLSKQSILQVVSLRLNDVAE # RLKNKRITLDVDESARGRLATQGYSELYGARAIARVVRTDVLFPLAQKLLKGTIREGDTVLIRAGDDGSSLYIKDNHLPDPNASAAQTTEITSTHYLH # KS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g127 ### # start gene g128 Scaffold_5 AUGUSTUS gene 590161 590956 0.47 - . g128 Scaffold_5 AUGUSTUS transcript 590161 590956 0.47 - . g128.t1 Scaffold_5 AUGUSTUS stop_codon 590161 590163 . - 0 transcript_id "g128.t1"; gene_id "g128"; Scaffold_5 AUGUSTUS CDS 590161 590765 0.94 - 2 transcript_id "g128.t1"; gene_id "g128"; Scaffold_5 AUGUSTUS CDS 590902 590956 0.47 - 0 transcript_id "g128.t1"; gene_id "g128"; Scaffold_5 AUGUSTUS start_codon 590954 590956 . - 0 transcript_id "g128.t1"; gene_id "g128"; # protein sequence = [MQLWNVVSNPLALMSLQWTAVYSSRYISDRYLPDKAIDLVDEAASALRLAQESKPDELESLDREIMTLQIELASLKNE # SDVFSVERREKVESDLKRKKDEAQHLTSIWQAERERLDKIKNLKERLEETKYQLEVAQRQGQYELASRLRFATIPELEAQLPKEDSEGAEVEGEGPLS # MLHDRVNPNDIARVVAKATGIPVQNLLKGEKDKLVHVRKQFTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g128 ### # start gene g129 Scaffold_5 AUGUSTUS gene 592567 592866 0.53 + . g129 Scaffold_5 AUGUSTUS transcript 592567 592866 0.53 + . g129.t1 Scaffold_5 AUGUSTUS start_codon 592567 592569 . + 0 transcript_id "g129.t1"; gene_id "g129"; Scaffold_5 AUGUSTUS CDS 592567 592866 0.53 + 0 transcript_id "g129.t1"; gene_id "g129"; Scaffold_5 AUGUSTUS stop_codon 592864 592866 . + 0 transcript_id "g129.t1"; gene_id "g129"; # protein sequence = [MREERINSPRGLRVGGIGDIGIMVDVELDEERLVGVELCGDGEGEREDLGVREPGPLMGVLERLELRKPVCVVDVEGF # DTSEVVVKELGLGKRNKRGFQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g129 ### # start gene g130 Scaffold_5 AUGUSTUS gene 596121 596561 0.87 - . g130 Scaffold_5 AUGUSTUS transcript 596121 596561 0.87 - . g130.t1 Scaffold_5 AUGUSTUS stop_codon 596121 596123 . - 0 transcript_id "g130.t1"; gene_id "g130"; Scaffold_5 AUGUSTUS CDS 596121 596561 0.87 - 0 transcript_id "g130.t1"; gene_id "g130"; Scaffold_5 AUGUSTUS start_codon 596559 596561 . - 0 transcript_id "g130.t1"; gene_id "g130"; # protein sequence = [MAKLVKKSKPDSGMPAILPIKGNSAPNTLMYSSTRNVAIPRATTVSSSEEPGKRISNTMQIALASATSSSVSYLSSTP # ALTSAPSLDLNTSTKTKPLNLYPHSKSVHYWAARALTAETLLAAGIEHSENLQNVTVSQETKKAVSSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g130 ### # start gene g131 Scaffold_5 AUGUSTUS gene 605391 606476 0.34 + . g131 Scaffold_5 AUGUSTUS transcript 605391 606476 0.34 + . g131.t1 Scaffold_5 AUGUSTUS start_codon 605391 605393 . + 0 transcript_id "g131.t1"; gene_id "g131"; Scaffold_5 AUGUSTUS CDS 605391 606476 0.34 + 0 transcript_id "g131.t1"; gene_id "g131"; Scaffold_5 AUGUSTUS stop_codon 606474 606476 . + 0 transcript_id "g131.t1"; gene_id "g131"; # protein sequence = [MMNYSKAIKLMYRVENPEVVQVFGGNTDKLERELERMARRKFKFVVSMQRYSKFNKEEQENAEFLLRAYPDLQIAYLE # EEPPRKEGGDPRIFSALIDGHSEFIADTSRRRPKFRVELPGNPILGDGKSDNQNHAIIFYRGEYLQLIDANQDNYLEECLKIRNILGEFEECGVSSQS # PYAQWGHKDFKTAPVAIVGAREYIFSENIGILGDLAAGKEQTFGTLFARSMAWIGGKLHYGHPDFLNALYMNTRGGVSKAQKGLHLNEDIYAGMNAFG # RGGRIKHTEYFQCGKGRDLGFGTILNFQTKIGTGMGEQMLSREYYYLGTQLPIDRFLTFYYGHPGFHINNMLVILSVQIFVVTSRSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g131 ### # start gene g132 Scaffold_5 AUGUSTUS gene 612085 614428 0.21 - . g132 Scaffold_5 AUGUSTUS transcript 612085 614428 0.21 - . g132.t1 Scaffold_5 AUGUSTUS stop_codon 612085 612087 . - 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_5 AUGUSTUS CDS 612085 613778 0.61 - 2 transcript_id "g132.t1"; gene_id "g132"; Scaffold_5 AUGUSTUS CDS 613873 614428 0.21 - 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_5 AUGUSTUS start_codon 614426 614428 . - 0 transcript_id "g132.t1"; gene_id "g132"; # protein sequence = [MGKSIWHRVTTVVILRQNMRQKNMTAEDNKFRTVLENMRYKKCTPSDIAFLRSRISANVPGADSICKSEFRNVPMITA # LNIDKDEINQIGCERFAAENMSNLTNFYSEDVARQSNDNALDEKRTKKKLLSIKEMTDDVQKLLWSLNHSSSDSHVPSKLFTLCKYACYDPKKPSNRT # LYNKRSGRNIEITGLPKNVVPVYSTTNSMQITLPNGCAVNVTREQVEVLPNFAMTDFASQGKTRPINVVDINNCKDYHGIYTALSRGSTASGTLLIQG # FSPRKLTEHKYVDTREEFRELEILDEITRLQYENQICSSIKGTYRQDLIKAYQKWKGKHYVPKNVPSAIKWSSKDPWKQFDLDEVKWQIIMKSDTSNT # KITADVTAGIRNNLETAKGTKGLCSQILQPPSGPFTYTNKLHIAPNSTLVINETADNQSADNQNFYIPSMGLFGKRKLHISPEATPENSPMKKKKSVG # YIMPKFGPTWENNSCAYDSVIAVFLAIWSSNPTVWYDTFMHSSNEVQVVLAQHLEKYNNGIVTLNEVRDAVHTKLYSNAPSTFEWGKYTVAGLICDAL # LNINTTVFTGTYTCPKNQNHLLDRPNLTLHSSLLDSTEPYDSISDWIHHHYHTTRHKCSSCNTNIHILYSMNVYPPIIAFQLSQPDQGKDIPYIEMTL # TVQDASNKNQKYSLSGIIYFGEAHYTARIIDQDGKVWYYDGIADNGRFSYNGNINTDNIQLHKRGQKQAAVAIYALDIENLNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g132 ### # start gene g133 Scaffold_5 AUGUSTUS gene 615562 616251 0.85 - . g133 Scaffold_5 AUGUSTUS transcript 615562 616251 0.85 - . g133.t1 Scaffold_5 AUGUSTUS stop_codon 615562 615564 . - 0 transcript_id "g133.t1"; gene_id "g133"; Scaffold_5 AUGUSTUS CDS 615562 616251 0.85 - 0 transcript_id "g133.t1"; gene_id "g133"; Scaffold_5 AUGUSTUS start_codon 616249 616251 . - 0 transcript_id "g133.t1"; gene_id "g133"; # protein sequence = [MKLGGPMISMYLLGNPDHYTDHHFVTFYWIDFVNEARRYWHPDDIRSEKQKVTLMKRNGKIVGMSPVYDYMYRGENLA # QMSLYEWARCTERITLSKAMSKNKKESKSALHINSDKVSELSRPDITFVKTTNYESLSDNESSSSENENDKLLSSFQLRKSCHHLDPEHPLYESHATY # VKSANKFDVVNFVGATLPRKDRGDHEYYCSTMLTLFKPWRTGADLKVLMGCNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g133 ### # start gene g134 Scaffold_5 AUGUSTUS gene 616704 618269 1 - . g134 Scaffold_5 AUGUSTUS transcript 616704 618269 1 - . g134.t1 Scaffold_5 AUGUSTUS stop_codon 616704 616706 . - 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_5 AUGUSTUS CDS 616704 618269 1 - 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_5 AUGUSTUS start_codon 618267 618269 . - 0 transcript_id "g134.t1"; gene_id "g134"; # protein sequence = [MKANVIAFESPTPKLYNILPPPREDIDEVAAVLFTGPAKPTVDDFKRTPLLVRPKEMKLALQWLILNHADYDDVQISE # ENLSSYNENELPCTVEYKFADTNKTAESTSVFDMEDEDGADKGEYPFIVHGITGEQIGTYTVQQLKAKAWLHFNNGGKVIAVGHATECESLWNNPRLY # PKMFPHLFPYGLGGLGCANLSEEEHRKFLLMYFDKRFQTDPHFPFVAFSYMQIKKSSDAAWLLTEKRSFEQISQRLLSVDTNLITIIANKLASNESFK # PTTEEEIKCYKVIQDIDQVAGHVKGSTITKKYMRNEIWSLIAHKGAPSWYITISPADEKHPISLYYSGTEETFNPTIIDYNHRLAQTAKNPVAAARFF # HFMVETFITEVLGCGTKHRGLYGDHAAHYGTVEQQGRLTLHLHLILWLKGNVSPQDMRDRILDPNSNWMKQVVQYLESVHCGEYSMGSQEEVLGKVRL # ASQHSSYKNPTETMPIPPPPLCSKHNLMEPDNCKDCKLYNQWKKEYEFTVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g134 ### # start gene g135 Scaffold_5 AUGUSTUS gene 618804 619778 1 - . g135 Scaffold_5 AUGUSTUS transcript 618804 619778 1 - . g135.t1 Scaffold_5 AUGUSTUS stop_codon 618804 618806 . - 0 transcript_id "g135.t1"; gene_id "g135"; Scaffold_5 AUGUSTUS CDS 618804 619778 1 - 0 transcript_id "g135.t1"; gene_id "g135"; Scaffold_5 AUGUSTUS start_codon 619776 619778 . - 0 transcript_id "g135.t1"; gene_id "g135"; # protein sequence = [MLGGHAKPLLPFADIKDYILPSNEIQVYYATYSFTFVGICRAIDHVKFPSETHLYATLPSQQLLKFLTLKDAQTLAKY # HGLNGYRPSLGIISEYFDNHSYQGCVPSMSVFNYRQSRMEKSIKNLQKQRANIKGEIVFPPLPLSRELEHKIISNSCKRMSQSLIEESGCAICGKLTP # ISNLSLLKHIQNQLMILDVAGVTRKEQSNLSSPITDCEGPVLESTCSKVCNQCQSCIRNNQIPKFALAQGLCEAWHKRPALVLSGLGLSKQDSCLGRT # RGGGISAATGVGSLTSGGCRAWVDLAKGPGVGEGGVVGEDGGGWGCGAST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g135 ### # start gene g136 Scaffold_5 AUGUSTUS gene 620196 620645 0.92 - . g136 Scaffold_5 AUGUSTUS transcript 620196 620645 0.92 - . g136.t1 Scaffold_5 AUGUSTUS stop_codon 620196 620198 . - 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_5 AUGUSTUS CDS 620196 620645 0.92 - 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_5 AUGUSTUS start_codon 620643 620645 . - 0 transcript_id "g136.t1"; gene_id "g136"; # protein sequence = [MIVQSPLITTMLLVLLDASASPNLQQNQTYTSYSGEPTSMKCYSKIISDDSASMKCYSETVSDDFASMKCYSEKVCDD # FVSMKFDHGDYIPIKCDNIISTSIKCYNNEITSMTHSATIPKYHNHHLLTNFHTLHYIVSSGYHTGMSYLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g136 ### # start gene g137 Scaffold_5 AUGUSTUS gene 631757 632833 0.48 - . g137 Scaffold_5 AUGUSTUS transcript 631757 632833 0.48 - . g137.t1 Scaffold_5 AUGUSTUS stop_codon 631757 631759 . - 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_5 AUGUSTUS CDS 631757 632833 0.48 - 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_5 AUGUSTUS start_codon 632831 632833 . - 0 transcript_id "g137.t1"; gene_id "g137"; # protein sequence = [MGILAAQGVWEGCQQQTNENDPVNDNDLIDTSPYTTSFLSSWIHTELHETRNLRPSFSSSVLSKRGLGVLGGVLYSGI # DSLLLKGRTPWTFRHTRNEEERRECLGSGGGSLDGGSLDGGRSLDSLRTHPSTTHTPIPYPPFDPPLSTDLLTSLMLTGTSHEEDQPEHLRVLGRPGD # DALSSYTDFGDFGGGESVLDVRISEIHEEGIAETESTETTETTETEDTENTEFIPKVTSPPSLRRTHTKINTGEYAGLLARACPAGVYEYVDVDVDDD # NHHSPPHNSGSSGGSGGEGKGEVGNGEGNEGSEGKSSDGESWNGKKLVINAQNCIHCKLCDIKVPSQDITWTVPEGGGGPKYSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g137 ### # start gene g138 Scaffold_5 AUGUSTUS gene 635385 636977 0.35 - . g138 Scaffold_5 AUGUSTUS transcript 635385 636977 0.35 - . g138.t1 Scaffold_5 AUGUSTUS stop_codon 635385 635387 . - 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_5 AUGUSTUS CDS 635385 636668 0.46 - 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_5 AUGUSTUS CDS 636768 636977 0.54 - 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_5 AUGUSTUS start_codon 636975 636977 . - 0 transcript_id "g138.t1"; gene_id "g138"; # protein sequence = [MSKRTLTQTNDSELDFINATTNPSKIPRTLTSPSHFEFPPPPPPPQLPLNNVLNINTKERAKESPRLCQGNTRGASSS # MQGVDNDNNNNDNRISQPRLGLSQNQNLNQNQNLPPGQSERTIARVLDARQSSSSSSLSSSLQSRSANRAGQRPSSTALIPPVPRDFSSPSSSSSSSP # SSSSSTSTSTSSSDQCMRLHAMLGKQKYKSEVYKEQLKEQRRRNKELEDRLAETSKQLLQVQGRDDETVQLHTETKIISLSKELEQKEQRMKDLATQN # TYLQSQTHPSQSQMHDAQTESHTHLTHLQNTHTALSKNLQESHAQVTHLRHVVMTGNTEKKSLEDKLRVSEETLQAAEDKLRVSEENLHVSEQNLRTS # EQNLHTSEQNLHTSECARKHISNELLMQVNANMHLVGEIKGMEERVRFLERERDGFRVELDRRMVVSTGSEVDEVGVEVGVGVGVGVGVGVGVLESTA # VEAPGEEEEEEEEEQIVGEEDESLFGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g138 ### # start gene g139 Scaffold_5 AUGUSTUS gene 641103 643322 0.44 - . g139 Scaffold_5 AUGUSTUS transcript 641103 643322 0.44 - . g139.t1 Scaffold_5 AUGUSTUS stop_codon 641103 641105 . - 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_5 AUGUSTUS CDS 641103 641912 0.98 - 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_5 AUGUSTUS CDS 643045 643154 0.45 - 2 transcript_id "g139.t1"; gene_id "g139"; Scaffold_5 AUGUSTUS CDS 643259 643322 0.7 - 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_5 AUGUSTUS start_codon 643320 643322 . - 0 transcript_id "g139.t1"; gene_id "g139"; # protein sequence = [MVVSSKLVKEATLIKSGNIRRQFQATERKESTSIALISCDLHSVGIGNARGENLESRMLLAPYFSSHETEVDGALEEL # RKRVYEFIQTKLRDVWELLLNSTALGQAFPSAATPVAQAQPSAQPPTLADPISGPAQLAAGFWRTYGPNVLAAGASMYRQLAPANAPGQAPQPMGYDV # GPEDRPVSSRMSTTQSIIERRRQLEAELAALNAGEASAAGASPPPFPIPQIPGMQMQSMLGPSTSSTPSAVSSASSSPTGRTPGLRERTTSTVGPGGR # FEEINSNDLDEEDESGVGHEYGPRPGLPSTSRPSWFGWGGGGGSGGYERVKSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g139 ### # start gene g140 Scaffold_5 AUGUSTUS gene 654802 658101 0.29 - . g140 Scaffold_5 AUGUSTUS transcript 654802 658101 0.29 - . g140.t1 Scaffold_5 AUGUSTUS stop_codon 654802 654804 . - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_5 AUGUSTUS CDS 654802 655604 0.99 - 2 transcript_id "g140.t1"; gene_id "g140"; Scaffold_5 AUGUSTUS CDS 657103 657246 0.61 - 2 transcript_id "g140.t1"; gene_id "g140"; Scaffold_5 AUGUSTUS CDS 657366 657775 0.94 - 1 transcript_id "g140.t1"; gene_id "g140"; Scaffold_5 AUGUSTUS CDS 657863 658101 0.56 - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_5 AUGUSTUS start_codon 658099 658101 . - 0 transcript_id "g140.t1"; gene_id "g140"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQLSTAPCTLVTDNL # SNHSPPYGKQPQRRAASESPRDPPPHFDLDGGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPRSPISPDIPNEQRAML # ELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLEVAARAADRS # STTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDG # KLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLD # VCVIVYLDDILIYSDTPEEHREHVKEFFGGYGNIGFTPTPRSANSIWILLSIWVIFFLPTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g140 ### # start gene g141 Scaffold_5 AUGUSTUS gene 663960 664970 0.35 - . g141 Scaffold_5 AUGUSTUS transcript 663960 664970 0.35 - . g141.t1 Scaffold_5 AUGUSTUS stop_codon 663960 663962 . - 0 transcript_id "g141.t1"; gene_id "g141"; Scaffold_5 AUGUSTUS CDS 663960 664970 0.35 - 0 transcript_id "g141.t1"; gene_id "g141"; Scaffold_5 AUGUSTUS start_codon 664968 664970 . - 0 transcript_id "g141.t1"; gene_id "g141"; # protein sequence = [MEMVLWGSSTDTKTSAQEDKNKYEILMEGDDVFPPPHGNSDEDEDGNVTITVTATETLAGSATRIYTKPTHFLSTDVL # EVTGINDDVEASPTSTSTSASSSPSSSSSLGKIFSSQRPIFAIFELIFLIAVGVVLYVFLWRRRKQGSSADYEALAGQNVAMSRIPGDRDRSGRPGGR # GEMYEAFDGGEDEGEDDEDEEAGVDQPMLPRSARTPREDPSSAAIGQSRYRDQPSESDIPGKTQESMRILPKDDDSGSSGKLGTYIIAVHCNSIALSI # LAVCCLSNNRQYGCTSDFRSLSYNIPFRAWGNLVSVYSRHLYKPATEGIFIGNSDELLHRPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g141 ### # start gene g142 Scaffold_5 AUGUSTUS gene 664999 666440 0.32 - . g142 Scaffold_5 AUGUSTUS transcript 664999 666440 0.32 - . g142.t1 Scaffold_5 AUGUSTUS stop_codon 664999 665001 . - 0 transcript_id "g142.t1"; gene_id "g142"; Scaffold_5 AUGUSTUS CDS 664999 666110 0.44 - 2 transcript_id "g142.t1"; gene_id "g142"; Scaffold_5 AUGUSTUS CDS 666182 666440 0.36 - 0 transcript_id "g142.t1"; gene_id "g142"; Scaffold_5 AUGUSTUS start_codon 666438 666440 . - 0 transcript_id "g142.t1"; gene_id "g142"; # protein sequence = [MGIQDPLFPEQWHILNPESPEHMMNVTGLWEEGYTGVGVISSLIDDGLDYTSEDLAANFDAVHSHDYNDHEDLPTPKL # PEDTHGTRSVRILSGTITDVDEAAALNQGFDEVSIYSCSWGPPDDGRTMDGPDYLIQKAIVNGVNRGRQGKGSIFVFASGNGKGSGDECNYDGYTNSI # WSVTVGAADWTGRSPYYSEACAANMIVAYSSGNGKSIVTTDKGKNQCSRGHGGTSAAAPNVVGVIALALQARPELSWRDIQHLCVRTAIPINYDPSST # LPSSPSDTDYELTAAHRPFSYAFGYGAIDAYTFVHAALKWDLVPRQTWIRTRTVVLGDGKMTKDKVFSGGIPFGQSKNGGEVSVSSTLEVTEKMMSRA # LLSPQGLEHVNVRVWIDHQRRGDVRVEIVSPNGIKSILAGVSSGGEGGRKYDKAKTGFPGWLFMSVKHWMRTPSGHGPSQCRIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g142 ### # start gene g143 Scaffold_5 AUGUSTUS gene 675096 676294 0.26 - . g143 Scaffold_5 AUGUSTUS transcript 675096 676294 0.26 - . g143.t1 Scaffold_5 AUGUSTUS stop_codon 675096 675098 . - 0 transcript_id "g143.t1"; gene_id "g143"; Scaffold_5 AUGUSTUS CDS 675096 676064 1 - 0 transcript_id "g143.t1"; gene_id "g143"; Scaffold_5 AUGUSTUS CDS 676196 676294 0.26 - 0 transcript_id "g143.t1"; gene_id "g143"; Scaffold_5 AUGUSTUS start_codon 676292 676294 . - 0 transcript_id "g143.t1"; gene_id "g143"; # protein sequence = [MFLITLQHSMLSPKGIMAWACPLSTPTSLWRVDLDDAVEFKLNFNKPLEEFNEAKALGITTRPVVLGPITYLALSKAT # KEAKADFEPISLLPKILPVYKQLLSELKAAGAEWVQIDEPILVTDKGANFESQYGSAYPELVAVAPKLLLTTFYGRLESNVNFIAKLPIAGLHIDLDR # APEQLEKAINAVSSTPIVLSLGVVSGRSVWKTDFSAAIKLAEKAISALGEDRVIVATASTVLHIPVTLASEKKLTEEQKDWFSFALEKASEVATIAAV # VSGSQDAVVAAALEANRTSIAKRRDFEKNSDDSVRKRVASITPDQYERKSPFAVRLEAQKVLNLPKFPTTTIGSFPVRIVF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g143 ### # start gene g144 Scaffold_5 AUGUSTUS gene 680848 681308 0.32 + . g144 Scaffold_5 AUGUSTUS transcript 680848 681308 0.32 + . g144.t1 Scaffold_5 AUGUSTUS start_codon 680848 680850 . + 0 transcript_id "g144.t1"; gene_id "g144"; Scaffold_5 AUGUSTUS CDS 680848 680900 0.34 + 0 transcript_id "g144.t1"; gene_id "g144"; Scaffold_5 AUGUSTUS CDS 680951 681308 0.88 + 1 transcript_id "g144.t1"; gene_id "g144"; Scaffold_5 AUGUSTUS stop_codon 681306 681308 . + 0 transcript_id "g144.t1"; gene_id "g144"; # protein sequence = [MKKYDGRFKDIFQEIYESQYKSSFEAAGIYYEHRLIDDMVAQVIKSSGGFVWACKNYDGDVQSDILAQGFGSLGMMTS # ELITPDGLVVESEAAHGTVTRHYREWQKGNETSTNPVASIFAWTRVCCIELSLTGTTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g144 ### # start gene g145 Scaffold_5 AUGUSTUS gene 685289 685603 0.23 - . g145 Scaffold_5 AUGUSTUS transcript 685289 685603 0.23 - . g145.t1 Scaffold_5 AUGUSTUS stop_codon 685289 685291 . - 0 transcript_id "g145.t1"; gene_id "g145"; Scaffold_5 AUGUSTUS CDS 685289 685603 0.23 - 0 transcript_id "g145.t1"; gene_id "g145"; Scaffold_5 AUGUSTUS start_codon 685601 685603 . - 0 transcript_id "g145.t1"; gene_id "g145"; # protein sequence = [MSVSEAEAKGIFVEQQSEQCLFRDFSAGQEHFPLLCEHMELDPFKEYYPQALEEQGVSAFDDHHPDLELRKEDQEYGH # PSHPTAQGMSWVVLCIVAQLILVQSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g145 ### # start gene g146 Scaffold_5 AUGUSTUS gene 686875 687421 0.34 - . g146 Scaffold_5 AUGUSTUS transcript 686875 687421 0.34 - . g146.t1 Scaffold_5 AUGUSTUS stop_codon 686875 686877 . - 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_5 AUGUSTUS CDS 686875 687093 0.76 - 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_5 AUGUSTUS CDS 687167 687421 0.44 - 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_5 AUGUSTUS start_codon 687419 687421 . - 0 transcript_id "g146.t1"; gene_id "g146"; # protein sequence = [MAAFTMQSQHIRDGLHAQDKLALQHHLQTTGDLSKHQAWLQTTLQDQNQLVIRQHDEVLNAVKRTMPSPLSSPNNVDE # FEEYEDNSEWKPKQVLLSSDEEEGSWMSPDSQVLVIDQASVVRNVKYRVRTFKAAANDKPEQKGAAFEVRTAFLFSLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g146 ### # start gene g147 Scaffold_5 AUGUSTUS gene 689438 690073 1 - . g147 Scaffold_5 AUGUSTUS transcript 689438 690073 1 - . g147.t1 Scaffold_5 AUGUSTUS stop_codon 689438 689440 . - 0 transcript_id "g147.t1"; gene_id "g147"; Scaffold_5 AUGUSTUS CDS 689438 690073 1 - 0 transcript_id "g147.t1"; gene_id "g147"; Scaffold_5 AUGUSTUS start_codon 690071 690073 . - 0 transcript_id "g147.t1"; gene_id "g147"; # protein sequence = [MTVTIREARESDADAVSRICLLTAKGGQSADDLHDFKELPGLTYAVPYVKLPTTLGFVLIDDKNSGSGEGEVVGYTLA # SRNSREFDRYAAEHWWPILAEKYPPSLAQKPADKEFMELFRNMHGKSEARVSFGAANMHINLLEPYQRQGWGSKLVGRMVEALHKEDPDGGVTLGMDP # RNLAVRRFYEKFGFESFEGGKFNELGLKFSKAKVT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g147 ### # start gene g148 Scaffold_5 AUGUSTUS gene 705645 706455 0.23 - . g148 Scaffold_5 AUGUSTUS transcript 705645 706455 0.23 - . g148.t1 Scaffold_5 AUGUSTUS stop_codon 705645 705647 . - 0 transcript_id "g148.t1"; gene_id "g148"; Scaffold_5 AUGUSTUS CDS 705645 705850 0.38 - 2 transcript_id "g148.t1"; gene_id "g148"; Scaffold_5 AUGUSTUS CDS 705966 706300 0.25 - 1 transcript_id "g148.t1"; gene_id "g148"; Scaffold_5 AUGUSTUS CDS 706448 706455 0.68 - 0 transcript_id "g148.t1"; gene_id "g148"; Scaffold_5 AUGUSTUS start_codon 706453 706455 . - 0 transcript_id "g148.t1"; gene_id "g148"; # protein sequence = [MKGSYEWKVMPFSLTNTPAAFQYFVNDIFSDMPDVCVIIYLDNILIYSDMLGEHQEHVKEVLWQLQKHWLYANPDKCE # FNMDMGYILSPDGLTMSKEKVQPFWNGLFLGRLRTFTQNCFYFCAYSAHWEPNYPIIMETNASDYTIVVILSIQTVDGEIHPLAFLSRTLHAAELNYN # THDKSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g148 ### # start gene g149 Scaffold_5 AUGUSTUS gene 706879 707379 0.34 - . g149 Scaffold_5 AUGUSTUS transcript 706879 707379 0.34 - . g149.t1 Scaffold_5 AUGUSTUS stop_codon 706879 706881 . - 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_5 AUGUSTUS CDS 706879 707379 0.34 - 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_5 AUGUSTUS start_codon 707377 707379 . - 0 transcript_id "g149.t1"; gene_id "g149"; # protein sequence = [MLVWNLSFFVLFTQRLWPVLLTTPTVPPLHHSIPEEYAEFADAFDEIAANALPEHRPYDLKIDLEEATSPPLGRIYPL # SEKELVALKDFIDKQLATGAITPSSSPHGARVLLVPKKDRKLQLCVDFCGLNRITKKDRYPLPLISNLLNAPKQAKIYTKLDLAHTYC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g149 ### # start gene g150 Scaffold_5 AUGUSTUS gene 708297 708626 0.83 - . g150 Scaffold_5 AUGUSTUS transcript 708297 708626 0.83 - . g150.t1 Scaffold_5 AUGUSTUS stop_codon 708297 708299 . - 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_5 AUGUSTUS CDS 708297 708626 0.83 - 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_5 AUGUSTUS start_codon 708624 708626 . - 0 transcript_id "g150.t1"; gene_id "g150"; # protein sequence = [MAHLPELATLANYCQEVLCFDNHYWKRKKTKKREAGKPFIARNPKKGSMDFKAGSTNQQSNTQPLGSSVPFKPKPKPF # NRGKPQNSSNSGQSGGQCPMFKYRGADGKKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g150 ### # start gene g151 Scaffold_5 AUGUSTUS gene 709088 709548 0.2 - . g151 Scaffold_5 AUGUSTUS transcript 709088 709548 0.2 - . g151.t1 Scaffold_5 AUGUSTUS stop_codon 709088 709090 . - 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_5 AUGUSTUS CDS 709088 709425 0.33 - 2 transcript_id "g151.t1"; gene_id "g151"; Scaffold_5 AUGUSTUS CDS 709539 709548 0.47 - 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_5 AUGUSTUS start_codon 709546 709548 . - 0 transcript_id "g151.t1"; gene_id "g151"; # protein sequence = [MNWTIAHCTGKQPQCRATSQSPRDPPPHFELDAGNHDDQNPPVNPDNLGANNDNPDNNDLDDKSGHLLRGEPGDPSGP # HTPISPDIPNEQHAMLELLSGFKGSIEILGIILATLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g151 ### # start gene g152 Scaffold_5 AUGUSTUS gene 713540 714592 0.85 + . g152 Scaffold_5 AUGUSTUS transcript 713540 714592 0.85 + . g152.t1 Scaffold_5 AUGUSTUS start_codon 713540 713542 . + 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_5 AUGUSTUS CDS 713540 714592 0.85 + 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_5 AUGUSTUS stop_codon 714590 714592 . + 0 transcript_id "g152.t1"; gene_id "g152"; # protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLS # YLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIK # DEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSG # QSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g152 ### # start gene g153 Scaffold_5 AUGUSTUS gene 714925 715635 0.33 + . g153 Scaffold_5 AUGUSTUS transcript 714925 715635 0.33 + . g153.t1 Scaffold_5 AUGUSTUS start_codon 714925 714927 . + 0 transcript_id "g153.t1"; gene_id "g153"; Scaffold_5 AUGUSTUS CDS 714925 714944 0.61 + 0 transcript_id "g153.t1"; gene_id "g153"; Scaffold_5 AUGUSTUS CDS 715013 715356 0.44 + 1 transcript_id "g153.t1"; gene_id "g153"; Scaffold_5 AUGUSTUS CDS 715430 715635 0.73 + 2 transcript_id "g153.t1"; gene_id "g153"; Scaffold_5 AUGUSTUS stop_codon 715633 715635 . + 0 transcript_id "g153.t1"; gene_id "g153"; # protein sequence = [MANIAVRIGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINPVVAKVAVPLPEPSPSVSPTILETPPGDSPR # SRALTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVKVAARAADRSSTTPTVPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGAS # PPLGRIYLCLKRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g153 ### # start gene g154 Scaffold_5 AUGUSTUS gene 717709 718691 0.41 + . g154 Scaffold_5 AUGUSTUS transcript 717709 718691 0.41 + . g154.t1 Scaffold_5 AUGUSTUS start_codon 717709 717711 . + 0 transcript_id "g154.t1"; gene_id "g154"; Scaffold_5 AUGUSTUS CDS 717709 717806 0.41 + 0 transcript_id "g154.t1"; gene_id "g154"; Scaffold_5 AUGUSTUS CDS 717917 718691 0.44 + 1 transcript_id "g154.t1"; gene_id "g154"; Scaffold_5 AUGUSTUS stop_codon 718689 718691 . + 0 transcript_id "g154.t1"; gene_id "g154"; # protein sequence = [MCLLIITYDYDTQYISVIIWDQPAAVLLSRSAFKLYIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAF # FQALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNTPNASTGITPFFANKGYHPNITVWPEVNMKSDLARDF # VVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFLAKHIRSTCPTEKFSENILVLSRSSVDLVLCLTSSSSRTIFAAFTQFPRLTAGAS # YAESIPESYSISSTSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g154 ### # start gene g155 Scaffold_5 AUGUSTUS gene 729834 731225 1 - . g155 Scaffold_5 AUGUSTUS transcript 729834 731225 1 - . g155.t1 Scaffold_5 AUGUSTUS stop_codon 729834 729836 . - 0 transcript_id "g155.t1"; gene_id "g155"; Scaffold_5 AUGUSTUS CDS 729834 731225 1 - 0 transcript_id "g155.t1"; gene_id "g155"; Scaffold_5 AUGUSTUS start_codon 731223 731225 . - 0 transcript_id "g155.t1"; gene_id "g155"; # protein sequence = [MSTPIPPATPAPPASAEDLMTQLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS # QAKLIKSALGFFTESAGDWATPHLLHFNAEHPPFGGNWEEFLKEFGQRFESVDPGMEARSEIKNLKQSKGQTVAEFAQKFKDIGDRTGMSDIDLRERF # FTALLPEIRQNLIIVNIAQGLAPTLKEAIKRAISVDVYMHDPTMTGRNSGHTPTHAAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQG # HVKQNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPTPFSLFPNESVQIASSTPTSAPATVPATPSPPNQDFSNQIGQIRE # LLIVLTLCLLVLWLSTGFLKRVPASAAPRVPRNQFVMFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATPCF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g155 ### # start gene g156 Scaffold_5 AUGUSTUS gene 741751 741960 0.53 - . g156 Scaffold_5 AUGUSTUS transcript 741751 741960 0.53 - . g156.t1 Scaffold_5 AUGUSTUS stop_codon 741751 741753 . - 0 transcript_id "g156.t1"; gene_id "g156"; Scaffold_5 AUGUSTUS CDS 741751 741960 0.53 - 0 transcript_id "g156.t1"; gene_id "g156"; Scaffold_5 AUGUSTUS start_codon 741958 741960 . - 0 transcript_id "g156.t1"; gene_id "g156"; # protein sequence = [MKRMNRALLAEGAVLLFPSTEPDPMRSVRFDAASVIVEIESSDPGSRIQTELSTRNMRDVTHENYTKKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g156 ### # start gene g157 Scaffold_5 AUGUSTUS gene 752721 753818 0.36 + . g157 Scaffold_5 AUGUSTUS transcript 752721 753818 0.36 + . g157.t1 Scaffold_5 AUGUSTUS start_codon 752721 752723 . + 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_5 AUGUSTUS CDS 752721 753818 0.36 + 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_5 AUGUSTUS stop_codon 753816 753818 . + 0 transcript_id "g157.t1"; gene_id "g157"; # protein sequence = [MHPRIWIGSGVRDTTTTTTARSPFLSSTKTRKMYMHDEHYGRRIPPSGTSQGVAEYHDIELPDHSHSHSHCNNRREHH # HHHLDHDRDHDNSENGNGENGENDVTVYPDDHHTGHRDYHDAKYNHYYYYHRNNNNDNNNNNSTNDPDDSENQYRYYPSHHDELCRRRRRRRRTTSTH # HNINNHSESEEAQGCNCNGNYGNFDHLGMGFRVPGSVVPPGTTMFAVNMSGYYPGVPVETTTSGWYVPVIGPGLPGFGLGFGSGLGMGSGSSLSSGST # LFGPSRNWDYTDNNTRTSAGGIVIMGAAGNLVLGMLMKDTMRDILLLGVTPGEGITVTGGDSVISMGDTTRGTADSIVTTTSMVPLPQEMH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g157 ### # start gene g158 Scaffold_5 AUGUSTUS gene 755853 756779 0.8 - . g158 Scaffold_5 AUGUSTUS transcript 755853 756779 0.8 - . g158.t1 Scaffold_5 AUGUSTUS stop_codon 755853 755855 . - 0 transcript_id "g158.t1"; gene_id "g158"; Scaffold_5 AUGUSTUS CDS 755853 756779 0.8 - 0 transcript_id "g158.t1"; gene_id "g158"; Scaffold_5 AUGUSTUS start_codon 756777 756779 . - 0 transcript_id "g158.t1"; gene_id "g158"; # protein sequence = [MPNTNSSRSSWLTIQQPEHFPGDSESRVSLYSGPVPREDTTHSMALSAVNGPLSTRHSAPHSISNSNPSNPSRDSNHD # RPEPTASLEVYMRDRGIVPSSASASPASAYRGENRSDAGRHSHGEIGLGLPVVHSMLSIVPSATTTVAVIPGYPMLVQTSSGFSPTNLDSGPFSTGAA # SWSYGTYTENYIGGFNGGHHNGDYSHSNEHAESSCYPHRGNRDGNRIFFYHKHQPYFEFTNFSRHTVSYEGKIYPTNEHLFQAFKVSGEHHDCVFFDS # YKYTLYILFSESASSSTIIPTSRNTSALARIFPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g158 ### # start gene g159 Scaffold_5 AUGUSTUS gene 762981 764959 0.3 - . g159 Scaffold_5 AUGUSTUS transcript 762981 764959 0.3 - . g159.t1 Scaffold_5 AUGUSTUS stop_codon 762981 762983 . - 0 transcript_id "g159.t1"; gene_id "g159"; Scaffold_5 AUGUSTUS CDS 762981 763306 0.69 - 2 transcript_id "g159.t1"; gene_id "g159"; Scaffold_5 AUGUSTUS CDS 763768 764959 0.34 - 0 transcript_id "g159.t1"; gene_id "g159"; Scaffold_5 AUGUSTUS start_codon 764957 764959 . - 0 transcript_id "g159.t1"; gene_id "g159"; # protein sequence = [MPKLPQAPGGISEFKYGSRSRPEQEAIVVHNVFAHTRDVSNFSTNSGFRDSFNSMSHGAGGSLSSKFPGIPPRVTKAS # QMALQDSFYVVARSASSESKGKENQGAGLSISNSFHRKPVPRASLILAPASIDPFVDEDTQIGVKLPTPLGTTEHAHQMSIALSTAPTTTKDSLFARP # AESSPRPSSYSQFTPNTGQTEDPFKYDAEKRDLEAVGSRNRTRASVVPSELPLVRESSIQSPSQYLDYHDRGKSIETLDLSWLQPPNSGKYNESINSY # SEESTIERAMRRKISLPSTIHPLSGSDPAPLPGSSQRRSRSAPRFKSIGKAPKRYTPSPTISSYTRESIYIEPIIIPPRQYGGFPNVEVEQGSLNGGS # MLSGITGMDGITSRTSRMDGNSAGSEPALDLHYWSLSQGMPYRQSKESDSSIAMPAITMEDDLGIVYLVDNAQQFWSGVLVSKVLEKGVKYLTKLFLE # LEDILVIPKEAIPTLEQLDLTLKRSLSLCAAYHGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g159 ### # start gene g160 Scaffold_5 AUGUSTUS gene 765306 765937 0.77 - . g160 Scaffold_5 AUGUSTUS transcript 765306 765937 0.77 - . g160.t1 Scaffold_5 AUGUSTUS stop_codon 765306 765308 . - 0 transcript_id "g160.t1"; gene_id "g160"; Scaffold_5 AUGUSTUS CDS 765306 765790 0.77 - 2 transcript_id "g160.t1"; gene_id "g160"; Scaffold_5 AUGUSTUS CDS 765865 765937 0.77 - 0 transcript_id "g160.t1"; gene_id "g160"; Scaffold_5 AUGUSTUS start_codon 765935 765937 . - 0 transcript_id "g160.t1"; gene_id "g160"; # protein sequence = [MLIILIPVVIVFNEVASFIGITHRIAVGFSNPQNKTLWTIFTDFDLGFITVYQALNFSFAFFRLAKAFLEQQRIESSD # TDEALLIKGTGWVTLGIKLGAVESAIGFVPPQFGVVLARRILRFLGRALLIIGLLKGCVFNALPNLICDVVAYKLIGSMYPKTFNKSAKKLSLENANG # HSAVPVSDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g160 ### # start gene g161 Scaffold_5 AUGUSTUS gene 773895 775140 0.84 - . g161 Scaffold_5 AUGUSTUS transcript 773895 775140 0.84 - . g161.t1 Scaffold_5 AUGUSTUS stop_codon 773895 773897 . - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_5 AUGUSTUS CDS 773895 775056 0.84 - 1 transcript_id "g161.t1"; gene_id "g161"; Scaffold_5 AUGUSTUS CDS 775136 775140 0.96 - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_5 AUGUSTUS start_codon 775138 775140 . - 0 transcript_id "g161.t1"; gene_id "g161"; # protein sequence = [MFATSEPKGPVYLWARREVMEEEHPFALYNSLSMKPHISVSPAALSPVDTMAISTALLTALHPLIITSHIGRNQDAVS # SVLTLSTLLAVPVFCVCPSTVNIPFSHPFLFGITYLSPGPTTDSFEEHLQIADTVLVLDSDIPWIPSKCGPSEDGSRVFIIDSGDPLKTNVAMGTWDA # ALHRGVELICCADTETAVGQLVDVTKEHIRGSTTKLETVILEIRDRIKQRAQRIKQVHDKWIARLDGDESIPDVAKEGPSNLITVPHIMRALREVVAP # ISSKSLIINEAISNYGVWEHARAEFPGSLLTSGGSSLGYALGACVGAVLGSSSSSGTGSDTMDYDLVTAVVGDGTFMFGVPSSAFWIARRYNTVSLCH # YLFMRFLMLKSYHSLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g161 ### # start gene g162 Scaffold_5 AUGUSTUS gene 786734 787579 0.35 - . g162 Scaffold_5 AUGUSTUS transcript 786734 787579 0.35 - . g162.t1 Scaffold_5 AUGUSTUS stop_codon 786734 786736 . - 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_5 AUGUSTUS CDS 786734 787579 0.35 - 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_5 AUGUSTUS start_codon 787577 787579 . - 0 transcript_id "g162.t1"; gene_id "g162"; # protein sequence = [MRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGY # LPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYR # LDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKK # HPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g162 ### # start gene g163 Scaffold_5 AUGUSTUS gene 788190 790439 0.97 - . g163 Scaffold_5 AUGUSTUS transcript 788190 790439 0.97 - . g163.t1 Scaffold_5 AUGUSTUS stop_codon 788190 788192 . - 0 transcript_id "g163.t1"; gene_id "g163"; Scaffold_5 AUGUSTUS CDS 788190 790439 0.97 - 0 transcript_id "g163.t1"; gene_id "g163"; Scaffold_5 AUGUSTUS start_codon 790437 790439 . - 0 transcript_id "g163.t1"; gene_id "g163"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADAFLVWQYIMYQIAMTISNRPSLNLATSPKSPLQSYGTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g163 ### # start gene g164 Scaffold_5 AUGUSTUS gene 790768 791647 0.72 - . g164 Scaffold_5 AUGUSTUS transcript 790768 791647 0.72 - . g164.t1 Scaffold_5 AUGUSTUS stop_codon 790768 790770 . - 0 transcript_id "g164.t1"; gene_id "g164"; Scaffold_5 AUGUSTUS CDS 790768 791284 0.89 - 1 transcript_id "g164.t1"; gene_id "g164"; Scaffold_5 AUGUSTUS CDS 791352 791647 0.73 - 0 transcript_id "g164.t1"; gene_id "g164"; Scaffold_5 AUGUSTUS start_codon 791645 791647 . - 0 transcript_id "g164.t1"; gene_id "g164"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPTL # KEAIKRAISVDVYLHDPTMTGRNTGHAPAHTLTLPLPTLTPWTLMLLIPALGIAGRPSLPVCADDVLVVELKAMLSRIAHTRRLPADTVDAGDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g164 ### # start gene g165 Scaffold_5 AUGUSTUS gene 792806 794108 0.9 + . g165 Scaffold_5 AUGUSTUS transcript 792806 794108 0.9 + . g165.t1 Scaffold_5 AUGUSTUS start_codon 792806 792808 . + 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_5 AUGUSTUS CDS 792806 792934 0.9 + 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_5 AUGUSTUS CDS 793053 794108 0.96 + 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_5 AUGUSTUS stop_codon 794106 794108 . + 0 transcript_id "g165.t1"; gene_id "g165"; # protein sequence = [MEPILLRAIHSEVAARAADHSSTAPTVPPLPHSIPAEYAEFADELVTLKDFIDKQLATGAITPSSSPHGAPVLFVPKK # DGKLRLWVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYSSYEWKVMPFGLTNAPAAFQRFVNDIFSDM # LDVCIIVYLDDILIYSNMPEEHQEHIKEVLRQLWKHWLYTNPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFYRR # FIYNYSDIVVPMTWLTRKGAPWIWDNDCQEAFENLKIALTSAPILAHWEPNHPISVETDASDYAIAAILSIQTVDSEIHPLAFLSRTLHTAELNYDTH # DKELLAIFEAFKNLASLSGQLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g165 ### # start gene g166 Scaffold_5 AUGUSTUS gene 802398 803069 1 + . g166 Scaffold_5 AUGUSTUS transcript 802398 803069 1 + . g166.t1 Scaffold_5 AUGUSTUS start_codon 802398 802400 . + 0 transcript_id "g166.t1"; gene_id "g166"; Scaffold_5 AUGUSTUS CDS 802398 803069 1 + 0 transcript_id "g166.t1"; gene_id "g166"; Scaffold_5 AUGUSTUS stop_codon 803067 803069 . + 0 transcript_id "g166.t1"; gene_id "g166"; # protein sequence = [MATQQPLTRFSGDPDDPIQPATFLQDFEVHMTELMTLRADLVSGIKPYLERSSRAWEWYTEDLTATDRTRAWEAFEAK # FHARFPSQKKEKKSAKSYLASLEGERIMHEMIMKTSKDTNQLYHQWWADRLLRLAKGAEVEKTKQSIGTVWKHLPYALKKAIDEEHDNWEFTSAIKAV # KWSVLKVEAEHEVGKTTPLVVPETPRTKLANNFATARISTSPLPSPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g166 ### # start gene g167 Scaffold_5 AUGUSTUS gene 807155 808018 0.94 + . g167 Scaffold_5 AUGUSTUS transcript 807155 808018 0.94 + . g167.t1 Scaffold_5 AUGUSTUS start_codon 807155 807157 . + 0 transcript_id "g167.t1"; gene_id "g167"; Scaffold_5 AUGUSTUS CDS 807155 808018 0.94 + 0 transcript_id "g167.t1"; gene_id "g167"; Scaffold_5 AUGUSTUS stop_codon 808016 808018 . + 0 transcript_id "g167.t1"; gene_id "g167"; # protein sequence = [MYKLNDECVAAGLPASFDLPTRPQPPDPTEHADVTKPAKWRMCQNFMAVNKLTEIAPMPQGNIRSKQQSLSGHTYICL # FDFASGFYACKVERKSRPYTAFYVEGKGYFWCVKLPFGLTGAPSTFANMTARHLDDLIADGTIELFVDDGGSADDDFESMFAKLTRILERVCERDLSL # SAAKSEFFMLEGIFAGGKLSKEGVTADPAKLTAIVEWKQPADTLNLASFVGLTGHFRDLIRNYARIEGLLRNLLKSVPLPQNCTKSTYRRAMESFKLE # GKWTLDHTKHFWL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g167 ### # start gene g168 Scaffold_5 AUGUSTUS gene 808087 808569 0.15 + . g168 Scaffold_5 AUGUSTUS transcript 808087 808569 0.15 + . g168.t1 Scaffold_5 AUGUSTUS start_codon 808087 808089 . + 0 transcript_id "g168.t1"; gene_id "g168"; Scaffold_5 AUGUSTUS CDS 808087 808569 0.15 + 0 transcript_id "g168.t1"; gene_id "g168"; Scaffold_5 AUGUSTUS stop_codon 808567 808569 . + 0 transcript_id "g168.t1"; gene_id "g168"; # protein sequence = [MDGCKEGFAAVVAQRFEVVHPNGTTTYKMHPVGFASKRTSSSEQNYKPFLLEFAALKFGLDKFLDMIWGFPVEIETDC # QALRDVIANDKLNAVHCRWRDGVLAHHIVDVRHIPGKLNIVADGLSRMWEGQDRVVGDGSKWTVSEDWEAVTGLVNDVFGSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g168 ### # start gene g169 Scaffold_5 AUGUSTUS gene 809051 809737 0.27 + . g169 Scaffold_5 AUGUSTUS transcript 809051 809737 0.27 + . g169.t1 Scaffold_5 AUGUSTUS start_codon 809051 809053 . + 0 transcript_id "g169.t1"; gene_id "g169"; Scaffold_5 AUGUSTUS CDS 809051 809737 0.27 + 0 transcript_id "g169.t1"; gene_id "g169"; Scaffold_5 AUGUSTUS stop_codon 809735 809737 . + 0 transcript_id "g169.t1"; gene_id "g169"; # protein sequence = [MSKGKSGYKTIGLYLDTYSQRVWAFKFKVARLGATTSASLHSLFNGYLPPETFMTDNGTHFANKEVEALCAKWGTKQH # FTPAYSPWVNGLVEGTKQNSAPCSKRLCAPKLGEDSEEFTAMTWDTLPDKWPEFLEEAVRIINNRILPSVKFSPNEFLLGAVVNTRRTTVEEATSILP # QQSVAVQAAYVAQQQLDGYNAFVSHADMPKFWLDVYAVNCDIFTYRSVSRGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g169 ### # start gene g170 Scaffold_5 AUGUSTUS gene 813430 814950 0.85 - . g170 Scaffold_5 AUGUSTUS transcript 813430 814950 0.85 - . g170.t1 Scaffold_5 AUGUSTUS stop_codon 813430 813432 . - 0 transcript_id "g170.t1"; gene_id "g170"; Scaffold_5 AUGUSTUS CDS 813430 814950 0.85 - 0 transcript_id "g170.t1"; gene_id "g170"; Scaffold_5 AUGUSTUS start_codon 814948 814950 . - 0 transcript_id "g170.t1"; gene_id "g170"; # protein sequence = [MDECFLQPVTGVAGRTISLLDRYTPDCNQTQIILDTRTRALNVSSYNYLGFAQARGGCADAVEESMKRYGVTSCGSRL # EGGSTDLHTLAESVVAKFVGMEAAVISSMGFATNSTFIPALVSKGCLIISDELNHSSIRFGARSSGAHVRMFKHNDMEALESLLREAISQGQPKTHRP # WKKILLIVEGMYSMEGTMVDLPSVLMLKEKYKVSSLALITFIHQLTFIKFYLFVDEAHSIGAIGPHGRGVCDYFGVDPRKVDVLMGTFTKSFGASGGY # LSGNKALIDRLRIRGYSGAYTEAIAPPVLTQIIASMASIMSIDDDGSVPGAIKLGLHPSSSSSTLHQVVDYPHPGPISQRALPHWLSLPLPLASGAEG # LMRLRRLSFNSYYLHRGLDKLGFITYGHPSSPIVPLLLFNPAKMIMFHRMMKDRKTPIVIVVVAYPATPLVTSRVRFCVSASHTKEDIDSVLMACDEI # GDVLDLKHGLSKGERWSIDEVCRRAVELVHIPDHEH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g170 ### # start gene g171 Scaffold_5 AUGUSTUS gene 825336 826295 0.92 + . g171 Scaffold_5 AUGUSTUS transcript 825336 826295 0.92 + . g171.t1 Scaffold_5 AUGUSTUS start_codon 825336 825338 . + 0 transcript_id "g171.t1"; gene_id "g171"; Scaffold_5 AUGUSTUS CDS 825336 826295 0.92 + 0 transcript_id "g171.t1"; gene_id "g171"; Scaffold_5 AUGUSTUS stop_codon 826293 826295 . + 0 transcript_id "g171.t1"; gene_id "g171"; # protein sequence = [MRSLLARLGINSDLTSGYRPQSNGQTERANQEVEKYIRLYVGQRQDDWAEHLPMGEFVINSRTHSALGMSPFKLTYGY # LPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYKRGKRKAHQFKVGDPVWLSAEDINLQLSSEKLGPYRILEKVGPLDYHLDIPL # SLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDELEYEVEDILDSRVRWKKLEYLVKWKGYDAGHNSWEPTPNLSRAPKIVRAFHKNTRQLT # IEGNGHKEGVKSMPRASIPPLSIPKIYLYCNLSLLFFLATHTLSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g171 ### # start gene g172 Scaffold_5 AUGUSTUS gene 827683 828937 0.55 - . g172 Scaffold_5 AUGUSTUS transcript 827683 828937 0.55 - . g172.t1 Scaffold_5 AUGUSTUS stop_codon 827683 827685 . - 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_5 AUGUSTUS CDS 827683 828219 0.96 - 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_5 AUGUSTUS CDS 828270 828562 0.71 - 2 transcript_id "g172.t1"; gene_id "g172"; Scaffold_5 AUGUSTUS CDS 828623 828849 0.58 - 1 transcript_id "g172.t1"; gene_id "g172"; Scaffold_5 AUGUSTUS CDS 828918 828937 0.81 - 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_5 AUGUSTUS start_codon 828935 828937 . - 0 transcript_id "g172.t1"; gene_id "g172"; # protein sequence = [MANIAVRIRLQFLIRYNPLINWASQNITFRNTSHFDSPQMSVPSATNTVDAKIAVLLPEPSPLVSPTFWKPLLGIHFA # LTLGFSQFAAQLETPEVDIALISAAVFNRACKDAGMEPILLCAIHSEVAARAANRSSITPTVPPLHHFIPEEYAEFADVFDEIAADSLPEHRPYNLKI # DLAEELVALKDFIDKQLATGAITPSSSPYGALVLFVLKKDGKLWLCVDFCGLNRITKKDRYPLLLISDLLDTPKRAKIYTKLDLAHAYHLVRIAEGDE # WKTTFWTHYGSYKWKVMPFGLTNAPAASQCFVNDIFSDMLDVCVIVYLDDILIYSDMPEEHREHVKEVLRRLQKHWLYANPDKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g172 ### # start gene g173 Scaffold_5 AUGUSTUS gene 834283 835104 0.44 + . g173 Scaffold_5 AUGUSTUS transcript 834283 835104 0.44 + . g173.t1 Scaffold_5 AUGUSTUS start_codon 834283 834285 . + 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_5 AUGUSTUS CDS 834283 834303 0.79 + 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_5 AUGUSTUS CDS 834391 834425 0.45 + 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_5 AUGUSTUS CDS 834470 834498 0.57 + 1 transcript_id "g173.t1"; gene_id "g173"; Scaffold_5 AUGUSTUS CDS 834557 835104 0.77 + 2 transcript_id "g173.t1"; gene_id "g173"; Scaffold_5 AUGUSTUS stop_codon 835102 835104 . + 0 transcript_id "g173.t1"; gene_id "g173"; # protein sequence = [MRHPENLISFADGTIHKVETTVATHAQPTALASEIIQPGAEEGTEELERGVNSEKTHEGTLQQPPKAPRTKVKLEEVK # DEEYESRQPGPHELFPSEKDLGPDGPILMGINEWLAFVSKSTEQEVEETLEAGRSAMEARTPQLAKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKK # RREHGPYPDPPILNIEILNIPKIPSRSGLTPKGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g173 ### # start gene g174 Scaffold_5 AUGUSTUS gene 835216 835797 0.69 + . g174 Scaffold_5 AUGUSTUS transcript 835216 835797 0.69 + . g174.t1 Scaffold_5 AUGUSTUS start_codon 835216 835218 . + 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_5 AUGUSTUS CDS 835216 835797 0.69 + 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_5 AUGUSTUS stop_codon 835795 835797 . + 0 transcript_id "g174.t1"; gene_id "g174"; # protein sequence = [MDRLLREGTPAYFLHISPTKEESPTGEMLRASDSSSPEGVQQPKDLEGGNPSPEQEGVIKELDEEALKRQETEELKKS # IPVQYQDYLDIFSPGEARTLPPHRPYDIKIEMEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGRGSYDPPVPPWELPSCLPRKRMVPYDSVSTIKCKT # WVKIGLRVGFGMWRFML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g174 ### # start gene g175 Scaffold_5 AUGUSTUS gene 843208 844039 0.89 - . g175 Scaffold_5 AUGUSTUS transcript 843208 844039 0.89 - . g175.t1 Scaffold_5 AUGUSTUS stop_codon 843208 843210 . - 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_5 AUGUSTUS CDS 843208 843930 0.89 - 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_5 AUGUSTUS CDS 844019 844039 1 - 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_5 AUGUSTUS start_codon 844037 844039 . - 0 transcript_id "g175.t1"; gene_id "g175"; # protein sequence = [MRHPENLISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKELCLTFQDRNVRISAALASEIVQPGAEGGT # EELGRGVNGKEIHAGTLQSPPEAPQRPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPGPHKLFPSDKDLGPDDPILMGINEWLAFAS # ESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSRDTERSSSWPELSKKSGGGRKGGSMDLIPTSPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g175 ### # start gene g176 Scaffold_5 AUGUSTUS gene 846059 847825 0.51 - . g176 Scaffold_5 AUGUSTUS transcript 846059 847825 0.51 - . g176.t1 Scaffold_5 AUGUSTUS stop_codon 846059 846061 . - 0 transcript_id "g176.t1"; gene_id "g176"; Scaffold_5 AUGUSTUS CDS 846059 847825 0.51 - 0 transcript_id "g176.t1"; gene_id "g176"; Scaffold_5 AUGUSTUS start_codon 847823 847825 . - 0 transcript_id "g176.t1"; gene_id "g176"; # protein sequence = [MTLRLEDVIRIQECIPEDVAMVLREVLESMGIEIGRRSRILRPTSTVPNSGNSTGDRPPREGPAVADDPRERSDFLWL # YNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRILYRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDE # ESNEDANAIAAKNRRRRRYPTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMRHMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLE # RALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPRV # NLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAPF # GTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTAGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQA # TEPISFNRNTPTGARMETPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g176 ### # start gene g177 Scaffold_5 AUGUSTUS gene 847915 848544 0.8 - . g177 Scaffold_5 AUGUSTUS transcript 847915 848544 0.8 - . g177.t1 Scaffold_5 AUGUSTUS stop_codon 847915 847917 . - 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_5 AUGUSTUS CDS 847915 848544 0.8 - 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_5 AUGUSTUS start_codon 848542 848544 . - 0 transcript_id "g177.t1"; gene_id "g177"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY # PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g177 ### # start gene g178 Scaffold_5 AUGUSTUS gene 870451 870954 0.98 - . g178 Scaffold_5 AUGUSTUS transcript 870451 870954 0.98 - . g178.t1 Scaffold_5 AUGUSTUS stop_codon 870451 870453 . - 0 transcript_id "g178.t1"; gene_id "g178"; Scaffold_5 AUGUSTUS CDS 870451 870954 0.98 - 0 transcript_id "g178.t1"; gene_id "g178"; Scaffold_5 AUGUSTUS start_codon 870952 870954 . - 0 transcript_id "g178.t1"; gene_id "g178"; # protein sequence = [MPDAALFTRPPRNEHSVLETDYNTLTAIVLFTKLPFAFLPIDIFLQRVSDTDMDTPTDAIDSQVLITLTTHFKVHWRT # SVLSNNSQHVLIASQTLEDLFEVMPCVSNEYPEEIVEDDKVIGYKETNGMNGSSGCVIVINDLAYGDALNEEDYAEYVGISQFSVCYRH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g178 ### # start gene g179 Scaffold_5 AUGUSTUS gene 882168 882623 0.81 + . g179 Scaffold_5 AUGUSTUS transcript 882168 882623 0.81 + . g179.t1 Scaffold_5 AUGUSTUS start_codon 882168 882170 . + 0 transcript_id "g179.t1"; gene_id "g179"; Scaffold_5 AUGUSTUS CDS 882168 882623 0.81 + 0 transcript_id "g179.t1"; gene_id "g179"; Scaffold_5 AUGUSTUS stop_codon 882621 882623 . + 0 transcript_id "g179.t1"; gene_id "g179"; # protein sequence = [MTTTASTAVTLTQDSTSSPLPKFKAPSVETFSFKAPLLPASSVAAAGSSKQRRVSLALPSSPRVVPTSAWTFRDDTDL # EEKKGKLRKIVTDGDEESHERKLRKKWSQEETQMLVDGCNRVRALILLHFQFIDRLFSSTESEIGRLFLVIPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g179 ### # start gene g180 Scaffold_5 AUGUSTUS gene 882684 883721 0.81 + . g180 Scaffold_5 AUGUSTUS transcript 882684 883721 0.81 + . g180.t1 Scaffold_5 AUGUSTUS start_codon 882684 882686 . + 0 transcript_id "g180.t1"; gene_id "g180"; Scaffold_5 AUGUSTUS CDS 882684 883721 0.81 + 0 transcript_id "g180.t1"; gene_id "g180"; Scaffold_5 AUGUSTUS stop_codon 883719 883721 . + 0 transcript_id "g180.t1"; gene_id "g180"; # protein sequence = [MQIINLIYSFRTYFPDAYKQHYPNARTHLSTKIRSTLPDGSSLFEKTRSKKRRPFTEEEDRALKAGYEKHGTVWATIV # KDPIFQEQNRRSTDLRDRFRNAFPELYQAAGYKPRTAVKKKIAPTVSSTAATAASTPVFTSGPSTPATSPKKQLIRAATDDQLAMSTTGPVRMQTRRR # RRNTSQGIFRGGTKSVPQSNAPSEDEMSSGGEDDDGVVKPMRVTRSISNSLSSSNLLGWGHKPSPSSFSSFSSSPVTSTTATDDEVDNVAEVTDMMDT # SLGEYGYDFAVPQNSNGDGDPGNSHGGLTTMIGKSAWGTQDWFPPILDWTIVPITLPAATLPRLPLLWRAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g180 ### # start gene g181 Scaffold_5 AUGUSTUS gene 884107 885642 0.66 + . g181 Scaffold_5 AUGUSTUS transcript 884107 885642 0.66 + . g181.t1 Scaffold_5 AUGUSTUS start_codon 884107 884109 . + 0 transcript_id "g181.t1"; gene_id "g181"; Scaffold_5 AUGUSTUS CDS 884107 885642 0.66 + 0 transcript_id "g181.t1"; gene_id "g181"; Scaffold_5 AUGUSTUS stop_codon 885640 885642 . + 0 transcript_id "g181.t1"; gene_id "g181"; # protein sequence = [MDGGIGIGGPGGRGFTHHSDYAGDLIFSARTHQPVQPFAQQGLGLGLSGMGMPDIPQSSGIHPLQLHTHTPVLSALPG # IDEIELTGITLEDSVMTESSPDLDVGIMDMSSPPSSASNTQQDMLLQQRQSQQIPDATIRRRNPHPRSQSVVSESRLLRPLAFEDLVDINLRNHNDDE # DGKGKNNHLILLTTDQDNLEYPSDDDEQHLTPPATPITRPRPLRGSRRISRRVGGAGGQYNSIPTHGRSVSVPPVDRPGSDSPDLPHHANSQPELNRL # SSSSLNYQLGPSSSMDIMDHSPSSTRQQETPASTIGGLSTPAAAAQIPLPNPPTFASLFLATQGEDLYNLPFLDLHYYGGNQSSGPNISGGEMVPAIL # DSETGSSRQALDLAQSVRSVSATTGTGNTFTLAGRRMMLDKEGSTIEGNSNVTKAGVSAVPLSQSPHSPPPPMRSHSLSHSHTHSQQTKSRHSGHLGH # HQRGQSTANVMNAGSSVCPQDLILRSETNKRKRASWDGANS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g181 ### # start gene g182 Scaffold_5 AUGUSTUS gene 887898 890884 0.37 + . g182 Scaffold_5 AUGUSTUS transcript 887898 890884 0.37 + . g182.t1 Scaffold_5 AUGUSTUS start_codon 887898 887900 . + 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_5 AUGUSTUS CDS 887898 888355 0.82 + 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_5 AUGUSTUS CDS 888439 888748 0.43 + 1 transcript_id "g182.t1"; gene_id "g182"; Scaffold_5 AUGUSTUS CDS 889364 890884 0.73 + 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_5 AUGUSTUS stop_codon 890882 890884 . + 0 transcript_id "g182.t1"; gene_id "g182"; # protein sequence = [MLCALEYNRLYLDFSLFVQLMNEPADPHPHHTGLISIYDRTYAAIHDIDPNHILFLDGNTFATDFTKFPEDSATRWGS # NVAFAIHDYSTFGFPNSPEAYEGTDDQKDKMKVAYVRKRKWMDERGLCVWNGEWGPVYGREEYDGEKTEDINRRRAASQDSLSWSIWLYKDIGFQGMV # YVSQDTPYMKHFREFLLKKHRLAVDAWGADDKYVKPIYEPLINLIKEEVAQPNQKLYPPIWSLENRVTRISRTILVAEFLILRVAAINHAAFEWIHHE # HVARDAGLTTEQLYVIRDTSFLPSPGNAILSPLQSAALAFAHHSTSTVKVPPEVTLSLADALRSSIASGSNDTESLAQDLLVESAAVVASYNMVSRFL # VSLDVAAMSDFPPPWPATKSTFKVPLSVDPANGVLEDGHFLYAETHVTDPDAPWIVCANSLLTTTDMWEWALEKMLAPQPRGAKEVETLGTEGMLPDG # LFLGKYKTFNVLLHDQRGHGKSSFPSNTKPDGLQCTIPILASDIAYLISTLILPSSSSVRSTIDSEPKVHAVIGVSQGGAAALAFTAMYPLLTKSVVS # CDTGPRTPEGNKAAWTERIELVKANGGGEDGMRKLAAITVPRWFPAPSKCSTEMYLPGQILSPPSSPEVSSIYGRRPRSEALQAQIVTTSLDGFIVGA # SALQDYDLLAGTGMNRSLLDVTSPADPKVLLIAGSLDGGGKVSSGMGKLRDAWNAKRIPAGGGSVKLEVIEGAGHLPMVDETEKWWDIVGKWLAGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g182 ### # start gene g183 Scaffold_5 AUGUSTUS gene 892543 892839 0.86 + . g183 Scaffold_5 AUGUSTUS transcript 892543 892839 0.86 + . g183.t1 Scaffold_5 AUGUSTUS start_codon 892543 892545 . + 0 transcript_id "g183.t1"; gene_id "g183"; Scaffold_5 AUGUSTUS CDS 892543 892839 0.86 + 0 transcript_id "g183.t1"; gene_id "g183"; Scaffold_5 AUGUSTUS stop_codon 892837 892839 . + 0 transcript_id "g183.t1"; gene_id "g183"; # protein sequence = [MIITALECGRPWTSIAPLLAAPNAEPELVGAVAPVMLELRVTAKPEEAGTAPLSAPEPTDRETVEDWTVEAITVLIDL # VALEMDVDGVATLTKLEASL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g183 ### # start gene g184 Scaffold_5 AUGUSTUS gene 898169 898932 0.13 - . g184 Scaffold_5 AUGUSTUS transcript 898169 898932 0.13 - . g184.t1 Scaffold_5 AUGUSTUS stop_codon 898169 898171 . - 0 transcript_id "g184.t1"; gene_id "g184"; Scaffold_5 AUGUSTUS CDS 898169 898365 0.24 - 2 transcript_id "g184.t1"; gene_id "g184"; Scaffold_5 AUGUSTUS CDS 898443 898932 0.38 - 0 transcript_id "g184.t1"; gene_id "g184"; Scaffold_5 AUGUSTUS start_codon 898930 898932 . - 0 transcript_id "g184.t1"; gene_id "g184"; # protein sequence = [MIKIAQLKQLDMKLLNRFQPVLEVLLAVEKEAEGMIAEIERVIAEHDIKGEALKREAAEQRVLQASKHAGESSSKGKE # KQREKSPFSEDDEDEDDEDDVEDNDLPKTLAGKEHRDKRSALMHRLREARVQFHRVKFLQGDVYHNLGEMYTAQENGAYAVAEAVPTEQDAKNGMAQL # HLDIIGGRAGVSKTDLLIPVPYLEQGGIRSADTASQKSCSFSVADNSVFHLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g184 ### # start gene g185 Scaffold_5 AUGUSTUS gene 899515 900323 0.42 - . g185 Scaffold_5 AUGUSTUS transcript 899515 900323 0.42 - . g185.t1 Scaffold_5 AUGUSTUS stop_codon 899515 899517 . - 0 transcript_id "g185.t1"; gene_id "g185"; Scaffold_5 AUGUSTUS CDS 899515 899680 0.42 - 1 transcript_id "g185.t1"; gene_id "g185"; Scaffold_5 AUGUSTUS CDS 899956 900323 0.91 - 0 transcript_id "g185.t1"; gene_id "g185"; Scaffold_5 AUGUSTUS start_codon 900321 900323 . - 0 transcript_id "g185.t1"; gene_id "g185"; # protein sequence = [MVEELKVHAPGLKVLVYNGWSSIKIPISDEQVEQERQQRQKAQQKAQKKSGRARTKAEAQANIKKKGKATAVDVGAID # VDVEEEIVDWCSYVHGFDVVITTYTVLQNDFNVARVPPKRPRRDVLIFENITDSYDSTLNLVYGNGSSSQALLANSTAFSNTILFGRSLFNIKAPIFL # K] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g185 ### # start gene g186 Scaffold_5 AUGUSTUS gene 903487 904760 0.46 - . g186 Scaffold_5 AUGUSTUS transcript 903487 904760 0.46 - . g186.t1 Scaffold_5 AUGUSTUS stop_codon 903487 903489 . - 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_5 AUGUSTUS CDS 903487 904161 0.82 - 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_5 AUGUSTUS CDS 904248 904760 0.46 - 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_5 AUGUSTUS start_codon 904758 904760 . - 0 transcript_id "g186.t1"; gene_id "g186"; # protein sequence = [MNIPKADILNPDSDDPSSSTNPAVKLALAETHIINETKAYFESNGVVLASFSSSRTARADTTILVKNIPYGTSDTQIR # ELFEPHGTVSRVLVPPAGTIAVVEFEKPDEASRGFRAVAYRRLGNSVIYLEKAPIGIFTDAPPPPASYSPQLLVPFPLMLSKSPNKLLKRRMKMFRNL # PSFAFARVQMKPDPKKPDGKLSMGYGFIGFKDVDGARKAMKSMQGFVLDGHALHIKFAGRGADEDVDKRKDGVSSKSRTTKMIVKNVPFEATKKDIRD # LFGYVNPVSFSHFHEISLLRSRSHGQLKSVRLPKKFDSRTRGFAFLDFVSRQEAENAYAALRHTHLLGRHLVLEWAEEAEQDLEMLRKKAGIGFGAGK # EMPGKKRKLDMSITGENEEDEEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g186 ### # start gene g187 Scaffold_5 AUGUSTUS gene 909303 910200 0.2 + . g187 Scaffold_5 AUGUSTUS transcript 909303 910200 0.2 + . g187.t1 Scaffold_5 AUGUSTUS start_codon 909303 909305 . + 0 transcript_id "g187.t1"; gene_id "g187"; Scaffold_5 AUGUSTUS CDS 909303 909664 0.38 + 0 transcript_id "g187.t1"; gene_id "g187"; Scaffold_5 AUGUSTUS CDS 909801 910200 0.32 + 1 transcript_id "g187.t1"; gene_id "g187"; Scaffold_5 AUGUSTUS stop_codon 910198 910200 . + 0 transcript_id "g187.t1"; gene_id "g187"; # protein sequence = [MGSVATVHARHIFDLDPLRAGQYFWVVPVDGTGSNSSLLAMQIQTIFPNNASVEAAEAALQPFIDDASNITDVQVETA # CEEQLINDMLFAADDSVGTNIILGSRLFSESLYETSPEAIGDIMALNPAWRTAKTHVRFRLYKLYHILLFHFGSKVFLAHEWADSATIPDVIATQHAF # SSGYERAALVGLAGEDSGSYTNEGDRFEPNLQVTFYGSTENYEKLEQVKSAYDPEDLFLVTAGVGDERWSGGICRLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g187 ### # start gene g188 Scaffold_5 AUGUSTUS gene 913414 913893 0.27 - . g188 Scaffold_5 AUGUSTUS transcript 913414 913893 0.27 - . g188.t1 Scaffold_5 AUGUSTUS stop_codon 913414 913416 . - 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_5 AUGUSTUS CDS 913414 913893 0.27 - 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_5 AUGUSTUS start_codon 913891 913893 . - 0 transcript_id "g188.t1"; gene_id "g188"; # protein sequence = [MDVQLPSGFLKTELCGTCVIAAGRTQVPVIPSQLILSSPQPRPHMSSTSTYIDAMAQQNPQANLAKLALDQANARSEA # AQKRMLPKSSRAPTVPLTTDSLSTVRNEASDGSRIRTVIFPAVTKNHKIVEVASLGIFDNTLRPDILFQGQELYFFLQLTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g188 ### # start gene g189 Scaffold_5 AUGUSTUS gene 925495 926407 0.33 - . g189 Scaffold_5 AUGUSTUS transcript 925495 926407 0.33 - . g189.t1 Scaffold_5 AUGUSTUS stop_codon 925495 925497 . - 0 transcript_id "g189.t1"; gene_id "g189"; Scaffold_5 AUGUSTUS CDS 925495 925969 0.84 - 1 transcript_id "g189.t1"; gene_id "g189"; Scaffold_5 AUGUSTUS CDS 926026 926283 0.62 - 1 transcript_id "g189.t1"; gene_id "g189"; Scaffold_5 AUGUSTUS CDS 926376 926407 0.44 - 0 transcript_id "g189.t1"; gene_id "g189"; Scaffold_5 AUGUSTUS start_codon 926405 926407 . - 0 transcript_id "g189.t1"; gene_id "g189"; # protein sequence = [MAQGFRASFTARRAADPSSTMVEPGENFVSGWDDMIDLKSKSPTPRSPTSTASMRSGTSPVNYPSSPTPPPHSPPPIP # DKTLRSLVPSSNPVRTSTTSFPWTSVTSYSPPHVYKPLPRSVGDKALRETPQVPVKLNAPQSVPDDVQSTISSIFDAAWPQPPCSPPPFTPRVGHQSP # AYSDTVFGEHDGPFDRVRNYARPFRGPGVRPVPDSVKHLDATSRATSPTLNKARKYLRAGSHPPSNEAIFMTVVQETT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g189 ### # start gene g190 Scaffold_5 AUGUSTUS gene 928868 930388 0.6 - . g190 Scaffold_5 AUGUSTUS transcript 928868 930388 0.6 - . g190.t1 Scaffold_5 AUGUSTUS stop_codon 928868 928870 . - 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_5 AUGUSTUS CDS 928868 930388 0.6 - 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_5 AUGUSTUS start_codon 930386 930388 . - 0 transcript_id "g190.t1"; gene_id "g190"; # protein sequence = [MNILERAHSLSNLNHNSSIEKGKGSPVATKTPQDIHGSDDDEVEVAGPTDGEYETESESSRTEGNGSPRRSAFTPRAN # DDDGGQNPGLNSDYAERRPLAHHPAKARSWYEFDLAVVAALVSPVGQWLTGGDHIKNLLFVLLLVFYLHQIIESMCIASSHKFASVHPFSSVPWTLYY # NARPRVRPHSTSLPAAEDFYTRRASSELRFLEFLFFSFAVVSPFLGAYLLRYVTFSVTGQDIHSWFSIGLFILATGVRPWSHLIQRFNQRVTDLHDIV # HYHSSVKEGSSEGIVEMKQQLERLHEQMQDMEKLITKLKKKLAKETNEVYDYVDEQVDSVEKIVKRHEKALEYVLQLPASLLGSHPSKSSIKSLSPNG # SPSPATYKHLLRSPSHPGASSPVLTKLETIPELMEIHTDRQKSNNTLIRPKTVVVKSPPTSPGSTVQPIISRPFFVMVSIMTLPILFFVHVLYATTLP # FRWCLRVFLRLVGLEKIVFRLYDEYSSSFRVYLKLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g190 ### # start gene g191 Scaffold_5 AUGUSTUS gene 944134 945286 0.49 - . g191 Scaffold_5 AUGUSTUS transcript 944134 945286 0.49 - . g191.t1 Scaffold_5 AUGUSTUS stop_codon 944134 944136 . - 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_5 AUGUSTUS CDS 944134 944988 0.79 - 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_5 AUGUSTUS CDS 945173 945286 0.52 - 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_5 AUGUSTUS start_codon 945284 945286 . - 0 transcript_id "g191.t1"; gene_id "g191"; # protein sequence = [MCTIPLGIYIIYIDLKGIPLAPWISWDDTHFDFGRVVLREDQETGKGRVANLLGTCLYIFLWLSNSFDLLFRLNKFKL # NSDDADSLPVYVASAGPVIPSAREKARKSFTEADSRSTICFPDDDDVELGPYRKSFSTRTSHDVPCSPSSSTSTYSPATPRTPMASSTAPPPYIDSEH # LDAAAAALSKCEDDTRLHSSREASWVTLPDMIVEEISRPSSYSHSSMISHREAQEDEDDISITDAYMDSRPTSPVMHHVYTQAPTPVPFVPSELPVPP # PPALSFHRPFSPPSVYPITHPHITSHANDSTGIIVTVHTQSSRESLSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g191 ### # start gene g192 Scaffold_5 AUGUSTUS gene 951279 952406 0.93 - . g192 Scaffold_5 AUGUSTUS transcript 951279 952406 0.93 - . g192.t1 Scaffold_5 AUGUSTUS stop_codon 951279 951281 . - 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_5 AUGUSTUS CDS 951279 952406 0.93 - 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_5 AUGUSTUS start_codon 952404 952406 . - 0 transcript_id "g192.t1"; gene_id "g192"; # protein sequence = [MYASRSPAFAPRQGKDPVFQDLVILKTVQRLLLQARNGSVEALQSLAPEVQEDVDLLIELMPMILLNIPNKNHPLLSS # TPDPNQAPDKTTRLGYTALHVLLRGLNGYRFADGDASELKFMQRWPDIFAWCSFLAVNYLERPTYFLDQGDDFKEELQLTITMLSWLLTLPASGVVSI # VTTTPGCISLIARLYLLAARMSLTTEESLLFAGRALQNLLQLPQSAWDPEFTNELDKTHPSVVNDILYRVIKDTERRPMNCPALKGGFIILSNICRSP # VLNRLLIRKDAVYWICRAIHKLVVNPAMVEKENIKMATGTIKMGCHYLLEAISQQGYECVVQAVNFRLLSSMLRSTAMVEDDLTTENPNPPIPYSRST # VGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g192 ### # start gene g193 Scaffold_5 AUGUSTUS gene 954606 955064 0.96 + . g193 Scaffold_5 AUGUSTUS transcript 954606 955064 0.96 + . g193.t1 Scaffold_5 AUGUSTUS start_codon 954606 954608 . + 0 transcript_id "g193.t1"; gene_id "g193"; Scaffold_5 AUGUSTUS CDS 954606 955064 0.96 + 0 transcript_id "g193.t1"; gene_id "g193"; Scaffold_5 AUGUSTUS stop_codon 955062 955064 . + 0 transcript_id "g193.t1"; gene_id "g193"; # protein sequence = [MSLENLGYLQLATLPLSLFSKIPQITANYKAKSTGQLSAFAVLSQIIGCAVRVYTTSTEVGDPVVQAGFGLALFLNVI # LGIQMMSYWGNIPPATKKKVAVEKKKVAPAEVELLDETLSQDYFLSNGRQRRSKPMQRVDHAEGSSRKWERKVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g193 ### # start gene g194 Scaffold_5 AUGUSTUS gene 961705 963774 0.68 - . g194 Scaffold_5 AUGUSTUS transcript 961705 963774 0.68 - . g194.t1 Scaffold_5 AUGUSTUS stop_codon 961705 961707 . - 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_5 AUGUSTUS CDS 961705 963774 0.68 - 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_5 AUGUSTUS start_codon 963772 963774 . - 0 transcript_id "g194.t1"; gene_id "g194"; # protein sequence = [MRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIIS # RLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSSDLQEHRRVVREVLI # RLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPAPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTRKDISFTWMDTQQQA # FDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDH # SNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRINTQADALSRMAAHQVLDNEDNRQQTVLKPNHFTKIAASILRNPLEDRIRKASQREAQVLEG # LKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCETCARKKIQRHP # RAVTQPLDVPLGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHALPCTSSITAEGVADIYYKEIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLG # IKSDLTSGYPRSLMVKLNAPTKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g194 ### # start gene g195 Scaffold_5 AUGUSTUS gene 965482 965862 0.69 - . g195 Scaffold_5 AUGUSTUS transcript 965482 965862 0.69 - . g195.t1 Scaffold_5 AUGUSTUS stop_codon 965482 965484 . - 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_5 AUGUSTUS CDS 965482 965862 0.69 - 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_5 AUGUSTUS start_codon 965860 965862 . - 0 transcript_id "g195.t1"; gene_id "g195"; # protein sequence = [MSTPIPPATPAPPASAEDLMTQLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS # QAKLIKSALGFFTESAVTGQPRICYISMRNIPLWRKLGGVPERVWSTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g195 ### # start gene g196 Scaffold_5 AUGUSTUS gene 986477 986881 1 + . g196 Scaffold_5 AUGUSTUS transcript 986477 986881 1 + . g196.t1 Scaffold_5 AUGUSTUS start_codon 986477 986479 . + 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_5 AUGUSTUS CDS 986477 986881 1 + 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_5 AUGUSTUS stop_codon 986879 986881 . + 0 transcript_id "g196.t1"; gene_id "g196"; # protein sequence = [MGQLNAQNRSAEDYIATFDPTTSKITRLELQNYHGDQPISVHGMDVVPSSTNPNELFVYLVNHRAPPREQDPETVGAD # SVIEVFKTTVSGNQLVHIKTVRDPNVISTPNDVAGDADGKGFYFTNDHGFKVSHVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g196 ### # start gene g197 Scaffold_5 AUGUSTUS gene 1002565 1003236 0.86 - . g197 Scaffold_5 AUGUSTUS transcript 1002565 1003236 0.86 - . g197.t1 Scaffold_5 AUGUSTUS stop_codon 1002565 1002567 . - 0 transcript_id "g197.t1"; gene_id "g197"; Scaffold_5 AUGUSTUS CDS 1002565 1003236 0.86 - 0 transcript_id "g197.t1"; gene_id "g197"; Scaffold_5 AUGUSTUS start_codon 1003234 1003236 . - 0 transcript_id "g197.t1"; gene_id "g197"; # protein sequence = [MRGVCIAEGDILAISISKSSPIYHASLYSATFTGLISELLQGKYCLPEPKYPDCLLYKHEQGLWKEARDRYSKLSGTH # RSEEFNNAILPLCRPLAEFIGHRMAYEAAVDQGVDPALVELYEAGVIKLDSSWYVENGLLSRAEQFDLESVAANKVLPDLERFLDLLDVAEYATAPIL # SGKSWNEFVVSLPQFLGNSEPLEELRGDSPKPTSMSETVYRKFLFWR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g197 ### # start gene g198 Scaffold_5 AUGUSTUS gene 1013927 1015775 0.07 + . g198 Scaffold_5 AUGUSTUS transcript 1013927 1015775 0.07 + . g198.t1 Scaffold_5 AUGUSTUS start_codon 1013927 1013929 . + 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_5 AUGUSTUS CDS 1013927 1014048 0.36 + 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_5 AUGUSTUS CDS 1014105 1014366 0.33 + 1 transcript_id "g198.t1"; gene_id "g198"; Scaffold_5 AUGUSTUS CDS 1014408 1014666 0.73 + 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_5 AUGUSTUS CDS 1014757 1014893 0.94 + 2 transcript_id "g198.t1"; gene_id "g198"; Scaffold_5 AUGUSTUS CDS 1015041 1015775 0.52 + 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_5 AUGUSTUS stop_codon 1015773 1015775 . + 0 transcript_id "g198.t1"; gene_id "g198"; # protein sequence = [MLSVDYKLTGMTIGLRPSMIKFIGAPSTKLEIAQVFDKPTPFYLNRPLIVLLEGLGVPFETFKYYQDLAVKEAQEAMH # SLESASYFFQVQGIGGSFRLPTVMTLLSKIGYTMLKDDFFERVLDLGVKHMPTTSGVTHYAHEARIPVPGAYNLVGIADINQELGPNEISVCIMEKNS # GKLKYLSGPCLVSRSPSIHPGDIQLVNAIFPKATSALRRDRPVPSALGGGDLDGDEYDIIPLDILPKFRISQSQIQKPSLYKPAVALTWRVLADSSPR # GILDNECLRLADLHSQAVDYPKTGNPVSFYSIPRKTKYNNRLPDWYAPESMEVIDEQKYYRSTRALGKLFRDIDLSSGSEISSSGHHTDLQEQEELSL # DQLTTLMSTTSISGSEFGDILRVIESYVAQFIEGNEEHDNNSELHGMFVQYCADLQIICSMHNLNRSKSYLLSEEEAVAGTILYNAEVSTAVRNDHIR # KLREETNISSRVFTICCMGPTSHRAVPCAGILFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g198 ### # start gene g199 Scaffold_5 AUGUSTUS gene 1017431 1018093 0.5 + . g199 Scaffold_5 AUGUSTUS transcript 1017431 1018093 0.5 + . g199.t1 Scaffold_5 AUGUSTUS start_codon 1017431 1017433 . + 0 transcript_id "g199.t1"; gene_id "g199"; Scaffold_5 AUGUSTUS CDS 1017431 1018093 0.5 + 0 transcript_id "g199.t1"; gene_id "g199"; Scaffold_5 AUGUSTUS stop_codon 1018091 1018093 . + 0 transcript_id "g199.t1"; gene_id "g199"; # protein sequence = [MWEATVRSEWNGKEGGWADILPVSASISSTLNPQSIADNTGDASSDSDGVNNHNTTSSPALGTNSMASRLRSAPAASA # RVAVGIWRLISPGSHHPSQSDHNFSASHNAHPLVETKAHQTLPHAEMSVPTHVEVAVLIAMPGALAVAAHRSKEGADEEDLPHVEVGMAEVIIPLIPQ # LHTSLKRDLPVKSSHRACNDSIVMLFLLRTVPVLYDIFRKCILL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g199 ### # start gene g200 Scaffold_5 AUGUSTUS gene 1024092 1026440 0.33 - . g200 Scaffold_5 AUGUSTUS transcript 1024092 1026440 0.33 - . g200.t1 Scaffold_5 AUGUSTUS stop_codon 1024092 1024094 . - 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_5 AUGUSTUS CDS 1024092 1026440 0.33 - 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_5 AUGUSTUS start_codon 1026438 1026440 . - 0 transcript_id "g200.t1"; gene_id "g200"; # protein sequence = [MIIDNVPSSTMWNIFFDLKIDRGTYSTLTAHCEKLCQTSRSQSDWANSSYGSVLKFSTLHTLEEARRHWQLYVEMESL # PSDRQKFLRDAFAKQSQEASEKSKGTIFSSARAAGPLMLMASSVYSEHMKHYARTGVSSTDPRVVTAATMINPTFAYSFVGEGCNVHYGTSPLTPFPS # AALFGNATRALGMKDVVVSAQKQFGEWSDAFYTRVSSQPGSVALRFILSEATALCRAFRDLNDNHRIQTVTPISQWKATMLTFDSAQYSATGSLLSCA # PTIFNVIDTSNLVDHVGYLNILVSTIPLRTVDGTIYTESLLYKGEDATKELTEQLFSDLGTVSLLLGVAPIDYLSNFFTRSNTHEIMLHNFADGGQFH # QVTTWKSPMSADVPVDVQPSVTFDTMQLGTFLWDMYHRMFEEEDAMTYWAKHGANLKAISKSSLISYNRESFVLFLRLARSNLGLSVEDWGSVMERFL # DLQEGDTTMPMDTVNRQDFHSHLYRYGVYTVPTYRGSLSRVGRFSQWSSVPQLVRIILTVPRSVLEEVFAESPNMATQTPILQCHVSGLWSMNAFSAV # HAAFGRVSTLGSKASPRLSFEEDRDGLKGRSPLVVSFTMPTQLLVNIEPQDQLKVNFSIRSTGASVMFTKKLGMNLNVYSAALLDETQVQVLPESLSP # SKISTPVFSKIPQHIGPSRPVVASFNEECEVVNWLSTRIDIQNPDVIHSYGSLGAIPEIKQLSPCTARITVSGISQMVIFPVPIRGKDNRLRLARKSL # WIEVSAILNVRCQSLKQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g200 ### # start gene g201 Scaffold_5 AUGUSTUS gene 1031354 1033600 0.82 - . g201 Scaffold_5 AUGUSTUS transcript 1031354 1033600 0.82 - . g201.t1 Scaffold_5 AUGUSTUS stop_codon 1031354 1031356 . - 0 transcript_id "g201.t1"; gene_id "g201"; Scaffold_5 AUGUSTUS CDS 1031354 1032269 0.99 - 1 transcript_id "g201.t1"; gene_id "g201"; Scaffold_5 AUGUSTUS CDS 1032456 1033600 0.83 - 0 transcript_id "g201.t1"; gene_id "g201"; Scaffold_5 AUGUSTUS start_codon 1033598 1033600 . - 0 transcript_id "g201.t1"; gene_id "g201"; # protein sequence = [MTYLGVSDGGHGNIYMRSNNAMFTATHAVFDEKLFPRCKSSERHRSTRLPDRNPDPKDPIPPPGDDDVPIFHQPTTPQ # MRQDPEQDVAPPVPAEQPARDPSPPPQPRNEQPPAQEQLRRSGRVRRPPTRLTGDPRSSTKLPTEQQVERPKRDIQRRAPQPGSSSAEQERPEPEQVP # GPSTEHPTPENGEQPSVTPGDEANTLIRLCREGGAELIYFLMAKAVPFEGELKSSENVREWTYKDITRLPKAEREEWLKACQEELEALKRRGTFELMD # RPADRKVIKNRWVFDIKSDGRKKARLVVKGFSQIEGLDYDQVFSPVVRFETVRLLLALTALNNWYLTGLDVRNAYLYGVLHETIYMEQPEGFRIKGKE # DKVLLLRKALFPKGKFMSHWECRDLGEAKEFLRMRINRRGKKIYIDQCAYLDKVLKRCGMENAKMADTPLPAGFQPEPTKGQSNSALRSKFQMVIGSL # LYLMLGTRPDISFAVTKLAQHAANPSQEHLNKALYICRYLLGTRSYALCYDGESGIGLSAWTDSDWASDPYTRRSQTGFFMKLANGIFSWTSHAQKTI # AHSSTEAEYMALSDCSRQVVWIRNLLEELGYKLDAIPIAGDNQGSIFMASNPVTSKHSKHIDIRYHYIREVVERGLVQVFFVDGSNNPADLFTKNLGR # IKFELFRSMLGLEFYSSTNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g201 ### # start gene g202 Scaffold_5 AUGUSTUS gene 1033687 1035163 0.9 - . g202 Scaffold_5 AUGUSTUS transcript 1033687 1035163 0.9 - . g202.t1 Scaffold_5 AUGUSTUS stop_codon 1033687 1033689 . - 0 transcript_id "g202.t1"; gene_id "g202"; Scaffold_5 AUGUSTUS CDS 1033687 1034933 0.9 - 2 transcript_id "g202.t1"; gene_id "g202"; Scaffold_5 AUGUSTUS CDS 1035031 1035163 0.9 - 0 transcript_id "g202.t1"; gene_id "g202"; Scaffold_5 AUGUSTUS start_codon 1035161 1035163 . - 0 transcript_id "g202.t1"; gene_id "g202"; # protein sequence = [MSPVDDVENGSKAPTPPPPSPPMDFEVPGTASFDPDELMNFDLDLAKTCKSAFEPDLLSRLYNYRIDAKYISNEHFCV # HDVSYSVCKKCKGKQRNQPKWWMNDSGCSEHTTFDLSDFIEYEDLEEKVLIATATTTAYITGVGTVLINFKDVRGRMHSARIAPVFYMKELSHRLIAQ # GRFLQDGKTVRGNADKVDFWDKDGLFLSFEPRTHSDTIYILKDYSPQPMAVNLVIHSVDYTTMHRRMGHPSREALTQLRKHAEGVPTFSIPHEEDLCE # GCAKGKMTLRPFPPTNRRASRPFEIIHSDLKEWPTISYHKYKYTIFFIDDYTSHGFYCHLKKKSGALPVIKQFIATVKNLYETNVKEWMSDGGGEFRS # NALDEFFKNEGIKAQWSSPHIHQQNGRAERFIRLYRRKVNHSAFKPVFLIPGGNSLLHTLCMCITALLCVVTNGRHHMRFCTTKFRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g202 ### # start gene g203 Scaffold_5 AUGUSTUS gene 1035276 1036088 0.74 - . g203 Scaffold_5 AUGUSTUS transcript 1035276 1036088 0.74 - . g203.t1 Scaffold_5 AUGUSTUS stop_codon 1035276 1035278 . - 0 transcript_id "g203.t1"; gene_id "g203"; Scaffold_5 AUGUSTUS CDS 1035276 1036088 0.74 - 0 transcript_id "g203.t1"; gene_id "g203"; Scaffold_5 AUGUSTUS start_codon 1036086 1036088 . - 0 transcript_id "g203.t1"; gene_id "g203"; # protein sequence = [MATCGGYWDWSGCSQGMTPSIRILAKEYSDTAKKLWNYLAKTYNVKSLGAVFNDFAAAMAIKIPYKQNPLSSMMEIGM # YFTRMDEAGIGLADHLEALILLSKLPSRYSVVVQTMSQLETAELKKLTFAKVRIAVMNAFSGDTIGNSQPQNANKFSNVHRKGNDPKFSQQQHGNNSN # QQQKGQNGNDDNKKKRKRGSGKNKKAKKNANAAQADADSMDFSPIGSTVDFGPVRTDLTPSVQDVRKHSIHPPYNPPPNATSLHLHKDGHQTCP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g203 ### # start gene g204 Scaffold_5 AUGUSTUS gene 1037080 1037400 0.41 - . g204 Scaffold_5 AUGUSTUS transcript 1037080 1037400 0.41 - . g204.t1 Scaffold_5 AUGUSTUS stop_codon 1037080 1037082 . - 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_5 AUGUSTUS CDS 1037080 1037400 0.41 - 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_5 AUGUSTUS start_codon 1037398 1037400 . - 0 transcript_id "g204.t1"; gene_id "g204"; # protein sequence = [MLTFSVDFIQIAMSSALFTAVTTTLKGDNYDTWASEMEAFLQATGLESAITTDQPSEPSPLVVANAASVEAWKNYEVA # FKAWKEIDTKAIGNIRLLISPSVRPGSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g204 ### # start gene g205 Scaffold_5 AUGUSTUS gene 1040542 1040967 0.71 + . g205 Scaffold_5 AUGUSTUS transcript 1040542 1040967 0.71 + . g205.t1 Scaffold_5 AUGUSTUS start_codon 1040542 1040544 . + 0 transcript_id "g205.t1"; gene_id "g205"; Scaffold_5 AUGUSTUS CDS 1040542 1040599 0.72 + 0 transcript_id "g205.t1"; gene_id "g205"; Scaffold_5 AUGUSTUS CDS 1040693 1040967 0.71 + 2 transcript_id "g205.t1"; gene_id "g205"; Scaffold_5 AUGUSTUS stop_codon 1040965 1040967 . + 0 transcript_id "g205.t1"; gene_id "g205"; # protein sequence = [MFDSLNDFRDFVAGAPFLGTGCGGPVIPFSAGRVDATEAGPETVPEPQQDLASHTEAFRRQGFTPTEMISLVACGHTL # GGVRQVDFPLVVTNTEDFLQTFDTTTNFDNAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g205 ### # start gene g206 Scaffold_5 AUGUSTUS gene 1041458 1042126 0.85 + . g206 Scaffold_5 AUGUSTUS transcript 1041458 1042126 0.85 + . g206.t1 Scaffold_5 AUGUSTUS start_codon 1041458 1041460 . + 0 transcript_id "g206.t1"; gene_id "g206"; Scaffold_5 AUGUSTUS CDS 1041458 1042126 0.85 + 0 transcript_id "g206.t1"; gene_id "g206"; Scaffold_5 AUGUSTUS stop_codon 1042124 1042126 . + 0 transcript_id "g206.t1"; gene_id "g206"; # protein sequence = [MLWADRQGSSCSSTGCTSPSTHFVQVFLGLIGDIQGLTADRYAFNATINATTSISKFWFEINENDGSDPVIVDNGGYS # FAIGQDSVFIDNSRSEFVIFSSSLINYQKVVMAVCNSTLHLSTRLKSSLFLVNQVRGDASSSVSITTFDPHTNASTPPYLPTIITTNLQLDDSNPAEG # GFTFFTVNVSSTVTFLNISGNVGGVSYTQENFDMTAVDFTFVSISQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g206 ### # start gene g207 Scaffold_5 AUGUSTUS gene 1044563 1046706 0.69 + . g207 Scaffold_5 AUGUSTUS transcript 1044563 1046706 0.69 + . g207.t1 Scaffold_5 AUGUSTUS start_codon 1044563 1044565 . + 0 transcript_id "g207.t1"; gene_id "g207"; Scaffold_5 AUGUSTUS CDS 1044563 1046414 0.7 + 0 transcript_id "g207.t1"; gene_id "g207"; Scaffold_5 AUGUSTUS CDS 1046504 1046706 0.8 + 2 transcript_id "g207.t1"; gene_id "g207"; Scaffold_5 AUGUSTUS stop_codon 1046704 1046706 . + 0 transcript_id "g207.t1"; gene_id "g207"; # protein sequence = [MSYLTQTALTPSRPAPKPNDNNAMYTPNTSSSSTSAALSSSGYNSALSYSPSTPAPSSSAYNAYNSNYSGIGGVPSAQ # GSTPSRMNSVDSSATGSSNGLGGGGGGGYGSGSGMSSPGLQSLSSYNSSSNLRRTGTSATDDASIIRSGYASVKEDGTFASWIWKVKWLVLKEQTLTF # HKSESSYTPQTTIPLKDVSNIERTDLKPYCLLLEAAPNKRFFLSLKNDEELYSWQDEIYSRTPLSSFSQPTNFVHKVHVGFDPISGAFTGMPEQWSKL # LTKSAITREDYAKDPQAVLDVLEFYTDGLKKREMEEMGMGVGVSLGGLSTANANAAASSSSLGLASPARFNAGTGLGGASTNTPTTPLSSAAARAADI # VANGATSSLSPQRTPLVAPPGALQASRPAPPRPLLTGQRTAPAAPGLGASGTATSGHAHTPSSADLRARQKAVGPREPGSAAPPPRGDSLASAEIREK # EELEKAQQERRDRAEQDKRDRERERETERERERERDRREKERRDRDRAERAERAERVERIERERAEALEAQQQQQQQLSDPSTTQPISTSRSRDRTPE # PPAGARPPANPLGGTGSAKSTPANVGGAAPPVKPLQPAKKVQIEDGGRKAGVAAAAAALNGSSANGTTGTNGTAKVEKEKRISTMTEVQIMAKLRSVV # SDEDPKTLYSKIKKVGQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g207 ### # start gene g208 Scaffold_5 AUGUSTUS gene 1060579 1061502 1 - . g208 Scaffold_5 AUGUSTUS transcript 1060579 1061502 1 - . g208.t1 Scaffold_5 AUGUSTUS stop_codon 1060579 1060581 . - 0 transcript_id "g208.t1"; gene_id "g208"; Scaffold_5 AUGUSTUS CDS 1060579 1061502 1 - 0 transcript_id "g208.t1"; gene_id "g208"; Scaffold_5 AUGUSTUS start_codon 1061500 1061502 . - 0 transcript_id "g208.t1"; gene_id "g208"; # protein sequence = [MSASTGEAELRQNSHSENSATSPEHQSSPNSWTLGDRTLNDHSRAKSPHQTASEEPEGHDQSDKDSLQGSTEKSKPKD # KVKANATAEKFKGKEKAIEKEKVTSPQKKPMPNRRSSTRLQTNDNSSLSILSDDDDPSPPSSECLPDDQAAIADALKVQILGKKRSTAVVASALNRNT # LALGGHQLELVEIQRKNEERVRGEIGELRVRVDALEVSGLGAHVDESVISDGSGSPKVPAASLLRDIRTRIKALEGNNHLLKDGVDWKRTLDKEFRTL # KDKVEVYEGFRKLSPSQRMSWRYAHTPQRSLRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g208 ### # start gene g209 Scaffold_5 AUGUSTUS gene 1063139 1063618 0.66 - . g209 Scaffold_5 AUGUSTUS transcript 1063139 1063618 0.66 - . g209.t1 Scaffold_5 AUGUSTUS stop_codon 1063139 1063141 . - 0 transcript_id "g209.t1"; gene_id "g209"; Scaffold_5 AUGUSTUS CDS 1063139 1063618 0.66 - 0 transcript_id "g209.t1"; gene_id "g209"; Scaffold_5 AUGUSTUS start_codon 1063616 1063618 . - 0 transcript_id "g209.t1"; gene_id "g209"; # protein sequence = [MEKSDPQASLQSCPQCRLAFYCSDEHWGPVAFNHMSAPCEDGYGGLSQCELNQNLKVDARFARIMGSASGPVRIFQWA # PERLRTRWNPLPEEGDWDKEYGDELRSMAGGGGPPLGPFLRGSSEGLSFPLTILYALQNLNNDDVWTQRKSLTIHVSVGHC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g209 ### # start gene g210 Scaffold_5 AUGUSTUS gene 1065756 1066181 0.92 + . g210 Scaffold_5 AUGUSTUS transcript 1065756 1066181 0.92 + . g210.t1 Scaffold_5 AUGUSTUS start_codon 1065756 1065758 . + 0 transcript_id "g210.t1"; gene_id "g210"; Scaffold_5 AUGUSTUS CDS 1065756 1066181 0.92 + 0 transcript_id "g210.t1"; gene_id "g210"; Scaffold_5 AUGUSTUS stop_codon 1066179 1066181 . + 0 transcript_id "g210.t1"; gene_id "g210"; # protein sequence = [MVELWSLLHYLYPSVFTPNTQQLFETSFDLTKGTYSLPFVNAAQKLLSTVMIRRTKANVDIDVPAREEQTIFIPLTEI # QRFWMYRMITRLDSVNFREIFDATMELQDNGAQDGRKEVLSLLEDSSNRAGKETKRKQAAFDY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g210 ### # start gene g211 Scaffold_5 AUGUSTUS gene 1067211 1067690 0.79 + . g211 Scaffold_5 AUGUSTUS transcript 1067211 1067690 0.79 + . g211.t1 Scaffold_5 AUGUSTUS start_codon 1067211 1067213 . + 0 transcript_id "g211.t1"; gene_id "g211"; Scaffold_5 AUGUSTUS CDS 1067211 1067690 0.79 + 0 transcript_id "g211.t1"; gene_id "g211"; Scaffold_5 AUGUSTUS stop_codon 1067688 1067690 . + 0 transcript_id "g211.t1"; gene_id "g211"; # protein sequence = [MGSDNPTSSSSETSDMSSGALLDILRKGSSALLPGAEMKLSKFLQAPIAEILSLSKAREDARDAKLEQTLRTAKSNPD # VHAQQLLKDAEDEEQRLLSGAAQVRCHLFEGQMLQRGTSSSNKQIADEWTNLQKRASKSRETVVLNGMTFVVIPPPVDQEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g211 ### # start gene g212 Scaffold_5 AUGUSTUS gene 1070070 1070393 0.71 - . g212 Scaffold_5 AUGUSTUS transcript 1070070 1070393 0.71 - . g212.t1 Scaffold_5 AUGUSTUS stop_codon 1070070 1070072 . - 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_5 AUGUSTUS CDS 1070070 1070393 0.71 - 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_5 AUGUSTUS start_codon 1070391 1070393 . - 0 transcript_id "g212.t1"; gene_id "g212"; # protein sequence = [MVQDTTTGKLEEAQASSYHDANHNLYSNTSNKIKSRGNMQQGATAVSQIDPYKPNEFEKYQPEPQIDPMDTFGYIRCH # CKNSAEADVSVDELLNISTWPTAHGHYVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g212 ### # start gene g213 Scaffold_5 AUGUSTUS gene 1075962 1076774 0.68 - . g213 Scaffold_5 AUGUSTUS transcript 1075962 1076774 0.68 - . g213.t1 Scaffold_5 AUGUSTUS stop_codon 1075962 1075964 . - 0 transcript_id "g213.t1"; gene_id "g213"; Scaffold_5 AUGUSTUS CDS 1075962 1076774 0.68 - 0 transcript_id "g213.t1"; gene_id "g213"; Scaffold_5 AUGUSTUS start_codon 1076772 1076774 . - 0 transcript_id "g213.t1"; gene_id "g213"; # protein sequence = [MTNGLALPLKMDGLPPPAKPEGVMDTMASWGVKYDTARERLSEKNIERRRRALESIKQAGIEPPSRSMGLLGTGSPMS # SRPGLRPPSTSTGRSASSSASSSSGFKSMASSAFNTVNDLRLQMEVRNERIEQQRNASLFNSGRGNGGLGGLLGPKMTRMEQKVADADLLEHWGAEKF # LWIVVMASDKGKVIVVNIFFWRSSLLIHYTRIDEEIADISIAEDPANEEHIDDKTWRERMAFERDEMELEDFEESEHRQQQENSAGTQASGSRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g213 ### # start gene g214 Scaffold_5 AUGUSTUS gene 1078598 1079617 0.97 - . g214 Scaffold_5 AUGUSTUS transcript 1078598 1079617 0.97 - . g214.t1 Scaffold_5 AUGUSTUS stop_codon 1078598 1078600 . - 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_5 AUGUSTUS CDS 1078598 1079617 0.97 - 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_5 AUGUSTUS start_codon 1079615 1079617 . - 0 transcript_id "g214.t1"; gene_id "g214"; # protein sequence = [MLALLDSSESKLSSKLNKFGRGVGSVFLKIPLPVVNPIASTIIHAISDKPPAISPSGREGDPIKNSVLRRRVAMTEGF # ALSLNIDDIPPPVKPDGVMDTMASWGVRFDTAIEKFSEKNNERRRRALQSIKEANIEQPSSSIRLLETGSPTSSSASLPRPPSNTGRSGISSTSSTGF # KNMASSALNTVNDWRLQREVYFEQQNTVLRNSRLGNVGLLGHKKSRMEQKVADADLLEHWVRRKFFWVVIMASDKGKAIPFNLVIPQSLALIHYVCSS # LVLFHIDEGIENIGIAEDPADEEQIDDRTWRERMAVERDEMELEDLQKLQQQETHASVHASEGNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g214 ### # start gene g215 Scaffold_5 AUGUSTUS gene 1085087 1085853 0.47 - . g215 Scaffold_5 AUGUSTUS transcript 1085087 1085853 0.47 - . g215.t1 Scaffold_5 AUGUSTUS stop_codon 1085087 1085089 . - 0 transcript_id "g215.t1"; gene_id "g215"; Scaffold_5 AUGUSTUS CDS 1085087 1085637 0.97 - 2 transcript_id "g215.t1"; gene_id "g215"; Scaffold_5 AUGUSTUS CDS 1085727 1085853 0.47 - 0 transcript_id "g215.t1"; gene_id "g215"; Scaffold_5 AUGUSTUS start_codon 1085851 1085853 . - 0 transcript_id "g215.t1"; gene_id "g215"; # protein sequence = [MPILTWCEPVVGQPLNAYQLSPNELPLTLPHRQQLLLVSGILRSSVAAFLENGFENPAAHPPNSLGHHLPALANGRAQ # ENAAGATSDATPPNVQDPRAVSTPTAQCDHSTAALSASNDADSPPHLPLKKKRSEMGQAEKAAARKAALARAEKLSLDLEGLLISQNELRAKVAEENN # VTVARVATLLNQVSARSSTKKASDYNVLVFLKTQELNASKCCPMLAISL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g215 ### # start gene g216 Scaffold_5 AUGUSTUS gene 1086121 1086537 0.83 + . g216 Scaffold_5 AUGUSTUS transcript 1086121 1086537 0.83 + . g216.t1 Scaffold_5 AUGUSTUS start_codon 1086121 1086123 . + 0 transcript_id "g216.t1"; gene_id "g216"; Scaffold_5 AUGUSTUS CDS 1086121 1086537 0.83 + 0 transcript_id "g216.t1"; gene_id "g216"; Scaffold_5 AUGUSTUS stop_codon 1086535 1086537 . + 0 transcript_id "g216.t1"; gene_id "g216"; # protein sequence = [MTKVHTNELSILEIPKSPTPLLPSQRITPEARAARLALIEEAQSEAEPDHAHARPNLTAAADDVFRRAAAEQAVKAAT # GKLKAFHLAQQLMLLLCSALQAMVAARSQAQHDLDNADGNLSYAFEQVTQSFSEQPAFQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g216 ### # start gene g217 Scaffold_5 AUGUSTUS gene 1098776 1099597 0.24 - . g217 Scaffold_5 AUGUSTUS transcript 1098776 1099597 0.24 - . g217.t1 Scaffold_5 AUGUSTUS stop_codon 1098776 1098778 . - 0 transcript_id "g217.t1"; gene_id "g217"; Scaffold_5 AUGUSTUS CDS 1098776 1099439 0.24 - 1 transcript_id "g217.t1"; gene_id "g217"; Scaffold_5 AUGUSTUS CDS 1099491 1099597 0.55 - 0 transcript_id "g217.t1"; gene_id "g217"; Scaffold_5 AUGUSTUS start_codon 1099595 1099597 . - 0 transcript_id "g217.t1"; gene_id "g217"; # protein sequence = [MFSKGPVLALVLLVRSSSGYRQPYEYLEALDVFGAAFSNPAGVFNGSTPSPLSSDVVGRIDVITTFVGQDLNAEFLFG # LFYQDTLLDTTTQLIGIPSGMTIQSAVVEPPVVAVSYISDMAFPTVNLSIPLQIDMFMAFDDDSMKVVSYDAILRRIDELMAYTAPYLAPQIAEELNS # TSTNVTELIQLKTAADVCAVSSLYCTGEFQQYDSQDACLTFMEALPFGESWQGGMNTGWCRYIHKSMFCFGSFHFFMGLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g217 ### # start gene g218 Scaffold_5 AUGUSTUS gene 1115568 1115954 0.97 - . g218 Scaffold_5 AUGUSTUS transcript 1115568 1115954 0.97 - . g218.t1 Scaffold_5 AUGUSTUS stop_codon 1115568 1115570 . - 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_5 AUGUSTUS CDS 1115568 1115954 0.97 - 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_5 AUGUSTUS start_codon 1115952 1115954 . - 0 transcript_id "g218.t1"; gene_id "g218"; # protein sequence = [MPASSLHLPGDGLAELDFKYNDDNDNSDITSVTLAQSQILKTVKPVRPSSSATSSIFTSTLRESQSGDGCSYDENSRV # PGEELVTGNKKVNGYDRYDLPPLANDLIAEAQNERRYRLLLVHEFHPSRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g218 ### # start gene g219 Scaffold_5 AUGUSTUS gene 1116986 1119958 0.53 - . g219 Scaffold_5 AUGUSTUS transcript 1116986 1119958 0.53 - . g219.t1 Scaffold_5 AUGUSTUS stop_codon 1116986 1116988 . - 0 transcript_id "g219.t1"; gene_id "g219"; Scaffold_5 AUGUSTUS CDS 1116986 1117970 0.98 - 1 transcript_id "g219.t1"; gene_id "g219"; Scaffold_5 AUGUSTUS CDS 1118067 1119958 0.53 - 0 transcript_id "g219.t1"; gene_id "g219"; Scaffold_5 AUGUSTUS start_codon 1119956 1119958 . - 0 transcript_id "g219.t1"; gene_id "g219"; # protein sequence = [MPTTPVALGAPDLQTPKVSQAYSQVPMEPFSLSSGISTARPPFPYAASSLLSLSGTRSVSTTASASASSHSLIPGLHG # LPASSSHSSWSQSQSQSVSVDQSNDQSIEAYSWNYNSNNNSEMTSTGKIPPSLSSVQVPPEPVSPKDTSTVIPSVSITPSSRPSTATSSSTASTQIES # SIITESYNAPSSAALQTRSGQIQKSSLPQPPIQLIPTKSSIEASGAMLDAIQRRGNVSVGSSELKASSLETSATSTSICTVTPGATSVESTSTTSAAT # STATSTTASHTTIHPIPPALIPSASSLPPTQVLPTLLSLTRHQAALDAESDYADLRGVMRTALSKGSDVEILKVLGVGLRQARLGRGSVGQLEGLSRG # RSGMGGEEGGIESSGLDAGEMAEAIKTLQRAHEAILERERWEDLQARQQEQEDVSNLAPTQLSHVSQITSQQSLEVKSREVQVQQQDNRPGLESRSSS # SSSSSIKMLSGIKRRMSLQGSRSYSSTAASLGFQTSLNETIIDEEVEGDENVNRGKPEVGKLRSKRGKVGARLMRSKTSSSSSTSSTATTNDSAWSRS # ESGSGSGVSKSSVCGKKYTREKDTLDKEFIESGIDALRRMSRSTAVQSRTKTRSHEEVEDPARYEIDREEKIGVGFFSDVYKGTWRPPSVPSAPLYPY # SAITGISNNGDTFPSLSFYSSYSSRVVAIKVLAETTPRSLFLRETAIWKKLSHPNVLELYGASSASGDPPWFFVSPYMRNGCLVEYLRRNSTSIPHTT # QGGFWDAKVPWGLILPGNSAYGVYEAAGLGGGKSLSRYTESTAGGLGRQVAIQGFDLHMSTATLDSASIGLGLGLGPNAANPPDVSSASPPIPPHLAS # KAYIRGPTRADTSGSGSLEDSIRSAGNADVKNSGSGVENVPKEWDLLRFMHEIAKGMEYLHGQGVLHGDLKASFVTGHAQIADQSLPYVFSLDIGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g219 ### # start gene g220 Scaffold_5 AUGUSTUS gene 1120719 1121669 1 - . g220 Scaffold_5 AUGUSTUS transcript 1120719 1121669 1 - . g220.t1 Scaffold_5 AUGUSTUS stop_codon 1120719 1120721 . - 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_5 AUGUSTUS CDS 1120719 1121669 1 - 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_5 AUGUSTUS start_codon 1121667 1121669 . - 0 transcript_id "g220.t1"; gene_id "g220"; # protein sequence = [MQSADCVTQDRLPQHNHPHRRSLPASLSTTPRHSSPLNPGAHNVNFSPNHKHSASFSGPASPYNSPLSFSSPGREARG # DNTPPCVPGAHQSAPSLGSPFKPSPDKPCRGTGLSLSINTAGGSELTTLSTVSTTSSPVRSPTQTPGLLSPSATLRPEAFPSDDVRTSRVRARSGSAP # KPFTGVGKVTSPNGIPPALAREFILYLTFEKLRNNELAIATSSRASFWRRDEEKLLSPSDSSHSRPWHSMFDTSASSKDRPRRHSVATGTPTKEGKEG # KDNDTTGTVPVEQMENWEITRKVCTTYPFVLLYAHLYCLGSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g220 ### # start gene g221 Scaffold_5 AUGUSTUS gene 1122889 1123455 0.31 - . g221 Scaffold_5 AUGUSTUS transcript 1122889 1123455 0.31 - . g221.t1 Scaffold_5 AUGUSTUS stop_codon 1122889 1122891 . - 0 transcript_id "g221.t1"; gene_id "g221"; Scaffold_5 AUGUSTUS CDS 1122889 1123455 0.31 - 0 transcript_id "g221.t1"; gene_id "g221"; Scaffold_5 AUGUSTUS start_codon 1123453 1123455 . - 0 transcript_id "g221.t1"; gene_id "g221"; # protein sequence = [MQKKYEPEVDENGIHALQPPHARPKLTTTSSTSSSRSSSANRLNRKVTVEDLNTHTIILNATFYPGKPLNAPGLSNHE # ADEEAQDIVKGFLMNHEGLSKDLGKLVASRRVIFGNSFRYLSLPEGSFVHFKLEAIPAVPGCNPECHATALRVKGTPDTFRGKISADLTGFPVIGWDE # PLKKPTSGSKLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g221 ### # start gene g222 Scaffold_5 AUGUSTUS gene 1124516 1126063 0.22 + . g222 Scaffold_5 AUGUSTUS transcript 1124516 1126063 0.22 + . g222.t1 Scaffold_5 AUGUSTUS start_codon 1124516 1124518 . + 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_5 AUGUSTUS CDS 1124516 1124918 0.71 + 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_5 AUGUSTUS CDS 1124993 1125327 0.29 + 2 transcript_id "g222.t1"; gene_id "g222"; Scaffold_5 AUGUSTUS CDS 1125737 1126063 0.91 + 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_5 AUGUSTUS stop_codon 1126061 1126063 . + 0 transcript_id "g222.t1"; gene_id "g222"; # protein sequence = [MSAPIISPEALPSTPAHEWANETLNSVPSDSAVSTSTSTPVSSSTATTPGLDFPGAYPKTPSTQLPVGVNELADRARV # AASTAAAGVGDAVNALPAVETISGSVAGGFDGVKEVLFNATVTASQYLPSNVVEYFPSTAERDAQRISLPSTEHSVDPNPSSQGVGSLPGPSSEAGVA # SLPFERELSSNDSEESKIDEKGIESRNSLANASMVAQDGSSAPTPTTLRTPVQYESTSSHFTENLNQEVPDTQTSSTAIDADIPVPNVPPIVTIPPIP # NVSPPSTKPVDSMSSISPHSPQNDSTIANVGHDKLTSGTPEIPSPNVGATPSACVSGSCESREANLRTVICILDLDPVFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g222 ### # start gene g223 Scaffold_5 AUGUSTUS gene 1133190 1133582 0.81 - . g223 Scaffold_5 AUGUSTUS transcript 1133190 1133582 0.81 - . g223.t1 Scaffold_5 AUGUSTUS stop_codon 1133190 1133192 . - 0 transcript_id "g223.t1"; gene_id "g223"; Scaffold_5 AUGUSTUS CDS 1133190 1133582 0.81 - 0 transcript_id "g223.t1"; gene_id "g223"; Scaffold_5 AUGUSTUS start_codon 1133580 1133582 . - 0 transcript_id "g223.t1"; gene_id "g223"; # protein sequence = [MELESADCLASLVSSQLTLEEIRDITFARKGKTREDNPATDEEIAFKLFEEENAAVVGSLRLAFSLQHALDVDQAILA # KLSVEELGAVDDHRYAQALSLGQALPDKSDAQKALEDSAVDSEVWVKVVFQE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g223 ### # start gene g224 Scaffold_5 AUGUSTUS gene 1140350 1142301 0.48 - . g224 Scaffold_5 AUGUSTUS transcript 1140350 1142301 0.48 - . g224.t1 Scaffold_5 AUGUSTUS stop_codon 1140350 1140352 . - 0 transcript_id "g224.t1"; gene_id "g224"; Scaffold_5 AUGUSTUS CDS 1140350 1140978 0.92 - 2 transcript_id "g224.t1"; gene_id "g224"; Scaffold_5 AUGUSTUS CDS 1141066 1141548 0.5 - 2 transcript_id "g224.t1"; gene_id "g224"; Scaffold_5 AUGUSTUS CDS 1141668 1142301 0.66 - 0 transcript_id "g224.t1"; gene_id "g224"; Scaffold_5 AUGUSTUS start_codon 1142299 1142301 . - 0 transcript_id "g224.t1"; gene_id "g224"; # protein sequence = [MLAASVSGEIFASPSAKQILSTIRLAAYAGEDVHPRRNTITDRSAIHVPHRKDVLAIINNYTGDRLNFGLAIEKARAE # GIRVDSVVVADDVSLLHSESSSLVGPRGLAGNILVCKILGALAERGSSLENLKHAGDTIVSHLASIGVGLDHCHIPGNNSYSATIGDDECEVGLGLHN # EPGVHRMDIRDSVKLIDELIGKLLRSRGVVDGGRDNSLEQKLRGFPALSDIHPLRIYSSSFMTSLNAPGFSISLLNVSGVYRSSRPSAIYHSIDILGL # LDDPTEAHSWVGLRRFWSSDGRKDLRSHHRATEMVLDLMSGGSRASKTQDDHAETPYWQYADVSPERVKEGIIGACMAVLGEETLLTQYDTIVGDGDC # AILSSVETQQLEVNKLSPDQLIHRIGEIIEDNMGGTIGACEHFLPSHLKDCYKFASVFAIFFTAWSSAIKRMIHPSTTSVSSVRFMDTLSDALTSLSH # HTSAKPGDRTIMDALYPLCDTTVPLSDSRNADEVGFESSTECSNGNLVAEACHRAHEGALNTRGMKPKLGRAVYVELKEGLELPQTQGLGGSQCLRKG # FGLDSVSRPRNTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g224 ### # start gene g225 Scaffold_5 AUGUSTUS gene 1145507 1146355 0.92 + . g225 Scaffold_5 AUGUSTUS transcript 1145507 1146355 0.92 + . g225.t1 Scaffold_5 AUGUSTUS start_codon 1145507 1145509 . + 0 transcript_id "g225.t1"; gene_id "g225"; Scaffold_5 AUGUSTUS CDS 1145507 1146355 0.92 + 0 transcript_id "g225.t1"; gene_id "g225"; Scaffold_5 AUGUSTUS stop_codon 1146353 1146355 . + 0 transcript_id "g225.t1"; gene_id "g225"; # protein sequence = [MRELYFDLQTYLEHPAFQSEFYTRDAERVRSAIRAFDKKRKNLVRNLKLDRKQKRLQDTELYAQIAEAKIKAEALMRR # HEFIAGVKALSRKAPRSSNLGTKDSLSFFWECGKTGGRVKKKMRYYTEVTFGPGFDAYEAEWESPLVTPLNPFMKKFSRSEHPEQMNFVRIDPEEVDG # KKGRLEEEGDDREFFNFRLAGGKVYVIGWTLSCVWDGKAGPGPVIQLDDGESNFILSDRFSVKLDTSRPGRWHCKVTFVFQSSYNFPDLKLEQVRVRY # FPPSTDCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g225 ### # start gene g226 Scaffold_5 AUGUSTUS gene 1148048 1149354 0.54 + . g226 Scaffold_5 AUGUSTUS transcript 1148048 1149354 0.54 + . g226.t1 Scaffold_5 AUGUSTUS start_codon 1148048 1148050 . + 0 transcript_id "g226.t1"; gene_id "g226"; Scaffold_5 AUGUSTUS CDS 1148048 1148069 0.54 + 0 transcript_id "g226.t1"; gene_id "g226"; Scaffold_5 AUGUSTUS CDS 1148141 1149354 1 + 2 transcript_id "g226.t1"; gene_id "g226"; Scaffold_5 AUGUSTUS stop_codon 1149352 1149354 . + 0 transcript_id "g226.t1"; gene_id "g226"; # protein sequence = [MAVLPSLSTANTSADSTSAATSAASSSADATSAAPTSASSASPTSTPSSTPTSTAASTSASAATSASATSAPASSAPA # SSAPSSNGSSSSSSTSSTSESSNSGSPSKASPTTISSTLTAAMTTSVQATVMSTGSDGKVYTTVIETASVLSAGSIVTSTASADDNSGTTSSNTAEIV # GGVIGGVGGLLVILGVLFFILKRQRRKRQLEEAFDGNFDPDRIVNSGGFGAGVRDSMASSSDTAGYAYAGGEKAKSKKAAKRASRGANMLGEGEGTLP # DIPLDGGSPHRHPEMQQLMSIGATSRNNLLDEEGMDDNTPNPSPYHSPHASPFHNSFSLPNTASSDGHGLVGAMTSPPRSPGGRPLSISASASLSGHG # HPGYGPGPGYSRPPSFYGNNAYGISPPGSPPPPSRITDM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g226 ### # start gene g227 Scaffold_5 AUGUSTUS gene 1150677 1152485 0.98 + . g227 Scaffold_5 AUGUSTUS transcript 1150677 1152485 0.98 + . g227.t1 Scaffold_5 AUGUSTUS start_codon 1150677 1150679 . + 0 transcript_id "g227.t1"; gene_id "g227"; Scaffold_5 AUGUSTUS CDS 1150677 1152485 0.98 + 0 transcript_id "g227.t1"; gene_id "g227"; Scaffold_5 AUGUSTUS stop_codon 1152483 1152485 . + 0 transcript_id "g227.t1"; gene_id "g227"; # protein sequence = [MSSSSNMPNVQRFPTGISLEGEDNWWPYKREVSLAVESKGLQGYLHGTIAKPSDTKPAVTVTSPEGTTTTPTATTPPY # SQTPSPEEWYARDRYVASTIVSNILDPTGLGVDYTETASEIWQELVKQFEQKSEELLLFHDSNLRAHRYMYPEETMEEHKRTMRNLLRKATNAGAVIT # DGQFRVIVLASLPKDWDSDIRHLPGKTSSEAFIYLQGIWLQREKRRTEEEREEKKVKALLAMHVASIQTPDKSRPTCTNPNCRKVGHTIQKCWAKGGG # AEGKGPNGWRFNKNNEPNRGQATPGNTVAAAVANANDTLPLETYVLSADTRRADMSTSSSMSTSTPHRSTTPTDRLFDSDDHTFLKGWERQEGAEEDG # DKDVHRHHVVASPQACAIHQGNKLLYTPMKTPYIRTFIDSGATEHCWVNKSDFVEYEQVQGQSGTSALAGDAGRFRIRGTGTVEFTTRVGDTARRIRL # TSVKHTPEFGHNLISLSTLDQQAFQGDWGNGVLSVKTPEGLVVMTGRGKTKMYEVEIISQTSANSARSHEKPVDIQTWHRRLGHVSAPRILRMESRKL # VDGLQIKSKQLTGMCIDCLYGKATRRLSRSAEAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g227 ### # start gene g228 Scaffold_5 AUGUSTUS gene 1154728 1156680 0.89 - . g228 Scaffold_5 AUGUSTUS transcript 1154728 1156680 0.89 - . g228.t1 Scaffold_5 AUGUSTUS stop_codon 1154728 1154730 . - 0 transcript_id "g228.t1"; gene_id "g228"; Scaffold_5 AUGUSTUS CDS 1154728 1156680 0.89 - 0 transcript_id "g228.t1"; gene_id "g228"; Scaffold_5 AUGUSTUS start_codon 1156678 1156680 . - 0 transcript_id "g228.t1"; gene_id "g228"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIFEKCLLSLKH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g228 ### # start gene g229 Scaffold_5 AUGUSTUS gene 1156731 1157897 0.85 - . g229 Scaffold_5 AUGUSTUS transcript 1156731 1157897 0.85 - . g229.t1 Scaffold_5 AUGUSTUS stop_codon 1156731 1156733 . - 0 transcript_id "g229.t1"; gene_id "g229"; Scaffold_5 AUGUSTUS CDS 1156731 1157897 0.85 - 0 transcript_id "g229.t1"; gene_id "g229"; Scaffold_5 AUGUSTUS start_codon 1157895 1157897 . - 0 transcript_id "g229.t1"; gene_id "g229"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g229 ### # start gene g230 Scaffold_5 AUGUSTUS gene 1170817 1171590 0.8 + . g230 Scaffold_5 AUGUSTUS transcript 1170817 1171590 0.8 + . g230.t1 Scaffold_5 AUGUSTUS start_codon 1170817 1170819 . + 0 transcript_id "g230.t1"; gene_id "g230"; Scaffold_5 AUGUSTUS CDS 1170817 1171590 0.8 + 0 transcript_id "g230.t1"; gene_id "g230"; Scaffold_5 AUGUSTUS stop_codon 1171588 1171590 . + 0 transcript_id "g230.t1"; gene_id "g230"; # protein sequence = [MLNLFTTVGSHTYGEWQQSSVQASIALKKTHTITSSPASRIHTRNCKVSVTNIQGPKVDSRNGHSHGLQKCAREFIET # CEIPGNPYGTWAKSILETHPDLKVEVMNHLLSVGKYVQAHDIVTFLNRDDVKGRYGLKETVSIATAKRWMKALKFHWVRNHLGQYVDGHECVDVVHYR # QQVFLPAWYRMEAQTHSWSADNVEEVVDEIIAAGHRIVVWFHNESIFYAHDWRKAQWVPDGASPEPYAKGEKKCHEAAKAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g230 ### # start gene g231 Scaffold_5 AUGUSTUS gene 1175128 1175523 0.88 - . g231 Scaffold_5 AUGUSTUS transcript 1175128 1175523 0.88 - . g231.t1 Scaffold_5 AUGUSTUS stop_codon 1175128 1175130 . - 0 transcript_id "g231.t1"; gene_id "g231"; Scaffold_5 AUGUSTUS CDS 1175128 1175523 0.88 - 0 transcript_id "g231.t1"; gene_id "g231"; Scaffold_5 AUGUSTUS start_codon 1175521 1175523 . - 0 transcript_id "g231.t1"; gene_id "g231"; # protein sequence = [MVDEWFSGLEPDVKQRMENKIQARKEEDEEDDSWLDNPDIRARILGEMVRKKDRKPWWFNTSTGEWDTRFNEDEDKEE # EDFMINICERIPTSRSSIKISCHCKWDLTKWSGRMKEPFLQITGSDDEDAQMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g231 ### # start gene g232 Scaffold_5 AUGUSTUS gene 1176559 1177155 1 - . g232 Scaffold_5 AUGUSTUS transcript 1176559 1177155 1 - . g232.t1 Scaffold_5 AUGUSTUS stop_codon 1176559 1176561 . - 0 transcript_id "g232.t1"; gene_id "g232"; Scaffold_5 AUGUSTUS CDS 1176559 1177155 1 - 0 transcript_id "g232.t1"; gene_id "g232"; Scaffold_5 AUGUSTUS start_codon 1177153 1177155 . - 0 transcript_id "g232.t1"; gene_id "g232"; # protein sequence = [MTTLFHAPIVENSETISNTPLPASQPGMNGISSITAANQARKFDAAVASRLASDLNGIEEGYTLHTVCVSRCCFKLGR # ITVPPAVLMATNGVSVHPWELSNSEAANPSVQRYSPSNPPPTWTSESQALFSKSKGGSPRKLREFYKGQWREIQAAGDVNTDPWWERAVGVGGIIEER # RKERLDVCRKLVGGLDGVREIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g232 ### # start gene g233 Scaffold_5 AUGUSTUS gene 1191557 1193180 0.76 - . g233 Scaffold_5 AUGUSTUS transcript 1191557 1193180 0.76 - . g233.t1 Scaffold_5 AUGUSTUS stop_codon 1191557 1191559 . - 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_5 AUGUSTUS CDS 1191557 1192588 0.89 - 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_5 AUGUSTUS CDS 1192644 1193180 0.77 - 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_5 AUGUSTUS start_codon 1193178 1193180 . - 0 transcript_id "g233.t1"; gene_id "g233"; # protein sequence = [MPIPRLRSQNPPWTVIHHTKYKLRLLATSCSMMARDDQVLPYQAYLPPTELIYALQDVPLSKIRLDPEYTTNFTPVIS # QNLEEAASLPPSFEDSTGPYALAIQIGSQIAGFWGLTDYWDFKFSFKSDPPPPPPSDPSIPSSADYSLQDAIIVASNNNGYNADPQTSYGSSDISGNR # HMTAYLYAEEFSWLWWGAERIWTGDLLRLKIGRNVIAKDGTPHILAPSPADSNALLHSAQNGDNLNQKELGAPSQGVFMRLDALFTVEVDLEKGRKRN # DCRAAGMLYELTNIDWIDPSEDAVRRPTSTPLTTDAAISDEDYQGVSNAVPHSPLKPTALRNPNPAIPITETARQMLSKILPHASVPENEANRVYKPP # IPVSHYDLPQPPTGFKFRPILNPEYEAVFSLTLLNGRYYPGILGHPLLVETIHQVRTPEGKIDPHDPQSNHLWALEGLEPGFSNSVNPIRYKKDRFSM # VVDGEINARAQLTKHFSTNSEQTDGDVSTENGNAKQSMEIDPISNDQMQVDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g233 ### # start gene g234 Scaffold_5 AUGUSTUS gene 1194505 1195682 0.4 - . g234 Scaffold_5 AUGUSTUS transcript 1194505 1195682 0.4 - . g234.t1 Scaffold_5 AUGUSTUS stop_codon 1194505 1194507 . - 0 transcript_id "g234.t1"; gene_id "g234"; Scaffold_5 AUGUSTUS CDS 1194505 1195081 0.43 - 1 transcript_id "g234.t1"; gene_id "g234"; Scaffold_5 AUGUSTUS CDS 1195663 1195682 0.52 - 0 transcript_id "g234.t1"; gene_id "g234"; Scaffold_5 AUGUSTUS start_codon 1195680 1195682 . - 0 transcript_id "g234.t1"; gene_id "g234"; # protein sequence = [MVQSLESLSNGETHNSSANCNVVGGSSRQYSPTPYPYFQYPSLSHPVPLGSVLGGNSYPISTNSCLNKNEAFLPSIAR # SDNVDEICQSYSRWPPHWDSTFHSASSFSSAEQFLAASIPNFEIDMFNSVNSATKETFVPVLPPISVLEDLRGFHVDDALNVLHRLTADDEENIAAEQ # FSQVSILSMSSHYFIQITCLFQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g234 ### # start gene g235 Scaffold_5 AUGUSTUS gene 1206788 1207105 0.68 + . g235 Scaffold_5 AUGUSTUS transcript 1206788 1207105 0.68 + . g235.t1 Scaffold_5 AUGUSTUS start_codon 1206788 1206790 . + 0 transcript_id "g235.t1"; gene_id "g235"; Scaffold_5 AUGUSTUS CDS 1206788 1207105 0.68 + 0 transcript_id "g235.t1"; gene_id "g235"; Scaffold_5 AUGUSTUS stop_codon 1207103 1207105 . + 0 transcript_id "g235.t1"; gene_id "g235"; # protein sequence = [MYDSTVWNLSQNVDRTIGSNKVDVCPCVTPPMFPYITGCGGPIVGLEALSTQGIPVDRMLLIRKVENQLVDLARNVMS # TTVVGVYIIGSMVIGLRHFKKGDEEAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g235 ### # start gene g236 Scaffold_5 AUGUSTUS gene 1210029 1210358 0.98 + . g236 Scaffold_5 AUGUSTUS transcript 1210029 1210358 0.98 + . g236.t1 Scaffold_5 AUGUSTUS start_codon 1210029 1210031 . + 0 transcript_id "g236.t1"; gene_id "g236"; Scaffold_5 AUGUSTUS CDS 1210029 1210358 0.98 + 0 transcript_id "g236.t1"; gene_id "g236"; Scaffold_5 AUGUSTUS stop_codon 1210356 1210358 . + 0 transcript_id "g236.t1"; gene_id "g236"; # protein sequence = [MSDDGNDSFVENSSNEGSLDEADSSEVSLEDDISSPKSKKIQVKKKAAPSSSSATENDMDVDEDFQSSANGKLKAEGD # GNRSAKKQRVDTDPWKLVSSKLYRDWTPHAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g236 ### # start gene g237 Scaffold_5 AUGUSTUS gene 1213057 1214151 1 - . g237 Scaffold_5 AUGUSTUS transcript 1213057 1214151 1 - . g237.t1 Scaffold_5 AUGUSTUS stop_codon 1213057 1213059 . - 0 transcript_id "g237.t1"; gene_id "g237"; Scaffold_5 AUGUSTUS CDS 1213057 1214151 1 - 0 transcript_id "g237.t1"; gene_id "g237"; Scaffold_5 AUGUSTUS start_codon 1214149 1214151 . - 0 transcript_id "g237.t1"; gene_id "g237"; # protein sequence = [MPTLTPAAALALAYTSAVSGEPIASSQDGEAGTKNATSDVLKQSGSTSLSSSSLEKLPQETSTKSGETMKEWWKDGGT # GGAETEPRIIYSDAFTKSLHQAISESIPATSRALTTQQIHSLAAPVAERNTFSQRLTSPNTSRASSLITTHPSPQPNAVSTALLNALLTKLNQDDPLH # DRLMTNGTQKKKDDYLPPSKILGSRPATSKYPIDTTLPVNNLATHNVRSYPVNLTPVHSSLRPHCAARERLVQWKPAGKRSFQDSTGLPLVLPDEFVD # RIQHVLTNGYVESTLETYASGLLSFHIFCDSRNIPEAQRAPCSSDLLNAWISTMAGHYAGTSVKTMSTESGHGTLFTAFNGKLTRTPSTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g237 ### # start gene g238 Scaffold_5 AUGUSTUS gene 1217720 1218610 0.71 - . g238 Scaffold_5 AUGUSTUS transcript 1217720 1218610 0.71 - . g238.t1 Scaffold_5 AUGUSTUS stop_codon 1217720 1217722 . - 0 transcript_id "g238.t1"; gene_id "g238"; Scaffold_5 AUGUSTUS CDS 1217720 1218610 0.71 - 0 transcript_id "g238.t1"; gene_id "g238"; Scaffold_5 AUGUSTUS start_codon 1218608 1218610 . - 0 transcript_id "g238.t1"; gene_id "g238"; # protein sequence = [MADANTPEVTTNELAVQCLKDQWEAHIEGLRTQYQAQLQEAEALREQRGQEAAEAEKLAEADRLEKEKELSKETEKKR # LPIYSFQKGLGVDSIPLQLHPYAKKMMTARKYVPLWYFLPDAAADARERSKESLPSAIRSGGGCPLAGSTVSLVGSHSVRASPNAIPDSQLSWPQVMR # AKSAFLNALQLGAWPDTFIVMFAGFYSNMDMHRELQEQDGDRVMAHYHAEMRLAWYDAMERKDPFDLSIISDGVLRESRLQIVKQKQEKSLKGTSFPP # TPRDRTYLTASPRLHNNSSTTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g238 ### # start gene g239 Scaffold_5 AUGUSTUS gene 1224069 1224617 0.88 - . g239 Scaffold_5 AUGUSTUS transcript 1224069 1224617 0.88 - . g239.t1 Scaffold_5 AUGUSTUS stop_codon 1224069 1224071 . - 0 transcript_id "g239.t1"; gene_id "g239"; Scaffold_5 AUGUSTUS CDS 1224069 1224617 0.88 - 0 transcript_id "g239.t1"; gene_id "g239"; Scaffold_5 AUGUSTUS start_codon 1224615 1224617 . - 0 transcript_id "g239.t1"; gene_id "g239"; # protein sequence = [MQAPPIDQQLFDPFMCEDNLSINGLDKLTTEGQGLYQELGKKHWTEKHVERKAWKKEYQTKVSMREEASSPGSSHEAR # GPSGSVVHPSTPRDSTISTASKITSHTDQTHLPHPTHTSFEVSYSPIIISSGPNPFLLIDVLATEETPVLTNEPTHNSCTQSFDNDLPDPCVGLQPDR # SRYPWH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g239 ### # start gene g240 Scaffold_5 AUGUSTUS gene 1225796 1226371 0.95 - . g240 Scaffold_5 AUGUSTUS transcript 1225796 1226371 0.95 - . g240.t1 Scaffold_5 AUGUSTUS stop_codon 1225796 1225798 . - 0 transcript_id "g240.t1"; gene_id "g240"; Scaffold_5 AUGUSTUS CDS 1225796 1226371 0.95 - 0 transcript_id "g240.t1"; gene_id "g240"; Scaffold_5 AUGUSTUS start_codon 1226369 1226371 . - 0 transcript_id "g240.t1"; gene_id "g240"; # protein sequence = [MISDEDPNTLKKASRTVHDNDRESAMYTYGTEVGKKSQNYAASDEESFIGIVDSGQNEQMENAEDSPSSEDDNPDPWV # AAGTQCRAFSLDSSSNQNNSQKRKMILKLKRPQTVISIQRIALMGTNSIAKAKTTVNLIMNPAVTISMRTMNQMTPATLIIPGIHTNIICHNNCQRLV # LVTGVTRCHTQENLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g240 ### # start gene g241 Scaffold_5 AUGUSTUS gene 1235780 1236390 0.94 + . g241 Scaffold_5 AUGUSTUS transcript 1235780 1236390 0.94 + . g241.t1 Scaffold_5 AUGUSTUS start_codon 1235780 1235782 . + 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_5 AUGUSTUS CDS 1235780 1235990 0.96 + 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_5 AUGUSTUS CDS 1236107 1236390 0.97 + 2 transcript_id "g241.t1"; gene_id "g241"; Scaffold_5 AUGUSTUS stop_codon 1236388 1236390 . + 0 transcript_id "g241.t1"; gene_id "g241"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTSIARRTGK # QPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGLVPAVPADLVVLVDLVVLVLQFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g241 ### # start gene g242 Scaffold_5 AUGUSTUS gene 1237784 1238446 0.74 + . g242 Scaffold_5 AUGUSTUS transcript 1237784 1238446 0.74 + . g242.t1 Scaffold_5 AUGUSTUS start_codon 1237784 1237786 . + 0 transcript_id "g242.t1"; gene_id "g242"; Scaffold_5 AUGUSTUS CDS 1237784 1238446 0.74 + 0 transcript_id "g242.t1"; gene_id "g242"; Scaffold_5 AUGUSTUS stop_codon 1238444 1238446 . + 0 transcript_id "g242.t1"; gene_id "g242"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAVNTVDAKVAV # PLPELRRRFHRQFWRPLLGLTSLSLSLPLSDFTGQAPFVQIPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAAR # AADRSSTTPTVPPLHPSIPEEYASLQTSSTRLLQIHFLNIDLTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g242 ### # start gene g243 Scaffold_5 AUGUSTUS gene 1244751 1245251 0.67 - . g243 Scaffold_5 AUGUSTUS transcript 1244751 1245251 0.67 - . g243.t1 Scaffold_5 AUGUSTUS stop_codon 1244751 1244753 . - 0 transcript_id "g243.t1"; gene_id "g243"; Scaffold_5 AUGUSTUS CDS 1244751 1245251 0.67 - 0 transcript_id "g243.t1"; gene_id "g243"; Scaffold_5 AUGUSTUS start_codon 1245249 1245251 . - 0 transcript_id "g243.t1"; gene_id "g243"; # protein sequence = [MCEDCLYRKAMKHAFDEVLTHETESWREYILTSLDQRGQQTHGEANYIMLCMARKLSFQVPSYLTNKQKEARLRALHK # YRVMVEKDTGRSLRIIRIDWGGELNNRLVDAYCAEHGIIMEKVPHDSSAANGVAEQSFQIVMEGTRTLLEDADLPYISGGRPQPPSYT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g243 ### # start gene g244 Scaffold_5 AUGUSTUS gene 1252248 1253450 0.7 + . g244 Scaffold_5 AUGUSTUS transcript 1252248 1253450 0.7 + . g244.t1 Scaffold_5 AUGUSTUS start_codon 1252248 1252250 . + 0 transcript_id "g244.t1"; gene_id "g244"; Scaffold_5 AUGUSTUS CDS 1252248 1253450 0.7 + 0 transcript_id "g244.t1"; gene_id "g244"; Scaffold_5 AUGUSTUS stop_codon 1253448 1253450 . + 0 transcript_id "g244.t1"; gene_id "g244"; # protein sequence = [MSIIYVQHHVQVYLLPMLFMELLNHSNSSFKYNCMLYRLPVDIWWYIFTVYDIDLRPLVLVCKFMQNIVGNLVFRSVY # FPRPNKLRLAKRTWDLAKRNVTAHILFLRIGTPHESDTALDNVHFRYRRRWIASWRTASDLLSTFCRLTEVVLAGAVLPSNFGEGLSSLIHLRNLEVK # RCCCEGIAHFSNVNLPLRRLRLELMCWHDNNQDLDIICSCEQLVSLSITWHNTISQEWVWIGKRLPSTVEELSLSASQSFWSNTSLLDADIIECLFIL # LRQFPNLKALTVPKGMGCMPRNSDKQCLFGYNIKYYCGPIRFLRYIASKSTVLVDIHLVNHCFYTIRVDEDLPNDLVVENFDLNLTTWDAESIQILMK # KISSVKRLSLRWNWLPRNIVSILSSYME] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g244 ### # start gene g245 Scaffold_5 AUGUSTUS gene 1257047 1257445 0.6 + . g245 Scaffold_5 AUGUSTUS transcript 1257047 1257445 0.6 + . g245.t1 Scaffold_5 AUGUSTUS start_codon 1257047 1257049 . + 0 transcript_id "g245.t1"; gene_id "g245"; Scaffold_5 AUGUSTUS CDS 1257047 1257445 0.6 + 0 transcript_id "g245.t1"; gene_id "g245"; Scaffold_5 AUGUSTUS stop_codon 1257443 1257445 . + 0 transcript_id "g245.t1"; gene_id "g245"; # protein sequence = [MLLLTTTPITDCSILCMNPPHPVTTHFNPFYLEEKTIHANVIPLPSPLSSHTDFNFNITAVKAYLECTAHSDAKGTDC # TTYSQLMSIPNDGVQDGLEHAMTEQNKVHQGQTSSYWRFPTSIRFKTKMHYLLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g245 ### # start gene g246 Scaffold_5 AUGUSTUS gene 1276358 1276810 0.74 + . g246 Scaffold_5 AUGUSTUS transcript 1276358 1276810 0.74 + . g246.t1 Scaffold_5 AUGUSTUS start_codon 1276358 1276360 . + 0 transcript_id "g246.t1"; gene_id "g246"; Scaffold_5 AUGUSTUS CDS 1276358 1276810 0.74 + 0 transcript_id "g246.t1"; gene_id "g246"; Scaffold_5 AUGUSTUS stop_codon 1276808 1276810 . + 0 transcript_id "g246.t1"; gene_id "g246"; # protein sequence = [MKYANQKHQEAPDWKEGDQVWLNMENVKTRRPTKKLDHKWMGPYSILSQVGSHAYRLDLPGDLHKIHNVFHMDRLKPH # FHNKFKRQNSPPPPIFIKVESKHFVESILDSKPTKGTPNEMEYLVNWEGYDNDFNSWMRWRGMAGSLELVKQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g246 ### # start gene g247 Scaffold_5 AUGUSTUS gene 1290570 1291001 0.76 - . g247 Scaffold_5 AUGUSTUS transcript 1290570 1291001 0.76 - . g247.t1 Scaffold_5 AUGUSTUS stop_codon 1290570 1290572 . - 0 transcript_id "g247.t1"; gene_id "g247"; Scaffold_5 AUGUSTUS CDS 1290570 1291001 0.76 - 0 transcript_id "g247.t1"; gene_id "g247"; Scaffold_5 AUGUSTUS start_codon 1290999 1291001 . - 0 transcript_id "g247.t1"; gene_id "g247"; # protein sequence = [MEFVFILFFYGLVQSSVLRNFTSLDFHSRQTLYDQVEQLIAGNLELLSPLDVIMHFLNDTISGNSIPDTSTMSMQRVA # SLSDHGGLWLVDSAREVVSVAVVAQISPYADDLKCGEYLDMNVYNQEVCDRFSGQCKQIDVFILD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g247 ### # start gene g248 Scaffold_5 AUGUSTUS gene 1301765 1302466 1 - . g248 Scaffold_5 AUGUSTUS transcript 1301765 1302466 1 - . g248.t1 Scaffold_5 AUGUSTUS stop_codon 1301765 1301767 . - 0 transcript_id "g248.t1"; gene_id "g248"; Scaffold_5 AUGUSTUS CDS 1301765 1302466 1 - 0 transcript_id "g248.t1"; gene_id "g248"; Scaffold_5 AUGUSTUS start_codon 1302464 1302466 . - 0 transcript_id "g248.t1"; gene_id "g248"; # protein sequence = [MPVILKHENLNTELGITNGARGHLRKLELSTDSNGLVYCKYALVEFVDSKVELSGLPKGYFPIKARSWRYSTYLLNAE # HKKVLVSVVRMQLPFEPLFALTGQGAQGHTLVAILCMLHLGGYGGYVSASRPRSREGLFITKKVTLDNLNLPAIPYDLWFEARRFEVMAHNTKVVWGF # DEGDLKDVPDAEGEQRFHFSKVHYEFTAYVGKKRSYDDVENNGKEHKKLKSGNNEHN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g248 ### # start gene g249 Scaffold_5 AUGUSTUS gene 1302774 1304689 0.45 - . g249 Scaffold_5 AUGUSTUS transcript 1302774 1304689 0.45 - . g249.t1 Scaffold_5 AUGUSTUS stop_codon 1302774 1302776 . - 0 transcript_id "g249.t1"; gene_id "g249"; Scaffold_5 AUGUSTUS CDS 1302774 1303938 0.51 - 1 transcript_id "g249.t1"; gene_id "g249"; Scaffold_5 AUGUSTUS CDS 1304043 1304689 0.45 - 0 transcript_id "g249.t1"; gene_id "g249"; Scaffold_5 AUGUSTUS start_codon 1304687 1304689 . - 0 transcript_id "g249.t1"; gene_id "g249"; # protein sequence = [MCKVLRRLGDNMFSHQTVILPSGNLVSFVKQVYKLNNGSESSNDEQGEVDIQLSLGFKDGKMFTYSQVIDYWYRDVTL # FDMCFYDFIRYVSLQVQSKSKAVNTSATRLGVLRRYKLMFGHPLHQTHELIRHTNYEQGDVGKEFVPVMIGIVPPRKHHKDYALFVIAHFKPFSNSHD # LIQDALEVELENLALSEEHQRILCNWEEIHECADQRDAESSLKNKSTRSALDVQELQLLRTDLTCSAWLKEPSDRLKESILTNSNSNLNFVTLNDINV # QKWINEGKTLADKVASARYSKNNVASQDCNDGAEYDLDGNIGCYGGNNYSKVSEKNSEGCSPMQLKNKIAEEFDLNDEQLIAFEIISMIIYREILKIP # EWIAKPALVMNLTGPGGTGKTHIIRAVEKVMEYYGIEHTYRALASTGNAASLVNGKTIHSGLNISVREYKNGRSKRPLGELDENVAIFATVKKNNSLR # REWKDVCLLLIDEVSMVDSILLADIDGSLRYAKEKPDDFFGGVNVIFCGDPFQYPPVGTPLYVPIRSSGKQTDEELMRRLGRMAWKSINTVVELHKQK # RMEGDLEYAAAVGRLRLRQCNSADVDLFNSRVIKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g249 ### # start gene g250 Scaffold_5 AUGUSTUS gene 1305525 1306874 0.22 - . g250 Scaffold_5 AUGUSTUS transcript 1305525 1306874 0.22 - . g250.t1 Scaffold_5 AUGUSTUS stop_codon 1305525 1305527 . - 0 transcript_id "g250.t1"; gene_id "g250"; Scaffold_5 AUGUSTUS CDS 1305525 1306874 0.22 - 0 transcript_id "g250.t1"; gene_id "g250"; Scaffold_5 AUGUSTUS start_codon 1306872 1306874 . - 0 transcript_id "g250.t1"; gene_id "g250"; # protein sequence = [MPRLALNNYLYRGELIEGIENITWVEEMACAIYHTSAHVARIYGSSSAGDSLQLHGNVCAHPLDICSVAKKLPWSPAD # LNDLITVVFVSKAKLKQHDLQKLKPYFVRRSIIRMLLSDLCHRNRLYVGLYTLDSSMLELYPDNDLLPGLQERIVYDCDSSVNELFGVESAGFDDHPA # ELLVDSEQDSVLLERSGIYDAESQDVPARFMTASSIYNIAQSLPANNADVVLKYDKDPISEYNNPDLFPGMFPTLFPLGIGGFEDRRRSPAVSLEAHV # EHLLDQSTHEFRYHHFFFVCCSECDSAKKGSSSYIIMDIIKQIFFTCSNVLSVSSSVLSDLADKLRNEKDEAEFLDEELDAFQLLKQVNIIAAKIPGS # QSSKTATRNHIRSYYGYFGLPHLFLTLNPSAVHSPVFQVMYGEEKVDLEERFPFVVHPRGERACRVAKDPVAAADFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g250 ### # start gene g251 Scaffold_5 AUGUSTUS gene 1323017 1323358 1 + . g251 Scaffold_5 AUGUSTUS transcript 1323017 1323358 1 + . g251.t1 Scaffold_5 AUGUSTUS start_codon 1323017 1323019 . + 0 transcript_id "g251.t1"; gene_id "g251"; Scaffold_5 AUGUSTUS CDS 1323017 1323358 1 + 0 transcript_id "g251.t1"; gene_id "g251"; Scaffold_5 AUGUSTUS stop_codon 1323356 1323358 . + 0 transcript_id "g251.t1"; gene_id "g251"; # protein sequence = [MLSQALKHFPGQEVDEGNWDAHTESSLTPSDSASRVVWSFSQGKKARPLATSTTLTVHTEESVTTAANDNGESKSDAT # TESGRYSSANADLPFKIPTIMMTAATPSPPSTTVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g251 ### # start gene g252 Scaffold_5 AUGUSTUS gene 1323703 1324008 0.92 - . g252 Scaffold_5 AUGUSTUS transcript 1323703 1324008 0.92 - . g252.t1 Scaffold_5 AUGUSTUS stop_codon 1323703 1323705 . - 0 transcript_id "g252.t1"; gene_id "g252"; Scaffold_5 AUGUSTUS CDS 1323703 1324008 0.92 - 0 transcript_id "g252.t1"; gene_id "g252"; Scaffold_5 AUGUSTUS start_codon 1324006 1324008 . - 0 transcript_id "g252.t1"; gene_id "g252"; # protein sequence = [MTNPTGQKVVPDYGRVQGISSVSIINHHPNIPLGILIGCVAAFTIIVTSVGPEHHGYEFEKHRVAFEEGGADNDAVMT # EEVPEEMDEVFAGKDDAIMVGNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g252 ### # start gene g253 Scaffold_5 AUGUSTUS gene 1326376 1328541 0.48 - . g253 Scaffold_5 AUGUSTUS transcript 1326376 1328541 0.48 - . g253.t1 Scaffold_5 AUGUSTUS stop_codon 1326376 1326378 . - 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_5 AUGUSTUS CDS 1326376 1326934 1 - 1 transcript_id "g253.t1"; gene_id "g253"; Scaffold_5 AUGUSTUS CDS 1327041 1327177 1 - 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_5 AUGUSTUS CDS 1327255 1328541 0.48 - 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_5 AUGUSTUS start_codon 1328539 1328541 . - 0 transcript_id "g253.t1"; gene_id "g253"; # protein sequence = [MEFTPTLVKNQQRDSLLSSAGGSPGTRNRLASVTGASAPHSPPRDILRRPSSPPQPYAYSHSRTPSDADSIAERFVIS # SRTVSNPSNPTNYNSNPPPPPINAHNYPILPITRATTTTSTSTQPPSGIAARLRRESLGNRNMVSDSYLPLTTTGSSTQPFPSSSSSISSITGGTGSS # APPTTTLLSSPMAMRRPGLNPFKSNTLAGAGSTTSTSGSPRLTNALPGATGSGLALGAGVVSSSPLGPGSAGLTSLSSLSNLSNLPRRPSSPSSLSRP # SPPSFTPSSIGPASNSTGSGSITIGAVGTATAPLNTATGEIAVPRKRYSSSFGHRYSSSPARGGAAMSVGSQGSQGGSGIVEGTGVSNSGAGVVVGSL # GQTSVRSGMSGMSAMSIHSGQSAGSGSTGGVGSNISGIGTGREGLVNIGRGIGATPDSAHSSTYPDFHDTLDGQDLFSHDHDDISTFVHDIDSRKPLI # GRSRMERLPLNPSLNPLPFSREADSPQDAPTVSRGAGSSSTRSGVVKTPPSSRRASYTGLSPPSSPLRNAIPLIAEDEDDQIEPSANAFITTSSSAVA # TLATSPSSQAAPLPSVPSSADPGSSNAATGAEEGSPSSPPQHSSPMLTTASDVEARLKKMNDVFLASLQGLGGRSIKGRNDKGKERGGSGTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g253 ### # start gene g254 Scaffold_5 AUGUSTUS gene 1340563 1340946 0.82 - . g254 Scaffold_5 AUGUSTUS transcript 1340563 1340946 0.82 - . g254.t1 Scaffold_5 AUGUSTUS stop_codon 1340563 1340565 . - 0 transcript_id "g254.t1"; gene_id "g254"; Scaffold_5 AUGUSTUS CDS 1340563 1340946 0.82 - 0 transcript_id "g254.t1"; gene_id "g254"; Scaffold_5 AUGUSTUS start_codon 1340944 1340946 . - 0 transcript_id "g254.t1"; gene_id "g254"; # protein sequence = [MTTSRTQTTTTSSSTAGPSRSRPVPLPPPPPSDSAVHEEEDFEDEDEDDIIRKAQARVERVRARKVAAAAKKAAEEKA # ARAAAARASSARGARTGQLGSSTGGRDCGAEETFGGGSDCQKSKGDLSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g254 ### # start gene g255 Scaffold_5 AUGUSTUS gene 1346293 1347138 0.64 + . g255 Scaffold_5 AUGUSTUS transcript 1346293 1347138 0.64 + . g255.t1 Scaffold_5 AUGUSTUS start_codon 1346293 1346295 . + 0 transcript_id "g255.t1"; gene_id "g255"; Scaffold_5 AUGUSTUS CDS 1346293 1347138 0.64 + 0 transcript_id "g255.t1"; gene_id "g255"; Scaffold_5 AUGUSTUS stop_codon 1347136 1347138 . + 0 transcript_id "g255.t1"; gene_id "g255"; # protein sequence = [MEPISFTRQTPMGVREGNPQEGQTALLPATPSVDRRRIQEWGARVQRAELGEYVRPEGGRYALEDGGVAASGGGFRPP # DREPPPHLSSQTRDRKRPLSQGGWDQRRQERSGGGAPPPPPPPPPPSEGPSDNDSEGSNKGEYTQSSRNEGRNGEEGVELLTGAPEVPPTRYDQDQPW # YYDPKQGWHRKAAPRTPNKGRNTWESNKEKNRITIESKLDVGKIESFADDDRSAWKTWVLSLGYVLLSTLEKRTNALRQPAISLVQHSPLRHVESAMT # EGGVHLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g255 ### # start gene g256 Scaffold_5 AUGUSTUS gene 1348369 1348907 0.75 + . g256 Scaffold_5 AUGUSTUS transcript 1348369 1348907 0.75 + . g256.t1 Scaffold_5 AUGUSTUS start_codon 1348369 1348371 . + 0 transcript_id "g256.t1"; gene_id "g256"; Scaffold_5 AUGUSTUS CDS 1348369 1348389 0.83 + 0 transcript_id "g256.t1"; gene_id "g256"; Scaffold_5 AUGUSTUS CDS 1348476 1348612 0.75 + 0 transcript_id "g256.t1"; gene_id "g256"; Scaffold_5 AUGUSTUS CDS 1348715 1348907 0.83 + 1 transcript_id "g256.t1"; gene_id "g256"; Scaffold_5 AUGUSTUS stop_codon 1348905 1348907 . + 0 transcript_id "g256.t1"; gene_id "g256"; # protein sequence = [MRHPENLISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKELCLTKEIHEGILQPPPEAPQQPPETPQQP # SEAPQQPPEAPLRAPRTRVKLEEVKDEEYEASQPGPHE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g256 ### # start gene g257 Scaffold_5 AUGUSTUS gene 1358005 1358763 0.97 + . g257 Scaffold_5 AUGUSTUS transcript 1358005 1358763 0.97 + . g257.t1 Scaffold_5 AUGUSTUS start_codon 1358005 1358007 . + 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_5 AUGUSTUS CDS 1358005 1358763 0.97 + 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_5 AUGUSTUS stop_codon 1358761 1358763 . + 0 transcript_id "g257.t1"; gene_id "g257"; # protein sequence = [MRGPKVSSWVQNYTDDNFNDDEEEWKVTWKGFKDALNASFLDKGLTENAQEKLEHLRQGPNERAEDFFKEFEVIMRDA # GYAKDAPYVIRLIEMNVKPKLIDQVYGTSNERIEKFDELKQKIISIDDMWWRREEMRRNWSNRYQRNAGQGPSSQRWQPQTTQAPITKAPTPAVPTQD # RKDGTGTTFKGAGRPMDIDAARRNKECFHCGKQGHIAKFCPEKAPKPQFVRGMWSRMTQEDQEAMAKELGFVLPQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g257 ### # start gene g258 Scaffold_5 AUGUSTUS gene 1358889 1360085 0.93 + . g258 Scaffold_5 AUGUSTUS transcript 1358889 1360085 0.93 + . g258.t1 Scaffold_5 AUGUSTUS start_codon 1358889 1358891 . + 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_5 AUGUSTUS CDS 1358889 1360085 0.93 + 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_5 AUGUSTUS stop_codon 1360083 1360085 . + 0 transcript_id "g258.t1"; gene_id "g258"; # protein sequence = [MTTRAEEKPVRYEPNTPEWVAQRLQMDKLPMAIGILRAWMPESRVREASEETVLAIRNLSHATATEAVTNLKSRKRFV # RGTRGRELKLRTTIENIDNGVQIETEALLDSGATGSCINKDFVEQHQLTVKELPVKMPVYNADGTLNKNGSIEGYVQVRMVIGDHAERIDMAVTNLGK # TDIFLGIDWLRYHNPSIDWKESTLTFERCPDKCGYLPHYESPEDDGTEEKLVDGERIFWFDWDGYLSDQGHIKVQTATTDAATPYLAEYADVFSKKDF # DQMPERRPWDHAIELTPGSKPVDCKVYPLSPPEQKALDEFLEENLRSGRIRPSRSPMASPFFFVKKKDGTLRPVQDYRKLNDMTVKNRYPLPLIQELI # DKLKNSKIFTKMDVRWGFNNIRIKGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g258 ### # start gene g259 Scaffold_5 AUGUSTUS gene 1366727 1367737 0.99 + . g259 Scaffold_5 AUGUSTUS transcript 1366727 1367737 0.99 + . g259.t1 Scaffold_5 AUGUSTUS start_codon 1366727 1366729 . + 0 transcript_id "g259.t1"; gene_id "g259"; Scaffold_5 AUGUSTUS CDS 1366727 1367737 0.99 + 0 transcript_id "g259.t1"; gene_id "g259"; Scaffold_5 AUGUSTUS stop_codon 1367735 1367737 . + 0 transcript_id "g259.t1"; gene_id "g259"; # protein sequence = [MSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKI # FTKIDLRAGYNNVRVAQGHKWKTAFRTRYGSFEYLVMPFGLTNAPSGFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEESHVEHVRKVLERLRANHLH # AKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAF # SEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDRHIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g259 ### # start gene g260 Scaffold_5 AUGUSTUS gene 1368631 1369443 0.83 + . g260 Scaffold_5 AUGUSTUS transcript 1368631 1369443 0.83 + . g260.t1 Scaffold_5 AUGUSTUS start_codon 1368631 1368633 . + 0 transcript_id "g260.t1"; gene_id "g260"; Scaffold_5 AUGUSTUS CDS 1368631 1369443 0.83 + 0 transcript_id "g260.t1"; gene_id "g260"; Scaffold_5 AUGUSTUS stop_codon 1369441 1369443 . + 0 transcript_id "g260.t1"; gene_id "g260"; # protein sequence = [MPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNN # TPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKAYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKW # TGPYTILLKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKCQTSLPPPIFIKGEMEHFVEDILDSKPKKGRPEEVEYLVKWEGYNDITPM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g260 ### # start gene g261 Scaffold_5 AUGUSTUS gene 1370865 1371554 0.93 + . g261 Scaffold_5 AUGUSTUS transcript 1370865 1371554 0.93 + . g261.t1 Scaffold_5 AUGUSTUS start_codon 1370865 1370867 . + 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_5 AUGUSTUS CDS 1370865 1371554 0.93 + 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_5 AUGUSTUS stop_codon 1371552 1371554 . + 0 transcript_id "g261.t1"; gene_id "g261"; # protein sequence = [MDQGRSRIGAEKAAEDMKRQYDKHRNEAIKYKAGDKVWLEGTNITTDHPMKKLGINDLDRLKFLKRLGPAHTNSTSLA # CGKESIMSSTKHTYPRTMNPNSRHNPEYRATSRSSWREEEYEVEEVVDARKYRNGIQYKVKWRGYGPHEMMWEPAANMTNAKEAVQDFHKKYPNKPRP # RTLKRIEIPIAQFPTELFRQIPTPDIEPVPSTMPSEALVNRLARHGIHALKGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g261 ### # start gene g262 Scaffold_5 AUGUSTUS gene 1373438 1375618 0.42 - . g262 Scaffold_5 AUGUSTUS transcript 1373438 1375618 0.42 - . g262.t1 Scaffold_5 AUGUSTUS stop_codon 1373438 1373440 . - 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_5 AUGUSTUS CDS 1373438 1375618 0.42 - 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_5 AUGUSTUS start_codon 1375616 1375618 . - 0 transcript_id "g262.t1"; gene_id "g262"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLESESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSE # SASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLV # ADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMV # REVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTD # TRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPSTVR # HHYGPFEPRILAHCTRPHRRQARWALYLSRFDFHMIHRPGRVNTQADALSCMAVHHVIGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g262 ### # start gene g263 Scaffold_5 AUGUSTUS gene 1375669 1376148 0.71 - . g263 Scaffold_5 AUGUSTUS transcript 1375669 1376148 0.71 - . g263.t1 Scaffold_5 AUGUSTUS stop_codon 1375669 1375671 . - 0 transcript_id "g263.t1"; gene_id "g263"; Scaffold_5 AUGUSTUS CDS 1375669 1376148 0.71 - 0 transcript_id "g263.t1"; gene_id "g263"; Scaffold_5 AUGUSTUS start_codon 1376146 1376148 . - 0 transcript_id "g263.t1"; gene_id "g263"; # protein sequence = [MTGRNSGYLLPLTTPADPHAMDIDATHTSNGNTREAFLACEDDACCGAQGHVKQNCPHRETTCRYCGRRGHLKTSSWD # SDEEADARRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g263 ### # start gene g264 Scaffold_5 AUGUSTUS gene 1378522 1379142 0.99 - . g264 Scaffold_5 AUGUSTUS transcript 1378522 1379142 0.99 - . g264.t1 Scaffold_5 AUGUSTUS stop_codon 1378522 1378524 . - 0 transcript_id "g264.t1"; gene_id "g264"; Scaffold_5 AUGUSTUS CDS 1378522 1379142 0.99 - 0 transcript_id "g264.t1"; gene_id "g264"; Scaffold_5 AUGUSTUS start_codon 1379140 1379142 . - 0 transcript_id "g264.t1"; gene_id "g264"; # protein sequence = [MEKKGIRRHIWHRKTLTNAPASIRTSPSPADTDPLAYPSPAVSSVTPRPDTSHSIDSKPSVFLTPLANCVQACNGQQL # AFQNFLQQNLSNNGSFDSGVGMSSTIQVASTSAACPDSGTANDCINWQNDSEINLPGPGIDENSSISVPTSVNSTSQNSLSHSIINRLNFGLSIMAQI # ILSRDSLEFTPLDPSALETIVKTVQATVKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g264 ### # start gene g265 Scaffold_5 AUGUSTUS gene 1382193 1382492 0.8 + . g265 Scaffold_5 AUGUSTUS transcript 1382193 1382492 0.8 + . g265.t1 Scaffold_5 AUGUSTUS start_codon 1382193 1382195 . + 0 transcript_id "g265.t1"; gene_id "g265"; Scaffold_5 AUGUSTUS CDS 1382193 1382492 0.8 + 0 transcript_id "g265.t1"; gene_id "g265"; Scaffold_5 AUGUSTUS stop_codon 1382490 1382492 . + 0 transcript_id "g265.t1"; gene_id "g265"; # protein sequence = [MGISRFGGLNQSKLKPKHTDPYGGLELCTGTTTQCDLPLRLMTDPKFKEYPTAEYNFLQSQGAEHDVPILTSAGPKWL # LAKRFCAATRQEAGGGRSEYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g265 ### # start gene g266 Scaffold_5 AUGUSTUS gene 1386496 1387485 0.74 + . g266 Scaffold_5 AUGUSTUS transcript 1386496 1387485 0.74 + . g266.t1 Scaffold_5 AUGUSTUS start_codon 1386496 1386498 . + 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_5 AUGUSTUS CDS 1386496 1387485 0.74 + 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_5 AUGUSTUS stop_codon 1387483 1387485 . + 0 transcript_id "g266.t1"; gene_id "g266"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPLQWNLGWDHHNEVYLHGLAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPYP # NNLGRHPGGYQPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEILGD # GLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANDQIFSGCTTSCWTQRGCWNC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g266 ### # start gene g267 Scaffold_5 AUGUSTUS gene 1392806 1393651 0.35 + . g267 Scaffold_5 AUGUSTUS transcript 1392806 1393651 0.35 + . g267.t1 Scaffold_5 AUGUSTUS start_codon 1392806 1392808 . + 0 transcript_id "g267.t1"; gene_id "g267"; Scaffold_5 AUGUSTUS CDS 1392806 1393651 0.35 + 0 transcript_id "g267.t1"; gene_id "g267"; Scaffold_5 AUGUSTUS stop_codon 1393649 1393651 . + 0 transcript_id "g267.t1"; gene_id "g267"; # protein sequence = [MCVPLTLSSTWGDYITIGSIHGPRESEGVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWT # HSVVVPSNSEVSILRSPGSGTLQSGPTVILECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQI # QVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATILMNEDSSKSSEGS # SKRYEYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g267 ### # start gene g268 Scaffold_5 AUGUSTUS gene 1398360 1399550 0.71 - . g268 Scaffold_5 AUGUSTUS transcript 1398360 1399550 0.71 - . g268.t1 Scaffold_5 AUGUSTUS stop_codon 1398360 1398362 . - 0 transcript_id "g268.t1"; gene_id "g268"; Scaffold_5 AUGUSTUS CDS 1398360 1399550 0.71 - 0 transcript_id "g268.t1"; gene_id "g268"; Scaffold_5 AUGUSTUS start_codon 1399548 1399550 . - 0 transcript_id "g268.t1"; gene_id "g268"; # protein sequence = [MSAPLRRSSSRTRSPQLPILTTIGEVPSPDLESDGEAEQDQLAFTIEFPSRPQLQLFETVFNTGKPLSGYCQDDPLWP # LLAEVASPCSNCSKSPAKCKVLPNSPQCTNCSVKKTCSLGKILRYRYFARRCNQDLTYSCRFLELHGTPAHQSTWGIPVGTWRQYDAALHERTSSTST # LLELNMLDDQDTADVDQQELQDFLALQQGEAAVAAKRKRDLSPLPVAGPSSKKVRSNASKKRPRRRSPMQETAQESPRRVRLVVPPVRSLPITTSTSL # PPRASPSLMEVPDDDLSVQGHSSLVQLAAVAEAQSGLVQQPVVPSSIKGTGPDLLSSNMPPVPRPTLVPRALATHPYCAENQRLTARVRLLESQLSDS # QRENSSLTSAFGILPMLSNLGSGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g268 ### # start gene g269 Scaffold_5 AUGUSTUS gene 1405040 1406059 0.21 + . g269 Scaffold_5 AUGUSTUS transcript 1405040 1406059 0.21 + . g269.t1 Scaffold_5 AUGUSTUS start_codon 1405040 1405042 . + 0 transcript_id "g269.t1"; gene_id "g269"; Scaffold_5 AUGUSTUS CDS 1405040 1405068 0.21 + 0 transcript_id "g269.t1"; gene_id "g269"; Scaffold_5 AUGUSTUS CDS 1405255 1406059 0.58 + 1 transcript_id "g269.t1"; gene_id "g269"; Scaffold_5 AUGUSTUS stop_codon 1406057 1406059 . + 0 transcript_id "g269.t1"; gene_id "g269"; # protein sequence = [MADSFNGPGDQTSSPTLTLSIGIGNTSPVPGFPSPSSSFVPPPVVTPIEFATVKDKRKDENSRKNSKTGLVNVATKSK # SQLDTKPNTSAPAVDPNSIISPTTPTPNSLHRQRSFPNSESFSEVAATVIELPTELPTDDETHNSSSNLAAKAFGAAASRDTQSPIIPTPPFSKQSLN # ASHSLPKTPVRTPSNPPTPSSPGFHFPPSASSRKPNRDSTMSNFSTSSAASTRSTTSLKSNRPAPPSPALSRRTSGTGVGAATSPIAKRFSAGPGGIP # AFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g269 ### # start gene g270 Scaffold_5 AUGUSTUS gene 1406195 1407627 0.35 + . g270 Scaffold_5 AUGUSTUS transcript 1406195 1407627 0.35 + . g270.t1 Scaffold_5 AUGUSTUS start_codon 1406195 1406197 . + 0 transcript_id "g270.t1"; gene_id "g270"; Scaffold_5 AUGUSTUS CDS 1406195 1406723 0.41 + 0 transcript_id "g270.t1"; gene_id "g270"; Scaffold_5 AUGUSTUS CDS 1407206 1407627 0.97 + 2 transcript_id "g270.t1"; gene_id "g270"; Scaffold_5 AUGUSTUS stop_codon 1407625 1407627 . + 0 transcript_id "g270.t1"; gene_id "g270"; # protein sequence = [MSVPAPLPLTPVPGSATLPPVSASLLSGDLSSAGLSSAGLSSAALRTATTASTALTKGKGTGTASQMRRPIRIRDYAY # IPREDESLDADARPLWENDPQFLGFGADGKGLHVPTPNRVKVLNKALLTATNLSTISSNLNTAYTMWKTSYKRDRKERKAAVKRRAKETKRERAQARY # KGRGIDSPSPLDYDRVYGYDEDAYGQIPNSAFPSASPYPGSGDGYGYEDDSLDSIGEGELIPGQYRALYSFEPEGPSEMKLTEGEIVIVVGRGGGGGW # AVVVDKYTEYSPRDVEPGGTTNPNVTSKYALVPESYLETHPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g270 ### # start gene g271 Scaffold_5 AUGUSTUS gene 1410548 1411323 0.86 + . g271 Scaffold_5 AUGUSTUS transcript 1410548 1411323 0.86 + . g271.t1 Scaffold_5 AUGUSTUS start_codon 1410548 1410550 . + 0 transcript_id "g271.t1"; gene_id "g271"; Scaffold_5 AUGUSTUS CDS 1410548 1410903 0.88 + 0 transcript_id "g271.t1"; gene_id "g271"; Scaffold_5 AUGUSTUS CDS 1411026 1411323 0.86 + 1 transcript_id "g271.t1"; gene_id "g271"; Scaffold_5 AUGUSTUS stop_codon 1411321 1411323 . + 0 transcript_id "g271.t1"; gene_id "g271"; # protein sequence = [MAAPRALPTPPSLPATPPPPSATPPRPALPIPPTALSDPAGNLGSLRKKRNFKALQLPTPPSPISAAPAGPLPPLPGV # ARGLVATRNAPNQPFKRGLSIDVDNAQPHNTGLGLFGRGAARGSGNSTTTLSSSGLATGSSGVSSTSSVTTVDGAPSAELYRSKAERDRELIQAPLQD # SDLKNIAELGMGNGGSVMKVEHVPSGVVMAKKVQLSALFLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g271 ### # start gene g272 Scaffold_5 AUGUSTUS gene 1421608 1421934 0.48 - . g272 Scaffold_5 AUGUSTUS transcript 1421608 1421934 0.48 - . g272.t1 Scaffold_5 AUGUSTUS stop_codon 1421608 1421610 . - 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_5 AUGUSTUS CDS 1421608 1421934 0.48 - 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_5 AUGUSTUS start_codon 1421932 1421934 . - 0 transcript_id "g272.t1"; gene_id "g272"; # protein sequence = [MIMAKGTVKPTKEVYAAGLLRYNQFGDLMGISESDRMPASDRLIIGFIEHYAGKVSGKCISNWLSGLRLWHETMGAPW # PAESDKLDGELTSKALITNDPHDTPSPSSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g272 ### # start gene g273 Scaffold_5 AUGUSTUS gene 1427740 1429057 0.78 + . g273 Scaffold_5 AUGUSTUS transcript 1427740 1429057 0.78 + . g273.t1 Scaffold_5 AUGUSTUS start_codon 1427740 1427742 . + 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_5 AUGUSTUS CDS 1427740 1427759 0.79 + 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_5 AUGUSTUS CDS 1427828 1428183 0.99 + 1 transcript_id "g273.t1"; gene_id "g273"; Scaffold_5 AUGUSTUS CDS 1428255 1429057 0.99 + 2 transcript_id "g273.t1"; gene_id "g273"; Scaffold_5 AUGUSTUS stop_codon 1429055 1429057 . + 0 transcript_id "g273.t1"; gene_id "g273"; # protein sequence = [MANIAVRIGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINPVVAKVAVPLPEPSPSVSPTILETPPGDSPR # SRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVKVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLK # IDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKL # DLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILSTLIRQKNTENTLRKFFGGYGNIGFTPTPR # SANSIWILLSIWVIFFLPTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g273 ### # start gene g274 Scaffold_5 AUGUSTUS gene 1429620 1430021 0.62 + . g274 Scaffold_5 AUGUSTUS transcript 1429620 1430021 0.62 + . g274.t1 Scaffold_5 AUGUSTUS start_codon 1429620 1429622 . + 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_5 AUGUSTUS CDS 1429620 1430021 0.62 + 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_5 AUGUSTUS stop_codon 1430019 1430021 . + 0 transcript_id "g274.t1"; gene_id "g274"; # protein sequence = [MVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAI # ILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVLITAIFAFKSSLLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g274 ### # start gene g275 Scaffold_5 AUGUSTUS gene 1434403 1435002 0.9 + . g275 Scaffold_5 AUGUSTUS transcript 1434403 1435002 0.9 + . g275.t1 Scaffold_5 AUGUSTUS start_codon 1434403 1434405 . + 0 transcript_id "g275.t1"; gene_id "g275"; Scaffold_5 AUGUSTUS CDS 1434403 1435002 0.9 + 0 transcript_id "g275.t1"; gene_id "g275"; Scaffold_5 AUGUSTUS stop_codon 1435000 1435002 . + 0 transcript_id "g275.t1"; gene_id "g275"; # protein sequence = [MSNPTPAPTTTTSNIHGKSLLREPSSFDGDKAQFKEWRRTLFAYIRDPRNRIVTDSERIDIAVSYMRGPKVSSWVQNY # TDDNFNDDEEEWKVTWKGFKDALNASFLDKGLTENAQEKLEHLRQGPNERAEDFFKEFEVIMRDAGYAKDAPYVIRLIEMNVKPKLIDQVYGTSNERI # EKFDELKQKIISIDDMWWRREEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g275 ### # start gene g276 Scaffold_5 AUGUSTUS gene 1435203 1436000 0.79 + . g276 Scaffold_5 AUGUSTUS transcript 1435203 1436000 0.79 + . g276.t1 Scaffold_5 AUGUSTUS start_codon 1435203 1435205 . + 0 transcript_id "g276.t1"; gene_id "g276"; Scaffold_5 AUGUSTUS CDS 1435203 1436000 0.79 + 0 transcript_id "g276.t1"; gene_id "g276"; Scaffold_5 AUGUSTUS stop_codon 1435998 1436000 . + 0 transcript_id "g276.t1"; gene_id "g276"; # protein sequence = [MFPLWQARPHCKVLSRESTEATVRQRHVEPDDTGGSGGYGQRIGFCPAPAVDAGLPGPISESASDFSSSSYVDSQFSF # EFGSTGTPNKNNLSTMTTRAEEKPVRYEPNTPEWVAQRLQMDKLLMAIGILRAWMPESRVREALEETVLAVRNLSHATTTEAVTNLKSRKRFVRGTRG # RELKLRTTIENIDNGVQIETEALLDSGATGSCINKDFVEHHQLTVKELPVKMPVYNADGTLNKNGSIEGYVQVRVAMRQEAGDGRSRYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g276 ### # start gene g277 Scaffold_5 AUGUSTUS gene 1436495 1437076 0.85 + . g277 Scaffold_5 AUGUSTUS transcript 1436495 1437076 0.85 + . g277.t1 Scaffold_5 AUGUSTUS start_codon 1436495 1436497 . + 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_5 AUGUSTUS CDS 1436495 1437076 0.85 + 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_5 AUGUSTUS stop_codon 1437074 1437076 . + 0 transcript_id "g277.t1"; gene_id "g277"; # protein sequence = [MAVTNLGKTDIFLGIDWLRYHNPSIDWKESTLTFEHCPDKCGYLPHYESPEDDGTEEKLVDGERIFWFDWDGYLSDQG # HIKVQTATTDAATPYLAEYADVFSKKDFDQMPERRPWDHAIELTPGSKPVDCKVYPLSPPEQKALDEFLEENLRSGRIRPSCSPMASPFFFVKKKDGT # LRPVQDYQKLDDMTVKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g277 ### # start gene g278 Scaffold_5 AUGUSTUS gene 1437667 1438782 0.43 + . g278 Scaffold_5 AUGUSTUS transcript 1437667 1438782 0.43 + . g278.t1 Scaffold_5 AUGUSTUS start_codon 1437667 1437669 . + 0 transcript_id "g278.t1"; gene_id "g278"; Scaffold_5 AUGUSTUS CDS 1437667 1438782 0.43 + 0 transcript_id "g278.t1"; gene_id "g278"; Scaffold_5 AUGUSTUS stop_codon 1438780 1438782 . + 0 transcript_id "g278.t1"; gene_id "g278"; # protein sequence = [MIGELPESGGYNAISVFVDHFTKRLRLFATHTTITSEGMARVYCDKVFPIHGMPRKIVHDRGPQYHACFMYKLLGIES # NYTTAYHPQTNGQTEWINQEIEHYIRLFVNHHQSDWHEWLPMMEFAYNDRVHSATKVSPFYADNGRHPYKGTTPKMTSQNPTAQEFADSMKRIREEVG # LALKKAAEDMKRQYDKHRNEAIKYKAGDKVWLEGTNIMTDRPMKKLGDKQFGPFKVLEKIGSSSYKLDIPRTWKRVHNVFNETHLSPYHEPQFPTQPR # NTEPPPEVVGEEKEYEVEEVVDARKYRNGIQYKVKWRGYGPHEMTWEPAANMTNAKEAFRTSTRSILTSPGLEPLNGSRFQLLNFPLNCSDKYLHQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g278 ### # start gene g279 Scaffold_5 AUGUSTUS gene 1444111 1444473 0.35 + . g279 Scaffold_5 AUGUSTUS transcript 1444111 1444473 0.35 + . g279.t1 Scaffold_5 AUGUSTUS start_codon 1444111 1444113 . + 0 transcript_id "g279.t1"; gene_id "g279"; Scaffold_5 AUGUSTUS CDS 1444111 1444473 0.35 + 0 transcript_id "g279.t1"; gene_id "g279"; Scaffold_5 AUGUSTUS stop_codon 1444471 1444473 . + 0 transcript_id "g279.t1"; gene_id "g279"; # protein sequence = [MSSYIRFVTDTPLPPVDLQEEGSADHEEVSVLQEGESGGTAAVPLFLPDSLSATPVASAASPSPLPPRFGSVANLAID # MTADEDEEDIYESSGSVERRNRVEGNPGGDDPMEGAPVGQGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g279 ### # start gene g280 Scaffold_5 AUGUSTUS gene 1445559 1446965 0.42 - . g280 Scaffold_5 AUGUSTUS transcript 1445559 1446965 0.42 - . g280.t1 Scaffold_5 AUGUSTUS stop_codon 1445559 1445561 . - 0 transcript_id "g280.t1"; gene_id "g280"; Scaffold_5 AUGUSTUS CDS 1445559 1446965 0.42 - 0 transcript_id "g280.t1"; gene_id "g280"; Scaffold_5 AUGUSTUS start_codon 1446963 1446965 . - 0 transcript_id "g280.t1"; gene_id "g280"; # protein sequence = [MDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPV # VLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAEL # LSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTSVIEALKRIARNEEESLVWEDGL # LKRGGRIYVPDIGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRAKPYGNLRPLPIGQRPWSSISLDHITQ # LPVTAGPEKYDAILVVVCRLTKQAIYVPCHTTDNAEDFANLFVTHVFSKHGMPSDITSDRGSLFVSQFWRELCRVLGIEARLSTAYHPKRTDKRNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g280 ### # start gene g281 Scaffold_5 AUGUSTUS gene 1450978 1453460 0.32 - . g281 Scaffold_5 AUGUSTUS transcript 1450978 1453460 0.32 - . g281.t1 Scaffold_5 AUGUSTUS stop_codon 1450978 1450980 . - 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_5 AUGUSTUS CDS 1450978 1452000 0.58 - 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_5 AUGUSTUS CDS 1452100 1452233 0.34 - 2 transcript_id "g281.t1"; gene_id "g281"; Scaffold_5 AUGUSTUS CDS 1452317 1453460 0.74 - 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_5 AUGUSTUS start_codon 1453458 1453460 . - 0 transcript_id "g281.t1"; gene_id "g281"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPQPLSEMTLRLEDVIRIQECIPDVAMVLREVLESMGIEILG # DGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGDRSETRGEYFPSSLIPMEGRRNSVAKQGYVYCTE # PLTTDQEPYAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSY # MVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPRVNLQTKPLTPVSTQRYQFG # EVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAPFGTPFVTGAQMNRPGMAFE # SARSQESVAMIQQQARVIETLQEQLREVKKGFTAGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGARMET # PR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g281 ### # start gene g282 Scaffold_5 AUGUSTUS gene 1454770 1455366 0.55 + . g282 Scaffold_5 AUGUSTUS transcript 1454770 1455366 0.55 + . g282.t1 Scaffold_5 AUGUSTUS start_codon 1454770 1454772 . + 0 transcript_id "g282.t1"; gene_id "g282"; Scaffold_5 AUGUSTUS CDS 1454770 1455366 0.55 + 0 transcript_id "g282.t1"; gene_id "g282"; Scaffold_5 AUGUSTUS stop_codon 1455364 1455366 . + 0 transcript_id "g282.t1"; gene_id "g282"; # protein sequence = [MLFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDNILIYSDDEASHVEHVRKVLERLRVNHLHAKPEKCAFHVDTVEYL # GVIISPLGVSMDPVKAVMDWPKPRTVKELQAFLGSANFYRRFIDNYLGITKVFTKLKDSVWNWTPQYSSAFELLKSACFGNYNPDLLVILECDASDLV # IAGILSQLDPETGEIHPIAFHA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g282 ### # start gene g283 Scaffold_5 AUGUSTUS gene 1460820 1461481 0.61 - . g283 Scaffold_5 AUGUSTUS transcript 1460820 1461481 0.61 - . g283.t1 Scaffold_5 AUGUSTUS stop_codon 1460820 1460822 . - 0 transcript_id "g283.t1"; gene_id "g283"; Scaffold_5 AUGUSTUS CDS 1460820 1461178 0.78 - 2 transcript_id "g283.t1"; gene_id "g283"; Scaffold_5 AUGUSTUS CDS 1461250 1461481 0.76 - 0 transcript_id "g283.t1"; gene_id "g283"; Scaffold_5 AUGUSTUS start_codon 1461479 1461481 . - 0 transcript_id "g283.t1"; gene_id "g283"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQLFAPFSPRRRNRGFGPATVPTTSTLPEAMEEEEQFEYSTLYTGDGQPVQVLTPRP # IACRTGKQPQHRANSQSPYDPPPHFDLDAGDHNDQDPPVDPDDPGADNNNPDNDKLDDGSGSLPRGEPGAPGGPGGPGGPHSPISPDIPNEQRVMLEL # LSGFKGSIETLGTVLFAALG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g283 ### # start gene g284 Scaffold_5 AUGUSTUS gene 1464620 1467020 0.23 + . g284 Scaffold_5 AUGUSTUS transcript 1464620 1467020 0.23 + . g284.t1 Scaffold_5 AUGUSTUS start_codon 1464620 1464622 . + 0 transcript_id "g284.t1"; gene_id "g284"; Scaffold_5 AUGUSTUS CDS 1464620 1464635 0.3 + 0 transcript_id "g284.t1"; gene_id "g284"; Scaffold_5 AUGUSTUS CDS 1465639 1467020 0.6 + 2 transcript_id "g284.t1"; gene_id "g284"; Scaffold_5 AUGUSTUS stop_codon 1467018 1467020 . + 0 transcript_id "g284.t1"; gene_id "g284"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEAKQKKLEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g284 ### # start gene g285 Scaffold_5 AUGUSTUS gene 1467059 1467607 0.52 + . g285 Scaffold_5 AUGUSTUS transcript 1467059 1467607 0.52 + . g285.t1 Scaffold_5 AUGUSTUS start_codon 1467059 1467061 . + 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_5 AUGUSTUS CDS 1467059 1467607 0.52 + 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_5 AUGUSTUS stop_codon 1467605 1467607 . + 0 transcript_id "g285.t1"; gene_id "g285"; # protein sequence = [MTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMP # EGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQD # SSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g285 ### # start gene g286 Scaffold_5 AUGUSTUS gene 1467637 1468526 0.84 + . g286 Scaffold_5 AUGUSTUS transcript 1467637 1468526 0.84 + . g286.t1 Scaffold_5 AUGUSTUS start_codon 1467637 1467639 . + 0 transcript_id "g286.t1"; gene_id "g286"; Scaffold_5 AUGUSTUS CDS 1467637 1468222 0.89 + 0 transcript_id "g286.t1"; gene_id "g286"; Scaffold_5 AUGUSTUS CDS 1468261 1468526 0.87 + 2 transcript_id "g286.t1"; gene_id "g286"; Scaffold_5 AUGUSTUS stop_codon 1468524 1468526 . + 0 transcript_id "g286.t1"; gene_id "g286"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDTIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVHGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQVWH # MKTIVIIQW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g286 ### # start gene g287 Scaffold_5 AUGUSTUS gene 1468581 1469462 0.93 + . g287 Scaffold_5 AUGUSTUS transcript 1468581 1469462 0.93 + . g287.t1 Scaffold_5 AUGUSTUS start_codon 1468581 1468583 . + 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_5 AUGUSTUS CDS 1468581 1469462 0.93 + 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_5 AUGUSTUS stop_codon 1469460 1469462 . + 0 transcript_id "g287.t1"; gene_id "g287"; # protein sequence = [MKIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLL # GRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGERFKGKFSFLDELSSDQGEDEYAISFHFD # EKQNIVLDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNEQFNLNPIKSFFLQNGRIKP # KPVRKKVQKRRFVEPILKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g287 ### # start gene g288 Scaffold_5 AUGUSTUS gene 1470924 1471187 0.95 + . g288 Scaffold_5 AUGUSTUS transcript 1470924 1471187 0.95 + . g288.t1 Scaffold_5 AUGUSTUS start_codon 1470924 1470926 . + 0 transcript_id "g288.t1"; gene_id "g288"; Scaffold_5 AUGUSTUS CDS 1470924 1471187 0.95 + 0 transcript_id "g288.t1"; gene_id "g288"; Scaffold_5 AUGUSTUS stop_codon 1471185 1471187 . + 0 transcript_id "g288.t1"; gene_id "g288"; # protein sequence = [MPEKNIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIDCPALR # PINFDWMFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g288 ### # start gene g289 Scaffold_5 AUGUSTUS gene 1471399 1472684 0.18 + . g289 Scaffold_5 AUGUSTUS transcript 1471399 1472684 0.18 + . g289.t1 Scaffold_5 AUGUSTUS start_codon 1471399 1471401 . + 0 transcript_id "g289.t1"; gene_id "g289"; Scaffold_5 AUGUSTUS CDS 1471399 1471700 0.2 + 0 transcript_id "g289.t1"; gene_id "g289"; Scaffold_5 AUGUSTUS CDS 1472423 1472684 0.5 + 1 transcript_id "g289.t1"; gene_id "g289"; Scaffold_5 AUGUSTUS stop_codon 1472682 1472684 . + 0 transcript_id "g289.t1"; gene_id "g289"; # protein sequence = [MQVILKALDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFI # MGDGKRKSRINLMTSKIKLTLEVRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLY # HRILINLINHN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g289 ### # start gene g290 Scaffold_5 AUGUSTUS gene 1472855 1473616 0.4 + . g290 Scaffold_5 AUGUSTUS transcript 1472855 1473616 0.4 + . g290.t1 Scaffold_5 AUGUSTUS start_codon 1472855 1472857 . + 0 transcript_id "g290.t1"; gene_id "g290"; Scaffold_5 AUGUSTUS CDS 1472855 1473616 0.4 + 0 transcript_id "g290.t1"; gene_id "g290"; Scaffold_5 AUGUSTUS stop_codon 1473614 1473616 . + 0 transcript_id "g290.t1"; gene_id "g290"; # protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE # VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDI # VESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDAKKLQSYEDSNENIDIQLKIGISNQVNWSRLEFWN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g290 ### # start gene g291 Scaffold_5 AUGUSTUS gene 1473660 1473965 0.75 + . g291 Scaffold_5 AUGUSTUS transcript 1473660 1473965 0.75 + . g291.t1 Scaffold_5 AUGUSTUS start_codon 1473660 1473662 . + 0 transcript_id "g291.t1"; gene_id "g291"; Scaffold_5 AUGUSTUS CDS 1473660 1473965 0.75 + 0 transcript_id "g291.t1"; gene_id "g291"; Scaffold_5 AUGUSTUS stop_codon 1473963 1473965 . + 0 transcript_id "g291.t1"; gene_id "g291"; # protein sequence = [MVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIF # DAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g291 ### # start gene g292 Scaffold_5 AUGUSTUS gene 1481856 1483022 0.9 + . g292 Scaffold_5 AUGUSTUS transcript 1481856 1483022 0.9 + . g292.t1 Scaffold_5 AUGUSTUS start_codon 1481856 1481858 . + 0 transcript_id "g292.t1"; gene_id "g292"; Scaffold_5 AUGUSTUS CDS 1481856 1483022 0.9 + 0 transcript_id "g292.t1"; gene_id "g292"; Scaffold_5 AUGUSTUS stop_codon 1483020 1483022 . + 0 transcript_id "g292.t1"; gene_id "g292"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g292 ### # start gene g293 Scaffold_5 AUGUSTUS gene 1483073 1484188 0.91 + . g293 Scaffold_5 AUGUSTUS transcript 1483073 1484188 0.91 + . g293.t1 Scaffold_5 AUGUSTUS start_codon 1483073 1483075 . + 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_5 AUGUSTUS CDS 1483073 1484188 0.91 + 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_5 AUGUSTUS stop_codon 1484186 1484188 . + 0 transcript_id "g293.t1"; gene_id "g293"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVMIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLETTLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYRSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g293 ### # start gene g294 Scaffold_5 AUGUSTUS gene 1495223 1495852 0.75 + . g294 Scaffold_5 AUGUSTUS transcript 1495223 1495852 0.75 + . g294.t1 Scaffold_5 AUGUSTUS start_codon 1495223 1495225 . + 0 transcript_id "g294.t1"; gene_id "g294"; Scaffold_5 AUGUSTUS CDS 1495223 1495852 0.75 + 0 transcript_id "g294.t1"; gene_id "g294"; Scaffold_5 AUGUSTUS stop_codon 1495850 1495852 . + 0 transcript_id "g294.t1"; gene_id "g294"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY # PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g294 ### # start gene g295 Scaffold_5 AUGUSTUS gene 1501407 1502564 0.97 + . g295 Scaffold_5 AUGUSTUS transcript 1501407 1502564 0.97 + . g295.t1 Scaffold_5 AUGUSTUS start_codon 1501407 1501409 . + 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_5 AUGUSTUS CDS 1501407 1502564 0.97 + 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_5 AUGUSTUS stop_codon 1502562 1502564 . + 0 transcript_id "g295.t1"; gene_id "g295"; # protein sequence = [MFGVRPTIYAGEKDKCASAASHLTGAALSHFDTLNRQRLKGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQ # MPEESFANFFICFNEYAPLTGFNDEALITYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLHGEKPLQGWLSRFPGLELAPE # APYKSPLRREREPADVWTSNPKPAATGRFQNRSNWKEGRQRASAAWGEGESYDSENREGDEDCCHCRDGGEWTEAVLRAGVTDTGRKWTPEERAEKWR # RRRQELCMRCGRKEHWAKDCPNPELLEHPAEDQGSSERASKADSTRGRGTANQGGGHKDDSTRPLEWIRAGIVVEEREGMDDLWNVHILDSPKGGEQE # LLDEVGNGQGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g295 ### # start gene g296 Scaffold_5 AUGUSTUS gene 1502777 1503880 0.77 + . g296 Scaffold_5 AUGUSTUS transcript 1502777 1503880 0.77 + . g296.t1 Scaffold_5 AUGUSTUS start_codon 1502777 1502779 . + 0 transcript_id "g296.t1"; gene_id "g296"; Scaffold_5 AUGUSTUS CDS 1502777 1503880 0.77 + 0 transcript_id "g296.t1"; gene_id "g296"; Scaffold_5 AUGUSTUS stop_codon 1503878 1503880 . + 0 transcript_id "g296.t1"; gene_id "g296"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTQLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQNRNVRIAAALASEIIQPGAEGGTEELGRGVNGEGIHKGTLQPPPEAPQQPPEAPQPPSEVPQQSPEAPLRAPRTGVKLEEVKDEEYEASQPG # PHKLFPSDRDLGPDDPILMGINEWLAFASESTGEEVEEILEAGRSAMEKVTPKPAKDSEEAYQKWKSRDTERSSSWPGAKQKVWWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTILLRSCTPCNRAKATRCLSAEDEWDSSEVINNTAVTPLVPGERE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g296 ### # start gene g297 Scaffold_5 AUGUSTUS gene 1506598 1507290 0.6 + . g297 Scaffold_5 AUGUSTUS transcript 1506598 1507290 0.6 + . g297.t1 Scaffold_5 AUGUSTUS start_codon 1506598 1506600 . + 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_5 AUGUSTUS CDS 1506598 1507290 0.6 + 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_5 AUGUSTUS stop_codon 1507288 1507290 . + 0 transcript_id "g297.t1"; gene_id "g297"; # protein sequence = [MPSDIVSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQAVEAYLRIYCSYDQDDWDLLLPMAEFVYNN # TPNTTTGVSPFFANKGYHPKLSITLELVQGAEVNEYASNLKELHAYLQERIRVANEVYAQYANQKRQEAPDWKEGDHVWLNMENVRTRRPMKKLDHKW # TGPYSILAKIGSHAYRLDLPGDLHKIHNVFHVDRLKPTSTTNSNARPPHLPQSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g297 ### # start gene g298 Scaffold_5 AUGUSTUS gene 1508697 1509124 0.85 - . g298 Scaffold_5 AUGUSTUS transcript 1508697 1509124 0.85 - . g298.t1 Scaffold_5 AUGUSTUS stop_codon 1508697 1508699 . - 0 transcript_id "g298.t1"; gene_id "g298"; Scaffold_5 AUGUSTUS CDS 1508697 1509001 0.91 - 2 transcript_id "g298.t1"; gene_id "g298"; Scaffold_5 AUGUSTUS CDS 1509061 1509124 0.85 - 0 transcript_id "g298.t1"; gene_id "g298"; Scaffold_5 AUGUSTUS start_codon 1509122 1509124 . - 0 transcript_id "g298.t1"; gene_id "g298"; # protein sequence = [MEDSRVLDQFPALDEALSGAPEYLGTLPEGAGRPSNATRERRVAVEKLITSTRKNSQLRTTLLHQQGLVDESNALATR # QRRLVEELQEEVHRVRGRAVFVEQMLKEYPDEGYYEVVLPLFAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g298 ### # start gene g299 Scaffold_5 AUGUSTUS gene 1516637 1517229 0.88 + . g299 Scaffold_5 AUGUSTUS transcript 1516637 1517229 0.88 + . g299.t1 Scaffold_5 AUGUSTUS start_codon 1516637 1516639 . + 0 transcript_id "g299.t1"; gene_id "g299"; Scaffold_5 AUGUSTUS CDS 1516637 1516788 0.88 + 0 transcript_id "g299.t1"; gene_id "g299"; Scaffold_5 AUGUSTUS CDS 1516878 1517229 0.89 + 1 transcript_id "g299.t1"; gene_id "g299"; Scaffold_5 AUGUSTUS stop_codon 1517227 1517229 . + 0 transcript_id "g299.t1"; gene_id "g299"; # protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTGSAKEWFVPDILDPDLDSLPAWTSSFK # ALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPDRRRSPIIVRSSSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g299 ### # start gene g300 Scaffold_5 AUGUSTUS gene 1530333 1530608 0.89 + . g300 Scaffold_5 AUGUSTUS transcript 1530333 1530608 0.89 + . g300.t1 Scaffold_5 AUGUSTUS start_codon 1530333 1530335 . + 0 transcript_id "g300.t1"; gene_id "g300"; Scaffold_5 AUGUSTUS CDS 1530333 1530608 0.89 + 0 transcript_id "g300.t1"; gene_id "g300"; Scaffold_5 AUGUSTUS stop_codon 1530606 1530608 . + 0 transcript_id "g300.t1"; gene_id "g300"; # protein sequence = [MDPGVESSDVVVEQPMGEGGPPSSLQVPLFLPEQESPTSPSPPPPSPLPASPLSIDLTGDDDKLYEMEVRVPEAREVE # VVAGEGMPKDEPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g300 ### # start gene g301 Scaffold_5 AUGUSTUS gene 1533442 1535811 0.98 - . g301 Scaffold_5 AUGUSTUS transcript 1533442 1535811 0.98 - . g301.t1 Scaffold_5 AUGUSTUS stop_codon 1533442 1533444 . - 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_5 AUGUSTUS CDS 1533442 1535678 1 - 2 transcript_id "g301.t1"; gene_id "g301"; Scaffold_5 AUGUSTUS CDS 1535766 1535811 0.98 - 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_5 AUGUSTUS start_codon 1535809 1535811 . - 0 transcript_id "g301.t1"; gene_id "g301"; # protein sequence = [MLHRQNCRYATPRKFDQFCGWNNSQGGVPSNSITPHGSNCARIAVATHAQPVIDWKELCLTFQDRNVRISAALASEIV # QPGAEGGTEEPGRGVNGEEIHEGPLQPPHEAPQQPPEAPQPPPEVPQQTPEALRAPRTRVKLEEVKDEEYEASQPGPHKLFPSDKDLGPDDPILMGIN # EWLAFANESMEEEVEEILEAGRSTMEKVAPNPAKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDLPTLDIESLNIPKIPSRSGLTPK # GSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASDSSATEGVQQPKDPESGDPSSEQGGV # VKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYINEMLGKGFIRSSSSPAGAPV # LFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLWKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSVFQFFMN # EIFHDMVDVCVVIYLDDILIYSDDEASHVGHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGF # ANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVILECDASDLAIAGILSQLDPETGRYILLPSMHDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g301 ### # start gene g302 Scaffold_5 AUGUSTUS gene 1537326 1538636 1 + . g302 Scaffold_5 AUGUSTUS transcript 1537326 1538636 1 + . g302.t1 Scaffold_5 AUGUSTUS start_codon 1537326 1537328 . + 0 transcript_id "g302.t1"; gene_id "g302"; Scaffold_5 AUGUSTUS CDS 1537326 1538636 1 + 0 transcript_id "g302.t1"; gene_id "g302"; Scaffold_5 AUGUSTUS stop_codon 1538634 1538636 . + 0 transcript_id "g302.t1"; gene_id "g302"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDL # DTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAAL # GRPSDSSESKTKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTFRWSVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGV # YDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFV # ARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g302 ### # start gene g303 Scaffold_5 AUGUSTUS gene 1546720 1547718 0.3 + . g303 Scaffold_5 AUGUSTUS transcript 1546720 1547718 0.3 + . g303.t1 Scaffold_5 AUGUSTUS start_codon 1546720 1546722 . + 0 transcript_id "g303.t1"; gene_id "g303"; Scaffold_5 AUGUSTUS CDS 1546720 1546777 0.3 + 0 transcript_id "g303.t1"; gene_id "g303"; Scaffold_5 AUGUSTUS CDS 1546826 1547718 0.77 + 2 transcript_id "g303.t1"; gene_id "g303"; Scaffold_5 AUGUSTUS stop_codon 1547716 1547718 . + 0 transcript_id "g303.t1"; gene_id "g303"; # protein sequence = [MIDNSPNELEPHTLSQRPLQPHTPSHQSPDTPQHSPFSQTLSNTLSRPSSTSTSFLVSDSPICSTSHLPEMATMFISP # IKERDARLLSHQPRTEYEVELQQALRRSNGLINQQKEWLMAMQAQNILQDMYTRRLRTQLEYQEEKAAGKKSTRLHVDGHPRLLTNAAFIELVEQSRQ # KKEEEEAEAARKKDAKTHAQKQLTSALLKWEAECQKIEEDNTKEMEKWETSVEVWKKEQELARTERRKPHWTKPMKPTYTSGVLVKPPTKPKLGDFVS # SRRTALTRKRQRANGNEAIEPEEDDSDEDSDEDDEGDGSSGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g303 ### # start gene g304 Scaffold_5 AUGUSTUS gene 1550736 1552729 0.2 + . g304 Scaffold_5 AUGUSTUS transcript 1550736 1552729 0.2 + . g304.t1 Scaffold_5 AUGUSTUS start_codon 1550736 1550738 . + 0 transcript_id "g304.t1"; gene_id "g304"; Scaffold_5 AUGUSTUS CDS 1550736 1551623 0.33 + 0 transcript_id "g304.t1"; gene_id "g304"; Scaffold_5 AUGUSTUS CDS 1551770 1552729 0.6 + 0 transcript_id "g304.t1"; gene_id "g304"; Scaffold_5 AUGUSTUS stop_codon 1552727 1552729 . + 0 transcript_id "g304.t1"; gene_id "g304"; # protein sequence = [MKFRPLVFRNTHPYIYVDRLQDLTPPELIRTSHSKCDRRISVYGYVRGTNWRGQGQKVHIPGVGDLLVESIEKMVDPV # PIIEKGGDEEKRRRMSEKRKLVVHAPMSDLGGVSFDKDAVYVNVKGSFTRREGEEVEEGEGEKMVMDLQEAGMTLDDAVKQTKIRLFGSSEKPLAVGG # NDDDDDEPSSADEVEDDFASVDDEGESSGSEAELDTLNKVQSDPRNTGRSQPRRPARSLPQAESTGKGLDFDSDSGDSDENEDEDAEEGFIVNDDDDD # ENYIEEEEDDEVEGEDGEDLDMHSSSSSSSSSLTAHAQKSNVDVDMDNEDDGFFFKKPSNDTANTLLDSSTTLSDLADKSKPEFSSAELNKWEDEDML # ESIRRLFITAVTETTGEDGGGDGAEDDDDDESGGDFVDFEATGGDPSLTSDSAPSTAKKIPDPPPISSSSRSALATKKALLKARFDEEYDDPSNSNPS # STFYDQKKAELTTQQSLNATAFASIQDPELRAQLEGYVPGTYVRVVLDGVPGEMVNFFDPEYPLIWVGWVLGRVFPYIHLHYILLSNCSHPILRPYPP # PSPPQTPPLPSSSPKIQRPSYPQHRLAAFPNTPHLFPRRPFYPNAYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g304 ### # start gene g305 Scaffold_5 AUGUSTUS gene 1556447 1557304 0.72 - . g305 Scaffold_5 AUGUSTUS transcript 1556447 1557304 0.72 - . g305.t1 Scaffold_5 AUGUSTUS stop_codon 1556447 1556449 . - 0 transcript_id "g305.t1"; gene_id "g305"; Scaffold_5 AUGUSTUS CDS 1556447 1557304 0.72 - 0 transcript_id "g305.t1"; gene_id "g305"; Scaffold_5 AUGUSTUS start_codon 1557302 1557304 . - 0 transcript_id "g305.t1"; gene_id "g305"; # protein sequence = [MGRMLGLDNESSPNSTDGTTSSSPIPYEHLYKASPSPAVPVCAYVSKMFAVRRGDLPEERENAKSAQAKAARDRKRVA # AEKLNEEVKVTDAGDGNDGNDDELQEKDQEDHQKDLDEDILLGFARIYSGTLSAGEQVLVLLPKFNPAMENTAASLNDISTAVVHPSNVQYVLGLPST # SSQSLVAQASKMHSSSQPTHPTRITIAALYLMMGRELLPVSSVSAGQIFAARFKYEFSSSTKSNQDLEEKTGNTKEEIESVVWRGGTIVRPPLHKVPA # LITRGSSTSVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g305 ### # start gene g306 Scaffold_5 AUGUSTUS gene 1557804 1558412 0.52 - . g306 Scaffold_5 AUGUSTUS transcript 1557804 1558412 0.52 - . g306.t1 Scaffold_5 AUGUSTUS stop_codon 1557804 1557806 . - 0 transcript_id "g306.t1"; gene_id "g306"; Scaffold_5 AUGUSTUS CDS 1557804 1558412 0.52 - 0 transcript_id "g306.t1"; gene_id "g306"; Scaffold_5 AUGUSTUS start_codon 1558410 1558412 . - 0 transcript_id "g306.t1"; gene_id "g306"; # protein sequence = [MAGKIRYMDSREDEQERGITMEASAVGLKYRVKDGDMYVLNMIDTPGHVDFQSEVSTASRLCDGALILVDVVEGVQTQ # TTSLLRQAYQDQLTPILVLNKIDRMIMELKLTPEEAYERLARVVEDVNVVMGGLWGGERMKKADNDTDTGVDASGGVTTKDDEEDDSGIYFDPAQGNV # IFASAIDSWGFSTFALCPNICEEIVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g306 ### # start gene g307 Scaffold_5 AUGUSTUS gene 1562997 1563425 0.97 + . g307 Scaffold_5 AUGUSTUS transcript 1562997 1563425 0.97 + . g307.t1 Scaffold_5 AUGUSTUS start_codon 1562997 1562999 . + 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_5 AUGUSTUS CDS 1562997 1563425 0.97 + 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_5 AUGUSTUS stop_codon 1563423 1563425 . + 0 transcript_id "g307.t1"; gene_id "g307"; # protein sequence = [MWIGHPDTPFEHWVLNIDKSNNFHTKKVSRNPKHPLKPSLYSKDYSSVNDPDWQYIDLDCEATFNSDSKMEDVFKDLV # NIPWTSAPIDSGGNCLDYVKAALELLAEGNFISAVPSKFTDRYNKYYVDVTKTVWKVEVTLPQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g307 ### # start gene g308 Scaffold_5 AUGUSTUS gene 1563978 1565196 0.43 - . g308 Scaffold_5 AUGUSTUS transcript 1563978 1565196 0.43 - . g308.t1 Scaffold_5 AUGUSTUS stop_codon 1563978 1563980 . - 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_5 AUGUSTUS CDS 1563978 1564327 0.68 - 2 transcript_id "g308.t1"; gene_id "g308"; Scaffold_5 AUGUSTUS CDS 1564491 1565196 0.43 - 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_5 AUGUSTUS start_codon 1565194 1565196 . - 0 transcript_id "g308.t1"; gene_id "g308"; # protein sequence = [MLVFAVRLHRYSERNNIHPDFNLAGHNDNTELAHVDFSYIRKEYGVPHMVGHRSSLANAMFDACKKETAITFHFKLSC # GGVKSWLPKPIFTVVPREGESYDVSVDVVLAADGIKSVVRPQILRELNIDAEVIDSGQSAYRIMLTREQMASDPEMLQLLDSDQVTRWIGERRHIIAY # PISNKSIYNISTAQPDVHFAAAPSATYTTRGSKADMLDNFKDFCPLVLRMLNLVPEGEIYQGAAQAIEDAGVLAVVLSKLPDRSPDSINKALKVYKHV # RKKRAETLVELAAASGRTLHLGEGAAREDRDKQFAALKDKGGPSPDKAVDAEVQKMILGTDVMQLARKNFENIFENL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g308 ### # start gene g309 Scaffold_5 AUGUSTUS gene 1579818 1581514 0.29 + . g309 Scaffold_5 AUGUSTUS transcript 1579818 1581514 0.29 + . g309.t1 Scaffold_5 AUGUSTUS start_codon 1579818 1579820 . + 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_5 AUGUSTUS CDS 1579818 1580073 0.97 + 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_5 AUGUSTUS CDS 1580145 1580580 0.5 + 2 transcript_id "g309.t1"; gene_id "g309"; Scaffold_5 AUGUSTUS CDS 1580706 1581063 0.63 + 1 transcript_id "g309.t1"; gene_id "g309"; Scaffold_5 AUGUSTUS CDS 1581185 1581514 0.81 + 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_5 AUGUSTUS stop_codon 1581512 1581514 . + 0 transcript_id "g309.t1"; gene_id "g309"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRPIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPAVPAVPAVLVDLV # DLVPQSLLTSPTSNVLCWNSSRGSRVPLRPLVPSSPLSAALLTALNPRARSRSQSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQ # GEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEFFVLTIPSGSSAPFTPKPKPFSGGKPNN # NGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g309 ### # start gene g310 Scaffold_5 AUGUSTUS gene 1583116 1584257 0.56 + . g310 Scaffold_5 AUGUSTUS transcript 1583116 1584257 0.56 + . g310.t1 Scaffold_5 AUGUSTUS start_codon 1583116 1583118 . + 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_5 AUGUSTUS CDS 1583116 1583198 0.56 + 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_5 AUGUSTUS CDS 1583282 1584257 0.72 + 1 transcript_id "g310.t1"; gene_id "g310"; Scaffold_5 AUGUSTUS stop_codon 1584255 1584257 . + 0 transcript_id "g310.t1"; gene_id "g310"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLDDIVVPMTRLTRKGAPGSGTAAVKRPSKISKSLYFCADTGPLGAESPTYRG # TDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQF # NMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVAGLELAKD # PSNERWSLGSDKLLRLDDRIYVLITAIFAFKSFAISMIIHSAISARTALSKLYVVNTPGPRSETLFVTTLPLHYLWSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g310 ### # start gene g311 Scaffold_5 AUGUSTUS gene 1588090 1588992 0.88 + . g311 Scaffold_5 AUGUSTUS transcript 1588090 1588992 0.88 + . g311.t1 Scaffold_5 AUGUSTUS start_codon 1588090 1588092 . + 0 transcript_id "g311.t1"; gene_id "g311"; Scaffold_5 AUGUSTUS CDS 1588090 1588992 0.88 + 0 transcript_id "g311.t1"; gene_id "g311"; Scaffold_5 AUGUSTUS stop_codon 1588990 1588992 . + 0 transcript_id "g311.t1"; gene_id "g311"; # protein sequence = [MFGIGYDELLHSSTSATKVLVELNMLDDQDSQAVDRSELRRFQEAQEQEALLAARRKRVNASPPPKVRSKKRRLTKVV # EEPVIEEVPRLVRLVIPPSRPAPSAPGSAPSTFARSSAALPLTSVQATGQLGSVQGPSPLARLADLVDQQTDSQAEASTRSLGPGSSPIKASLGDSNL # PKMSPVVRPPLVPRILSQHPYRVENERLAARIRLLESQLASSRQENATLTSALRDTSVSLEARQGELDQLRESVSSAAQQQELYDRLLDQVQTLKRAL # PGPPNEVCYLPTLTGLLLISFPVFSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g311 ### # start gene g312 Scaffold_5 AUGUSTUS gene 1591684 1593298 0.94 - . g312 Scaffold_5 AUGUSTUS transcript 1591684 1593298 0.94 - . g312.t1 Scaffold_5 AUGUSTUS stop_codon 1591684 1591686 . - 0 transcript_id "g312.t1"; gene_id "g312"; Scaffold_5 AUGUSTUS CDS 1591684 1592599 0.95 - 1 transcript_id "g312.t1"; gene_id "g312"; Scaffold_5 AUGUSTUS CDS 1592700 1593298 0.96 - 0 transcript_id "g312.t1"; gene_id "g312"; Scaffold_5 AUGUSTUS start_codon 1593296 1593298 . - 0 transcript_id "g312.t1"; gene_id "g312"; # protein sequence = [MSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKI # FTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEVSHVEHVRKVLERLRANHLH # AKPEKCAFHVDTVEYLGVIISPLGRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQLD # PETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAKP # DALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTSVIEALKRIARNEEESLVWEDGLLKRGGRIYVPDIGTLRREV # LQSYHDHKLRGHPGEKRTKKLVNQLFSGKGCPRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g312 ### # start gene g313 Scaffold_5 AUGUSTUS gene 1595570 1598446 0.39 - . g313 Scaffold_5 AUGUSTUS transcript 1595570 1598446 0.39 - . g313.t1 Scaffold_5 AUGUSTUS stop_codon 1595570 1595572 . - 0 transcript_id "g313.t1"; gene_id "g313"; Scaffold_5 AUGUSTUS CDS 1595570 1598446 0.39 - 0 transcript_id "g313.t1"; gene_id "g313"; Scaffold_5 AUGUSTUS start_codon 1598444 1598446 . - 0 transcript_id "g313.t1"; gene_id "g313"; # protein sequence = [MTLRLEDVIRIQECIPEDVAMVLREVLESMGIEIGRRSRILRPTSTVPNSGNSTGDRPPREGPAVADDPRERSDFLWL # YNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRILYRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDE # ESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMRHMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLE # RALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPRV # NLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAPF # GTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTAGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQA # TEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQG # GQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGR # STWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKRE # FGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPGCLYRLLPEGRNLDPTTSGPECSRSWTELYVRKRRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g313 ### # start gene g314 Scaffold_5 AUGUSTUS gene 1598536 1599165 0.72 - . g314 Scaffold_5 AUGUSTUS transcript 1598536 1599165 0.72 - . g314.t1 Scaffold_5 AUGUSTUS stop_codon 1598536 1598538 . - 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_5 AUGUSTUS CDS 1598536 1599165 0.72 - 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_5 AUGUSTUS start_codon 1599163 1599165 . - 0 transcript_id "g314.t1"; gene_id "g314"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY # PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g314 ### # start gene g315 Scaffold_5 AUGUSTUS gene 1601238 1601861 0.72 - . g315 Scaffold_5 AUGUSTUS transcript 1601238 1601861 0.72 - . g315.t1 Scaffold_5 AUGUSTUS stop_codon 1601238 1601240 . - 0 transcript_id "g315.t1"; gene_id "g315"; Scaffold_5 AUGUSTUS CDS 1601238 1601861 0.72 - 0 transcript_id "g315.t1"; gene_id "g315"; Scaffold_5 AUGUSTUS start_codon 1601859 1601861 . - 0 transcript_id "g315.t1"; gene_id "g315"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTILEWPVPRKIKDIQSFSGFANFYRRFIYNYSDIIVPMTRLTWKGAPWIWDNDC # QEAFENLKIAFTSAPILAHWEPNRPIIMETDTSDYTIAAILSIQTVDGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDIV # TNHKNLEYFSTTKILTCRQVCWSEYSTNSTW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g315 ### # start gene g316 Scaffold_5 AUGUSTUS gene 1606411 1606869 0.35 - . g316 Scaffold_5 AUGUSTUS transcript 1606411 1606869 0.35 - . g316.t1 Scaffold_5 AUGUSTUS stop_codon 1606411 1606413 . - 0 transcript_id "g316.t1"; gene_id "g316"; Scaffold_5 AUGUSTUS CDS 1606411 1606869 0.35 - 0 transcript_id "g316.t1"; gene_id "g316"; Scaffold_5 AUGUSTUS start_codon 1606867 1606869 . - 0 transcript_id "g316.t1"; gene_id "g316"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVKQARKYTKGTLQSPPEAPQQPPEAPQNSRTSQHLKSSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g316 ### # start gene g317 Scaffold_5 AUGUSTUS gene 1610591 1611367 1 - . g317 Scaffold_5 AUGUSTUS transcript 1610591 1611367 1 - . g317.t1 Scaffold_5 AUGUSTUS stop_codon 1610591 1610593 . - 0 transcript_id "g317.t1"; gene_id "g317"; Scaffold_5 AUGUSTUS CDS 1610591 1611367 1 - 0 transcript_id "g317.t1"; gene_id "g317"; Scaffold_5 AUGUSTUS start_codon 1611365 1611367 . - 0 transcript_id "g317.t1"; gene_id "g317"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g317 ### # start gene g318 Scaffold_5 AUGUSTUS gene 1612830 1613312 0.27 + . g318 Scaffold_5 AUGUSTUS transcript 1612830 1613312 0.27 + . g318.t1 Scaffold_5 AUGUSTUS start_codon 1612830 1612832 . + 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_5 AUGUSTUS CDS 1612830 1613312 0.27 + 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_5 AUGUSTUS stop_codon 1613310 1613312 . + 0 transcript_id "g318.t1"; gene_id "g318"; # protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKA # LSMELHYTSGYHPEADGQTSVSIRLSSSTSGSIAPTNKMTGRLYFRSPSSPITTLPMLPLVLLHSSLTKDTTQTSPFGPRST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g318 ### # start gene g319 Scaffold_5 AUGUSTUS gene 1628681 1629142 0.95 - . g319 Scaffold_5 AUGUSTUS transcript 1628681 1629142 0.95 - . g319.t1 Scaffold_5 AUGUSTUS stop_codon 1628681 1628683 . - 0 transcript_id "g319.t1"; gene_id "g319"; Scaffold_5 AUGUSTUS CDS 1628681 1629142 0.95 - 0 transcript_id "g319.t1"; gene_id "g319"; Scaffold_5 AUGUSTUS start_codon 1629140 1629142 . - 0 transcript_id "g319.t1"; gene_id "g319"; # protein sequence = [MEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYP # LSEKELVALKDFIDKQLATGAITPSSSPHGARSFLSRRKTANFAFASISVDSIVSPKRIVTHSHSFRSSRRSEKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g319 ### # start gene g320 Scaffold_5 AUGUSTUS gene 1630598 1631458 1 - . g320 Scaffold_5 AUGUSTUS transcript 1630598 1631458 1 - . g320.t1 Scaffold_5 AUGUSTUS stop_codon 1630598 1630600 . - 0 transcript_id "g320.t1"; gene_id "g320"; Scaffold_5 AUGUSTUS CDS 1630598 1631458 1 - 0 transcript_id "g320.t1"; gene_id "g320"; Scaffold_5 AUGUSTUS start_codon 1631456 1631458 . - 0 transcript_id "g320.t1"; gene_id "g320"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGNNPNVAASESPRDPPPHFDLD # TGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGSRVPLRPLVPSSPLSA # VPLTALNQEQGQGAEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYD # AQGEAEDSLSVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g320 ### # start gene g321 Scaffold_5 AUGUSTUS gene 1633832 1635169 0.24 + . g321 Scaffold_5 AUGUSTUS transcript 1633832 1635169 0.24 + . g321.t1 Scaffold_5 AUGUSTUS start_codon 1633832 1633834 . + 0 transcript_id "g321.t1"; gene_id "g321"; Scaffold_5 AUGUSTUS CDS 1633832 1634212 0.56 + 0 transcript_id "g321.t1"; gene_id "g321"; Scaffold_5 AUGUSTUS CDS 1634351 1634610 0.48 + 0 transcript_id "g321.t1"; gene_id "g321"; Scaffold_5 AUGUSTUS CDS 1634659 1635169 0.55 + 1 transcript_id "g321.t1"; gene_id "g321"; Scaffold_5 AUGUSTUS stop_codon 1635167 1635169 . + 0 transcript_id "g321.t1"; gene_id "g321"; # protein sequence = [MALYSTIEASKEVLLSTFDKDLPVLPGIRELVDSVEFSTDSAEPLIPIVLKAHESFASLKGLEGIIAVALCKKRFGED # TKVKALVNCNHAALFPAMSFLSTVDGIPKWGSEMKNKIMGMSVDDGIYRRGVSLLNGLSSLDATPTLKALGLPPYDEGKNEKKVAQRAIEVSTQRYTS # EDLDKMIRDIKQAGSPCLTRAEFLASSHVRIERERTQVPLFELSQLESTSPTLKLSLEGPNILSGVKILDLSRVIAGPVISRTLAEYGAQVLRVTNHN # LPDQSYYAVDFNFGKRTIDLDLKSSEGRQAFEKLLEDVDVIVDGYRPGAIAKLGYGPDELRKRFLENEALFMSKKAVMEMEASGRIDLDGSRSPTQCA # PSLLYTVDLLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g321 ### # start gene g322 Scaffold_5 AUGUSTUS gene 1640397 1641356 0.75 + . g322 Scaffold_5 AUGUSTUS transcript 1640397 1641356 0.75 + . g322.t1 Scaffold_5 AUGUSTUS start_codon 1640397 1640399 . + 0 transcript_id "g322.t1"; gene_id "g322"; Scaffold_5 AUGUSTUS CDS 1640397 1640913 0.76 + 0 transcript_id "g322.t1"; gene_id "g322"; Scaffold_5 AUGUSTUS CDS 1641031 1641356 0.76 + 2 transcript_id "g322.t1"; gene_id "g322"; Scaffold_5 AUGUSTUS stop_codon 1641354 1641356 . + 0 transcript_id "g322.t1"; gene_id "g322"; # protein sequence = [MRTHPRECRIPDSVSYSQAALAEPLSVLLHASRRAGICPASSYPSLGSSTSFSTTSTTSTSSSAAGKKVLVFGVGAIG # LIACALAQELGAERVCAVDINNDRLAFAARERFTTSEGNSTYCLPLPPKITSMEPNPKEPENIRRAKENAANALAVFDEPDGFDVIFECTGAESLGMG # SPILSSFPISAAATREVDLIGSFRYADTYNEAVELLSGSNLLTSSCKGGHTNGVQAVQNAGFSQKLSKLVTHRYPLSQAKEAFELLARGRDDHGGMVL # KVMIES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g322 ### # start gene g323 Scaffold_5 AUGUSTUS gene 1647338 1648435 0.76 - . g323 Scaffold_5 AUGUSTUS transcript 1647338 1648435 0.76 - . g323.t1 Scaffold_5 AUGUSTUS stop_codon 1647338 1647340 . - 0 transcript_id "g323.t1"; gene_id "g323"; Scaffold_5 AUGUSTUS CDS 1647338 1648435 0.76 - 0 transcript_id "g323.t1"; gene_id "g323"; Scaffold_5 AUGUSTUS start_codon 1648433 1648435 . - 0 transcript_id "g323.t1"; gene_id "g323"; # protein sequence = [MKKPLIIRGPLPDFAPSMSSNSRLKLSARTDKRNSQSLDPIYTAISSAPSSLISHPASHRKLLVLDLNGTLLFRPKRY # TKPAHDAHGSVRLRVIHPRPYITSFREYLFHPQTKIWLDTMVWSSAQPPSVKDMVQRCFGDRHGELKAVWARDTLDLDPIAYRAYGVSLSPFISLKGL # RFQTRNLLQLRTSTSYGRRSLHILPKLRFSSMILHKKRGFNLGTISLSKNTDTPNARANLSHLWGSSHPDKQQDDVVPDVSDLFDNLTLSPSMLKTSL # APPPSSDAFDSILLAVIGILDAVKYHDNVSGWLKSGGIVLCGAEGMTGGGGGIIGDRWFDTVHIVNWWANKGRAALAELNIDEVAGLVANK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g323 ### # start gene g324 Scaffold_5 AUGUSTUS gene 1649147 1650164 0.48 + . g324 Scaffold_5 AUGUSTUS transcript 1649147 1650164 0.48 + . g324.t1 Scaffold_5 AUGUSTUS start_codon 1649147 1649149 . + 0 transcript_id "g324.t1"; gene_id "g324"; Scaffold_5 AUGUSTUS CDS 1649147 1649728 0.49 + 0 transcript_id "g324.t1"; gene_id "g324"; Scaffold_5 AUGUSTUS CDS 1649871 1650164 0.87 + 0 transcript_id "g324.t1"; gene_id "g324"; Scaffold_5 AUGUSTUS stop_codon 1650162 1650164 . + 0 transcript_id "g324.t1"; gene_id "g324"; # protein sequence = [MLAFAHPGEEEHHHDRRAELNVREFKAAAKRGFSACSEKLQRRDFHNRAAERRAAKVDSYRRHNGLSARDTNTTADTS # HLSSANYTSGTPESTIFASNGTCILNPEGETGPYWVKGELIRSDLREEQPGVPITIEGQFVDVETCEPIVGLYWDIWNCNSTGVYSGLVAMGNGNSDD # ESNMNSTFCVVSSRLMMRVFWDQDLINDVEATYPYNTNTIVITENVDDRVFSTETEDTTSDPVLEYVYLGSNLSDGLFAWVTIAVNTSATYDPNYSFV # WTSDGSIAESGGELTVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g324 ### # start gene g325 Scaffold_5 AUGUSTUS gene 1653218 1653972 0.58 + . g325 Scaffold_5 AUGUSTUS transcript 1653218 1653972 0.58 + . g325.t1 Scaffold_5 AUGUSTUS start_codon 1653218 1653220 . + 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_5 AUGUSTUS CDS 1653218 1653233 0.58 + 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_5 AUGUSTUS CDS 1653314 1653972 0.69 + 2 transcript_id "g325.t1"; gene_id "g325"; Scaffold_5 AUGUSTUS stop_codon 1653970 1653972 . + 0 transcript_id "g325.t1"; gene_id "g325"; # protein sequence = [MLAASMFPQDLTYGFYSLRKKHGDPTKPLDWAIVEATAITEEGYIVPGASVGASPEILQSAEKIIIEVNTRIPSLEGL # HDINHSWIPPHRQPYLITHPSDRIGLTAIPIDPDRVVAVIEGNKPDNTGENAPETAESRAIAKHLIEFLSGEVDAGRLPRSLLPLQSGIGNVANSIIG # GLAEGPFDNVQVWTEVLQGEIPCPNKDVSFCLIMGLRYVPPVLRFRKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g325 ### # start gene g326 Scaffold_5 AUGUSTUS gene 1655550 1656590 0.44 - . g326 Scaffold_5 AUGUSTUS transcript 1655550 1656590 0.44 - . g326.t1 Scaffold_5 AUGUSTUS stop_codon 1655550 1655552 . - 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_5 AUGUSTUS CDS 1655550 1656065 0.78 - 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_5 AUGUSTUS CDS 1656462 1656590 0.44 - 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_5 AUGUSTUS start_codon 1656588 1656590 . - 0 transcript_id "g326.t1"; gene_id "g326"; # protein sequence = [MSGLTPKSPSTAATSPQQLADGDVSAQISQLNLGEPVDDNLRVSWLGKPHFLLEGVIHTVFEGDTQHEEWTKVKHVPH # SRVAAVLDGSWRGLIRWKRVGFGSYPAATPSASSSPNPSHIALPSASNRSYGAASKADLTGPSAEFNTLIDLSTLWVVPKQVRPLEKQLPTESRKLWE # GVTSRLLKKDFSEATKEKVVIEQKQRDEAAERKKKGVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g326 ### # start gene g327 Scaffold_5 AUGUSTUS gene 1665930 1666316 0.71 - . g327 Scaffold_5 AUGUSTUS transcript 1665930 1666316 0.71 - . g327.t1 Scaffold_5 AUGUSTUS stop_codon 1665930 1665932 . - 0 transcript_id "g327.t1"; gene_id "g327"; Scaffold_5 AUGUSTUS CDS 1665930 1666316 0.71 - 0 transcript_id "g327.t1"; gene_id "g327"; Scaffold_5 AUGUSTUS start_codon 1666314 1666316 . - 0 transcript_id "g327.t1"; gene_id "g327"; # protein sequence = [MRFDPERQYESTSSRTDAPAGATIPVSSLVPFSELPSSFDYSGFLSPMNPPSGPMTDELNTEANSLTPAHPFHNPGIT # RSSTSLSAANSQEDPCRVAVRDNSEDSAIFSPAPLPSRRLSALRLTFILN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g327 ### # start gene g328 Scaffold_5 AUGUSTUS gene 1677504 1677932 0.87 + . g328 Scaffold_5 AUGUSTUS transcript 1677504 1677932 0.87 + . g328.t1 Scaffold_5 AUGUSTUS start_codon 1677504 1677506 . + 0 transcript_id "g328.t1"; gene_id "g328"; Scaffold_5 AUGUSTUS CDS 1677504 1677932 0.87 + 0 transcript_id "g328.t1"; gene_id "g328"; Scaffold_5 AUGUSTUS stop_codon 1677930 1677932 . + 0 transcript_id "g328.t1"; gene_id "g328"; # protein sequence = [MPNTPCTGHEDRAWHIAWNPAKSLLASCSADKSVKLFTYSHDGEGTLNFTLAASIPTGHLKTVRSVAWSPSGRTLATA # SFDSNIGIWEQELDDDGNPGEWECASLLEGHETECKSVAYSSTGTLLASCSRDKTVWIWEGVCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g328 ### # start gene g329 Scaffold_5 AUGUSTUS gene 1683386 1684398 0.46 + . g329 Scaffold_5 AUGUSTUS transcript 1683386 1684398 0.46 + . g329.t1 Scaffold_5 AUGUSTUS start_codon 1683386 1683388 . + 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_5 AUGUSTUS CDS 1683386 1683908 0.51 + 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_5 AUGUSTUS CDS 1684013 1684398 0.71 + 2 transcript_id "g329.t1"; gene_id "g329"; Scaffold_5 AUGUSTUS stop_codon 1684396 1684398 . + 0 transcript_id "g329.t1"; gene_id "g329"; # protein sequence = [MFTAVEVLDGENMVGCRRCWKLANGWYEEREKKREGKRGRERIREEDEEDEYGNDDSEDENSTEEDSGDEDDEDDHER # GSESEDTSPTTSGSIEEVPGSAANLRTTSSAPASPTLTHKPLSSFSSPHLGLYAHGNKSDAFSVISSPPDVAGNSNLQTSSSTTPQSLVDTNNQQRTK # PDDKSLFRRSEVFTDATPSTDSSELLHLVSSSTNSHIGTGISASTSTNYSSDVDGGESDTTSISTTASAAASGQSVESLADTSMTNPSTTPSAVLFET # NGNNGQQHHRTIIIQISIFIDEEESQEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g329 ### # start gene g330 Scaffold_5 AUGUSTUS gene 1688105 1688815 0.48 + . g330 Scaffold_5 AUGUSTUS transcript 1688105 1688815 0.48 + . g330.t1 Scaffold_5 AUGUSTUS start_codon 1688105 1688107 . + 0 transcript_id "g330.t1"; gene_id "g330"; Scaffold_5 AUGUSTUS CDS 1688105 1688815 0.48 + 0 transcript_id "g330.t1"; gene_id "g330"; Scaffold_5 AUGUSTUS stop_codon 1688813 1688815 . + 0 transcript_id "g330.t1"; gene_id "g330"; # protein sequence = [MYSNLYKPGTIRSSETSVRLSSSRDPYRYKQEWDYGVHWREDDEFDNEDEDEEDELSEEIENGEAQARWGQKRTILWD # TSGSQPSMARFQMIKVLLYMCVVPHFFLCLLQRFLQFHSSLSDSECPVQVQITLFKGPIPSRAGAGNTPYIFQARGHVYLSPLEDDELDPEEDYAEDL # KMDIDIDTWNEPKNAFAKFLLIQWVSRLQIFIRYVVCAVTSKYVLNSCAVATRFEFILYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g330 ### # start gene g331 Scaffold_5 AUGUSTUS gene 1695441 1696679 0.9 + . g331 Scaffold_5 AUGUSTUS transcript 1695441 1696679 0.9 + . g331.t1 Scaffold_5 AUGUSTUS start_codon 1695441 1695443 . + 0 transcript_id "g331.t1"; gene_id "g331"; Scaffold_5 AUGUSTUS CDS 1695441 1696679 0.9 + 0 transcript_id "g331.t1"; gene_id "g331"; Scaffold_5 AUGUSTUS stop_codon 1696677 1696679 . + 0 transcript_id "g331.t1"; gene_id "g331"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTQTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANTMSSSSLAFNRVFKEVPASAAPRVPRNQFCYASLLFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g331 ### # start gene g332 Scaffold_5 AUGUSTUS gene 1710520 1711200 0.99 - . g332 Scaffold_5 AUGUSTUS transcript 1710520 1711200 0.99 - . g332.t1 Scaffold_5 AUGUSTUS stop_codon 1710520 1710522 . - 0 transcript_id "g332.t1"; gene_id "g332"; Scaffold_5 AUGUSTUS CDS 1710520 1711200 0.99 - 0 transcript_id "g332.t1"; gene_id "g332"; Scaffold_5 AUGUSTUS start_codon 1711198 1711200 . - 0 transcript_id "g332.t1"; gene_id "g332"; # protein sequence = [MSDPSQPAQPAQSAPTPPTANNLMTQLIKQVANLATAMEECSSARSSMNKPKVFKGKDSAEARRFMAQFQNWASEQPD # LTKSQAKLIKSTLRFFTESAGDWATPHLLHFNAENPPFGGIWEEFLKEFVQHFESVDPGMEAHSEIKNLKQGKGQTVVEFTQKFKDIGDQTGMSDIDL # REHFFTALLLEIQQNLIIVNIAQGLAPTLKEAIKQAISVDVYMHNPTMTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g332 ### # start gene g333 Scaffold_5 AUGUSTUS gene 1713595 1714579 0.37 + . g333 Scaffold_5 AUGUSTUS transcript 1713595 1714579 0.37 + . g333.t1 Scaffold_5 AUGUSTUS start_codon 1713595 1713597 . + 0 transcript_id "g333.t1"; gene_id "g333"; Scaffold_5 AUGUSTUS CDS 1713595 1714226 0.48 + 0 transcript_id "g333.t1"; gene_id "g333"; Scaffold_5 AUGUSTUS CDS 1714324 1714579 0.57 + 1 transcript_id "g333.t1"; gene_id "g333"; Scaffold_5 AUGUSTUS stop_codon 1714577 1714579 . + 0 transcript_id "g333.t1"; gene_id "g333"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTASVFDITDPSQMISWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDELKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIQLESLIPRELTEEQQQMVALNKDLMEA # NMKEIRAVKSLQSHFKEGQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g333 ### # start gene g334 Scaffold_5 AUGUSTUS gene 1734046 1734622 0.41 + . g334 Scaffold_5 AUGUSTUS transcript 1734046 1734622 0.41 + . g334.t1 Scaffold_5 AUGUSTUS start_codon 1734046 1734048 . + 0 transcript_id "g334.t1"; gene_id "g334"; Scaffold_5 AUGUSTUS CDS 1734046 1734182 0.41 + 0 transcript_id "g334.t1"; gene_id "g334"; Scaffold_5 AUGUSTUS CDS 1734271 1734622 0.86 + 1 transcript_id "g334.t1"; gene_id "g334"; Scaffold_5 AUGUSTUS stop_codon 1734620 1734622 . + 0 transcript_id "g334.t1"; gene_id "g334"; # protein sequence = [MLNMRFEGTDTSLMVLPDPNERLEGEDGGDGGEDFLKAFRRVYKAEFIVQQVRGIGKTFDTLGESVYNEVEKLQSSNA # IKAVNSFDPSLSPAKPDKADATWSVYFDEPVGRVDNTPVFQLEKLEIGDEVHGPAMIIDDTQTIVVIPGARALLTSKHLYITLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g334 ### # start gene g335 Scaffold_5 AUGUSTUS gene 1747754 1748155 0.79 - . g335 Scaffold_5 AUGUSTUS transcript 1747754 1748155 0.79 - . g335.t1 Scaffold_5 AUGUSTUS stop_codon 1747754 1747756 . - 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_5 AUGUSTUS CDS 1747754 1748155 0.79 - 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_5 AUGUSTUS start_codon 1748153 1748155 . - 0 transcript_id "g335.t1"; gene_id "g335"; # protein sequence = [MSTWTHSASSKWAEEVAMASMQKSSQNADEPSTTSMSFDLPIPVVQKQPSDSSLRRNFTFVSRLNCALYSKTTNIFRR # VQKTLAAPSSSTVVRESLEGIQHALDNNRYALEEDQAVKVEEVNEDESCRRSCGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g335 ### # start gene g336 Scaffold_5 AUGUSTUS gene 1750340 1752992 0.18 - . g336 Scaffold_5 AUGUSTUS transcript 1750340 1752992 0.18 - . g336.t1 Scaffold_5 AUGUSTUS stop_codon 1750340 1750342 . - 0 transcript_id "g336.t1"; gene_id "g336"; Scaffold_5 AUGUSTUS CDS 1750340 1751175 0.56 - 2 transcript_id "g336.t1"; gene_id "g336"; Scaffold_5 AUGUSTUS CDS 1751252 1752992 0.21 - 0 transcript_id "g336.t1"; gene_id "g336"; Scaffold_5 AUGUSTUS start_codon 1752990 1752992 . - 0 transcript_id "g336.t1"; gene_id "g336"; # protein sequence = [MKDGRMVEAGYRYDLERSMDESGEEGEFMRLARNQGILSGDDEDESSPRSPEFDIEFAPEGFESEAFDAASLEVHQPF # SHRLTMGASMMGGWMFDVVADLTKGSTNPTQASKPPSRISRALSPSRFSRALSPVPKNRNTTLSPLPPAFSPLSINTQTRPRRPSSVSIPSPLHLDTM # SPFNDAAAVPEQSKAPRQRRYSLQFEPATPTGLTFADLQKQGLDEKRALERSAQSVSIRRRQTRREVLGLDAEKLEIVTPIASEATPIVNEIGFWQLI # RALYPSMPYKPLLFIGLLICVISGAMTPIFSFLLSRLLFEVSTGVQDVRTVNEYGGLVLGMAALDGLLMGVKFFLMQSLGWMWIERIRESAFARLVSM # PKSFFDAGVVGKEKPSPNSAARTSPVALTQILTKSAEDAKNLLAVVAGQALVVFSMLAVGLIWAFVIGWQFTLIGLAIAPVFAGVMSIQSKFVADTER # KNKAARESVASAYYDAVANIRSIRYTGLTTVFQQRFDVSLDRAMSIGVKGAMVEGCTYGVASGLIYAAEALLFYVGAVLVAKGTYTYLQMVEVLDLVV # FTVTIGSQLMAFMQAARDLHAVLELPTDTSETQGFLRPEFQHTPLPIVFHDVEFSYPSRPDVPVLKGLNLSIAPGETVALVGASGCGKSTVAQLIQRL # YEPSSGSVQVADIDTRAMDIQHLRQHVSVVSQQAHLFDASVAENIAYGNSSISEVGIRKAAKAANIHDWVMSLEKGYDTIVGENASQLSGGQAQRLQI # ARALARPCRILILDECTSALDPENQREVLDTIQGLDRKGRTTVMVTHKVPAMKMCDRILVVDNGRIVEEGKYDELVQRRGVFATLASGGEWFGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g336 ### # start gene g337 Scaffold_5 AUGUSTUS gene 1753156 1754391 0.49 - . g337 Scaffold_5 AUGUSTUS transcript 1753156 1754391 0.49 - . g337.t1 Scaffold_5 AUGUSTUS stop_codon 1753156 1753158 . - 0 transcript_id "g337.t1"; gene_id "g337"; Scaffold_5 AUGUSTUS CDS 1753156 1754391 0.49 - 0 transcript_id "g337.t1"; gene_id "g337"; Scaffold_5 AUGUSTUS start_codon 1754389 1754391 . - 0 transcript_id "g337.t1"; gene_id "g337"; # protein sequence = [MNERKDGGQLATLLERTFTFISTVKAFTAVPFHKAKLHNLLTGRMRSNEISLNAIWGLSSGSSQFVMMSMFVQAFWFG # SKLVREGTIQPGAVMSVFWACLIATSNLQMCVPQLVTVGKGKVAMAALMALVKENPDYQPDVEVLPPSHPYNTPSTPMSATFPPHSPASSATLTTYSA # RPGRSIHRSSTTKSRVLRKIRPSRFKGDINLNQVCFAYPSRPNHPVLIDVDMYIPAGEITFIVGSSGSGKSSLAGIIAGLYKLNHKEGSSGEVLLDEQ # NLQYLDPVFVAANVGIVSQSPPVLLGGQSVHDNVAVALAAHPERTMESATEAEVVNACTLAMLHEFIRDLPEGYNTILGGDGSVGRQSEDDAGIQLSG # GQKQRLALARARLRNPSLLILGEYCAVFLFVSSLIQTLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g337 ### # start gene g338 Scaffold_5 AUGUSTUS gene 1754629 1755189 0.69 - . g338 Scaffold_5 AUGUSTUS transcript 1754629 1755189 0.69 - . g338.t1 Scaffold_5 AUGUSTUS stop_codon 1754629 1754631 . - 0 transcript_id "g338.t1"; gene_id "g338"; Scaffold_5 AUGUSTUS CDS 1754629 1755189 0.69 - 0 transcript_id "g338.t1"; gene_id "g338"; Scaffold_5 AUGUSTUS start_codon 1755187 1755189 . - 0 transcript_id "g338.t1"; gene_id "g338"; # protein sequence = [MPSRRPEPIDSDLQTLSSVETIEKPEPVSEVSSTPTHTPSPPSISTGSFKQLFSLLSTRHRFLILLPAIISSVIAGGI # APFMTIVIGQNFNAFAQFPQTPNPSESAKHQLLHDVGIAALELLGLAVGSFLLSAITSSLWIWTGEHNVREVRRRVFGSVLSQEMKWFDMKTQGDSVG # AAGLMAQFNQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g338 ### # start gene g339 Scaffold_5 AUGUSTUS gene 1767058 1767861 0.99 + . g339 Scaffold_5 AUGUSTUS transcript 1767058 1767861 0.99 + . g339.t1 Scaffold_5 AUGUSTUS start_codon 1767058 1767060 . + 0 transcript_id "g339.t1"; gene_id "g339"; Scaffold_5 AUGUSTUS CDS 1767058 1767861 0.99 + 0 transcript_id "g339.t1"; gene_id "g339"; Scaffold_5 AUGUSTUS stop_codon 1767859 1767861 . + 0 transcript_id "g339.t1"; gene_id "g339"; # protein sequence = [MIKTLLSTPTIRAPTTHDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGF # KGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSS # FKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRRSSSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g339 ### # start gene g340 Scaffold_5 AUGUSTUS gene 1770524 1771684 0.83 + . g340 Scaffold_5 AUGUSTUS transcript 1770524 1771684 0.83 + . g340.t1 Scaffold_5 AUGUSTUS start_codon 1770524 1770526 . + 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_5 AUGUSTUS CDS 1770524 1771684 0.83 + 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_5 AUGUSTUS stop_codon 1771682 1771684 . + 0 transcript_id "g340.t1"; gene_id "g340"; # protein sequence = [MVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAI # ILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLPAISARTALSKLYVVNTPGPRSETLFVTTLPLALSVVA # ISPAVRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFR # ALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVV # NLDELHVSFERKSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g340 ### # start gene g341 Scaffold_5 AUGUSTUS gene 1774423 1774917 0.69 + . g341 Scaffold_5 AUGUSTUS transcript 1774423 1774917 0.69 + . g341.t1 Scaffold_5 AUGUSTUS start_codon 1774423 1774425 . + 0 transcript_id "g341.t1"; gene_id "g341"; Scaffold_5 AUGUSTUS CDS 1774423 1774917 0.69 + 0 transcript_id "g341.t1"; gene_id "g341"; Scaffold_5 AUGUSTUS stop_codon 1774915 1774917 . + 0 transcript_id "g341.t1"; gene_id "g341"; # protein sequence = [MLSLRHLSRDSKVTDTIWATYSTNTALPVTSTQSTQPPPSSAHSALSKTYLYNFLTPFRSGVYLPNPPRDNMPSTFQS # HCQLHQPEHWSDDWWNQQDHDDQSFNINTLHHPTVPVAQKENDQTVAELLKIDEEKKKTTTGECDIDKKEKKTKQKKPLEQGVNLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g341 ### # start gene g342 Scaffold_5 AUGUSTUS gene 1782522 1783094 0.95 - . g342 Scaffold_5 AUGUSTUS transcript 1782522 1783094 0.95 - . g342.t1 Scaffold_5 AUGUSTUS stop_codon 1782522 1782524 . - 0 transcript_id "g342.t1"; gene_id "g342"; Scaffold_5 AUGUSTUS CDS 1782522 1783094 0.95 - 0 transcript_id "g342.t1"; gene_id "g342"; Scaffold_5 AUGUSTUS start_codon 1783092 1783094 . - 0 transcript_id "g342.t1"; gene_id "g342"; # protein sequence = [MSLLQLRDPDPGTLTRHRKRRHEYVPEPRKSRNPGNTSSSDRTQPQIIIETPSTYSRSTSTLTDIPTSPSTSGEYASV # TTSPFSPVQPLPHSSAWCESDNPQSLSSFAGGQTDLNPSSAGYNQWDAMNATYSTLPTTPTPTTPTLSLPLPAIPRPRIEDESPQPSFLRRKPLGIQD # ILTEEGRVYWGRCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g342 ### # start gene g343 Scaffold_5 AUGUSTUS gene 1788913 1789563 0.69 + . g343 Scaffold_5 AUGUSTUS transcript 1788913 1789563 0.69 + . g343.t1 Scaffold_5 AUGUSTUS start_codon 1788913 1788915 . + 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_5 AUGUSTUS CDS 1788913 1789563 0.69 + 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_5 AUGUSTUS stop_codon 1789561 1789563 . + 0 transcript_id "g343.t1"; gene_id "g343"; # protein sequence = [MDGPGRVSKLPDGGGATKNGKRRKRRDAFPSGKGEEIEEDNLSSTHRRPEARSRRSEGDIDMIHSNLPDWTIGGPTTN # HPNANANAAGADPPLHQFVPSSLRIALGLNPDNDSNDADNIKYEEEKERGDWGDQDWEQRSGCDVFDEDAEVDDHNMDIEGGPDDSSRQRSRYPGKPS # GVSGSSEGWGQPGALVVSGGCDKSVRVWDIRSGCVRYFLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g343 ### # start gene g344 Scaffold_5 AUGUSTUS gene 1791606 1792854 0.38 + . g344 Scaffold_5 AUGUSTUS transcript 1791606 1792854 0.38 + . g344.t1 Scaffold_5 AUGUSTUS start_codon 1791606 1791608 . + 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_5 AUGUSTUS CDS 1791606 1791879 0.99 + 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_5 AUGUSTUS CDS 1791987 1792212 0.45 + 2 transcript_id "g344.t1"; gene_id "g344"; Scaffold_5 AUGUSTUS CDS 1792321 1792477 0.85 + 1 transcript_id "g344.t1"; gene_id "g344"; Scaffold_5 AUGUSTUS CDS 1792588 1792854 1 + 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_5 AUGUSTUS stop_codon 1792852 1792854 . + 0 transcript_id "g344.t1"; gene_id "g344"; # protein sequence = [MLSHRYFVSIFLSTGLLTSKLSLAAPLFGFGSSDNSASTTAVSNDTVTSDFLRPALFSRVAYCSSDAVQSFQCGSPCD # ALGSDIDVFQVGGRLEQTLYPDFIAHDPSTNTIVVAHQGTDPNNLLSILNDAKFGLVDLNITRFTAADGSEFLLQVFGNDTDTDTLCRSYWAFSGYAV # RDVSLESKLTQLGAAVATLDAMFLKENLDPSVQLTTSVFGLPRLGNTLSHITNQNDPVPTVPPEFLGFVHPSNEFHITGVDSNGQATGIIACPGQDNE # NCSTGNDILDASVANHLGMWFISGLPSSKQDLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g344 ### # start gene g345 Scaffold_5 AUGUSTUS gene 1798641 1799077 0.4 - . g345 Scaffold_5 AUGUSTUS transcript 1798641 1799077 0.4 - . g345.t1 Scaffold_5 AUGUSTUS stop_codon 1798641 1798643 . - 0 transcript_id "g345.t1"; gene_id "g345"; Scaffold_5 AUGUSTUS CDS 1798641 1798985 0.55 - 0 transcript_id "g345.t1"; gene_id "g345"; Scaffold_5 AUGUSTUS CDS 1799039 1799077 0.65 - 0 transcript_id "g345.t1"; gene_id "g345"; Scaffold_5 AUGUSTUS start_codon 1799075 1799077 . - 0 transcript_id "g345.t1"; gene_id "g345"; # protein sequence = [MLQKEEKEKEAKEKLERKESRSKTKKARSDVAAAQGDSSIPLESSSNNSTSASGVSELSANESSSSESENSTGIDADT # EESVTSEEESDKDGSVAVKDETQKEKWVTVSPPPSTASPTTSDTEVISS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g345 ### # start gene g346 Scaffold_5 AUGUSTUS gene 1811611 1811913 1 + . g346 Scaffold_5 AUGUSTUS transcript 1811611 1811913 1 + . g346.t1 Scaffold_5 AUGUSTUS start_codon 1811611 1811613 . + 0 transcript_id "g346.t1"; gene_id "g346"; Scaffold_5 AUGUSTUS CDS 1811611 1811913 1 + 0 transcript_id "g346.t1"; gene_id "g346"; Scaffold_5 AUGUSTUS stop_codon 1811911 1811913 . + 0 transcript_id "g346.t1"; gene_id "g346"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTLAVDNPPWSLRLGAGLLLELIPNPPSHSPPYGKQPQRRAASESPRDPPPHFDLD # TGDHDDQDPPPVDPDDPGPKQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g346 ### # start gene g347 Scaffold_5 AUGUSTUS gene 1812070 1813002 0.96 + . g347 Scaffold_5 AUGUSTUS transcript 1812070 1813002 0.96 + . g347.t1 Scaffold_5 AUGUSTUS start_codon 1812070 1812072 . + 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_5 AUGUSTUS CDS 1812070 1813002 0.96 + 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_5 AUGUSTUS stop_codon 1813000 1813002 . + 0 transcript_id "g347.t1"; gene_id "g347"; # protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLS # YLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIK # DEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSG # QSGGQRPAFNHLVQMESPSLREGKKDEEQPLSLLRW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g347 ### # start gene g348 Scaffold_5 AUGUSTUS gene 1823806 1824789 0.81 - . g348 Scaffold_5 AUGUSTUS transcript 1823806 1824789 0.81 - . g348.t1 Scaffold_5 AUGUSTUS stop_codon 1823806 1823808 . - 0 transcript_id "g348.t1"; gene_id "g348"; Scaffold_5 AUGUSTUS CDS 1823806 1824789 0.81 - 0 transcript_id "g348.t1"; gene_id "g348"; Scaffold_5 AUGUSTUS start_codon 1824787 1824789 . - 0 transcript_id "g348.t1"; gene_id "g348"; # protein sequence = [MELHYTSGYHPEADGQTEHVNQTLEQYIRIYCSYQQDDWLPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPE # VDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHLEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISQPGTLSYELKLPDCLRR # IHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAKILNSKLDRRYKCCPLRYYIWWASYKGTDDEFSWVAADELHADELYRHSTHNTLTSLD # LDHKKHFIPFSRFRRALPKLYFVCLEGKHDDSKLSVYPSFLIAYFGFFSYYSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g348 ### # start gene g349 Scaffold_5 AUGUSTUS gene 1836528 1836839 0.72 - . g349 Scaffold_5 AUGUSTUS transcript 1836528 1836839 0.72 - . g349.t1 Scaffold_5 AUGUSTUS stop_codon 1836528 1836530 . - 0 transcript_id "g349.t1"; gene_id "g349"; Scaffold_5 AUGUSTUS CDS 1836528 1836839 0.72 - 0 transcript_id "g349.t1"; gene_id "g349"; Scaffold_5 AUGUSTUS start_codon 1836837 1836839 . - 0 transcript_id "g349.t1"; gene_id "g349"; # protein sequence = [MDAVRISDNKPVMLKAVSRIIHPQEVKIGMYFSDKSIASDPRNHCIPIYDVFPVPDSEMDLIVMPVLRPFENPQFDTV # GEAIAFIQQLFEVCYIWEPCYISDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g349 ### # start gene g350 Scaffold_5 AUGUSTUS gene 1847912 1848433 0.77 + . g350 Scaffold_5 AUGUSTUS transcript 1847912 1848433 0.77 + . g350.t1 Scaffold_5 AUGUSTUS start_codon 1847912 1847914 . + 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_5 AUGUSTUS CDS 1847912 1848433 0.77 + 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_5 AUGUSTUS stop_codon 1848431 1848433 . + 0 transcript_id "g350.t1"; gene_id "g350"; # protein sequence = [MYIYSACSDFFCDIFLLISMASLDRYKGLKDVIKAFGDEPYSFAEQASDDMDAEQEASYSGNMPLPDEDEEMDILDDN # PQDVPALLIDSDEEDEEDDSEDEGDTQRRPDPARSLRKISKSKHHNSGPKTSGTTAMDATGLRNILNEASKGVSQDTAADYQRFVLSHSSSQIFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g350 ### # start gene g351 Scaffold_5 AUGUSTUS gene 1850161 1851073 0.51 - . g351 Scaffold_5 AUGUSTUS transcript 1850161 1851073 0.51 - . g351.t1 Scaffold_5 AUGUSTUS stop_codon 1850161 1850163 . - 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_5 AUGUSTUS CDS 1850161 1850796 0.59 - 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_5 AUGUSTUS CDS 1851005 1851073 0.51 - 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_5 AUGUSTUS start_codon 1851071 1851073 . - 0 transcript_id "g351.t1"; gene_id "g351"; # protein sequence = [MAGFVQRSKDLRTEQEKKETLDWAVREKKIEAQLDTLLELIRCNSTAQIPMRPLAHSLPSLPSTSSGQAGASTALGHR # LIVPLPQSDTESISVAPAPPIEPALVPVSSTNVSVPPHQPLPEPPLSLMSEPTRASGPSRVIVLADGTRITFVSSDVPDPILVSFSDDIAKLVRMWDE # AALGYQADECYLKIKGYGIPLRLWEQAYKYSGDGRWKGTKDKWCKWKVHHHYSTTSIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g351 ### # start gene g352 Scaffold_5 AUGUSTUS gene 1853663 1854388 0.39 - . g352 Scaffold_5 AUGUSTUS transcript 1853663 1854388 0.39 - . g352.t1 Scaffold_5 AUGUSTUS stop_codon 1853663 1853665 . - 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_5 AUGUSTUS CDS 1853663 1854388 0.39 - 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_5 AUGUSTUS start_codon 1854386 1854388 . - 0 transcript_id "g352.t1"; gene_id "g352"; # protein sequence = [MMKVQAGATYTPASGSDSQSPNGPLSGTKSSGTGYDVCPSSDLSELTNSMTYTSTLLWMLGSTLMPSDPSSSLLDSDR # ELSSDGENLVTASQRSSDYLTTRTPSSEASFKSLPSIPSEYITASEGSIAYKTISEPITEPTTAYSTAEMCPSKLETIPSEEETPKAYSEHLPELEEL # PSVLLSAHLSALPSFAPPSIPSFAPPSILHLHHHVFHRLHHHLPPSTLLSVPPSAPPSVSPGCTY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g352 ### # start gene g353 Scaffold_5 AUGUSTUS gene 1857221 1858288 0.37 + . g353 Scaffold_5 AUGUSTUS transcript 1857221 1858288 0.37 + . g353.t1 Scaffold_5 AUGUSTUS start_codon 1857221 1857223 . + 0 transcript_id "g353.t1"; gene_id "g353"; Scaffold_5 AUGUSTUS CDS 1857221 1858288 0.37 + 0 transcript_id "g353.t1"; gene_id "g353"; Scaffold_5 AUGUSTUS stop_codon 1858286 1858288 . + 0 transcript_id "g353.t1"; gene_id "g353"; # protein sequence = [MTSFSYSFVPRRLRCAIIEEAVSSVQTKPASIPGVNGVSFEKSPLRRLSTTRMPPQDASRPPFARKSSSFALPTPATP # SGTAESWKSKPSAVAPPPSSQPPSATTGKSRAMSFATPPPSALDHVESLTDLEVVDYSDLAEFMGVPEKIEEEQSKDLQVTQSETVSPSKSRRPVASD # FFDEESPSFIVSSTSTVRFDAGAWETNNEVPAVISLVDENAPNDAVSQSEVAVPEVVVPVLSKQAPVDQNLVPTVPPHIPPTGARRNHYNKEAAMSAV # DDAMSGIRCALDVMHEKDHRSFELDQPARTLFPSSPMSSNRWLPPALRESRPTETFATTCHRAAEVSKVMDHGKFSQSTFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g353 ### # start gene g354 Scaffold_5 AUGUSTUS gene 1858380 1859036 0.97 + . g354 Scaffold_5 AUGUSTUS transcript 1858380 1859036 0.97 + . g354.t1 Scaffold_5 AUGUSTUS start_codon 1858380 1858382 . + 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_5 AUGUSTUS CDS 1858380 1859036 0.97 + 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_5 AUGUSTUS stop_codon 1859034 1859036 . + 0 transcript_id "g354.t1"; gene_id "g354"; # protein sequence = [MSRREFTLNDVLFRKPYSYGGYKGKSKYRVQIPKSVLKVNLPSQNVTARPSTASKLTGADGASTWRKPTTTTGKIELQ # HSVGLDTTSRSPPPEPEPKPVSQVKKGEEVLTESEDTSVAPMHSRSQPKMPAGSGVAFYRNAHLSTESGLKSSVSLFATNELEVPSNTSLEDSQSILI # AQDLHPNAVSTANTQPSPSSSSTVNSSLVKSSPSTSQYGIAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g354 ### # start gene g355 Scaffold_5 AUGUSTUS gene 1865145 1866275 0.16 - . g355 Scaffold_5 AUGUSTUS transcript 1865145 1866275 0.16 - . g355.t1 Scaffold_5 AUGUSTUS stop_codon 1865145 1865147 . - 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_5 AUGUSTUS CDS 1865145 1866275 0.16 - 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_5 AUGUSTUS start_codon 1866273 1866275 . - 0 transcript_id "g355.t1"; gene_id "g355"; # protein sequence = [MTIPPEFGTLHQLQTLGVEGNPLDTNLKNLITKDGTPALIAFLRDSCPVSAPPQNRAWIPLITPVEQEALPPSTKTIS # VVCYNILRQCAATVRLYGYTPSWALAWDYRRELILSEILAHGADFICLQEVDVTSYEDFFLKHLSKAGHESVYWPKSRAKTMFNENERRFVDGLATFF # RADKYQLIEKHLIEFSAVAMQREDSKKTEDMFNRVLGKDHIATACAFENRDTGSRVLVANVHISWDPKFCDVKLVHVALMVEEVEKMAERFVKLPPRF # WPEPETANGNVDSVDGIADSSFSSSSELSSPFPTTSSLPSSSLPPSSSSSSPPDSPSSKPSTHRQRPKPPTYTSASQIPLIFCGDFNSIPGSGCTSFC # RRAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g355 ### # start gene g356 Scaffold_5 AUGUSTUS gene 1868127 1868633 0.23 - . g356 Scaffold_5 AUGUSTUS transcript 1868127 1868633 0.23 - . g356.t1 Scaffold_5 AUGUSTUS stop_codon 1868127 1868129 . - 0 transcript_id "g356.t1"; gene_id "g356"; Scaffold_5 AUGUSTUS CDS 1868127 1868633 0.23 - 0 transcript_id "g356.t1"; gene_id "g356"; Scaffold_5 AUGUSTUS start_codon 1868631 1868633 . - 0 transcript_id "g356.t1"; gene_id "g356"; # protein sequence = [MLIEPPSGSNPGVRERLAIEPAKPVGLITAGNGEEPDGENNVINEGKKELVLRQVNEGEEEEERDVMVPKKDDRIAGV # DGWKFKARNSLMFPPDANSAPYYPKTQASVSVPSGEEKSISYGNTRLSEQEVSTDANKSLIEPPSPTGSRIIAAITETPCRCIISALADT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g356 ### # start gene g357 Scaffold_5 AUGUSTUS gene 1869179 1869917 0.09 - . g357 Scaffold_5 AUGUSTUS transcript 1869179 1869917 0.09 - . g357.t1 Scaffold_5 AUGUSTUS stop_codon 1869179 1869181 . - 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_5 AUGUSTUS CDS 1869179 1869454 0.17 - 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_5 AUGUSTUS CDS 1869561 1869917 0.27 - 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_5 AUGUSTUS start_codon 1869915 1869917 . - 0 transcript_id "g357.t1"; gene_id "g357"; # protein sequence = [MACLVVSTTVLFAVRIRLKDRSQVNKLEIFLSNPDYQMTSYFRYGSVSSLFTYSLLECPNISKNHRNVADTQDRGALD # STDFAIGMYLIQGVTSGQISIIPTSLPPGLYQQASGGATPSMLQSQGTGGAVSKKPLVSPTIPARKTTNPSAIGNSAFGAQARWDVTAAEKASSDGYF # DTLDTTKAGYIEDEVAVPFMLESKLPGDALAQIW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g357 ### # start gene g358 Scaffold_5 AUGUSTUS gene 1871660 1872268 0.64 - . g358 Scaffold_5 AUGUSTUS transcript 1871660 1872268 0.64 - . g358.t1 Scaffold_5 AUGUSTUS stop_codon 1871660 1871662 . - 0 transcript_id "g358.t1"; gene_id "g358"; Scaffold_5 AUGUSTUS CDS 1871660 1872268 0.64 - 0 transcript_id "g358.t1"; gene_id "g358"; Scaffold_5 AUGUSTUS start_codon 1872266 1872268 . - 0 transcript_id "g358.t1"; gene_id "g358"; # protein sequence = [MTPTRRAYHDVGGAQGPMAIQHWYEVTPEFGNLLSSVFKQEWPDKWEEAMKRFKAGKWQAANPGPWVGKAIVYKLTSS # IHPDEEDAEECPTVTVPVGHFVGGHIQFLDIHARLQYSPGHIVIGLTSILFHRVEDWTIAAPSMKQLEEWKQWRLTPGRIGIVSFFPRNSYNLLNNKE # ALWGADTQYGRREELLPKSKRRKIIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g358 ### # start gene g359 Scaffold_5 AUGUSTUS gene 1873372 1873854 0.87 - . g359 Scaffold_5 AUGUSTUS transcript 1873372 1873854 0.87 - . g359.t1 Scaffold_5 AUGUSTUS stop_codon 1873372 1873374 . - 0 transcript_id "g359.t1"; gene_id "g359"; Scaffold_5 AUGUSTUS CDS 1873372 1873854 0.87 - 0 transcript_id "g359.t1"; gene_id "g359"; Scaffold_5 AUGUSTUS start_codon 1873852 1873854 . - 0 transcript_id "g359.t1"; gene_id "g359"; # protein sequence = [MTVGNNFPSSVQRLHVIFELTEGASRIAGRIDFAHLRNLTHIWLTFDDSDAQSPGDEFRVTEVLPLPDIGDWINHYCP # DDLQVLILEKDGGVESPLEDEEYRQYVDLPLVCLVNDGSIDLKYLADEEKPYAEQLTFDAEGFTTEQIWEHSLAVVAQKNSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g359 ### # start gene g360 Scaffold_5 AUGUSTUS gene 1874754 1875137 0.34 - . g360 Scaffold_5 AUGUSTUS transcript 1874754 1875137 0.34 - . g360.t1 Scaffold_5 AUGUSTUS stop_codon 1874754 1874756 . - 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_5 AUGUSTUS CDS 1874754 1875137 0.34 - 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_5 AUGUSTUS start_codon 1875135 1875137 . - 0 transcript_id "g360.t1"; gene_id "g360"; # protein sequence = [MKEEIEGVVSEADKYKVENEAATAWIAVKNALESYPYNLRHPLSDEKLADNFSPEDKAKLTTHVDETIKWRDESQDAL # KDDHKQKQKELEAIANPIMRKLYGAAGGPDVGGFLGAGVEEGPSVERVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g360 ### # start gene g361 Scaffold_5 AUGUSTUS gene 1876644 1876964 0.56 - . g361 Scaffold_5 AUGUSTUS transcript 1876644 1876964 0.56 - . g361.t1 Scaffold_5 AUGUSTUS stop_codon 1876644 1876646 . - 0 transcript_id "g361.t1"; gene_id "g361"; Scaffold_5 AUGUSTUS CDS 1876644 1876964 0.56 - 0 transcript_id "g361.t1"; gene_id "g361"; Scaffold_5 AUGUSTUS start_codon 1876962 1876964 . - 0 transcript_id "g361.t1"; gene_id "g361"; # protein sequence = [MNWQPTTKDDIDSGTPIHRRHISDSSSFHSGVHSGPSDMGHCSSENGHNTYGVADLPPVPPHDFTVGPPHLTTVGGYA # DVGRGTNDPSHQQSISPTIRIANNSSRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g361 ### # start gene g362 Scaffold_5 AUGUSTUS gene 1878186 1880245 0.23 + . g362 Scaffold_5 AUGUSTUS transcript 1878186 1880245 0.23 + . g362.t1 Scaffold_5 AUGUSTUS start_codon 1878186 1878188 . + 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_5 AUGUSTUS CDS 1878186 1878349 0.91 + 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_5 AUGUSTUS CDS 1878457 1878496 0.55 + 1 transcript_id "g362.t1"; gene_id "g362"; Scaffold_5 AUGUSTUS CDS 1878566 1880245 0.43 + 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_5 AUGUSTUS stop_codon 1880243 1880245 . + 0 transcript_id "g362.t1"; gene_id "g362"; # protein sequence = [MPDNRKPVPPNSPRWQPNPDPSTIEIPGLDTSASPQDQIEQIEQLITLKLQVSDSYSVGTEPVREAAKQAAQIRIPTY # EDYETVHEEGSSQQKESEPSEPSPSQAATSSILYDEQDENGHSLASAESSFAPGQAAFSSTPAANRLAHAESSRTSDDSSWSASLESPLVRLDRELRT # FSQDANETESSIVSSTPTPTKPPILREQERSQRSINKGKSREQSEPLLRNLLRQNIHSSVNASAISAEPGPSVSPLRPKGKTPILKDLNPFLPPGSNP # SKWNGLVDLRDASVMTPQRSKRFRDPRSSRKSPTPVKAPDYDSDDDSFDGLPPGMSPPVMISPARPMRSNASIKLGQTPRKDAAARITKDIVADVQGH # LGKSGKLGRGLFPDSSMSTISSPPSMSRYNNSTSSGMVTHESLESLMRQVGLKDPIPGNLPRQDSRQYEYSSANESDSPLQLPTSEPKPDLTQMASNH # LYNTNFGFPAQQFSTNDDEFLMPPPQQYQHDPYYYDDDDDDDDIVNNTAHPSAAFLMASQNKHPMGDDSFDDDDDSMVDGDGDGFGQDALLTGGGDPN # MMIPVHPFARGVSIEDDSFDDSFDNDLMQGNPMSEETLFGVLPVHREQRLGGRALELGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g362 ### # start gene g363 Scaffold_5 AUGUSTUS gene 1882563 1883432 0.93 - . g363 Scaffold_5 AUGUSTUS transcript 1882563 1883432 0.93 - . g363.t1 Scaffold_5 AUGUSTUS stop_codon 1882563 1882565 . - 0 transcript_id "g363.t1"; gene_id "g363"; Scaffold_5 AUGUSTUS CDS 1882563 1883432 0.93 - 0 transcript_id "g363.t1"; gene_id "g363"; Scaffold_5 AUGUSTUS start_codon 1883430 1883432 . - 0 transcript_id "g363.t1"; gene_id "g363"; # protein sequence = [MLDENRDAFKIASYDVLGTSIEDIFLDLMHKDEANKAIISGEAEKNTASEVSSELESVQPDSFAAPLKLTSGRAISPL # RQALTIFHKRILIARRSWLALALAVLVAVAASTIPLVFIRGRSPSCVKTFAASTNIPLYLPESSIDPFSLDDSARVLDSPPGITSTLGNTTTIFRIRD # VPDNSTFVDDIKQNFRNLSLGGVSIDVDSDAALIAWEATAPGLTGPAMLNLASNILYNRALNSSGQSSDTPTLILANYEDFPPVAAGTLFALKWVAFF # GAAMVSISTFHMNSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g363 ### # start gene g364 Scaffold_5 AUGUSTUS gene 1904875 1905734 0.33 - . g364 Scaffold_5 AUGUSTUS transcript 1904875 1905734 0.33 - . g364.t1 Scaffold_5 AUGUSTUS stop_codon 1904875 1904877 . - 0 transcript_id "g364.t1"; gene_id "g364"; Scaffold_5 AUGUSTUS CDS 1904875 1905530 0.45 - 2 transcript_id "g364.t1"; gene_id "g364"; Scaffold_5 AUGUSTUS CDS 1905590 1905734 0.59 - 0 transcript_id "g364.t1"; gene_id "g364"; Scaffold_5 AUGUSTUS start_codon 1905732 1905734 . - 0 transcript_id "g364.t1"; gene_id "g364"; # protein sequence = [MLTPAPGSSQQPGKIAKVSIEDIKDELWQNRAARRRIRVRVNEWIILVKAAWEDPKFLPFSSEIDRALQPNIGILTQL # MNNPDSVMDSLCPAKKWQAGMKRTTKAIEHSGGLTVDDCARINNWFYTVIPGASQKQHIWIGALPIAHARTLVLLHWHQSEFIHEVEGASIVELAFNR # LVAWTGKTVDGKDKLYERVDVDLEALQLLEKSVFDISEDAGVAGNQQWGLDAGSHLQNWNPWLEYGPESHCTKCEGDDEVECQVGKLYFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g364 ### # start gene g365 Scaffold_5 AUGUSTUS gene 1906328 1906801 0.43 - . g365 Scaffold_5 AUGUSTUS transcript 1906328 1906801 0.43 - . g365.t1 Scaffold_5 AUGUSTUS stop_codon 1906328 1906330 . - 0 transcript_id "g365.t1"; gene_id "g365"; Scaffold_5 AUGUSTUS CDS 1906328 1906801 0.43 - 0 transcript_id "g365.t1"; gene_id "g365"; Scaffold_5 AUGUSTUS start_codon 1906799 1906801 . - 0 transcript_id "g365.t1"; gene_id "g365"; # protein sequence = [MVSSQSQLPFYHTSNYMRSTLPLVSHPQINGQYFMVPPSNFTPAIPYHPVSGSTQVPTLLPSQTTNQHHLSSEQQIAN # QIPMEVHLPSPTLDKNTLQLQTHLSPEKNQTLAFTPTFSNQVGSAQPDIPLTGPYVNRDTQYVCLSDLPEGKCVFLQSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g365 ### # start gene g366 Scaffold_5 AUGUSTUS gene 1919752 1920713 0.99 + . g366 Scaffold_5 AUGUSTUS transcript 1919752 1920713 0.99 + . g366.t1 Scaffold_5 AUGUSTUS start_codon 1919752 1919754 . + 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_5 AUGUSTUS CDS 1919752 1919854 0.99 + 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_5 AUGUSTUS CDS 1919950 1920713 0.99 + 2 transcript_id "g366.t1"; gene_id "g366"; Scaffold_5 AUGUSTUS stop_codon 1920711 1920713 . + 0 transcript_id "g366.t1"; gene_id "g366"; # protein sequence = [MAGISPYNRQNDIQEDANDAYFRQENKDYARYWTAATEGEDGVGRGEDDEEEEDWDGSNSDVKVQTTATRGYSPSRPI # SPDDSSHEEQVQNGSIQPEPQSQSQSQVLWTTFVPIAGQNTFYLSPDELSLVLSSEKSTVPATLIALGPSENLTLLGTYRSTVIRGSIEIGGAILRSR # VHPETHNVFAPRSSPVPSIRVVSSAPSSPLPALLPLRIQHEIAALVGDPVLVLLQELHSGVEALGKVCRTFDGVFEVHPRDVLNRNRELEEETEDVLR # LTAVRIVSFPGFVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g366 ### # start gene g367 Scaffold_5 AUGUSTUS gene 1930796 1931125 0.4 - . g367 Scaffold_5 AUGUSTUS transcript 1930796 1931125 0.4 - . g367.t1 Scaffold_5 AUGUSTUS stop_codon 1930796 1930798 . - 0 transcript_id "g367.t1"; gene_id "g367"; Scaffold_5 AUGUSTUS CDS 1930796 1931125 0.4 - 0 transcript_id "g367.t1"; gene_id "g367"; Scaffold_5 AUGUSTUS start_codon 1931123 1931125 . - 0 transcript_id "g367.t1"; gene_id "g367"; # protein sequence = [MINRLHVLSDDVDDLGLLLHTEALNRANKIKQDIEHKRQAEEAREIAKREEVMRIQQTMTRAKALSDMKKKRLEELRG # QSTLDSMKQGKILSENTLCVFFEKNSVHRRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g367 ### # start gene g368 Scaffold_5 AUGUSTUS gene 1936138 1937204 0.44 - . g368 Scaffold_5 AUGUSTUS transcript 1936138 1937204 0.44 - . g368.t1 Scaffold_5 AUGUSTUS stop_codon 1936138 1936140 . - 0 transcript_id "g368.t1"; gene_id "g368"; Scaffold_5 AUGUSTUS CDS 1936138 1936502 0.94 - 2 transcript_id "g368.t1"; gene_id "g368"; Scaffold_5 AUGUSTUS CDS 1936664 1937204 0.45 - 0 transcript_id "g368.t1"; gene_id "g368"; Scaffold_5 AUGUSTUS start_codon 1937202 1937204 . - 0 transcript_id "g368.t1"; gene_id "g368"; # protein sequence = [MITGTSHADCAILIIAGGTGEFEAGISKDGQTREHALLAFTVGVRQPIVAVNNMDTTKVCIFCCAFFVRELLCLRSLR # SVQWSEDRFNEIIKEIKKVGYNPKAVAFVPISGWHGDNLLEESVNMPWYKGWTKETKAGVVKGKTLLDAVDAIQIPVRPSDKPLRLPLQDVYKIGGIG # TVPVVFKFPQLNVFCRNVSVKDIRRGNVASGSKNDPAKEAASFNAQVILLNHPGQIGAGYAPVLDCHTAHIACKFAELIENIDQRTGKSIENTPKFVK # SGDACIAKLIPSKPMARIAVRGSISRC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g368 ### # start gene g369 Scaffold_5 AUGUSTUS gene 1940058 1940492 0.32 - . g369 Scaffold_5 AUGUSTUS transcript 1940058 1940492 0.32 - . g369.t1 Scaffold_5 AUGUSTUS stop_codon 1940058 1940060 . - 0 transcript_id "g369.t1"; gene_id "g369"; Scaffold_5 AUGUSTUS CDS 1940058 1940492 0.32 - 0 transcript_id "g369.t1"; gene_id "g369"; Scaffold_5 AUGUSTUS start_codon 1940490 1940492 . - 0 transcript_id "g369.t1"; gene_id "g369"; # protein sequence = [MSVQCYVDSFNDFTDDNIISCVTHCNPSCHSIANITNDISQVIIFELNGVSTIVPSLQLIVPFHNTDIQLKYRLSGII # YFGSSHFTVRIFNESGIWKYDGQVNNGHYQQDYVISDIDLMELCGRHAHVLLYTFSSSHTNVNANM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g369 ### # start gene g370 Scaffold_5 AUGUSTUS gene 1940757 1943813 0.23 - . g370 Scaffold_5 AUGUSTUS transcript 1940757 1943813 0.23 - . g370.t1 Scaffold_5 AUGUSTUS stop_codon 1940757 1940759 . - 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_5 AUGUSTUS CDS 1940757 1943813 0.23 - 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_5 AUGUSTUS start_codon 1943811 1943813 . - 0 transcript_id "g370.t1"; gene_id "g370"; # protein sequence = [MFVQNEYRHLLDKYLDQDCSENLDIQVHFSFREGKLVHSNQVIDYWYRDLSLSDMCFYDFIKYISLQTQSKTKTVHNS # DTRTGVLRRHKLLSGHPLQSTHELIQHTNFKQGDVGREFVPMMIGAVPPRRTDKLYALFVLAHFKEFSILNPLISSNDVDGEFHSFQLHTDHQQILNN # WEEIHECADQRDAERLRKKASELAKSSQLVTGMESVLDDDEYADYNFVVPKGVKNIESKVFSDMQQMQLLKTDLCSAAWLSSPPSALRLSIQKSAVVS # PMLPLLTIQKVDKWIKEGKSEAERLANIRYKHSNISNQSSSDIHNSDAEVPQSSVSYSFQDIGNSSNPTSKVLTASQLKDKIANEFSLNKKQQFAFDI # IASFMIFREIFKLPEWSAKEPMVMLLTGPGGTGKTHIVQAVQKVMEYYRMDHGYRALAPTGNAASLINGRTIHSGLKIRVREHKNGKSHRPLGELNEN # IVVSASVKKNNNLRIEWKDVCLLLIDEISMVDSILLAEVDASLRYAKEKPNDFFGGINVIFCGDPFQYPPVGTPLYAPIRSVSIQTDEEMMRRLGRIA # WKSINTVIELDEQKRMQGDPEYAAAVGRLRTRECIQSDVELFNTRAIRTLSNPQGVMFTTEQQYMASIIVSKNSVRQALNDFKTTAICRGQEGPELID # VVAHDQLQYKKHTNANLNGKKVYPSVAQQQQLLAMDTSSGKLKDGLPGILKLYIGMPIIMKHENLNTELGVNNGSRGFLRKLDLSVDNNGFTYCKYAL # VEFPDSKVHLPGLPLHFFPVKARSWKCSTFIINENEEKILVSVTRTQLPFEPLFALTGQGAQGHTLGAILCMLHLGGFGAYVAASRPRSRDGLFITRK # VTLDDLNKPGIPYDLWFETQRFHVMAHNTMVIWGFCKGELKKVPDAECEKRGNFSKIQYEFGDDRHDIQHNMSLNTESNHINLNSLMDPEKMNVVSKI # NHLLLLSLVLCGIMSIGVALLIQHLLCCITVLFQCHCRIKLYGRINQDQNIYLHYLVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g370 ### # start gene g371 Scaffold_5 AUGUSTUS gene 1943855 1947231 0.22 - . g371 Scaffold_5 AUGUSTUS transcript 1943855 1947231 0.22 - . g371.t1 Scaffold_5 AUGUSTUS stop_codon 1943855 1943857 . - 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_5 AUGUSTUS CDS 1943855 1946570 0.82 - 1 transcript_id "g371.t1"; gene_id "g371"; Scaffold_5 AUGUSTUS CDS 1946753 1947231 0.25 - 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_5 AUGUSTUS start_codon 1947229 1947231 . - 0 transcript_id "g371.t1"; gene_id "g371"; # protein sequence = [MLVPHWVLPENVVACESDFQKLSLRLFPHHLQSLKKDVAVAELIQSLIEFSHRLFEVTDYVCSSLYSVVHKTCISLFG # ADIPELLYYNYHKYNGASERVDDVIAHGDVLSTACNVFEQLSTEDLKSLKSSLRITERHHKGGQIFCCLPKHGQPQLKSVHFIVKLTAAMDVEYSPQK # KYNEQRKDARRKSRIERGNEEYDLLHKSSEFWPQLVPFAVSMSCIAKYRQSIQYIVPSICACCGSEDRKFTGCYLPQSQWPVMSFLTVEDPFILSHTP # QARFTYICQDLDGLLLDPRGIRALDFDCTVFEMYLCRECLAYMHRSIMPRLALKNHLYRGELPEDLQNVTWVEEMACSIYRTSAHVTRIFGSSSECDP # FQLHGNTCAHPLNICYTAKRLPWSPADLNDLISIIFVGPKKLAKEDLQKLTPFFVRRSVIRMLLLYLQKHNRLYIELPPIDEQVLAMYPDNNLLPGLQ # DRFIYDHDTSVADVFGIESDGFDDHPADLLSHQSEVLLERSGVYDSESQDVPARFMTASSIHNIAQALPSTGFGTSDFIIRYGKDPIDEYNNPDLFPG # MFPTLYPLGIGGFEDHRQCPAISFEAHVQHLLDQSLRNFRYHHFFSFVALNVIQRRKAHLHTSLSISSNKYHYIASELLAVTPNILSNLANKLKNESD # NSSFTEDEQHAFRLLKEVNIIAAKIPGSQASKTKIRQQIRSYFAYFGLPHLFVTLNPSAVHSPVFQVMYGDQNVNLSQRFPAVVQPRSERAYRVAHDP # VAAADFFDFMYHVIFEDLFGWDFKNGKSTQQGGLFGHLRAFYGCAELTERGCFHGHYLLFLRGGLNPSEVHKKMHHVEEYQKQFFSFFEDIIHHHLPG # TDYNCAPQYESRSEMPPDVPELDSEGVSSELLSAWQKLFTDEHKKIGEQLQRHRCRPVCHKGKSANSDCRFGYPHDVVEHSSFDSNHNSIILSRKESD # VNGHNRFLLVYTRHNHDVKCILSGKAAKAAMFYISDYITKVPLNTEALLSTLSKAVASITSEDIDETPVMNAKRLLHRCLTHFGRKQQIHSQQCARYL # RDLLIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g371 ### # start gene g372 Scaffold_5 AUGUSTUS gene 1955703 1956032 0.59 + . g372 Scaffold_5 AUGUSTUS transcript 1955703 1956032 0.59 + . g372.t1 Scaffold_5 AUGUSTUS start_codon 1955703 1955705 . + 0 transcript_id "g372.t1"; gene_id "g372"; Scaffold_5 AUGUSTUS CDS 1955703 1956032 0.59 + 0 transcript_id "g372.t1"; gene_id "g372"; Scaffold_5 AUGUSTUS stop_codon 1956030 1956032 . + 0 transcript_id "g372.t1"; gene_id "g372"; # protein sequence = [MANSRWYVNLYPDPLLIAESSLLQNKSLSDSPDDMLSAQGVGWIKRKAMGAASITVTITHSKNNAGVETLSLVQVVSG # GDPAEAGGKDARLGGEDEGNQAFRRPLCYKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g372 ### # start gene g373 Scaffold_5 AUGUSTUS gene 1958405 1958761 0.95 - . g373 Scaffold_5 AUGUSTUS transcript 1958405 1958761 0.95 - . g373.t1 Scaffold_5 AUGUSTUS stop_codon 1958405 1958407 . - 0 transcript_id "g373.t1"; gene_id "g373"; Scaffold_5 AUGUSTUS CDS 1958405 1958761 0.95 - 0 transcript_id "g373.t1"; gene_id "g373"; Scaffold_5 AUGUSTUS start_codon 1958759 1958761 . - 0 transcript_id "g373.t1"; gene_id "g373"; # protein sequence = [MKATLSIPKSTWCSPSNGAAPLDPESEEPDDPELEEAVDIPEGKLGVNVAEGLAMQEVSAAIAAAVPDAPKGFTLPFP # EKLQSSNCIPLSWYHSFIVKESLMAEDIQLVHDAIHWDVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g373 ### # start gene g374 Scaffold_5 AUGUSTUS gene 1958996 1959364 0.96 + . g374 Scaffold_5 AUGUSTUS transcript 1958996 1959364 0.96 + . g374.t1 Scaffold_5 AUGUSTUS start_codon 1958996 1958998 . + 0 transcript_id "g374.t1"; gene_id "g374"; Scaffold_5 AUGUSTUS CDS 1958996 1959364 0.96 + 0 transcript_id "g374.t1"; gene_id "g374"; Scaffold_5 AUGUSTUS stop_codon 1959362 1959364 . + 0 transcript_id "g374.t1"; gene_id "g374"; # protein sequence = [MSVPPSPVLDGEQKQDAYEQATGPNDGGSLDAMNGGDDHHKLSGPDNENPADYSRGSNISASIPPKPDVEPPVLREKQ # VKVLRSSLLSSLSSTPVLFHGKTNKPVSQLESGKEYTRNTNIII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g374 ### # start gene g375 Scaffold_5 AUGUSTUS gene 1970592 1971107 0.35 + . g375 Scaffold_5 AUGUSTUS transcript 1970592 1971107 0.35 + . g375.t1 Scaffold_5 AUGUSTUS start_codon 1970592 1970594 . + 0 transcript_id "g375.t1"; gene_id "g375"; Scaffold_5 AUGUSTUS CDS 1970592 1971107 0.35 + 0 transcript_id "g375.t1"; gene_id "g375"; Scaffold_5 AUGUSTUS stop_codon 1971105 1971107 . + 0 transcript_id "g375.t1"; gene_id "g375"; # protein sequence = [MFNDCKGRFGEIYGQYDSYDYYPNATFVSRPWRRKKISPEKDKNRFMSYIPRSLASAIPDPILYQHGQVGECHDLAFG # FSLLDYATTKNLPESEVPKIVKVCITEIDKRGLDAEGIYRVSGRHAIVQTLQHEYEKDEKKFQFKAKDDIFAVASLMKVCCSTIQSIGAAIHI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g375 ### # start gene g376 Scaffold_5 AUGUSTUS gene 1971381 1971731 0.68 + . g376 Scaffold_5 AUGUSTUS transcript 1971381 1971731 0.68 + . g376.t1 Scaffold_5 AUGUSTUS start_codon 1971381 1971383 . + 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_5 AUGUSTUS CDS 1971381 1971731 0.68 + 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_5 AUGUSTUS stop_codon 1971729 1971731 . + 0 transcript_id "g376.t1"; gene_id "g376"; # protein sequence = [MDPKNLAIVFGGVIFGEDEIPKTGDLLSVQQWNDSLMEDLISNAHTLFSEDSKESNADNNNRAHPLPAPPPGEPTPVY # SYGSKTTKIVSIPPPLRNIGLSPNSEDFTPKLPPRPRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g376 ### # start gene g377 Scaffold_5 AUGUSTUS gene 1971790 1972086 0.58 + . g377 Scaffold_5 AUGUSTUS transcript 1971790 1972086 0.58 + . g377.t1 Scaffold_5 AUGUSTUS start_codon 1971790 1971792 . + 0 transcript_id "g377.t1"; gene_id "g377"; Scaffold_5 AUGUSTUS CDS 1971790 1972086 0.58 + 0 transcript_id "g377.t1"; gene_id "g377"; Scaffold_5 AUGUSTUS stop_codon 1972084 1972086 . + 0 transcript_id "g377.t1"; gene_id "g377"; # protein sequence = [MGPPPLPSRLRPAQSQGSLGDITPPQSSPPSATSSVFETDDSGSVNGGGEESLTRTSSIADPRSPTLPIIGESESGET # VKAVIPSSPSSARPPSPHHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g377 ### # start gene g378 Scaffold_5 AUGUSTUS gene 1972923 1973522 0.38 - . g378 Scaffold_5 AUGUSTUS transcript 1972923 1973522 0.38 - . g378.t1 Scaffold_5 AUGUSTUS stop_codon 1972923 1972925 . - 0 transcript_id "g378.t1"; gene_id "g378"; Scaffold_5 AUGUSTUS CDS 1972923 1973522 0.38 - 0 transcript_id "g378.t1"; gene_id "g378"; Scaffold_5 AUGUSTUS start_codon 1973520 1973522 . - 0 transcript_id "g378.t1"; gene_id "g378"; # protein sequence = [MSRFSYYNLQNVIQGSLVNGSLGKVIGFMTTHQALQEHIRVVEMRQVGGPRATAKNQVPTKRPRIESNDPELEFEPLT # TAEFTKDEKWPLVEFTSGLLLLCSPENFTIEGFLGNVEAKRIQVPLILAWALSIHKSQGQTLERVKVDLGRVFENGQGKAAYSLHTHSLIRVSILFSL # AYVALSRATSLEGLEIVNFNPAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g378 ### # start gene g379 Scaffold_5 AUGUSTUS gene 1976933 1978190 0.33 + . g379 Scaffold_5 AUGUSTUS transcript 1976933 1978190 0.33 + . g379.t1 Scaffold_5 AUGUSTUS start_codon 1976933 1976935 . + 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_5 AUGUSTUS CDS 1976933 1977020 0.69 + 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_5 AUGUSTUS CDS 1977166 1977224 0.48 + 2 transcript_id "g379.t1"; gene_id "g379"; Scaffold_5 AUGUSTUS CDS 1977383 1977501 0.49 + 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_5 AUGUSTUS CDS 1978031 1978190 0.56 + 1 transcript_id "g379.t1"; gene_id "g379"; Scaffold_5 AUGUSTUS stop_codon 1978188 1978190 . + 0 transcript_id "g379.t1"; gene_id "g379"; # protein sequence = [MSESTIKAFKALNRDVTYEDGVQPTELYAYANGNTLNYAQMERLLERLVNLEQGSLVNGSVGTVTNFSTSKQALKNGI # SVARIDSGQNIVTAHPTVLAWNDSHSTGASTISKRNKASSESNYLTDDEMDDYEAMTMYHDSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g379 ### # start gene g380 Scaffold_5 AUGUSTUS gene 1979265 1979981 0.36 - . g380 Scaffold_5 AUGUSTUS transcript 1979265 1979981 0.36 - . g380.t1 Scaffold_5 AUGUSTUS stop_codon 1979265 1979267 . - 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_5 AUGUSTUS CDS 1979265 1979981 0.36 - 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_5 AUGUSTUS start_codon 1979979 1979981 . - 0 transcript_id "g380.t1"; gene_id "g380"; # protein sequence = [MGVPSMTSRRPSVYRRPSTSYSASPSSSSLKHVGEGALDDSDSSSSSEGEVNDNQSKDSFFDEESDMRKTHVSPAVAT # SRISHPSPLSRVAGQHQWKGNDAEGEVQDDENDDDEASASPRSTDSEASNGGNTSLTRTGISSNRRSLKRSSTSLTKRIPRQEVKVRASSHTVSSHCL # CRLNKSHSFDRTPIVAYAQSLLAGKFRIVVIGMKEIPSKLKRLLNNCGMCLFNSVKIKHPRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g380 ### # start gene g381 Scaffold_5 AUGUSTUS gene 1980902 1983207 0.48 - . g381 Scaffold_5 AUGUSTUS transcript 1980902 1983207 0.48 - . g381.t1 Scaffold_5 AUGUSTUS stop_codon 1980902 1980904 . - 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_5 AUGUSTUS CDS 1980902 1981639 0.69 - 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_5 AUGUSTUS CDS 1981725 1981861 0.57 - 2 transcript_id "g381.t1"; gene_id "g381"; Scaffold_5 AUGUSTUS CDS 1982025 1982345 0.6 - 2 transcript_id "g381.t1"; gene_id "g381"; Scaffold_5 AUGUSTUS CDS 1983129 1983207 0.62 - 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_5 AUGUSTUS start_codon 1983205 1983207 . - 0 transcript_id "g381.t1"; gene_id "g381"; # protein sequence = [MKVKADRDESSPYAAMLAAQDVATRCPLKILRIVDPLQTNDLEDSIQYKTSAVGKGGFRIEASRNLWDGSGLKIDSSS # TCVAWCREGPSAAINSFFTFYPETTHWTEYKNKILTSARNGELIMWDINKSGSKYVNGRYLLYGAYLSHWSYSGSARISEIHHARPPSNRHPYDRIFP # RRMADLLPLFRRWDLKMGQRGSLDRIIVAHSASVTSLDWCSTSTATSPSSPPTSETTGNGYGWIVSGGLDRCINVWDLTLVTNSKSSHMPHKPTYTLH # PSFQVRRVLWRPSHECEIAVISNGEFSSGSNPEMGSNATPTVLPNTPGVPVRTSSTRNVQGGQGIFTKKGTGFGLGLDMSGNEGLRSKNGISGFAVTG # SPKGSSQIDGGVGDVAEIWDVRRGWIAKWHVNGSAAEGGSTGMCYPIFLSYI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g381 ### # start gene g382 Scaffold_5 AUGUSTUS gene 1984089 1985227 0.26 - . g382 Scaffold_5 AUGUSTUS transcript 1984089 1985227 0.26 - . g382.t1 Scaffold_5 AUGUSTUS stop_codon 1984089 1984091 . - 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_5 AUGUSTUS CDS 1984089 1984889 0.32 - 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_5 AUGUSTUS CDS 1985054 1985227 0.26 - 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_5 AUGUSTUS start_codon 1985225 1985227 . - 0 transcript_id "g382.t1"; gene_id "g382"; # protein sequence = [MAAGSLTLGGNASIAVGPLGRNGEASGSLNSSGKVAAMYSYSKTRGLFGGISVEGSVIQGRRRVCVRGLASPGAETAA # TLRKTRKGGDKSPYPPASWGEPKSSGSYFDSRINTGSNDYTNGTNTFSPKSTSQSSKSLSISVPHRELDDDSVTSSFDTRFESDYSPEEDLRRPSRMS # LYTPKEQADPFASLGDLSGHGRSMSMASPSPFSSNNRRYSSNLFSSSLPSSKLSSTMASMPISSPITNAQQYIAPKPELAKPLLRHEGVARAIALYNF # DGVEACHFLSYHLLSYFYCILKVLIQSGDLSLKKGDVIIITKKSESSDDW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g382 ### # start gene g383 Scaffold_5 AUGUSTUS gene 1991358 1992395 0.99 - . g383 Scaffold_5 AUGUSTUS transcript 1991358 1992395 0.99 - . g383.t1 Scaffold_5 AUGUSTUS stop_codon 1991358 1991360 . - 0 transcript_id "g383.t1"; gene_id "g383"; Scaffold_5 AUGUSTUS CDS 1991358 1992395 0.99 - 0 transcript_id "g383.t1"; gene_id "g383"; Scaffold_5 AUGUSTUS start_codon 1992393 1992395 . - 0 transcript_id "g383.t1"; gene_id "g383"; # protein sequence = [MCSQYAVNIELHEGEALYRVFASCSSDAMTQTELASLLAQFNLLFVEIVRAPNTIALQDQAQIFSRPINVSMPPTSLK # ASGDPEAAIKIWSPTQQQLWKILIDFTGLPSDAIRPSTLLIAIGIDSICAIQVASLARRAGIPLTATDVARSPTVQDLLFLDPVTNKGVVTQSKPIPL # ELSPELVQNIFARLPIGYQRKISRLLPLAAGMEWTLSAWQMNRAVFPFKLDRNDEAIDVVSSRLHNAWQKLIRRHEILRSVLIHTEEQNYRILLGILS # MEEFEVPWEEDRLPSHDLLSNKTELELVRMKTKELAVMPISFGQPPTQLVLLHGKQSSYIIIGLHHMQYGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g383 ### # start gene g384 Scaffold_5 AUGUSTUS gene 1992605 1994801 0.26 - . g384 Scaffold_5 AUGUSTUS transcript 1992605 1994801 0.26 - . g384.t1 Scaffold_5 AUGUSTUS stop_codon 1992605 1992607 . - 0 transcript_id "g384.t1"; gene_id "g384"; Scaffold_5 AUGUSTUS CDS 1992605 1994487 0.76 - 2 transcript_id "g384.t1"; gene_id "g384"; Scaffold_5 AUGUSTUS CDS 1994666 1994801 0.34 - 0 transcript_id "g384.t1"; gene_id "g384"; Scaffold_5 AUGUSTUS start_codon 1994799 1994801 . - 0 transcript_id "g384.t1"; gene_id "g384"; # protein sequence = [MRAFWISQFEDVDLRARAIRHPSSISPPSFLSHALDVPLSDIQAKTHGIESAICPLVSVIPTIVDLVPKLSWSNLLQR # SQSFVTESIQHEQVALGQIQRWLGVTELVDVLFSCRFDTGEQVSDVIEHIGTSRSSPEVRRHLIQPIHCFELNIQFIFAVEFVLQPTDDAIEVRVSFT # EPEITPAGVLSLFARLEQVLENVLSHNNDIACDSIINQSSVDNVQNANLIDESSSSVELELILQKYISEFLGIELPALRPTTSFTSLGLSSIKAVSLS # RVLLQHGINVSPVDIIQGDQIRAIAKRAHASASFDDALETTEWLNDMKERLANELNVERLKLEPEDAIVITGCTSLQTGMLAQVRISTMSAFFWLSMS # SQTINSRGLLYIHAFTLQLAFDCDVSRLQAAWHEAVQNLTILRTSFHFTPISGQWAQVTHSIIDFKWSHSTQDKLGSAAADFITTLAFDNEETFARPP # VYFRHVSADMEYLVVVLHHALYDGLSLPKLFHHVQQLYQSKPVDLSTPFNQVADTILVAEGNGTAFWTRRLESVKPCHFMVQSRSSEEAWRASTTLEI # TTAEIQRFCRRYHVHPQALGQATWAKILCMREIRSDIIFGQVVSGRSLSGADNVIGPVFVRHHASFHVNGSTTLIVHIEHYSLQSFTDQGTIQPATCP # RHSQIE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g384 ### # start gene g385 Scaffold_5 AUGUSTUS gene 1995228 1998333 0.28 - . g385 Scaffold_5 AUGUSTUS transcript 1995228 1998333 0.28 - . g385.t1 Scaffold_5 AUGUSTUS stop_codon 1995228 1995230 . - 0 transcript_id "g385.t1"; gene_id "g385"; Scaffold_5 AUGUSTUS CDS 1995228 1996201 0.71 - 2 transcript_id "g385.t1"; gene_id "g385"; Scaffold_5 AUGUSTUS CDS 1996257 1996628 0.79 - 2 transcript_id "g385.t1"; gene_id "g385"; Scaffold_5 AUGUSTUS CDS 1996765 1997094 0.83 - 2 transcript_id "g385.t1"; gene_id "g385"; Scaffold_5 AUGUSTUS CDS 1997154 1997317 0.47 - 1 transcript_id "g385.t1"; gene_id "g385"; Scaffold_5 AUGUSTUS CDS 1997660 1998333 0.47 - 0 transcript_id "g385.t1"; gene_id "g385"; Scaffold_5 AUGUSTUS start_codon 1998331 1998333 . - 0 transcript_id "g385.t1"; gene_id "g385"; # protein sequence = [MSALAKEFADYTYLALPDLGTGTRNPLPKVHSITRKTSVDIREVGLSHQTLVRASFAKLILLYLDTHDFLLADSTSNL # YVPVRAKIDANKTLRQFAEGLENSARSTEHVTLDYVRQILSLPENQDPLPVLYTWVQEEFAVNVKCPILLEAQVQDGNQLMLYLRCNSTVMSLDTAKI # FLEQLCATVSFICAYPSANCDIAMDLPMHISSALEAPYDPEEAELTCSCGSKFVLTSADQAPYFGELAIVLDDLSVQEEVLGHDAADICLAELDSLAY # LLYTSGTTGMPKGCLLNHRGLYWAIIAMCKLPSKVTNPDTDKRLALACMYYIAVCTSINFDVYQNQAIAFDVHISEICQSWCLGIRLVSGPRYEFLAN # LQENIIKIGITHLGMVPTSSQMGYVAEVNFGEFLWVSSALTQARIFTEVPELARPTEATIGCTSRQITINDRKENIGRPFASCQAYVVDSAMNIVPRG # TPGELVVEGPLVGVGYHKLPDATNRAFLEWPHPGCRCYRTGDLVRLMPDNTLEIMGRIDTQIKLRGVRIESEGVSNVLLTASPIPMDATTLVSLHPGL # GSAEVLVSFVAVLNPNITFFQRRSELPVVTDEAFSNPDTLQNMRDAAIRELAVYMRPSYIIPLNFLPLNMNGKTDNKILSALFKETQLQDLIRLQGQA # FVQITSDLTSEEAQVIEMVSRVTGLEPGHLNQFSNLFESGLDSLKFPALASELRKTFMTSVTVAELMRNPVIRDVARLVPRNDPDYPSGDQTNIVNEF # AEKWKSVVDGIFEPSSIQAVLPPFPVQEGILFRCIASPHLYVQHFMYRCCKSVDLGKMKRSWEAVMRRQEILR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g385 ### # start gene g386 Scaffold_5 AUGUSTUS gene 2003813 2004151 0.85 + . g386 Scaffold_5 AUGUSTUS transcript 2003813 2004151 0.85 + . g386.t1 Scaffold_5 AUGUSTUS start_codon 2003813 2003815 . + 0 transcript_id "g386.t1"; gene_id "g386"; Scaffold_5 AUGUSTUS CDS 2003813 2004151 0.85 + 0 transcript_id "g386.t1"; gene_id "g386"; Scaffold_5 AUGUSTUS stop_codon 2004149 2004151 . + 0 transcript_id "g386.t1"; gene_id "g386"; # protein sequence = [MNLHGLLNDIPAGDGPIGHQVDMLLRKGSLKPSDDTPFSNEIFDPEGENRRSSRLSSKYKALLQFIVTNDWFSTSEQG # RERIMAEYKATNYSVVNPRTIDAVSPACLAESTH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g386 ### # start gene g387 Scaffold_5 AUGUSTUS gene 2011862 2012464 0.52 + . g387 Scaffold_5 AUGUSTUS transcript 2011862 2012464 0.52 + . g387.t1 Scaffold_5 AUGUSTUS start_codon 2011862 2011864 . + 0 transcript_id "g387.t1"; gene_id "g387"; Scaffold_5 AUGUSTUS CDS 2011862 2012464 0.52 + 0 transcript_id "g387.t1"; gene_id "g387"; Scaffold_5 AUGUSTUS stop_codon 2012462 2012464 . + 0 transcript_id "g387.t1"; gene_id "g387"; # protein sequence = [MAEIVTKPLRIEPNLPNAIEVRRSSFTWSDTVSTSAAGSTPNAGLAARKAMDNISKGKNDDQHTNNEKASSTTSPDKR # SSPFSLHDITLTIPRGQLCAIVGPVGAGKSSLLQALLGNMPVVDGPLKEGESEHRGEVVFGEKVGYCPQIPWIQSATIRDNITFGRPFFEEMYWRVVE # AASLLPDFAMLVNGDLTEVGEKGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g387 ### # start gene g388 Scaffold_5 AUGUSTUS gene 2012877 2013248 0.51 + . g388 Scaffold_5 AUGUSTUS transcript 2012877 2013248 0.51 + . g388.t1 Scaffold_5 AUGUSTUS start_codon 2012877 2012879 . + 0 transcript_id "g388.t1"; gene_id "g388"; Scaffold_5 AUGUSTUS CDS 2012877 2013248 0.51 + 0 transcript_id "g388.t1"; gene_id "g388"; Scaffold_5 AUGUSTUS stop_codon 2013246 2013248 . + 0 transcript_id "g388.t1"; gene_id "g388"; # protein sequence = [MEERVLVADTQEVKNEQNAIDEAVGERVEQTKAKPQQQTLMQIEDRNVGSVNIKGEYESLQSTPSDKFLDVCKFTWSS # SKPAVWGTHFLCLLLLYASSRDLACLVRIGKCFKAYAVHRFIKST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g388 ### # start gene g389 Scaffold_5 AUGUSTUS gene 2020023 2020984 0.4 + . g389 Scaffold_5 AUGUSTUS transcript 2020023 2020984 0.4 + . g389.t1 Scaffold_5 AUGUSTUS start_codon 2020023 2020025 . + 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_5 AUGUSTUS CDS 2020023 2020199 0.45 + 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_5 AUGUSTUS CDS 2020265 2020984 0.6 + 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_5 AUGUSTUS stop_codon 2020982 2020984 . + 0 transcript_id "g389.t1"; gene_id "g389"; # protein sequence = [MLKQYSTLYTADSPKWDNITDLAHSFGWKNLIESTGAEFFTSNGVSKQYVFELIEAASRNIDSIHALEAACSIAANGA # SQIEGGNWQIFERFLNHSRANVFTDTKACSFRGRRDLVFLIYLQVTRITQKESKSRPWVVHSDKGPTGYKAVILAAPFHQTDIELPSALASQIPEQPY # VHLHVTLLTTTSPNLNREYLALSPNEKVPSMLLTTYDGVRQGRKAPEFNSISYHGKISEDEWVVKIFSESPVEDKWLQSLFNDQVGWVHRAEFDAYPK # LPPTSSFPPVKLDHGLFYVNAFEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g389 ### # start gene g390 Scaffold_5 AUGUSTUS gene 2032807 2033236 0.59 + . g390 Scaffold_5 AUGUSTUS transcript 2032807 2033236 0.59 + . g390.t1 Scaffold_5 AUGUSTUS start_codon 2032807 2032809 . + 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_5 AUGUSTUS CDS 2032807 2032812 0.59 + 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_5 AUGUSTUS CDS 2032961 2033236 0.6 + 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_5 AUGUSTUS stop_codon 2033234 2033236 . + 0 transcript_id "g390.t1"; gene_id "g390"; # protein sequence = [MECNPELSALITKTLKVDKSVWLKDLERLKELLPYAEDAAFRKEWAAIKQRNKERLAHHVETTLGLTVNTNAMFDVQI # KVNYVPIQVRWILMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g390 ### # start gene g391 Scaffold_5 AUGUSTUS gene 2035263 2036030 1 + . g391 Scaffold_5 AUGUSTUS transcript 2035263 2036030 1 + . g391.t1 Scaffold_5 AUGUSTUS start_codon 2035263 2035265 . + 0 transcript_id "g391.t1"; gene_id "g391"; Scaffold_5 AUGUSTUS CDS 2035263 2036030 1 + 0 transcript_id "g391.t1"; gene_id "g391"; Scaffold_5 AUGUSTUS stop_codon 2036028 2036030 . + 0 transcript_id "g391.t1"; gene_id "g391"; # protein sequence = [MGTENRRPPQDFIPPVPDPYEYIIFRASEVKDLAVDQSVEPPRGRSVHDDPAVLGASSQLPPQIPPSVQQPVPFQQQQ # PAPSQYTQETPAPGAAGEGGRSTSAAAVARARAQRLHTATASLETVERALGDLRVSQQQPANGHGNGTRRRGGAPGGATLKVPTTDFDFESSNRRFVK # AHNSDDSDQTSSGEEDDDGSRKKSSSAGTSKTSQAYNPSKSFFDSLTPGQGGGGSAGPRGGAAGMNGLRLLGQGVKRNE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g391 ### # start gene g392 Scaffold_5 AUGUSTUS gene 2039745 2040398 0.98 - . g392 Scaffold_5 AUGUSTUS transcript 2039745 2040398 0.98 - . g392.t1 Scaffold_5 AUGUSTUS stop_codon 2039745 2039747 . - 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_5 AUGUSTUS CDS 2039745 2040398 0.98 - 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_5 AUGUSTUS start_codon 2040396 2040398 . - 0 transcript_id "g392.t1"; gene_id "g392"; # protein sequence = [MNYIQTSRVAADFNVELFDWNQIEQAKSLGFAQIDLAELEPFQATEKTLTLTSHKHGDKGHLRVRLMFQPEVIVKSRK # NTSTFSTAGRAMTQIGGLPMSAGKGVFHGVTGILKKGHKGDGSDDSSVPDFPAGQQSHPVGTSELATSAGNPFPPSSSSENLPVSSNNEPGTLRVTVI # DAKDLAGGDAKAYAVIRVGDKEQKTKHSGKTASPEWYKLFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g392 ### # start gene g393 Scaffold_5 AUGUSTUS gene 2041195 2042924 0.05 - . g393 Scaffold_5 AUGUSTUS transcript 2041195 2042924 0.05 - . g393.t1 Scaffold_5 AUGUSTUS stop_codon 2041195 2041197 . - 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_5 AUGUSTUS CDS 2041195 2041746 0.76 - 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_5 AUGUSTUS CDS 2041840 2041858 0.28 - 1 transcript_id "g393.t1"; gene_id "g393"; Scaffold_5 AUGUSTUS CDS 2041909 2041947 0.28 - 1 transcript_id "g393.t1"; gene_id "g393"; Scaffold_5 AUGUSTUS CDS 2042058 2042094 0.54 - 2 transcript_id "g393.t1"; gene_id "g393"; Scaffold_5 AUGUSTUS CDS 2042192 2042617 0.54 - 2 transcript_id "g393.t1"; gene_id "g393"; Scaffold_5 AUGUSTUS CDS 2042669 2042924 0.14 - 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_5 AUGUSTUS start_codon 2042922 2042924 . - 0 transcript_id "g393.t1"; gene_id "g393"; # protein sequence = [METKFVLVNSLSETLNLNLYDFNDHRKDTLLGTATFELAQLQEDAVREGLTSPLLKDGKDRGELKYDISFYPVLKPEE # GQEVPDTKVGIVRLTVHQAKELDHTKSLSGDLNPIAKIYLGNSDTAIHATKCIKHTNSPVWEEPHEFLCADKNSSVITIKVIDDRDFLKDPVVGYMSI # KLADLLTAKSEARDWFPLSHCKSGKIRLSAEWKPLNMEGSLASADQYTPPIELKVLMEFSKSDPLKPCLGPNSLHTCSFSERDDRSLGSVDLHVEELA # VEHDDVEYPFKSTGVKEATDQIRLDKGGGFKGTLHYKAEFVPALKLKGGVQFNESGTSALTKGVSGSSSSKGSKDSDAGSFRSVGSKADEAGQDVPNG # VTISEPSKKTHNKGAKSTDTTATNATSGTVGTNGTTETSDEAQGESHDDVGVEMSKDELLAQREYHHIFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g393 ### # start gene g394 Scaffold_5 AUGUSTUS gene 2043422 2043928 0.65 - . g394 Scaffold_5 AUGUSTUS transcript 2043422 2043928 0.65 - . g394.t1 Scaffold_5 AUGUSTUS stop_codon 2043422 2043424 . - 0 transcript_id "g394.t1"; gene_id "g394"; Scaffold_5 AUGUSTUS CDS 2043422 2043928 0.65 - 0 transcript_id "g394.t1"; gene_id "g394"; Scaffold_5 AUGUSTUS start_codon 2043926 2043928 . - 0 transcript_id "g394.t1"; gene_id "g394"; # protein sequence = [MERTRRRSRDDIQRELVKSRLASEHETADWINNFLDRFWLIYEPVLSTTIVSSVDQILSTNTPAFLDSLRLSTFTLGT # KAPRIDKVRTFPRTEDDIVMMDWGISFTPNDISEMTPKQAAGKVNPKIVLSVRVGKGLASAAMPILLEDITFSGLMRIRMKLMSNFPTFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g394 ### # start gene g395 Scaffold_5 AUGUSTUS gene 2045275 2045712 0.77 + . g395 Scaffold_5 AUGUSTUS transcript 2045275 2045712 0.77 + . g395.t1 Scaffold_5 AUGUSTUS start_codon 2045275 2045277 . + 0 transcript_id "g395.t1"; gene_id "g395"; Scaffold_5 AUGUSTUS CDS 2045275 2045712 0.77 + 0 transcript_id "g395.t1"; gene_id "g395"; Scaffold_5 AUGUSTUS stop_codon 2045710 2045712 . + 0 transcript_id "g395.t1"; gene_id "g395"; # protein sequence = [MNSSSSLRDLYSNPSSTWSFTPPAPAGAAAAVAAATNSTHPTSGTPSFQWKSPRASHNSIFDLSPDLADVSDIDIMHV # VKTVLASAMLQYTSTAIAMPWEVGKLLLQVQWVPRDVQDPERIQDVPEDGEVCASRFLAMLLLLTYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g395 ### # start gene g396 Scaffold_5 AUGUSTUS gene 2047684 2048460 0.56 + . g396 Scaffold_5 AUGUSTUS transcript 2047684 2048460 0.56 + . g396.t1 Scaffold_5 AUGUSTUS start_codon 2047684 2047686 . + 0 transcript_id "g396.t1"; gene_id "g396"; Scaffold_5 AUGUSTUS CDS 2047684 2048460 0.56 + 0 transcript_id "g396.t1"; gene_id "g396"; Scaffold_5 AUGUSTUS stop_codon 2048458 2048460 . + 0 transcript_id "g396.t1"; gene_id "g396"; # protein sequence = [MMLRFWKYAQLEWEKQGLKIGIAVLSYCMLSSLASKQNLLTLIQAVGSDPNAAFPTQLYQATQALEYLLSEGCNPSDI # QIVGDSAGGNLVAQLLSHMVHPFPVSSLVPPTNLPPGTRLRGVFMISPWVSLSNPDQWGPTFRSKDYDVTVYKNLQEAGERYVNTISNIKNKIDDLSQ # VVPYAEPVLAPDNWYSNLPNTVVDRILVTAGKEERLSDQIQVFFEQKIRPYYSDAILLVQDGGIHDDVFMDFLFSDTPLEIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g396 ### # start gene g397 Scaffold_5 AUGUSTUS gene 2054226 2054882 0.5 - . g397 Scaffold_5 AUGUSTUS transcript 2054226 2054882 0.5 - . g397.t1 Scaffold_5 AUGUSTUS stop_codon 2054226 2054228 . - 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_5 AUGUSTUS CDS 2054226 2054882 0.5 - 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_5 AUGUSTUS start_codon 2054880 2054882 . - 0 transcript_id "g397.t1"; gene_id "g397"; # protein sequence = [MLNYEPHELICTTQPAVPIDATREQYPDGWTECLITGLMKQTVLQTPSFCQPLSQPVHASYRVGTVSAPNGPTSKPLP # GLYATKKLEMGDLILSERPVLIVPAMMRVGEIFSELLSQLDSHDQATVVSNQWQETLETVFGRLSKEDQEEFWKLRDIRQRNGKKSIDGIVKANGFAI # LGLADPGLSLARVVFWARFTVFIQDWKTITAHIVAFVLCCPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g397 ### # start gene g398 Scaffold_5 AUGUSTUS gene 2056171 2057485 0.36 - . g398 Scaffold_5 AUGUSTUS transcript 2056171 2057485 0.36 - . g398.t1 Scaffold_5 AUGUSTUS stop_codon 2056171 2056173 . - 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_5 AUGUSTUS CDS 2056171 2056716 0.74 - 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_5 AUGUSTUS CDS 2056859 2056885 0.44 - 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_5 AUGUSTUS CDS 2056949 2057485 0.87 - 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_5 AUGUSTUS start_codon 2057483 2057485 . - 0 transcript_id "g398.t1"; gene_id "g398"; # protein sequence = [MLTYEPSELICTTQPAVPIDATREQYPDGWTECLITGLMKQTVLQTPSFCQPLSQPVHTSYRVGTASAPNGPTSKPLP # GLYATKKLEMGDLILSERPVLIVPAMMRAGEIFSELLSQLDNHDQSIFVSNQWPGKVGDRFWEVVERDQEEFWKLRDIRQRNGKKSIDGIVKANGFAI # LGLDWKTMTAHILRAMRKISNDEELTVSYINQLEPFAVRQKNLKLFDIVCTCQSCKKPKIGDRRSTQFFKGKLTTDEFLNWITDTTLSDDHVIKRALV # QISLLEDDGLEDSPYYSYNLMMIMLCYVALGDSEKAMRWGKKLGKWELCKDGPKDVDNYDRPQWYMKHQWWKLRVIAWNNQWATANAMKEKMKQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g398 ### # start gene g399 Scaffold_5 AUGUSTUS gene 2063403 2064224 0.75 + . g399 Scaffold_5 AUGUSTUS transcript 2063403 2064224 0.75 + . g399.t1 Scaffold_5 AUGUSTUS start_codon 2063403 2063405 . + 0 transcript_id "g399.t1"; gene_id "g399"; Scaffold_5 AUGUSTUS CDS 2063403 2064224 0.75 + 0 transcript_id "g399.t1"; gene_id "g399"; Scaffold_5 AUGUSTUS stop_codon 2064222 2064224 . + 0 transcript_id "g399.t1"; gene_id "g399"; # protein sequence = [MEYPVFPSSMPLSLPPVFYHFFRTPLPYARTLALQEQLHAIQLSQRRLGAHKDVLLLLEHRPVYTAGRRQNEDSIRDD # KLRLTNIGADFINTQRGGELTYHGPGQIVGYPLLDLSRYSPAMGIRDYICRMQKILELHLSEGHGITPSASEHTGVFLNPTTKIASIGVQVRHRLTTH # GFSMNVTSEPITWFNQIVACGLADVKAGSIEGVQGRPISLKDEIPVLVERFGKLYEREMVEMDAKNEGEIGQAILEMEEDARRSGSWATEPIEAPIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g399 ### # start gene g400 Scaffold_5 AUGUSTUS gene 2064391 2065124 0.64 + . g400 Scaffold_5 AUGUSTUS transcript 2064391 2065124 0.64 + . g400.t1 Scaffold_5 AUGUSTUS start_codon 2064391 2064393 . + 0 transcript_id "g400.t1"; gene_id "g400"; Scaffold_5 AUGUSTUS CDS 2064391 2064766 0.64 + 0 transcript_id "g400.t1"; gene_id "g400"; Scaffold_5 AUGUSTUS CDS 2064823 2065124 0.93 + 2 transcript_id "g400.t1"; gene_id "g400"; Scaffold_5 AUGUSTUS stop_codon 2065122 2065124 . + 0 transcript_id "g400.t1"; gene_id "g400"; # protein sequence = [MRVLILGATGPIGIALCHEILSSIQDSSLVLFVRSPQKVPNDLSSSSRVSVITGQLTDVASLAEAMEGVDAVCSALGP # SVKKGPFHPSGEPLAHAYKNVIDAMKKHGVKRLFALGECSYVKSWARYKSDIKFTALVTAVSTFARTAYKDMVAIGETISKQDDLSWIIVRVPLLNDK # PNRDVIAGFIGDGKVNTGLSRIGFAVFVVAQLSDPDSIWIKKAPMICNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g400 ### # start gene g401 Scaffold_5 AUGUSTUS gene 2067637 2069199 0.41 - . g401 Scaffold_5 AUGUSTUS transcript 2067637 2069199 0.41 - . g401.t1 Scaffold_5 AUGUSTUS stop_codon 2067637 2067639 . - 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_5 AUGUSTUS CDS 2067637 2067936 0.7 - 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_5 AUGUSTUS CDS 2067991 2069199 0.43 - 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_5 AUGUSTUS start_codon 2069197 2069199 . - 0 transcript_id "g401.t1"; gene_id "g401"; # protein sequence = [MDYNSHGDLVFVQYKEKSSGPLVTETPKSSKVASSTSVNGGHRPWELVQEDPVDMYWRSRDGKIPRERDLQFCKHGPK # GMCDYCMPLEPYDIAYHKEHGIKHLSYHAYLQKITPKSSGAAQYIPPLNPLDYRVKVPCPTGNHPSWPSGICTSCQPSAITLQSQPFRMVDHLEIAST # NVIDRFLQAWRRTGMQRFGWMIGRYEPYDKVPMGVKAVVEAIHEPPQEGELDGLTLGLPWEDEPRVRSLASKGSTPLTIVGYIFTDLDPREDDRTKNV # YKRHPGSFVMSSLEAIFAAAMQAANPTPSKSSSSGKFSSRLVTAILTGTEDGAIDVSAYQVSEQATAMVEADMIEASVDPGIVRVKEEDRSVDSARYV # PDVFFSYKNEYGLEVKKSAKPAFPVEYLILNVTHGFPQNPVPLFQSTQFHIENRPGLENPTVEGVLSQLSALGAPDIQDSRHRKPGEAQKVFELAKFL # SDWHLIAFLDTTQLFPPVSMTCIDPYLSRIVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g401 ### # start gene g402 Scaffold_5 AUGUSTUS gene 2070145 2071406 0.45 + . g402 Scaffold_5 AUGUSTUS transcript 2070145 2071406 0.45 + . g402.t1 Scaffold_5 AUGUSTUS start_codon 2070145 2070147 . + 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_5 AUGUSTUS CDS 2070145 2070390 0.45 + 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_5 AUGUSTUS CDS 2070453 2071406 0.92 + 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_5 AUGUSTUS stop_codon 2071404 2071406 . + 0 transcript_id "g402.t1"; gene_id "g402"; # protein sequence = [MLSLKDFDNPQDKASDTSLLNPNIDSELEHWKKLVFSFDMDGGDSNNNGSSSSAHNNNPDRRNTRSRSHSVNQQVQGS # NAPMLPRADVQDALLLAQLSAGGLPQPHASHDPAYNALLLALLQAQHSQHSPPNFPPAMNQQVYGQHSVLQPSFGSMPSQYQWPPPPTFGQQQQSFPY # NQSGMSAHATGYPNLPQINTNVAMGTPDTSSAAVATSSNSPPTAVSRTESPDPTDPSVTEDKRRRNTAASGNPVLFPLRFSLILNFFLFVARFRIKKK # QRNLNLERTVSDLTGRADELEKEAADLRRENGWLKEIVMLKGSRFAGLDVSPQNLPKPPEGDASFWGPANLRSSQPVASSVRKPTDRSQEVEDSDSEN # DSDGTAKLRVQREGLQDRKERRDRSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g402 ### # start gene g403 Scaffold_5 AUGUSTUS gene 2082750 2084543 0.08 - . g403 Scaffold_5 AUGUSTUS transcript 2082750 2084543 0.08 - . g403.t1 Scaffold_5 AUGUSTUS stop_codon 2082750 2082752 . - 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_5 AUGUSTUS CDS 2082750 2083175 0.66 - 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_5 AUGUSTUS CDS 2083277 2083729 0.45 - 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_5 AUGUSTUS CDS 2083815 2084543 0.45 - 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_5 AUGUSTUS start_codon 2084541 2084543 . - 0 transcript_id "g403.t1"; gene_id "g403"; # protein sequence = [MDDDLVDQCKPGDRIQLVGFYRSVGGGSTGAFKCVLFFLCNVFVHSLLGRSLLIANNINLLTSKIGGGIAQTQLTDTD # IRNINQLSKKSNIFSLLSESLASSIYGHEYIKRAILLLLLGGAEKNLPNGTHIRGDINLLMVGDPSTAKSQLLRFVLSTAPLAIATTGRGSSGVGLTA # AVTSDKETGERRLEAGAMVLADRGVVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHTSLNARCSYDIHKDPHKNIALPDSLLSRFDLLFIVTDDV # EEERDRRIADHVLRMHRYLPPGVEEGTPSQDILSQPLSVEGPGVASNEELDTSPFQKYDPLLHVGVGSGSSGRQTRSQTRTQTSKKPEVLTISFVKKY # IQYAKSKPAPVLTKGAADYIVQTSPLTARTLETLIRLATAHAKSRLSAKVEESDAREAEMIMRFALYKEVPKRHRRKKRKLNHGGAARKGSESGDEDD # EDSEDEDEENEGTQRMNAPPAPAPREPQDPIWGDESQDTDMVDDAPAESEEMRKSNRCVALPYFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g403 ### # start gene g404 Scaffold_5 AUGUSTUS gene 2084671 2085213 0.49 - . g404 Scaffold_5 AUGUSTUS transcript 2084671 2085213 0.49 - . g404.t1 Scaffold_5 AUGUSTUS stop_codon 2084671 2084673 . - 0 transcript_id "g404.t1"; gene_id "g404"; Scaffold_5 AUGUSTUS CDS 2084671 2085213 0.49 - 0 transcript_id "g404.t1"; gene_id "g404"; Scaffold_5 AUGUSTUS start_codon 2085211 2085213 . - 0 transcript_id "g404.t1"; gene_id "g404"; # protein sequence = [MDDTNNTNSGPTENDKARVFEEFLLAPEENVYNYQKDIATMIRKDQTRLIVNIDDLRDYNREYADGLLKKPIDYFPAF # EIGLKNAIKLVAGEKYALKKSYKIGLGGSFGDHHVSPRNLHSGHLSKVISLEGIVTRCSLVRPKMMSSTHYCPETHMFGKNHMTTRNFLLSYRANQRA # SATD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g404 ### # start gene g405 Scaffold_5 AUGUSTUS gene 2087696 2088493 0.65 - . g405 Scaffold_5 AUGUSTUS transcript 2087696 2088493 0.65 - . g405.t1 Scaffold_5 AUGUSTUS stop_codon 2087696 2087698 . - 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_5 AUGUSTUS CDS 2087696 2088493 0.65 - 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_5 AUGUSTUS start_codon 2088491 2088493 . - 0 transcript_id "g405.t1"; gene_id "g405"; # protein sequence = [MNVNIKYDDMMLPLQGPENPFGDRKRFLNQNALAGHVEEQSMTEHAFRSQHLTHAILGYSANPSIDPNAPAVLGSIES # AQSNGFSTIDTLRATRSQRKELKRKRKQRGDLDIVEGEGAYVGPWATWQGDEPENHFLTGVELGDEQEEEEEEEEEEVVKTKKAKPKRGAPGQETSIF # HGKSMTDYQGRTYMSPPVAEAPNLLQEAGSQECFIPKVCIHTWTGHTQGVSVIRTFPETGHMFLSGSMDTKIKVSLFCCLWKHRLTRRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g405 ### # start gene g406 Scaffold_5 AUGUSTUS gene 2089316 2089702 0.58 - . g406 Scaffold_5 AUGUSTUS transcript 2089316 2089702 0.58 - . g406.t1 Scaffold_5 AUGUSTUS stop_codon 2089316 2089318 . - 0 transcript_id "g406.t1"; gene_id "g406"; Scaffold_5 AUGUSTUS CDS 2089316 2089702 0.58 - 0 transcript_id "g406.t1"; gene_id "g406"; Scaffold_5 AUGUSTUS start_codon 2089700 2089702 . - 0 transcript_id "g406.t1"; gene_id "g406"; # protein sequence = [MTPNNKGDLPPLPSSAKKTGSSGSGSRYSDQQATVRHMPPAAGATTTAAAVASTPRSGNSRVVHREASDEYDDDFTYE # DDEGYAGGYRQSDEILEEKISRTHLTDDEVEVPDTTMLDSVILPAIASVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g406 ### # start gene g407 Scaffold_5 AUGUSTUS gene 2094973 2095509 0.97 - . g407 Scaffold_5 AUGUSTUS transcript 2094973 2095509 0.97 - . g407.t1 Scaffold_5 AUGUSTUS stop_codon 2094973 2094975 . - 0 transcript_id "g407.t1"; gene_id "g407"; Scaffold_5 AUGUSTUS CDS 2094973 2095509 0.97 - 0 transcript_id "g407.t1"; gene_id "g407"; Scaffold_5 AUGUSTUS start_codon 2095507 2095509 . - 0 transcript_id "g407.t1"; gene_id "g407"; # protein sequence = [MDKKPSKTVSPPHDVDLDSIPVVKLEGMPAFLGVYLPFTINVDSANIYVIVGPVDSRLPSLRSTPFQYSPEPFYIDRV # GEMPTGAAALTNSSPSSHHSTPTPGSRPGSIISRTASPAPVRLSSGLTASISSFPQYEVADEDGQPATPTPEPVKVQSKKKKAPGTVTGKKKRPKAVA # AS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g407 ### # start gene g408 Scaffold_5 AUGUSTUS gene 2099022 2100210 0.35 + . g408 Scaffold_5 AUGUSTUS transcript 2099022 2100210 0.35 + . g408.t1 Scaffold_5 AUGUSTUS start_codon 2099022 2099024 . + 0 transcript_id "g408.t1"; gene_id "g408"; Scaffold_5 AUGUSTUS CDS 2099022 2099179 0.47 + 0 transcript_id "g408.t1"; gene_id "g408"; Scaffold_5 AUGUSTUS CDS 2099247 2099286 0.49 + 1 transcript_id "g408.t1"; gene_id "g408"; Scaffold_5 AUGUSTUS CDS 2099341 2100210 0.51 + 0 transcript_id "g408.t1"; gene_id "g408"; Scaffold_5 AUGUSTUS stop_codon 2100208 2100210 . + 0 transcript_id "g408.t1"; gene_id "g408"; # protein sequence = [MNRSAPEGFKLFQSQLRRGCLSHSCTEAQILFVHTRIVDDDVHDTVATRLRRGALSLSDTDVDCRLCGVIWFDQTKFA # RSWPHKRNRHPHLAVSERSFLPTPANKPFSRLFQVPSWNMTTTLSFSDSSILSTPELSSPSSASSSNDSSSFYSAVSSGDWNSIESEASLVASTPISS # DNNSESGYTSPYPLSFPSKANSTSASVIRSSVKNIASSNGIIFGSSFGEQRRADRRRPTPLPLVDPLDEILALPLVGFSAVSTSLTDVSVIERGRSIT # TRGARNLLGRRESSHVSDVRTERMRLQRVSSLPSIPSATLDPFWELSPEALNSKSEKAVQFDAADALQEVCTCFLLYINIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g408 ### # start gene g409 Scaffold_5 AUGUSTUS gene 2100286 2101593 0.78 + . g409 Scaffold_5 AUGUSTUS transcript 2100286 2101593 0.78 + . g409.t1 Scaffold_5 AUGUSTUS start_codon 2100286 2100288 . + 0 transcript_id "g409.t1"; gene_id "g409"; Scaffold_5 AUGUSTUS CDS 2100286 2101593 0.78 + 0 transcript_id "g409.t1"; gene_id "g409"; Scaffold_5 AUGUSTUS stop_codon 2101591 2101593 . + 0 transcript_id "g409.t1"; gene_id "g409"; # protein sequence = [MASLAWTGTLPSALPSSFPIANTEHASSAHPMSWTLTSACRSTWSLSDSTEPGSALFSSIPNLDDVFSPIPRSNTPVV # SEAFRLLDSDRRRQRRRWTLAMVITDDRISDEKLVEKLDRMMVSNIGGHVSSGWQENTGLRSPLSPTLFSAAIPSSNICASPREELEAESEVNVDEGD # CKNVEKRNDIVNGVLFPTSNNHFSQSTIWKTARRTLLICRELVRTERSYLSYLQVMLSQETMTPPPALLLAYLPALVQASEKLLSQMEMNPSAAGVAE # AFLACENQLELAFLGWCGIIGGFFAGAYDSPSIKRARTSSASFGRKDTRKGGYSDSSVKRRVGSWGKRLGSFRSRSWSMSGRSATEHAEYKVEVSFEE # KKELRMERYVHSVRDLAILPTQRVMRYTLLFRGDIDFLLFFFFMADISLSRPGIAHAVPFCVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g409 ### # start gene g410 Scaffold_5 AUGUSTUS gene 2104331 2105134 0.62 - . g410 Scaffold_5 AUGUSTUS transcript 2104331 2105134 0.62 - . g410.t1 Scaffold_5 AUGUSTUS stop_codon 2104331 2104333 . - 0 transcript_id "g410.t1"; gene_id "g410"; Scaffold_5 AUGUSTUS CDS 2104331 2105134 0.62 - 0 transcript_id "g410.t1"; gene_id "g410"; Scaffold_5 AUGUSTUS start_codon 2105132 2105134 . - 0 transcript_id "g410.t1"; gene_id "g410"; # protein sequence = [MASYSTSYPHHQHSTSYAGPPPPIVPSTSPSISSSSPSQSPVQDFREPEYESFSSTGGNFPYLTSQMSLGSASASAPY # LPLSSLNSLNTDTLSGPGRRPTPTRLSSRTSHPRLNDLNAYPSSNGAMQGMRHGGGRSPNPRSPFRPSPLSGPASATSPGSYFPLVPSNGGDISQLHN # MGMEQQHRQQQAQRQQLRSPSSQSQSSTSLPGTPFDEGVPDGYLTATNGNGYFSHQQQRQRVPSVPSMGHGAMQNGYASFSAEGSVGYFGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g410 ### # start gene g411 Scaffold_5 AUGUSTUS gene 2105422 2105745 0.37 - . g411 Scaffold_5 AUGUSTUS transcript 2105422 2105745 0.37 - . g411.t1 Scaffold_5 AUGUSTUS stop_codon 2105422 2105424 . - 0 transcript_id "g411.t1"; gene_id "g411"; Scaffold_5 AUGUSTUS CDS 2105422 2105745 0.37 - 0 transcript_id "g411.t1"; gene_id "g411"; Scaffold_5 AUGUSTUS start_codon 2105743 2105745 . - 0 transcript_id "g411.t1"; gene_id "g411"; # protein sequence = [MNEQMMRELGKVHANMVAANKHAFQAQGNGTPVPGRGGRRASKARPVTSTGYEGSGNPDGDFDSYLPLRFVDGRILVM # YPGLSQSKPGRNDFSDPSSVRKKEKEDGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g411 ### # start gene g412 Scaffold_5 AUGUSTUS gene 2107962 2109028 0.32 + . g412 Scaffold_5 AUGUSTUS transcript 2107962 2109028 0.32 + . g412.t1 Scaffold_5 AUGUSTUS start_codon 2107962 2107964 . + 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_5 AUGUSTUS CDS 2107962 2108018 0.37 + 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_5 AUGUSTUS CDS 2108693 2109028 0.62 + 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_5 AUGUSTUS stop_codon 2109026 2109028 . + 0 transcript_id "g412.t1"; gene_id "g412"; # protein sequence = [MYGILTLIFFVTYFPSGLMTSAPEDDCGHARYPFKSRSYTVTLPKKSELVSNVSLRAVIPSSLTSCISDVGFPVYVLP # RSVKCDGMDAVAGSVDRPDGDIGAEVMAAGAIGAASDNEGNVKVCFRFASSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g412 ### # start gene g413 Scaffold_5 AUGUSTUS gene 2110611 2111063 0.76 + . g413 Scaffold_5 AUGUSTUS transcript 2110611 2111063 0.76 + . g413.t1 Scaffold_5 AUGUSTUS start_codon 2110611 2110613 . + 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_5 AUGUSTUS CDS 2110611 2111063 0.76 + 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_5 AUGUSTUS stop_codon 2111061 2111063 . + 0 transcript_id "g413.t1"; gene_id "g413"; # protein sequence = [MNSNSTDDISSVPLEKVNLSNAQKKQVNGQIGKLVCGKVVEVAEKYQILYMFVPCLFCRLRIRVLSFFASRGFEATDI # LVAFSDPSAHLTSRSILSSSNDSTSSPMVESVDLLGWDKVKKITKDSSKDEVVSFLTLNSPFDEKSDMAMTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g413 ### # start gene g414 Scaffold_5 AUGUSTUS gene 2115109 2115546 0.7 - . g414 Scaffold_5 AUGUSTUS transcript 2115109 2115546 0.7 - . g414.t1 Scaffold_5 AUGUSTUS stop_codon 2115109 2115111 . - 0 transcript_id "g414.t1"; gene_id "g414"; Scaffold_5 AUGUSTUS CDS 2115109 2115546 0.7 - 0 transcript_id "g414.t1"; gene_id "g414"; Scaffold_5 AUGUSTUS start_codon 2115544 2115546 . - 0 transcript_id "g414.t1"; gene_id "g414"; # protein sequence = [MNTELVQSNVNDEEGRMIPALREMKVLTIKYIPNLIHRKSVELGSKASARRPMKPGMMENNYPEILSWTNQKGRIAYH # KQKSHIREAAKVSHNKEPNDGHSLARNIIEYCFQRSESEARVDQTSKLRTEAPLECIPSHVYLRLQK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g414 ### # start gene g415 Scaffold_5 AUGUSTUS gene 2130650 2131471 0.96 - . g415 Scaffold_5 AUGUSTUS transcript 2130650 2131471 0.96 - . g415.t1 Scaffold_5 AUGUSTUS stop_codon 2130650 2130652 . - 0 transcript_id "g415.t1"; gene_id "g415"; Scaffold_5 AUGUSTUS CDS 2130650 2131471 0.96 - 0 transcript_id "g415.t1"; gene_id "g415"; Scaffold_5 AUGUSTUS start_codon 2131469 2131471 . - 0 transcript_id "g415.t1"; gene_id "g415"; # protein sequence = [MPTTPSTPNYEGLPELFAPQPPPAQPLQHGQIPLQPIHEPEIGPRRGTRICEPSARQLQFQESAKREQSAFERNLAWA # QDSGTGIDELEENSLAMVAKSPFAFAAESSDKWVPNTYKQVMRPELWKAPMQAEYDTLIEKDCWTLVDLPPNANLTGGRWVYAIKWSKDGEVAKRKAC # YVAQGFTQIEGVDYDKTYGAVARMESVRIVLVIIAVLGLFMFQVDFKAAFLNLPINHDVYMKQPEGFVKEGEEHKVCKLNKSIYGTMQGRAMTGRTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g415 ### # start gene g416 Scaffold_5 AUGUSTUS gene 2132298 2133512 0.83 - . g416 Scaffold_5 AUGUSTUS transcript 2132298 2133512 0.83 - . g416.t1 Scaffold_5 AUGUSTUS stop_codon 2132298 2132300 . - 0 transcript_id "g416.t1"; gene_id "g416"; Scaffold_5 AUGUSTUS CDS 2132298 2133512 0.83 - 0 transcript_id "g416.t1"; gene_id "g416"; Scaffold_5 AUGUSTUS start_codon 2133510 2133512 . - 0 transcript_id "g416.t1"; gene_id "g416"; # protein sequence = [MPKSWRDLLINVKGISSDDAFIHLRQVYDNKKEDEEDTRQHSQVRALIAQEMASFHSANTASAPKKDHPTCTNPNCPP # VNVVLIQLTNVGHPVAVMKGGPKKAEASATQTANYASDGGNRTIMELFDLCTSSPTPILSTQLPNAHTCRDCVSVSTGYDADKEVTYHVDMFNSSISD # SIPNLDEYTACSAHNARSFLYAASKPQTPQTFLDSAASDHFWVRRADFIEYENLYGKAGKSAIAGKAGEFEIHGFMEFETAINGIRRRCRLNNVFHTP # SFHHNLISLRTLDAKGMKGEWGRGSLTVRTPNGSVVMQGKGKGTMYEVQTNFEPSFANFARSHNKPVDIHTWHCRLGHPAIDRILQMHKLNLVDGLQI # TSKKVAVNANHVFLANRLTDLSMRSSHMNQGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g416 ### # start gene g417 Scaffold_5 AUGUSTUS gene 2145540 2147028 0.54 - . g417 Scaffold_5 AUGUSTUS transcript 2145540 2147028 0.54 - . g417.t1 Scaffold_5 AUGUSTUS stop_codon 2145540 2145542 . - 0 transcript_id "g417.t1"; gene_id "g417"; Scaffold_5 AUGUSTUS CDS 2145540 2146963 0.63 - 2 transcript_id "g417.t1"; gene_id "g417"; Scaffold_5 AUGUSTUS CDS 2147016 2147028 0.54 - 0 transcript_id "g417.t1"; gene_id "g417"; Scaffold_5 AUGUSTUS start_codon 2147026 2147028 . - 0 transcript_id "g417.t1"; gene_id "g417"; # protein sequence = [MITRSRTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSISRGRLTSLPSNLKKSNLDPKWKRKEINPIDIEEDII # ELIAPESISTSSTSIESTTLIDTLNQTISQASNMIEPVKMTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFKATESIFEHGG # ITSDKAEVISALEWMSYKTRQTLRVFDSVKTPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMI # TNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSKRHINLPFAADVPK # TDRNYLQALKPKVEDKFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSG # PSNQSNRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g417 ### # start gene g418 Scaffold_5 AUGUSTUS gene 2147824 2148096 0.66 + . g418 Scaffold_5 AUGUSTUS transcript 2147824 2148096 0.66 + . g418.t1 Scaffold_5 AUGUSTUS start_codon 2147824 2147826 . + 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_5 AUGUSTUS CDS 2147824 2148096 0.66 + 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_5 AUGUSTUS stop_codon 2148094 2148096 . + 0 transcript_id "g418.t1"; gene_id "g418"; # protein sequence = [MLSATYNDLGYYTSHADPCVCTKWLKDGSFTMMDTYTDNIWGASSSKEEAERRMKELGDEWEIKDVGENKYFLGMHID # QGLDMGTIQLSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g418 ### # start gene g419 Scaffold_5 AUGUSTUS gene 2173490 2175713 0.31 - . g419 Scaffold_5 AUGUSTUS transcript 2173490 2175713 0.31 - . g419.t1 Scaffold_5 AUGUSTUS stop_codon 2173490 2173492 . - 0 transcript_id "g419.t1"; gene_id "g419"; Scaffold_5 AUGUSTUS CDS 2173490 2174694 0.5 - 2 transcript_id "g419.t1"; gene_id "g419"; Scaffold_5 AUGUSTUS CDS 2175698 2175713 0.44 - 0 transcript_id "g419.t1"; gene_id "g419"; Scaffold_5 AUGUSTUS start_codon 2175711 2175713 . - 0 transcript_id "g419.t1"; gene_id "g419"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNRGALVMFEGARGLTRKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g419 ### # start gene g420 Scaffold_5 AUGUSTUS gene 2178968 2179625 0.29 + . g420 Scaffold_5 AUGUSTUS transcript 2178968 2179625 0.29 + . g420.t1 Scaffold_5 AUGUSTUS start_codon 2178968 2178970 . + 0 transcript_id "g420.t1"; gene_id "g420"; Scaffold_5 AUGUSTUS CDS 2178968 2179016 0.29 + 0 transcript_id "g420.t1"; gene_id "g420"; Scaffold_5 AUGUSTUS CDS 2179078 2179625 0.66 + 2 transcript_id "g420.t1"; gene_id "g420"; Scaffold_5 AUGUSTUS stop_codon 2179623 2179625 . + 0 transcript_id "g420.t1"; gene_id "g420"; # protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTTRELFLRSILDLQNAGEDPVVVLEALKAAEPNRRAIN # LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLCSIHSGESTAHIDKHGHLVEASPPPDSATEALEGLKEVERGSADEGASSPVGGSVPMELDLP # TIESLAERTLSPEKGAESAQIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g420 ### # start gene g421 Scaffold_5 AUGUSTUS gene 2180653 2182099 0.22 + . g421 Scaffold_5 AUGUSTUS transcript 2180653 2182099 0.22 + . g421.t1 Scaffold_5 AUGUSTUS start_codon 2180653 2180655 . + 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_5 AUGUSTUS CDS 2180653 2180820 0.39 + 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_5 AUGUSTUS CDS 2181457 2181592 0.68 + 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_5 AUGUSTUS CDS 2181673 2181823 1 + 2 transcript_id "g421.t1"; gene_id "g421"; Scaffold_5 AUGUSTUS CDS 2181883 2182099 0.81 + 1 transcript_id "g421.t1"; gene_id "g421"; Scaffold_5 AUGUSTUS stop_codon 2182097 2182099 . + 0 transcript_id "g421.t1"; gene_id "g421"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKEEKS # AVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANCILKSRQDSGSDSSASDASFATAQS # IPTTGSEDTVVTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g421 ### # start gene g422 Scaffold_5 AUGUSTUS gene 2182355 2183200 0.83 - . g422 Scaffold_5 AUGUSTUS transcript 2182355 2183200 0.83 - . g422.t1 Scaffold_5 AUGUSTUS stop_codon 2182355 2182357 . - 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_5 AUGUSTUS CDS 2182355 2183200 0.83 - 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_5 AUGUSTUS start_codon 2183198 2183200 . - 0 transcript_id "g422.t1"; gene_id "g422"; # protein sequence = [MLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTG # AEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPR # YRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEE # LSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g422 ### # start gene g423 Scaffold_5 AUGUSTUS gene 2183719 2184828 0.8 - . g423 Scaffold_5 AUGUSTUS transcript 2183719 2184828 0.8 - . g423.t1 Scaffold_5 AUGUSTUS stop_codon 2183719 2183721 . - 0 transcript_id "g423.t1"; gene_id "g423"; Scaffold_5 AUGUSTUS CDS 2183719 2184828 0.8 - 0 transcript_id "g423.t1"; gene_id "g423"; Scaffold_5 AUGUSTUS start_codon 2184826 2184828 . - 0 transcript_id "g423.t1"; gene_id "g423"; # protein sequence = [MPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESWVKCQKMNGLNLLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g423 ### # start gene g424 Scaffold_5 AUGUSTUS gene 2186006 2187407 0.37 - . g424 Scaffold_5 AUGUSTUS transcript 2186006 2187407 0.37 - . g424.t1 Scaffold_5 AUGUSTUS stop_codon 2186006 2186008 . - 0 transcript_id "g424.t1"; gene_id "g424"; Scaffold_5 AUGUSTUS CDS 2186006 2186583 0.39 - 2 transcript_id "g424.t1"; gene_id "g424"; Scaffold_5 AUGUSTUS CDS 2186699 2187407 0.56 - 0 transcript_id "g424.t1"; gene_id "g424"; Scaffold_5 AUGUSTUS start_codon 2187405 2187407 . - 0 transcript_id "g424.t1"; gene_id "g424"; # protein sequence = [MFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDE # EIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSE # ITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMKLSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQ # VFCVWRDGVLGEFDDQLNNEQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNS # QRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g424 ### # start gene g425 Scaffold_5 AUGUSTUS gene 2187455 2189858 0.15 - . g425 Scaffold_5 AUGUSTUS transcript 2187455 2189858 0.15 - . g425.t1 Scaffold_5 AUGUSTUS stop_codon 2187455 2187457 . - 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_5 AUGUSTUS CDS 2187455 2188180 0.7 - 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_5 AUGUSTUS CDS 2188260 2188712 0.58 - 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_5 AUGUSTUS CDS 2188831 2188864 0.52 - 1 transcript_id "g425.t1"; gene_id "g425"; Scaffold_5 AUGUSTUS CDS 2188906 2189858 0.22 - 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_5 AUGUSTUS start_codon 2189856 2189858 . - 0 transcript_id "g425.t1"; gene_id "g425"; # protein sequence = [MDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLA # LEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIM # GDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLD # ELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRFGGERKCIVHMITDELLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRD # SLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFY # FLKMILWADRWNPLEKISTPMKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLK # KPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD # LSTEELAALSPAIRKLLCARYAIGESVQGLKRITTYQLYPKMEKLKFWTIHLGYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g425 ### # start gene g426 Scaffold_5 AUGUSTUS gene 2190307 2190843 0.59 - . g426 Scaffold_5 AUGUSTUS transcript 2190307 2190843 0.59 - . g426.t1 Scaffold_5 AUGUSTUS stop_codon 2190307 2190309 . - 0 transcript_id "g426.t1"; gene_id "g426"; Scaffold_5 AUGUSTUS CDS 2190307 2190843 0.59 - 0 transcript_id "g426.t1"; gene_id "g426"; Scaffold_5 AUGUSTUS start_codon 2190841 2190843 . - 0 transcript_id "g426.t1"; gene_id "g426"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVYI # LR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g426 ### # start gene g427 Scaffold_5 AUGUSTUS gene 2191117 2193350 0.36 - . g427 Scaffold_5 AUGUSTUS transcript 2191117 2193350 0.36 - . g427.t1 Scaffold_5 AUGUSTUS stop_codon 2191117 2191119 . - 0 transcript_id "g427.t1"; gene_id "g427"; Scaffold_5 AUGUSTUS CDS 2191117 2191844 0.5 - 2 transcript_id "g427.t1"; gene_id "g427"; Scaffold_5 AUGUSTUS CDS 2191959 2192576 0.38 - 2 transcript_id "g427.t1"; gene_id "g427"; Scaffold_5 AUGUSTUS CDS 2192627 2193350 0.91 - 0 transcript_id "g427.t1"; gene_id "g427"; Scaffold_5 AUGUSTUS start_codon 2193348 2193350 . - 0 transcript_id "g427.t1"; gene_id "g427"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQRILQKDIVESFLRDLSIDDERRNIAIVANQSVAYE # DHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNK # APFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTDGYKRCEQETFSKKELSEAYVLA # SREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSE # STETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERI # KLNQQDRSPINLIDETNKQVMKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g427 ### # start gene g428 Scaffold_5 AUGUSTUS gene 2193380 2194291 0.59 - . g428 Scaffold_5 AUGUSTUS transcript 2193380 2194291 0.59 - . g428.t1 Scaffold_5 AUGUSTUS stop_codon 2193380 2193382 . - 0 transcript_id "g428.t1"; gene_id "g428"; Scaffold_5 AUGUSTUS CDS 2193380 2194291 0.59 - 0 transcript_id "g428.t1"; gene_id "g428"; Scaffold_5 AUGUSTUS start_codon 2194289 2194291 . - 0 transcript_id "g428.t1"; gene_id "g428"; # protein sequence = [MNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESL # IPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCK # STDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIE # ELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g428 ### # start gene g429 Scaffold_5 AUGUSTUS gene 2194327 2194905 0.78 - . g429 Scaffold_5 AUGUSTUS transcript 2194327 2194905 0.78 - . g429.t1 Scaffold_5 AUGUSTUS stop_codon 2194327 2194329 . - 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_5 AUGUSTUS CDS 2194327 2194905 0.78 - 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_5 AUGUSTUS start_codon 2194903 2194905 . - 0 transcript_id "g429.t1"; gene_id "g429"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETGERCISYFYVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g429 ### # start gene g430 Scaffold_5 AUGUSTUS gene 2199553 2201028 0.49 - . g430 Scaffold_5 AUGUSTUS transcript 2199553 2201028 0.49 - . g430.t1 Scaffold_5 AUGUSTUS stop_codon 2199553 2199555 . - 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_5 AUGUSTUS CDS 2199553 2201028 0.49 - 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_5 AUGUSTUS start_codon 2201026 2201028 . - 0 transcript_id "g430.t1"; gene_id "g430"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPKMRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g430 ### # start gene g431 Scaffold_5 AUGUSTUS gene 2201079 2202245 0.83 - . g431 Scaffold_5 AUGUSTUS transcript 2201079 2202245 0.83 - . g431.t1 Scaffold_5 AUGUSTUS stop_codon 2201079 2201081 . - 0 transcript_id "g431.t1"; gene_id "g431"; Scaffold_5 AUGUSTUS CDS 2201079 2202245 0.83 - 0 transcript_id "g431.t1"; gene_id "g431"; Scaffold_5 AUGUSTUS start_codon 2202243 2202245 . - 0 transcript_id "g431.t1"; gene_id "g431"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g431 ### # start gene g432 Scaffold_5 AUGUSTUS gene 2210190 2211131 0.98 - . g432 Scaffold_5 AUGUSTUS transcript 2210190 2211131 0.98 - . g432.t1 Scaffold_5 AUGUSTUS stop_codon 2210190 2210192 . - 0 transcript_id "g432.t1"; gene_id "g432"; Scaffold_5 AUGUSTUS CDS 2210190 2211131 0.98 - 0 transcript_id "g432.t1"; gene_id "g432"; Scaffold_5 AUGUSTUS start_codon 2211129 2211131 . - 0 transcript_id "g432.t1"; gene_id "g432"; # protein sequence = [MEAPPETKLATPTPLPQQKQPDAPPIVGSTFESNGTAYHTRNDAPQHTSALTKFLEDDANERVVFSLDEFVTFILDLP # TDWKVKEEFSLPPTSTAVTEALGAYLKVAIKIAEGKRKKWRNAATNEIELNQPLTKVLDTLKGREEQLSRELDEEVFRVENPHLVLGSLLKRNPGLGG # IYNQLLKLTENKKLSTYLAEKNIFGVFWWLLLLFAELKLKKSFAEPDIQTESTSHGTPVNESSQSSVIEGLRPGSTVAPQALPIPSNLSLSGRPSHPK # SNKRLRSNEELDSTSMCPLLTLARLGTDKCFQSSAEQEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g432 ### # start gene g433 Scaffold_5 AUGUSTUS gene 2212281 2214493 0.19 - . g433 Scaffold_5 AUGUSTUS transcript 2212281 2214493 0.19 - . g433.t1 Scaffold_5 AUGUSTUS stop_codon 2212281 2212283 . - 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_5 AUGUSTUS CDS 2212281 2213018 0.92 - 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_5 AUGUSTUS CDS 2213092 2213391 0.57 - 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_5 AUGUSTUS CDS 2213478 2213514 0.56 - 1 transcript_id "g433.t1"; gene_id "g433"; Scaffold_5 AUGUSTUS CDS 2213598 2213745 0.38 - 2 transcript_id "g433.t1"; gene_id "g433"; Scaffold_5 AUGUSTUS CDS 2213818 2214493 0.42 - 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_5 AUGUSTUS start_codon 2214491 2214493 . - 0 transcript_id "g433.t1"; gene_id "g433"; # protein sequence = [MEQPRENVLATETPIPQQKQSQDLPVVAKTPASHEITTAEDAVPQRGSVLTEFLEDVRDRVVLSLDDFATLILNISAD # WKVEEEFSLRPESKIVQDAFEASLKVAIGAAEGAGKKGTDPIAHEKELHRPLRNLLNTLRDGEGHLGKDINEETLFVDPRPVLAFLLERKSDLSGIYI # QLQELLENRSLSDYLAERNITGIFWGLLISFVEVGCQKKDFVELNIRKEAANRSSQFMVSTPSQHGTTEGSQTAFSRSRSPPSSSQTEAIYHKLNKRV # SHAASKEGEIPVHLGTEPKIEDCPASAGRIQSDALPATPHPVSPHSASTLASAPTHLLCEDEDRLHVNIWSEDKKKTVEIATVQEYAQKDGMKSFGNH # IEFSSRGVEDNGKQFFSFHVQSFKNDEWKKLFIVMVCQLKTLPRTTKNAGSIPTLYIDGIEYLQDPELFSHTFALDTQDLIDAIYSFVGTDGCSRKVI # IESILHHAEDAVGLYAVVAEVECLCMEADCTWNGERKIVKISFMGTDRQSEQGLIGEARSKAESTGELWALNHLPNAIHSLSLLPNKKKTFHRRLKTY # LKDKYEERVMHITVFEKLHPLSELEDPRDFAQVFYDVLQSTPPFNSMYHHLTKPHMSSSSPMAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g433 ### # start gene g434 Scaffold_5 AUGUSTUS gene 2216158 2216658 0.95 + . g434 Scaffold_5 AUGUSTUS transcript 2216158 2216658 0.95 + . g434.t1 Scaffold_5 AUGUSTUS start_codon 2216158 2216160 . + 0 transcript_id "g434.t1"; gene_id "g434"; Scaffold_5 AUGUSTUS CDS 2216158 2216658 0.95 + 0 transcript_id "g434.t1"; gene_id "g434"; Scaffold_5 AUGUSTUS stop_codon 2216656 2216658 . + 0 transcript_id "g434.t1"; gene_id "g434"; # protein sequence = [MHYPAGSALPYPFTAILRAQPLSVHSPQLRFNVLGQKGSYIKYGVDVQEEQLKSLTAVPVTATSTSTASLTPENLITS # PSLGYGLEPEILWGALEHATDPVGTTFVKSVWPSEEPGCYADLYRNLAAAIREGVETKVKWEEATAVIEMIELAKKSAKEGRTVDVPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g434 ### # start gene g435 Scaffold_5 AUGUSTUS gene 2220863 2221652 0.24 - . g435 Scaffold_5 AUGUSTUS transcript 2220863 2221652 0.24 - . g435.t1 Scaffold_5 AUGUSTUS stop_codon 2220863 2220865 . - 0 transcript_id "g435.t1"; gene_id "g435"; Scaffold_5 AUGUSTUS CDS 2220863 2221061 0.87 - 1 transcript_id "g435.t1"; gene_id "g435"; Scaffold_5 AUGUSTUS CDS 2221132 2221320 0.69 - 1 transcript_id "g435.t1"; gene_id "g435"; Scaffold_5 AUGUSTUS CDS 2221432 2221652 0.26 - 0 transcript_id "g435.t1"; gene_id "g435"; Scaffold_5 AUGUSTUS start_codon 2221650 2221652 . - 0 transcript_id "g435.t1"; gene_id "g435"; # protein sequence = [MFVISSIRSTTDAFAIAGGLSGISTTTTSTAPAPPVAVQPPSMLRGKTIEEIVNKWSNELEAHVKEFNKFAAEVHVLA # AEREQNEVDQSLDHIEQQQKDLAATLDAYEKVTEEIFGGQGGSLRALDTGPADTERDKNYMLAADLQTHLDDLSGSLTQMIEAVNGLSISSGQSTSSD # LSANGNDRSQEDPMAQIFSDIEQPFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g435 ### # start gene g436 Scaffold_5 AUGUSTUS gene 2221943 2222865 0.15 - . g436 Scaffold_5 AUGUSTUS transcript 2221943 2222865 0.15 - . g436.t1 Scaffold_5 AUGUSTUS stop_codon 2221943 2221945 . - 0 transcript_id "g436.t1"; gene_id "g436"; Scaffold_5 AUGUSTUS CDS 2221943 2222214 0.52 - 2 transcript_id "g436.t1"; gene_id "g436"; Scaffold_5 AUGUSTUS CDS 2222372 2222668 0.4 - 2 transcript_id "g436.t1"; gene_id "g436"; Scaffold_5 AUGUSTUS CDS 2222748 2222865 0.74 - 0 transcript_id "g436.t1"; gene_id "g436"; Scaffold_5 AUGUSTUS start_codon 2222863 2222865 . - 0 transcript_id "g436.t1"; gene_id "g436"; # protein sequence = [MSFFANNTGNSGQAGAGAAGGNIFGGGGNANAGGSTGTPTNKPAGSIFGGGNSTLNTGTGSGTNLFGGGGGSGTSTST # PLFGGASNTNTNTNTTNNASAANPTPALFGGSPFSLPKPTEQANAPKPATSSCTFFAVSHSPKPGENNASSTSAASAPGTGGTGLLGGGFFNKPATPA # TNTQAAPTPSTSSSPFSLGGNAVGSGTIPTAPSPQVRLLLAVVNNFASRSTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g436 ### # start gene g437 Scaffold_5 AUGUSTUS gene 2227990 2228544 0.75 + . g437 Scaffold_5 AUGUSTUS transcript 2227990 2228544 0.75 + . g437.t1 Scaffold_5 AUGUSTUS start_codon 2227990 2227992 . + 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_5 AUGUSTUS CDS 2227990 2228544 0.75 + 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_5 AUGUSTUS stop_codon 2228542 2228544 . + 0 transcript_id "g437.t1"; gene_id "g437"; # protein sequence = [MQYHNGFRQQVLSWPTNPADHYVETLSSYHVNTIVADLGCGDAAIARALIPKGISVLSFDLVSHSPYVVEADICGTLP # LPGSEGTEGSLSEGEAHIVDIVVFSLSLMSTNWPKSIREAWRILKPKYVTSSLIEDDSQFTILISGELKIAEVTSRFRNLENFVSLVSSIGFKLKSKV # SFHPFARN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g437 ### # start gene g438 Scaffold_5 AUGUSTUS gene 2230170 2232560 0.73 + . g438 Scaffold_5 AUGUSTUS transcript 2230170 2232560 0.73 + . g438.t1 Scaffold_5 AUGUSTUS start_codon 2230170 2230172 . + 0 transcript_id "g438.t1"; gene_id "g438"; Scaffold_5 AUGUSTUS CDS 2230170 2232560 0.73 + 0 transcript_id "g438.t1"; gene_id "g438"; Scaffold_5 AUGUSTUS stop_codon 2232558 2232560 . + 0 transcript_id "g438.t1"; gene_id "g438"; # protein sequence = [MAIDVPGQVSTSLASSVTLVSPASPKVGAVLEANFEELLEDPRVSASTVVEYISSRAKTTSSVYIYDLAEQVGFGTLT # KIWSKAQDGTAPVVDLQTRAGAGLSLVGRLSEGTSSDTANGAVLTAFTSPQGLSLMAPALSYLPPATASSRLVIQVPNITPAGETYALSPTLANFATV # LPILPENIVVLASATSQETVHFTQLSYQLSASHVIHIFDHFSSSREVGHATLPLPEKDYGNISVAEAIQRAGYSSFDYVGDAEAHTVVLALNGPLAVA # AKAIANKSRHGFAAVSVNVLRPWDEAALRSVLPVTVKTVHVLDDVPNATTKGPLYIDVFSTLLDSINPPTVHSHRITPSQTQVYISQKDSFKEFLATL # VPELEDPVPAIMKKLMFFTTPSTTLSNLPLLVEGALSTSRTLSSRLSIDHDVFSKRGGITASRILLAPRSALDSEDFPIPLVLPYDAQTSGEVDFLAI # MDQTILKTHSVLKYAKPRSTILIVTTWTAEELFSNLPVPVTRLIVERELRPFIINVTDVAEKLTSAIGQVQDVISNIVAYLAFMRMYLGAAATEENVL # TLAIGSYGETVEGVELTKLNSQTWDALEEVLFIEAPAEEKPVELKEFEFNAIAVETDEGDTVVNGARLGSWHDAAKHLLFPTIFAPPTESTDEEFPQH # PSLRPELPERTFLVTCTVNCRLTPKEYDRNVFHLEFNTSGTGLKYAIGEALGVHGWNDNQEVTDFCEWYGVDPNRLITIPVPEARTSIILGPSFKPYN # NRSIYSDVLQNPSTPISQHMRLHKRTNIPCSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g438 ### # start gene g439 Scaffold_5 AUGUSTUS gene 2232927 2233474 0.63 + . g439 Scaffold_5 AUGUSTUS transcript 2232927 2233474 0.63 + . g439.t1 Scaffold_5 AUGUSTUS start_codon 2232927 2232929 . + 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_5 AUGUSTUS CDS 2232927 2232932 0.65 + 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_5 AUGUSTUS CDS 2233013 2233474 0.88 + 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_5 AUGUSTUS stop_codon 2233472 2233474 . + 0 transcript_id "g439.t1"; gene_id "g439"; # protein sequence = [MKPLIMAGLGTGAAPFRAFLQHKALLQSQGKAIGPVYYYFGSRHQSQEYLYGEEIEAFILDGIITRAGLAFSRDGPPG # LKKVYIQHKMLEDAQDLAKMLKHDQGVFYLCGPTWPVPDMYEALCGALEKYQGMSKDQAGEYLEGLKEEERYVLEVY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g439 ### # start gene g440 Scaffold_5 AUGUSTUS gene 2233725 2234349 0.8 + . g440 Scaffold_5 AUGUSTUS transcript 2233725 2234349 0.8 + . g440.t1 Scaffold_5 AUGUSTUS start_codon 2233725 2233727 . + 0 transcript_id "g440.t1"; gene_id "g440"; Scaffold_5 AUGUSTUS CDS 2233725 2234049 0.93 + 0 transcript_id "g440.t1"; gene_id "g440"; Scaffold_5 AUGUSTUS CDS 2234087 2234349 0.85 + 2 transcript_id "g440.t1"; gene_id "g440"; Scaffold_5 AUGUSTUS stop_codon 2234347 2234349 . + 0 transcript_id "g440.t1"; gene_id "g440"; # protein sequence = [MLLPSCLLALTFASIQVYAQLSLPSPPWLPANASAGAVATTGSNTSVPNEQWSTLLGDLLYFYEAQRSGKLPSNNRVS # WRNDSATSDGSDVGLDLTGGYYDAGGEDARNYIKVSFPLSFTLNSICWGGIDFGMGYDLSNQTSYLDSMLRWGLDWLIKMHPNTSTLYVEVADSEYAM # RHSFAANVETPDTLLFQPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g440 ### # start gene g441 Scaffold_5 AUGUSTUS gene 2234627 2235803 0.43 + . g441 Scaffold_5 AUGUSTUS transcript 2234627 2235803 0.43 + . g441.t1 Scaffold_5 AUGUSTUS start_codon 2234627 2234629 . + 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_5 AUGUSTUS CDS 2234627 2234981 0.43 + 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_5 AUGUSTUS CDS 2235072 2235202 0.71 + 2 transcript_id "g441.t1"; gene_id "g441"; Scaffold_5 AUGUSTUS CDS 2235255 2235803 0.71 + 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_5 AUGUSTUS stop_codon 2235801 2235803 . + 0 transcript_id "g441.t1"; gene_id "g441"; # protein sequence = [MTLYQNSVPEVQDSYASSGYGDELVMAGLWLSLAVNASQNANSTLNITTLSPQQYYSLAESYYSQFDLAGQNSVFNWD # DKTAGTYILFAQMSSLGLKEQVTSHSGKRKRNDIWMSWWTRGLLYYSGDSNDASLNPALNAAMLLTRYVASGLCSSNDKKATYLSFAQSQLDYTLGNN # PMFVPYIVGLHPNSPINPHSAMSSGGDDISQIDTSPPLSQGNTYVLYGAVVGGPDRFDRFFDIRSDWVENEVALDYNAPMLTLTAMHIVTDDIDPYFT # QVTVGANEKVKPKGQPCDDAIQDGCSGHRLSEGGEIALGVVLGVVGLVVVGLLAVWLWKLRSTGSFGGKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g441 ### # start gene g442 Scaffold_5 AUGUSTUS gene 2239198 2239897 0.23 - . g442 Scaffold_5 AUGUSTUS transcript 2239198 2239897 0.23 - . g442.t1 Scaffold_5 AUGUSTUS stop_codon 2239198 2239200 . - 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_5 AUGUSTUS CDS 2239198 2239646 0.58 - 2 transcript_id "g442.t1"; gene_id "g442"; Scaffold_5 AUGUSTUS CDS 2239732 2239897 0.31 - 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_5 AUGUSTUS start_codon 2239895 2239897 . - 0 transcript_id "g442.t1"; gene_id "g442"; # protein sequence = [MEDYVHRAGRTGRAGNKGTCVTFITPEQDRYSVDIYRALKASNATVPKDLEELANAQAAGSGFGGKGLDRLDKERDAK # EKAERKAYGEPEEEKPAVTEEAAPGGATANAAADDMTFGNFKVEIKRGPAPDSSKGLLGVAGAAAAARKLAHAKEEEKIQAQMRAAEEAAARAGKDSP # AHKQALSVREIERTAEGVQVGLAVAVGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g442 ### # start gene g443 Scaffold_5 AUGUSTUS gene 2240968 2242377 1 - . g443 Scaffold_5 AUGUSTUS transcript 2240968 2242377 1 - . g443.t1 Scaffold_5 AUGUSTUS stop_codon 2240968 2240970 . - 0 transcript_id "g443.t1"; gene_id "g443"; Scaffold_5 AUGUSTUS CDS 2240968 2241758 1 - 2 transcript_id "g443.t1"; gene_id "g443"; Scaffold_5 AUGUSTUS CDS 2241837 2242377 1 - 0 transcript_id "g443.t1"; gene_id "g443"; Scaffold_5 AUGUSTUS start_codon 2242375 2242377 . - 0 transcript_id "g443.t1"; gene_id "g443"; # protein sequence = [MVRRDRSYSPDSSNKRVRHSHRSSPRSPSPTRRSSQRSSNRKYDDERDRDWDRDRERDRVRERDRDRDRDRDRDRERD # RDRDRYRDDRHKEDRRRDHRDDKRISPSRERDRDRRPASPRKDTPRDSPAPGATPAPATPEDDAIKAKRARLEAWKKQREAQKALGEAKAKAMALAGK # SAPPAPNNTNNNNVELPTKPALAAIKGLPAKPEFAAAGFKGLPVKPDFVSTKQLTMDDSVETKRKLEKLEDMPAVDMTMGGEGEPSVGDLEVDDDDEE # ANRMDLAIKKAAAASAAMDVVEEDEADPLDAFMSGVKEEVKKVNLEDMKKAVSSNGRLSRRMDQGDDEDDNVVEGPGPDELDTTELNPEDILALAAKK # AKKKDLAAVDHSRVKYESFRKEFYVPPPDIAAMTEEEADLLRLELDSIKIRGLDCPKPVVKWSHYGLPANW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g443 ### # start gene g444 Scaffold_5 AUGUSTUS gene 2244349 2244633 0.57 + . g444 Scaffold_5 AUGUSTUS transcript 2244349 2244633 0.57 + . g444.t1 Scaffold_5 AUGUSTUS start_codon 2244349 2244351 . + 0 transcript_id "g444.t1"; gene_id "g444"; Scaffold_5 AUGUSTUS CDS 2244349 2244633 0.57 + 0 transcript_id "g444.t1"; gene_id "g444"; Scaffold_5 AUGUSTUS stop_codon 2244631 2244633 . + 0 transcript_id "g444.t1"; gene_id "g444"; # protein sequence = [MPFGLHNNNNPTTTANNHTGRDTALGAGAGGFAGHEGHHGHTARDAALGGFAGHEAGHHGGGTATGTHGNRDGLIGAG # AGAAAGHGHGRESNFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g444 ### # start gene g445 Scaffold_5 AUGUSTUS gene 2248004 2248651 0.15 + . g445 Scaffold_5 AUGUSTUS transcript 2248004 2248651 0.15 + . g445.t1 Scaffold_5 AUGUSTUS start_codon 2248004 2248006 . + 0 transcript_id "g445.t1"; gene_id "g445"; Scaffold_5 AUGUSTUS CDS 2248004 2248651 0.15 + 0 transcript_id "g445.t1"; gene_id "g445"; Scaffold_5 AUGUSTUS stop_codon 2248649 2248651 . + 0 transcript_id "g445.t1"; gene_id "g445"; # protein sequence = [MDILTRDYPDEDHVLVFDNATTHLKRAPDTPSATKMTKFPSLFGIKVTAKGSDGKTLYSSSGKPQKKKIPMSGGQLPD # GTPQSFYFPPGHAQEGMFKGMAIILEERGYGDWSMIRFECEKFKCDPTKQGNCCCRRKLYNEPDFVNGKSLLETACEARGFQCLFLPKFHCEINPIEQ # CWGRSKFWYRLLPMSKKEEDLKRNMLNSLNNVTLKEIRW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g445 ### # start gene g446 Scaffold_5 AUGUSTUS gene 2250542 2253266 0.04 + . g446 Scaffold_5 AUGUSTUS transcript 2250542 2253266 0.04 + . g446.t1 Scaffold_5 AUGUSTUS start_codon 2250542 2250544 . + 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_5 AUGUSTUS CDS 2250542 2252473 0.04 + 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_5 AUGUSTUS CDS 2252571 2253266 0.04 + 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_5 AUGUSTUS stop_codon 2253264 2253266 . + 0 transcript_id "g446.t1"; gene_id "g446"; # protein sequence = [MDNLLAKSQAVSMSVDQLKLILEALNIRELIRPKQPRCQMLGLVHRYLSRICGAHIEAEKCANRMLPCSVLDVFKDFN # KLRFPVLLQYCLMHKLDVNVTTATAEDLRLQLTSHILSAECYTNVTVLSKSNSPGGCLSIATTFDPPVMNESTDIESASDFKRSLIHLLSTKLSLLTL # RNILQILEIPFNQNDTKHVLRHRLQVYNESVGVDLKCIEHEKKLRSLRTQWPSFVPQDFKHKLVERFRDCTSSQTLRKLVCASCSSEELATACHIVTS # DSIDLSLLKRPDMRSKKGFPSTVVDSNWLDSDCVAPHMDNIFEDSPGVVLDGKGVQTDEQNVATLCLCPVCHSALRNKKTPTLSLANHMYLGKVPDVL # KNLTVVEEAMISRCCAKSWIIQLKEADQIANRTTQRGLKGNIIVYPQKPTALAKILPPSLEELTAPICVIFVGSSQPSVEWLRNKAKPLTARPKVVRD # ALIWLKSHNKWYKDIVIDYDFLATLPDEFVLPVHVECVESGKCTDGLTAGYAPTHSSSSYPSVERETSDCHDEEVSFESVVIADVDANATMNELRAAA # MRHIKFKGGSYIEIPHDTEPMNEFFNPSLFPMIYPTLFPYGIGGFEDYSRSEPVSLKRHVKYLLNLSESSFSGALLFASVTPSAIAAVSERFARGDMV # SFRNSAEHTVLQLMQQVNLVTSSVPGSTSALVNMRNEIRALMIDQGLPSFYITINPADVYNPLVKFLAGSDIDINCMLPKDVPEYWDQAVLVAKNPVV # AAKFFNVYLNAFIHSLLGYDTSQQDLTGGVLGVVKGYYGCIEAQGRGTLHCHMMIWLEGGLNPNEIRRRAIGCSERLLWLYRGSGPRNIALSYDDMVR # RWVKSKRDSPTCY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g446 ### # start gene g447 Scaffold_5 AUGUSTUS gene 2253888 2254652 0.93 + . g447 Scaffold_5 AUGUSTUS transcript 2253888 2254652 0.93 + . g447.t1 Scaffold_5 AUGUSTUS start_codon 2253888 2253890 . + 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_5 AUGUSTUS CDS 2253888 2254652 0.93 + 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_5 AUGUSTUS stop_codon 2254650 2254652 . + 0 transcript_id "g447.t1"; gene_id "g447"; # protein sequence = [MISQQELSAQQVNTYLLDLDDHFTSHSYKNFYWTQFEHFVDANYRPHECRSSRKAYQNVEDTFGDKDVRDTCGDDTCQ # DDSDASHPPEFDDTPKAVNEYDIDDEVGISVGSEGFLIAKASQLDDYRYRPDAVEELSLWESIARCTKMRKAWSQQSYDASDEFDNENDLLAGDDNEA # LVDLPEDTCSDDGQRVPLSKLLDHRTRSHPKFEFETGHPERLSHTFVLNSSRNRKVPVPIGPAIPRRDHEMIGQDIAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g447 ### # start gene g448 Scaffold_5 AUGUSTUS gene 2255021 2255404 0.57 + . g448 Scaffold_5 AUGUSTUS transcript 2255021 2255404 0.57 + . g448.t1 Scaffold_5 AUGUSTUS start_codon 2255021 2255023 . + 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_5 AUGUSTUS CDS 2255021 2255404 0.57 + 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_5 AUGUSTUS stop_codon 2255402 2255404 . + 0 transcript_id "g448.t1"; gene_id "g448"; # protein sequence = [MESCGFFGSKCLESDPNAIPKLGGDSTANLHLIVDDCPEREQTWKDAYVTRKQLWQQKLVAEPDNVNSNTNDYDCHIR # NPDQPLDELDDAILRPPIHAFQPTGLVDIDDFVSKFTPPLNEEQERAFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g448 ### # start gene g449 Scaffold_5 AUGUSTUS gene 2256323 2257048 0.45 + . g449 Scaffold_5 AUGUSTUS transcript 2256323 2257048 0.45 + . g449.t1 Scaffold_5 AUGUSTUS start_codon 2256323 2256325 . + 0 transcript_id "g449.t1"; gene_id "g449"; Scaffold_5 AUGUSTUS CDS 2256323 2257048 0.45 + 0 transcript_id "g449.t1"; gene_id "g449"; Scaffold_5 AUGUSTUS stop_codon 2257046 2257048 . + 0 transcript_id "g449.t1"; gene_id "g449"; # protein sequence = [MPVIITQNFDVNAGIVNGAQGILKSIRYKIDEKGRRHAISCVITLSTTDVTDPLPYMESKDDVVALEDKVSLSFVHEF # TKKRCTFQRTQLPIAPAFAMTTHKAQGQTLNSAIVDIESCHGTEAPYVMISRVKTLDGLLILRPFQLRKIQCRQSQDNRIEQQWLRHLSLTTILSVGS # DIDRAIAKKKLVVYKGKGSTVADSDVQSASKLDAIQRNMSEIEQVPDSRWAGDISEVRILSGSYV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g449 ### # start gene g450 Scaffold_5 AUGUSTUS gene 2259966 2260987 0.51 + . g450 Scaffold_5 AUGUSTUS transcript 2259966 2260987 0.51 + . g450.t1 Scaffold_5 AUGUSTUS start_codon 2259966 2259968 . + 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_5 AUGUSTUS CDS 2259966 2259968 0.58 + 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_5 AUGUSTUS CDS 2260086 2260171 0.54 + 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_5 AUGUSTUS CDS 2260284 2260548 0.66 + 1 transcript_id "g450.t1"; gene_id "g450"; Scaffold_5 AUGUSTUS CDS 2260595 2260987 0.94 + 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_5 AUGUSTUS stop_codon 2260985 2260987 . + 0 transcript_id "g450.t1"; gene_id "g450"; # protein sequence = [MVLKWNGIADNVTSLAPTSPTKRNLKKRNWCPSSYDYLAQQIYVGAEYDHRLMPDFGGPVFAMKKAKLIQPQWTNINN # DLIVPWEYYNYLRPGTVVVATICIEVFVMPVGSDNNTLRKIYHATITSLKVVADSDLVVLPPTPSIMRKNINHLLEPSSLAATALAAIDWSTSSTLPS # ASSSDQTLEDINDKIAGDEGGNSGYSSISKESSGITVPSTAAEDQTESGNEHNAIKGYIENTGESKKKRSRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g450 ### # start gene g451 Scaffold_5 AUGUSTUS gene 2263623 2264018 0.73 + . g451 Scaffold_5 AUGUSTUS transcript 2263623 2264018 0.73 + . g451.t1 Scaffold_5 AUGUSTUS start_codon 2263623 2263625 . + 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_5 AUGUSTUS CDS 2263623 2264018 0.73 + 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_5 AUGUSTUS stop_codon 2264016 2264018 . + 0 transcript_id "g451.t1"; gene_id "g451"; # protein sequence = [MLMIFQTSNNWLNVRGVPTHADIVMSFKVYSSGDIGIYDISFLLCNIYQSFLADDEPQFQICALSFNVGGDYSVGFAA # FAGVSAKWIERAETTPTFDIVPDLTETFVTTWPLCRDDLSAAKVVNLTLKESR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g451 ### # start gene g452 Scaffold_5 AUGUSTUS gene 2266408 2266876 0.43 - . g452 Scaffold_5 AUGUSTUS transcript 2266408 2266876 0.43 - . g452.t1 Scaffold_5 AUGUSTUS stop_codon 2266408 2266410 . - 0 transcript_id "g452.t1"; gene_id "g452"; Scaffold_5 AUGUSTUS CDS 2266408 2266754 0.92 - 2 transcript_id "g452.t1"; gene_id "g452"; Scaffold_5 AUGUSTUS CDS 2266825 2266876 0.43 - 0 transcript_id "g452.t1"; gene_id "g452"; Scaffold_5 AUGUSTUS start_codon 2266874 2266876 . - 0 transcript_id "g452.t1"; gene_id "g452"; # protein sequence = [MRRVADLERSLAITKAEPAQTRRTHQSDLARVVTSRDGRIQAKEDDVRRQAKVQADEERARKKKDEERDDIIRRAAQE # KEGTEFEGSLNSKNKTDLEDIAFSLGLDIDATAIVLKIRINAHFNTTPSLKQDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g452 ### # start gene g453 Scaffold_5 AUGUSTUS gene 2269184 2270062 0.96 + . g453 Scaffold_5 AUGUSTUS transcript 2269184 2270062 0.96 + . g453.t1 Scaffold_5 AUGUSTUS start_codon 2269184 2269186 . + 0 transcript_id "g453.t1"; gene_id "g453"; Scaffold_5 AUGUSTUS CDS 2269184 2270062 0.96 + 0 transcript_id "g453.t1"; gene_id "g453"; Scaffold_5 AUGUSTUS stop_codon 2270060 2270062 . + 0 transcript_id "g453.t1"; gene_id "g453"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTLTLPLPTLTPWTLMLLIPALGIAGRPSLPVCADDVLVVELKAMLS # RIAHTRRLPADTVDAGDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g453 ### # start gene g454 Scaffold_5 AUGUSTUS gene 2270391 2272055 0.98 + . g454 Scaffold_5 AUGUSTUS transcript 2270391 2272055 0.98 + . g454.t1 Scaffold_5 AUGUSTUS start_codon 2270391 2270393 . + 0 transcript_id "g454.t1"; gene_id "g454"; Scaffold_5 AUGUSTUS CDS 2270391 2272055 0.98 + 0 transcript_id "g454.t1"; gene_id "g454"; Scaffold_5 AUGUSTUS stop_codon 2272053 2272055 . + 0 transcript_id "g454.t1"; gene_id "g454"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g454 ### # start gene g455 Scaffold_5 AUGUSTUS gene 2283265 2284880 0.14 + . g455 Scaffold_5 AUGUSTUS transcript 2283265 2284880 0.14 + . g455.t1 Scaffold_5 AUGUSTUS start_codon 2283265 2283267 . + 0 transcript_id "g455.t1"; gene_id "g455"; Scaffold_5 AUGUSTUS CDS 2283265 2283373 0.14 + 0 transcript_id "g455.t1"; gene_id "g455"; Scaffold_5 AUGUSTUS CDS 2283526 2284880 0.9 + 2 transcript_id "g455.t1"; gene_id "g455"; Scaffold_5 AUGUSTUS stop_codon 2284878 2284880 . + 0 transcript_id "g455.t1"; gene_id "g455"; # protein sequence = [MLSNGFIRNHAMGITADDSGFRFQYYDRSKVVESQVTIPHLERRVEDAPHGYGLSAQQTFHGKLGFIPNLDLNKFDHL # RHPEQLTFNFEDDSSALVGATYTFTGSDGRRRRLKITKVLYRAEGIIGRCSIVVEVVCLCEEADCVWHEEGNQKTRVMKISFPSKTRPCEDGLIGEAR # SEAESSGQRWALNHLPEVIDSITFPYHEHTTVQGRLKKHLKDDYEERVMRVTFLEKLHPLSELTDPREYAQVFYDILQSTSLFDPFSHPSLPSSRTPL # VHQWLYECVGILHRDLSSGNIMYRRIDGKVYGVLNDFDLSSRVGDMNNGPTSKQRTGTRPFMSLDLLDPDWAGGHLYRHDLESLFYIILCLACRYEAP # GVPAPEPRPYSQWYSGSDEEICNNKYKFLTSPFGLINGLPIQSYFAGFQRWLRKIYDQLRGGYIRRPLCAKNLSTSNEESEESGDEDLEFSQSDNDLN # FDWNTLNRHVSTLGCAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g455 ### # start gene g456 Scaffold_5 AUGUSTUS gene 2286887 2287571 0.97 + . g456 Scaffold_5 AUGUSTUS transcript 2286887 2287571 0.97 + . g456.t1 Scaffold_5 AUGUSTUS start_codon 2286887 2286889 . + 0 transcript_id "g456.t1"; gene_id "g456"; Scaffold_5 AUGUSTUS CDS 2286887 2286956 0.98 + 0 transcript_id "g456.t1"; gene_id "g456"; Scaffold_5 AUGUSTUS CDS 2287123 2287571 0.99 + 2 transcript_id "g456.t1"; gene_id "g456"; Scaffold_5 AUGUSTUS stop_codon 2287569 2287571 . + 0 transcript_id "g456.t1"; gene_id "g456"; # protein sequence = [MIPVQYICQICKIDLLKATEESKGDMLTTCACNPNINLSTPTQWGQRSDEGNGEFVKNGKPKFCDEDDDSEVDAVGSI # DEEAKGPEWEIVQADRDVDVDLDIAPPPPTPVPRPSSVALELPVPQFLQPRFRISLLEDTHEPEPESTWLRIGHLRGFPTWEREKGSTVELEND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g456 ### # start gene g457 Scaffold_5 AUGUSTUS gene 2288302 2288769 0.99 + . g457 Scaffold_5 AUGUSTUS transcript 2288302 2288769 0.99 + . g457.t1 Scaffold_5 AUGUSTUS start_codon 2288302 2288304 . + 0 transcript_id "g457.t1"; gene_id "g457"; Scaffold_5 AUGUSTUS CDS 2288302 2288769 0.99 + 0 transcript_id "g457.t1"; gene_id "g457"; Scaffold_5 AUGUSTUS stop_codon 2288767 2288769 . + 0 transcript_id "g457.t1"; gene_id "g457"; # protein sequence = [MEPLPENPLPDPAPLPQTPKMKQANGPPVVESTPMSQKCTSHAEDEVPQRASVVNKFLEDDIGDGVVFSLDDFATLIL # ELPVDWKVKEDIALQLDSQAVKDAFETYLSVAIGVAEAEGKKRKGAAGHETQLYRPLANLLNVLKDSDGEEGRLGRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g457 ### # start gene g458 Scaffold_5 AUGUSTUS gene 2306217 2306543 0.94 - . g458 Scaffold_5 AUGUSTUS transcript 2306217 2306543 0.94 - . g458.t1 Scaffold_5 AUGUSTUS stop_codon 2306217 2306219 . - 0 transcript_id "g458.t1"; gene_id "g458"; Scaffold_5 AUGUSTUS CDS 2306217 2306543 0.94 - 0 transcript_id "g458.t1"; gene_id "g458"; Scaffold_5 AUGUSTUS start_codon 2306541 2306543 . - 0 transcript_id "g458.t1"; gene_id "g458"; # protein sequence = [MEPLPQNPLPDPAPLPQTPKTKQANGPPVVESTPTSKKYASHAEDEVPQRASVVNKFLEDDIGDSVVLSLDDFATLIL # ELPVDWKVKEEIALQLDSDAVKDAFEAYCR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g458 ### # start gene g459 Scaffold_5 AUGUSTUS gene 2307987 2308551 0.71 - . g459 Scaffold_5 AUGUSTUS transcript 2307987 2308551 0.71 - . g459.t1 Scaffold_5 AUGUSTUS stop_codon 2307987 2307989 . - 0 transcript_id "g459.t1"; gene_id "g459"; Scaffold_5 AUGUSTUS CDS 2307987 2308455 0.71 - 1 transcript_id "g459.t1"; gene_id "g459"; Scaffold_5 AUGUSTUS CDS 2308547 2308551 0.74 - 0 transcript_id "g459.t1"; gene_id "g459"; Scaffold_5 AUGUSTUS start_codon 2308549 2308551 . - 0 transcript_id "g459.t1"; gene_id "g459"; # protein sequence = [MRGFFTSQTNPTPTAPTAPTNANATSEEISVGISEEKEATVVDSNPAEILWSHEIHPNYMYPPTPFDSTAAEETDNLV # NKMLEEHTQHVTARRSPDSPRFIGNPEFLSIKIISAVKVGRVMCPCHATLRVDHNKDSIFMDVSAIKVRCVLYFLFIMI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g459 ### # start gene g460 Scaffold_5 AUGUSTUS gene 2315741 2316769 1 - . g460 Scaffold_5 AUGUSTUS transcript 2315741 2316769 1 - . g460.t1 Scaffold_5 AUGUSTUS stop_codon 2315741 2315743 . - 0 transcript_id "g460.t1"; gene_id "g460"; Scaffold_5 AUGUSTUS CDS 2315741 2316769 1 - 0 transcript_id "g460.t1"; gene_id "g460"; Scaffold_5 AUGUSTUS start_codon 2316767 2316769 . - 0 transcript_id "g460.t1"; gene_id "g460"; # protein sequence = [MNDLESNNFTVVANLPVECQVSSSSHFVAPDEQQLTACNDLFTTSDSFPNNLATSNPPSTFDNNTVDTTMFSPLENSF # NYSLPPLPPAPALTLLPAVDPLSPGPSPATAASSSTPAPPVTSASSTSTLSSPFTSTPLVRRPNAGNAKPKTTSKSKLKINTNLRRKPPSPSHRFVKP # LNQSPPAPAPAAAVTVSAPPSVPPKLPTLPPLTLNTLHCSYYSAHVRQPASSSNSTTATAPNKICTAADPQKLYSNVAGPNIVLNTPDFPAFGRAIER # SVSTEGCLGYSLLMRKAGEFGGKKGTKVHGGGKDEKPDLTQTYLRITLGSHMVSVIFFRVFVLIFLSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g460 ### # start gene g461 Scaffold_5 AUGUSTUS gene 2320611 2321465 0.98 + . g461 Scaffold_5 AUGUSTUS transcript 2320611 2321465 0.98 + . g461.t1 Scaffold_5 AUGUSTUS start_codon 2320611 2320613 . + 0 transcript_id "g461.t1"; gene_id "g461"; Scaffold_5 AUGUSTUS CDS 2320611 2321465 0.98 + 0 transcript_id "g461.t1"; gene_id "g461"; Scaffold_5 AUGUSTUS stop_codon 2321463 2321465 . + 0 transcript_id "g461.t1"; gene_id "g461"; # protein sequence = [MENRFAADPPFSTFSSSSTITSTFSTITPTSSTITSRSTSSSVASSSSPTATSSSSTDILSSSASIYTSTSDGVRETI # TAFVTPSASPSPSQSPVSSTNGFLNNKPLEGFVFTLCGIVGIVILCLVTTFALRRSRRKRMLNEALSYEPTTTHGYTGHTDRDVNEKIRASYSSAGSS # SNGLGPPHSNGSVIAGGYYSAPGMAPQAAHQYEREYPAYAPRSPNPAYDNSRSHGPSYNYNMSGAPVMAGYIPPAQPAFIQPILATNSSRVPVPAMSP # DPTAATESAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g461 ### # start gene g462 Scaffold_5 AUGUSTUS gene 2331265 2331735 0.7 - . g462 Scaffold_5 AUGUSTUS transcript 2331265 2331735 0.7 - . g462.t1 Scaffold_5 AUGUSTUS stop_codon 2331265 2331267 . - 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_5 AUGUSTUS CDS 2331265 2331735 0.7 - 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_5 AUGUSTUS start_codon 2331733 2331735 . - 0 transcript_id "g462.t1"; gene_id "g462"; # protein sequence = [MASGIAEMDLPILTIPDLFVAQKLGVTEVAASRFPSYSSATLVGETKETNKQIPANPQIVSPPTGYSSVNAVPYKRDS # TPDLDFSEGSTSGESDYDDDLPHNAVVAAMASSNSSSQSFSNSRYINPNIVECFPTAKKFSTDDVPFFVYHSHSGNVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g462 ### # start gene g463 Scaffold_5 AUGUSTUS gene 2339671 2341241 0.17 - . g463 Scaffold_5 AUGUSTUS transcript 2339671 2341241 0.17 - . g463.t1 Scaffold_5 AUGUSTUS stop_codon 2339671 2339673 . - 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_5 AUGUSTUS CDS 2339671 2340245 0.94 - 2 transcript_id "g463.t1"; gene_id "g463"; Scaffold_5 AUGUSTUS CDS 2340698 2341112 0.23 - 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_5 AUGUSTUS CDS 2341170 2341241 0.58 - 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_5 AUGUSTUS start_codon 2341239 2341241 . - 0 transcript_id "g463.t1"; gene_id "g463"; # protein sequence = [MYTEANTDSEPVTLIVVGCGQRGKAYGKYALQSDACQVVAIAEPRPQTRNMYAEQHKVDPTLVFGTWKDLHAASADTI # NTVGKRLADAVLIAVQDHMHVEVALAFAEQGYHILCEKPMATTMEDCIRIEEAINRAGIIFRMGHGKPFLYNTVYQCINDFPIPIYLDSVSRGNTGWP # VSTLVDGIPDIENITAALKVGPYGQCVYESKNDVCDNQIVNLEFENGNTASFTMVAFTSAICERQLRMHFTHGEIVGDMNKYTVTDFRTNKTKTFHPA # NEGGGHGGGDIGLIRTFVEAVRTGNQKLLGTDVGEVLKSHMTVFAAEASRREEKVVNCVAFEEKARASVRETRVQTVLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g463 ### # start gene g464 Scaffold_5 AUGUSTUS gene 2346117 2346518 0.68 + . g464 Scaffold_5 AUGUSTUS transcript 2346117 2346518 0.68 + . g464.t1 Scaffold_5 AUGUSTUS start_codon 2346117 2346119 . + 0 transcript_id "g464.t1"; gene_id "g464"; Scaffold_5 AUGUSTUS CDS 2346117 2346518 0.68 + 0 transcript_id "g464.t1"; gene_id "g464"; Scaffold_5 AUGUSTUS stop_codon 2346516 2346518 . + 0 transcript_id "g464.t1"; gene_id "g464"; # protein sequence = [MSMLYDYQHKYVDALIKQLPPGTVFPAPSRSVLIHPPTIIKAPPARQGPFLLQPSPRMLGESEGGDATDIVYLSYSQT # EETVSDAEDGVAENLDVVLITYQDGKIDVCLDVEKVEARWQSKVLESTSICPLPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g464 ### # start gene g465 Scaffold_5 AUGUSTUS gene 2347001 2347909 0.79 + . g465 Scaffold_5 AUGUSTUS transcript 2347001 2347909 0.79 + . g465.t1 Scaffold_5 AUGUSTUS start_codon 2347001 2347003 . + 0 transcript_id "g465.t1"; gene_id "g465"; Scaffold_5 AUGUSTUS CDS 2347001 2347909 0.79 + 0 transcript_id "g465.t1"; gene_id "g465"; Scaffold_5 AUGUSTUS stop_codon 2347907 2347909 . + 0 transcript_id "g465.t1"; gene_id "g465"; # protein sequence = [MRITSFSLNPRPESPLPKSPADNNLVQSTSRHLELLGDTPPYTSLLGTEPWMPPSILSRNTGLPFNPRLSLPKDASQR # EFMLTPDTLRYLATVVTRYSDQVREVELAQHGAEGRAALQIQEVIRQTTKCRELLAIVERIKESRREASQDRIQKVQQGQKILLKRLDRMLQVMMEKA # SPELSEHETKWFDELKRLKEAVIGADRYDESSLSTRIRTVRTCHIAMSFYLTMYQLEREYARLMPSLKALLEKERRRHNQAMTENPGLGFSQAFEFGE # RSNHEFVYLGVIDCTASNVSLSLLGVLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g465 ### # start gene g466 Scaffold_5 AUGUSTUS gene 2354960 2355376 0.64 + . g466 Scaffold_5 AUGUSTUS transcript 2354960 2355376 0.64 + . g466.t1 Scaffold_5 AUGUSTUS start_codon 2354960 2354962 . + 0 transcript_id "g466.t1"; gene_id "g466"; Scaffold_5 AUGUSTUS CDS 2354960 2355376 0.64 + 0 transcript_id "g466.t1"; gene_id "g466"; Scaffold_5 AUGUSTUS stop_codon 2355374 2355376 . + 0 transcript_id "g466.t1"; gene_id "g466"; # protein sequence = [MLKLSETDGIRQYLVTSLVAQIDALVKLQDQATGLWHTILDDETSYLESSCTAGFAYGILKALRLRLLPKKERYMDSA # KKAIQGVLANITPEGELKLVSFGTPVFDDIEEYKKIPLTSMPYGQSLALLALTEYLRTFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g466 ### # start gene g467 Scaffold_5 AUGUSTUS gene 2356022 2356700 0.51 + . g467 Scaffold_5 AUGUSTUS transcript 2356022 2356700 0.51 + . g467.t1 Scaffold_5 AUGUSTUS start_codon 2356022 2356024 . + 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_5 AUGUSTUS CDS 2356022 2356056 0.55 + 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_5 AUGUSTUS CDS 2356109 2356700 0.51 + 1 transcript_id "g467.t1"; gene_id "g467"; Scaffold_5 AUGUSTUS stop_codon 2356698 2356700 . + 0 transcript_id "g467.t1"; gene_id "g467"; # protein sequence = [MVDTDQGVAFPSPPSPERTGSTPLASTSADTTSITNAPVQSEPGPEPSSSSSPSRGSWLGSFGRSKGKEKAVGVTANN # TSSNSVADTPRPASKPLAEFPSTDEGVNNAEDLSSAIEALGSTQPYAFETIRADIQVPRVELPSLTEDTSRTVRASEGPKHSWFNPFAPYPSRPQNTS # AQPPPSQPSSSPVSSSTSPSSLRKTSSSYVDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g467 ### # start gene g468 Scaffold_5 AUGUSTUS gene 2357034 2359233 0.46 + . g468 Scaffold_5 AUGUSTUS transcript 2357034 2359233 0.46 + . g468.t1 Scaffold_5 AUGUSTUS start_codon 2357034 2357036 . + 0 transcript_id "g468.t1"; gene_id "g468"; Scaffold_5 AUGUSTUS CDS 2357034 2358060 0.73 + 0 transcript_id "g468.t1"; gene_id "g468"; Scaffold_5 AUGUSTUS CDS 2358143 2359233 0.47 + 2 transcript_id "g468.t1"; gene_id "g468"; Scaffold_5 AUGUSTUS stop_codon 2359231 2359233 . + 0 transcript_id "g468.t1"; gene_id "g468"; # protein sequence = [MLVRPQLVYLVSDISEPTSTTAVSSITATPSISNPSPPLNPLTMTETTAATLATAEAGRADFATNEVAVTIPSPSQPI # SQEIANNACPPSSSTSQSVNEYNEPIRTDLSSGPPLDIADAPAQSWWSYMGWSSSQSNVTRMEILDSELRTESHEDPTPNLNITQAQPDPLPERCASA # PPVMEPSNGNPEPPEAETNSPSNPQSTSTAQPQTETQAYVKAPSIFSLDVARAAGSWFNPWAWYGYGVVEPSSSDTVGSVALNGVPEESERVSDDGNG # NRGSIDDKANMTEMTESEKIKEAALARDRPSGASSSIASATTQEDNTSTGQIDSPTVGLEREFQETPPSRGLITKNLSDTVPEIEGLKDEVKRDENGM # EIMELTDDEAGSVHVNLQEPERELEKAVTKVPASSALILMRALAGHDLKQQKTIEAPKDEKSQLEQDTTNTNSNSPRIPPSPSNSSKYNAGALGADSV # SSSPTKVLSSRPGRASSVSTTQTSTSSVGTKPAPPLTISDELKASVVAAKKGKRAGVSPAGSSSLPKDGFSTPSGTDGPKKEKEKEKSKAVVKSGANT # PAPPPPPPNLVLPAWEDTFLTPPRNWVPEQYLPTTNNATGGLGTTIGKTMRYMSGMLLGADSGYTSGGESSRLGAGASATKRRSRKGSSRRRSISGEN # AIPGGNGVGSEAELIAREREKAAGAIKLGTQPAEGLGSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g468 ### # start gene g469 Scaffold_5 AUGUSTUS gene 2368831 2369654 0.63 - . g469 Scaffold_5 AUGUSTUS transcript 2368831 2369654 0.63 - . g469.t1 Scaffold_5 AUGUSTUS stop_codon 2368831 2368833 . - 0 transcript_id "g469.t1"; gene_id "g469"; Scaffold_5 AUGUSTUS CDS 2368831 2369318 1 - 2 transcript_id "g469.t1"; gene_id "g469"; Scaffold_5 AUGUSTUS CDS 2369414 2369654 0.63 - 0 transcript_id "g469.t1"; gene_id "g469"; Scaffold_5 AUGUSTUS start_codon 2369652 2369654 . - 0 transcript_id "g469.t1"; gene_id "g469"; # protein sequence = [MTTTFRPADNLPPTARAIALILSSTPSVQDAQPGVLHQLLEFSSRYTQQVLTDAKVYADHAGRQDKLDIDDVILAVQA # RVATQTNAIPLPSVPEVFGVRLPQSSDCLTSLDFDLIPNKAPPGVKIYDEEIEEIEESESEEEEEEEMEPATIPNYARSSTNQSVPPESAQEAPFPIS # AIHMPSEADTDTRMGGENGSDAGEEEDGLFAGGDDDSDGMEEVQTSLNEGVNNEMKRKLVETDDYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g469 ### # start gene g470 Scaffold_5 AUGUSTUS gene 2401579 2401868 0.67 - . g470 Scaffold_5 AUGUSTUS transcript 2401579 2401868 0.67 - . g470.t1 Scaffold_5 AUGUSTUS stop_codon 2401579 2401581 . - 0 transcript_id "g470.t1"; gene_id "g470"; Scaffold_5 AUGUSTUS CDS 2401579 2401789 0.67 - 1 transcript_id "g470.t1"; gene_id "g470"; Scaffold_5 AUGUSTUS CDS 2401864 2401868 0.67 - 0 transcript_id "g470.t1"; gene_id "g470"; Scaffold_5 AUGUSTUS start_codon 2401866 2401868 . - 0 transcript_id "g470.t1"; gene_id "g470"; # protein sequence = [MFYDSLYIATATIDGDIPTETSRCLTATQYAQPQRGAPNSPVQQIIQLSDHIMPEDEPLHRHSESQGIAFM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g470 ### # start gene g471 Scaffold_5 AUGUSTUS gene 2405133 2405633 1 - . g471 Scaffold_5 AUGUSTUS transcript 2405133 2405633 1 - . g471.t1 Scaffold_5 AUGUSTUS stop_codon 2405133 2405135 . - 0 transcript_id "g471.t1"; gene_id "g471"; Scaffold_5 AUGUSTUS CDS 2405133 2405633 1 - 0 transcript_id "g471.t1"; gene_id "g471"; Scaffold_5 AUGUSTUS start_codon 2405631 2405633 . - 0 transcript_id "g471.t1"; gene_id "g471"; # protein sequence = [MSQRKPKAKTEGEVAETLPPATTEPTTETPKKAPRQRKPRAPRTPRPAGEDPEGEQSKTVLFVANLGFNIDDAGLAAL # FTDAGISVTSARIVRRRWGHPRRSKGYGFVDVGSEEEQKKAIEALQGKEVGGRPIAVKVAVNSFHDEEAAEAAPPTDAVEVAPVTGAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g471 ### # start gene g472 Scaffold_5 AUGUSTUS gene 2405661 2406017 0.51 - . g472 Scaffold_5 AUGUSTUS transcript 2405661 2406017 0.51 - . g472.t1 Scaffold_5 AUGUSTUS stop_codon 2405661 2405663 . - 0 transcript_id "g472.t1"; gene_id "g472"; Scaffold_5 AUGUSTUS CDS 2405661 2406017 0.51 - 0 transcript_id "g472.t1"; gene_id "g472"; Scaffold_5 AUGUSTUS start_codon 2406015 2406017 . - 0 transcript_id "g472.t1"; gene_id "g472"; # protein sequence = [MSCSITAQVILRGTRSAGYGFVALSSVEAAQKAVDALDKQLLDGRQVIVELAKQSDQKDKEKKERKPKRRPGRRGSKA # VPGEVSEAEANGDDTKDDVAAGASESEKPKKKKSKKSVSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g472 ### # start gene g473 Scaffold_5 AUGUSTUS gene 2407476 2407958 0.54 + . g473 Scaffold_5 AUGUSTUS transcript 2407476 2407958 0.54 + . g473.t1 Scaffold_5 AUGUSTUS start_codon 2407476 2407478 . + 0 transcript_id "g473.t1"; gene_id "g473"; Scaffold_5 AUGUSTUS CDS 2407476 2407958 0.54 + 0 transcript_id "g473.t1"; gene_id "g473"; Scaffold_5 AUGUSTUS stop_codon 2407956 2407958 . + 0 transcript_id "g473.t1"; gene_id "g473"; # protein sequence = [MAHKLLNLLAFTSLAIMACSFGAEPVNALSNTHHVRDGLRGHDALAKRKRSVNGKRCKVRSAPADSSTASSTDSSSVD # SSSTDYTPAPITTSTWSDSSSSTWSSTSSSAPAATSSASSSSSGSGKGCLAWPNGDQSYLGDYKTDKTSLSVTSPFHSRQPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g473 ### # start gene g474 Scaffold_5 AUGUSTUS gene 2423630 2424571 0.95 + . g474 Scaffold_5 AUGUSTUS transcript 2423630 2424571 0.95 + . g474.t1 Scaffold_5 AUGUSTUS start_codon 2423630 2423632 . + 0 transcript_id "g474.t1"; gene_id "g474"; Scaffold_5 AUGUSTUS CDS 2423630 2424571 0.95 + 0 transcript_id "g474.t1"; gene_id "g474"; Scaffold_5 AUGUSTUS stop_codon 2424569 2424571 . + 0 transcript_id "g474.t1"; gene_id "g474"; # protein sequence = [MSKGKGGYKTVGLYLDTYSQRVWAFKFKVAGSGATTTSSLTSLFNGYLPPETFMTDNGSHFANKEVEMLCAKWGTKQH # LTPAYSPWVNGLVEGTNKILLHVLKRLCAPKLGEDSEEFKEMHWETLPEKWPEYLDDAIRIINNRILPSVKFSPNELLLGAVVNTRRTPVVDATSVLP # PQQIEIQTAYVEQQQLDGYSAFVQHAVKRKSVFDRRVLKKEGKEVVFEAGDLVQVYRSDLDYTFKTIKKIIPKWSRPYRVAERNVNSYTLRTTDGQLI # EGKQFAARRLREFKPRLGTKLAIEQQEVVRKREESKGGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g474 ### # start gene g475 Scaffold_5 AUGUSTUS gene 2428491 2428976 0.71 - . g475 Scaffold_5 AUGUSTUS transcript 2428491 2428976 0.71 - . g475.t1 Scaffold_5 AUGUSTUS stop_codon 2428491 2428493 . - 0 transcript_id "g475.t1"; gene_id "g475"; Scaffold_5 AUGUSTUS CDS 2428491 2428976 0.71 - 0 transcript_id "g475.t1"; gene_id "g475"; Scaffold_5 AUGUSTUS start_codon 2428974 2428976 . - 0 transcript_id "g475.t1"; gene_id "g475"; # protein sequence = [MFDGVNLTKETAAFQLCDITDVMLKEMIEDPDDVREACDVSQPNDVLSQKGNPNWISQERDGWYSTHALERIKAVLRL # KFFSLLDGRPATDEECQAVLEQAEMESSKAVASSRNAKMRLGKHNMAKGALRPEEAAVSGRVLILSYFLIRVFSGVPSTSHSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g475 ### # start gene g476 Scaffold_5 AUGUSTUS gene 2434897 2436814 0.69 + . g476 Scaffold_5 AUGUSTUS transcript 2434897 2436814 0.69 + . g476.t1 Scaffold_5 AUGUSTUS start_codon 2434897 2434899 . + 0 transcript_id "g476.t1"; gene_id "g476"; Scaffold_5 AUGUSTUS CDS 2434897 2436167 0.69 + 0 transcript_id "g476.t1"; gene_id "g476"; Scaffold_5 AUGUSTUS CDS 2436286 2436814 0.69 + 1 transcript_id "g476.t1"; gene_id "g476"; Scaffold_5 AUGUSTUS stop_codon 2436812 2436814 . + 0 transcript_id "g476.t1"; gene_id "g476"; # protein sequence = [MFSSAHGAFGSLAFGIGTSEVEHVLATQTLLQKKSKNMRITVDGELIEGVTSKDVVLHIIGVIGTAGGTGAVIEYAGS # VIRSLSMEARMSICNMSIEAGARAGMIAPDEITFAYLRNRPLSPKGETWDRAVTYWQTLKTDPDAKFDIEVNIPASDIIPTVTWGTSPQDVAPITGVV # PDPSTIEDPVKRASVTRSLTYMGLTPNTPMQDIKIDKVFIGSCTNSRIEDLRSAAKIVLAAGPEAKVAPGILAMIVPGSGLIKKQAETEGLDVVFKRA # GFDWREAGCSMCLGMNPDQLSPGERCASTSNRNFEGRQGAGGRTHLVSPAMAAAAAMTGKLTDVRKFLGATAEANIAAGPKLKLTSAFDFMDDPVLPS # PDPIQSTTPSTGGTNLPPSEAPSSVEKFIVLKGITAPLHIENVDTDMIIPKQLRFSFALAKTLDAEALVNMHHGVCKFTSCLKLNCQIDLVFCRNDFG # IRCVIAPSFADIFRNNSMQNGMLPVAVPQEDCMVLAQDAEAGLELEVDLEKQEIRRPNGMPSISFTTDPFRRHCLLNGLDDIALTLQDVDSIEVFEHR # RSELWPWLDGFGYKAGKIPVAAKRAPKKMDW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g476 ### # start gene g477 Scaffold_5 AUGUSTUS gene 2437650 2438621 0.77 + . g477 Scaffold_5 AUGUSTUS transcript 2437650 2438621 0.77 + . g477.t1 Scaffold_5 AUGUSTUS start_codon 2437650 2437652 . + 0 transcript_id "g477.t1"; gene_id "g477"; Scaffold_5 AUGUSTUS CDS 2437650 2438621 0.77 + 0 transcript_id "g477.t1"; gene_id "g477"; Scaffold_5 AUGUSTUS stop_codon 2438619 2438621 . + 0 transcript_id "g477.t1"; gene_id "g477"; # protein sequence = [MAHIAEAPLTPNTQVTRFPHVRTSSTSTTPILSSGASITFSALPPSPQSSSRPSSTTTAPQNSMNSVQAPLHTTHHPR # NNPRPSSPPLDNASMLTLASSAYAIPGLRVGMGTPIGWSSAPPSAVGGGADSVSQFEGAYADAESQNDEEPLDDRDVDASLRALRPRSTRRGSWESEV # SRWSARIQPSLVRERSVWTTNSVRTGALGTDQVHGSEKLDEAGNSPVVEGRPITEDISSSTTAPSEAADAPTSPHTTSLPATKRASTPQEKLSSETVA # QAEKPGVEKTPEPVVSLPKTGKTFAVTVNGSKEAPEEIKDQFADTAGVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g477 ### # start gene g478 Scaffold_5 AUGUSTUS gene 2441661 2441996 0.83 + . g478 Scaffold_5 AUGUSTUS transcript 2441661 2441996 0.83 + . g478.t1 Scaffold_5 AUGUSTUS start_codon 2441661 2441663 . + 0 transcript_id "g478.t1"; gene_id "g478"; Scaffold_5 AUGUSTUS CDS 2441661 2441996 0.83 + 0 transcript_id "g478.t1"; gene_id "g478"; Scaffold_5 AUGUSTUS stop_codon 2441994 2441996 . + 0 transcript_id "g478.t1"; gene_id "g478"; # protein sequence = [MLEFTLTTRSAATVIYSRLAADSAFISSSLQGSLGSVGSPAMLILDNSNDLINPQVTEQEIGSDLEPLQDEEVIQFRA # QVLNMGVLSSDGMNSRERELARMVRSLPNTLSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g478 ### # start gene g479 Scaffold_5 AUGUSTUS gene 2442399 2444033 0.9 + . g479 Scaffold_5 AUGUSTUS transcript 2442399 2444033 0.9 + . g479.t1 Scaffold_5 AUGUSTUS start_codon 2442399 2442401 . + 0 transcript_id "g479.t1"; gene_id "g479"; Scaffold_5 AUGUSTUS CDS 2442399 2444033 0.9 + 0 transcript_id "g479.t1"; gene_id "g479"; Scaffold_5 AUGUSTUS stop_codon 2444031 2444033 . + 0 transcript_id "g479.t1"; gene_id "g479"; # protein sequence = [MQEQQLLKRLTSLEDEMVKLKPVLLLDPFPATASESSLSHASAYLASLPYPAASGKEAVRAQRSRRKKLEAKHKDIDH # LDQEVDHVAANISASNDSPNSMGVGTQGTSLRTPNDLDGEISHSLSYIPDQLQDDSNVLPFKSVRSEKHVSRRTEPPGTLLLWPAHIQPPVTPPSLET # PSAILGAPSAPGLNERSENAAFDSAIEPPLASSLSKPARPLTSDARMEHLLLAARMIGRKRAAFAAGIVDAELEKGQKERKEKEKEWREKEKAKKQKE # REREKKEREIAEKSKSERSKEKTRSTATLRSSAGGSRSVKGKGKEKALPKSSGVGKTNSLKRTPSRSGRELEGILDDEVIAGSSKQRRTKQTRPKPRA # LSASSSAGSTQKTQLTGMDSLLSAARSMMDPGSNQFITRDKAHEGGIDIDSNVGSRRPASELGGYEDTDMLPPAKRQKSLVVSSNRPMRTPSALDVLA # DQAAAAVSTSAASSDMDSIILEVKMVKNDLEDEDAEGEYEDDPADSNSVTRLNSPTTNTDGPRRSSRRSASSGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g479 ### # start gene g480 Scaffold_5 AUGUSTUS gene 2446877 2448604 0.67 - . g480 Scaffold_5 AUGUSTUS transcript 2446877 2448604 0.67 - . g480.t1 Scaffold_5 AUGUSTUS stop_codon 2446877 2446879 . - 0 transcript_id "g480.t1"; gene_id "g480"; Scaffold_5 AUGUSTUS CDS 2446877 2448604 0.67 - 0 transcript_id "g480.t1"; gene_id "g480"; Scaffold_5 AUGUSTUS start_codon 2448602 2448604 . - 0 transcript_id "g480.t1"; gene_id "g480"; # protein sequence = [MMNQARHSVDSEEGREVGVLAEIFRGEVEAVEAALVLEPEGGRGSGNNGTTITTTNTSAITSTVTKPAEVASKPSTAT # FKAKLSETTATPKNTPLGKTGGRRRSNAKTIPQITVPPPSTSTSTTITDEVNALVEHVRAGALTPNGPITPFTPSHIDWAGDEEEDGSLPDLDDWGVS # TSSGGAPSTFEPASTVETTKGSNMKPDAISPILVEGLKSLPEPKVPEHPEPETEVKAASPVPYPERLNSKQTSPSETISTSTSSSLYPSFPHKPSSGS # VNRPPKNKLGMTGSSRDGSTPRPPRTSRGSRNNLAAIQPGPESSHDINTKNTGKPVSGGVSLSTPTPLTNHGAISLTPPESPTKGLTDSMHAPKPGLA # SAEPVRSKANIPASLNINGGSASKVGSYVPPHTRNSRPAFVPTPAPPPSDNGSLTAEFTFPSLSPSPISGHYPTGPRGPGGGGPSESAGSDRPHDRFN # GRNGAFNGNGSGFNPRYNNHAPRHYQQDPNHAANHFSRDRPVHQPQTQSHHSDPLHPGLNRSDSPHHTPRHTPHHSREHSASRPVITGDAISKLARTI # AGSPAKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g480 ### # start gene g481 Scaffold_5 AUGUSTUS gene 2453706 2453939 0.66 - . g481 Scaffold_5 AUGUSTUS transcript 2453706 2453939 0.66 - . g481.t1 Scaffold_5 AUGUSTUS stop_codon 2453706 2453708 . - 0 transcript_id "g481.t1"; gene_id "g481"; Scaffold_5 AUGUSTUS CDS 2453706 2453939 0.66 - 0 transcript_id "g481.t1"; gene_id "g481"; Scaffold_5 AUGUSTUS start_codon 2453937 2453939 . - 0 transcript_id "g481.t1"; gene_id "g481"; # protein sequence = [MYPTEPFNDGIAFIEYVVLNKALGDLDIERCSPFGTLKSRMAVAEGEWLPSEAYARIPSEERVKLVNRLSSFHPVAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g481 ### # start gene g482 Scaffold_5 AUGUSTUS gene 2454149 2455054 0.95 + . g482 Scaffold_5 AUGUSTUS transcript 2454149 2455054 0.95 + . g482.t1 Scaffold_5 AUGUSTUS start_codon 2454149 2454151 . + 0 transcript_id "g482.t1"; gene_id "g482"; Scaffold_5 AUGUSTUS CDS 2454149 2455054 0.95 + 0 transcript_id "g482.t1"; gene_id "g482"; Scaffold_5 AUGUSTUS stop_codon 2455052 2455054 . + 0 transcript_id "g482.t1"; gene_id "g482"; # protein sequence = [MYGRLYIPTGRLDALYSTRLSANLQGIVAAISDPPSPLSAQANVSNLMLSLQHDVGKWCTEYTYSAEDSMWGIKALHN # FGRIAGSGNAADSSQTPTRVGLKRIDEEDAVEGGLRGRLSAGAEIYLSAKEKSAGGNFYHPSCSRGLTYSLKVSTGIRFSTIPEAKTPSTGGSTSIII # PPQPPTTITALFNPMLGHLSGAYSARVSPDLALSSRFDFNVYSYESEWTMGAEYWLRRDNDPDSELSSPAVESSKKRIHGVVKARASTNNVCTCSTIQ # FTAALNAAPLLSGCRNSLGRPNAKYAH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g482 ### # start gene g483 Scaffold_5 AUGUSTUS gene 2456182 2457825 0.56 + . g483 Scaffold_5 AUGUSTUS transcript 2456182 2457825 0.56 + . g483.t1 Scaffold_5 AUGUSTUS start_codon 2456182 2456184 . + 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_5 AUGUSTUS CDS 2456182 2457825 0.56 + 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_5 AUGUSTUS stop_codon 2457823 2457825 . + 0 transcript_id "g483.t1"; gene_id "g483"; # protein sequence = [MARPVPGHIHEDRFQNVIRNILSIGYHASREDYHFILGQFAAVGHSIGSMGVYNEMRGNKGCLPNNVTIALVLQSIAH # RLGLPERKVDRQETANRARGLLKQILDDMRSRGIPWTNTNMDLTIRIMKYTSDEENFDTLLKLGYGIDLRYPDRPVLDDQSSALLPFTLHTLNTVINM # YGLGGNLSKLVQAFEVLTVPLPHAQKHFSASFEDEDDFGIVPPESSLSFRFPSAEPNTTTYTFLLRQISQHNKAHLARHYLLQAIKHDIEVSRDLRRK # VITTPNLEDVQAPRIAINRAMLVPVFGLSNRNKNVSLMRWLHDRIPSIIRRKKADILHFSNFIKHLERVGKWPPPPKPKSYHTTRRVPVSTSKDYIDV # DGVRWHRADVEDVLAVDPSIQQPVPVYTVKPIDLRLHLRILKTDVNDLTVYYGYVRSVLARTIERVKDKLGRRVWRGRNIYLKDVTLAGGTAAHPKSR # MKVSKDTWRQIVGYKPKLKTGFARPPSHFHHKVIRHQYWREVKSIREEQAKGSSAGHFTRSGQTSMLKPPGEKGREC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g483 ### # start gene g484 Scaffold_5 AUGUSTUS gene 2459471 2460075 0.8 + . g484 Scaffold_5 AUGUSTUS transcript 2459471 2460075 0.8 + . g484.t1 Scaffold_5 AUGUSTUS start_codon 2459471 2459473 . + 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_5 AUGUSTUS CDS 2459471 2459522 0.84 + 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_5 AUGUSTUS CDS 2459591 2460075 0.94 + 2 transcript_id "g484.t1"; gene_id "g484"; Scaffold_5 AUGUSTUS stop_codon 2460073 2460075 . + 0 transcript_id "g484.t1"; gene_id "g484"; # protein sequence = [MQSSQTTELQRLRWPVHVEVRLKSRSTSRFETIRTHVQAWITSFDRINLSSSLDGWEDVPELAASVERIVTSESACPS # QSLSVDEMALQIHVYQPCESDAFEEFSNSTNEDDDETMAATVRELPNRSWEGLWDSLIYEDNIKLKLLDYIHATLVFSDAEVDCKFLYIFIMLEGYSN # IR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g484 ### # start gene g485 Scaffold_5 AUGUSTUS gene 2461454 2462614 1 - . g485 Scaffold_5 AUGUSTUS transcript 2461454 2462614 1 - . g485.t1 Scaffold_5 AUGUSTUS stop_codon 2461454 2461456 . - 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_5 AUGUSTUS CDS 2461454 2462614 1 - 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_5 AUGUSTUS start_codon 2462612 2462614 . - 0 transcript_id "g485.t1"; gene_id "g485"; # protein sequence = [MTTYTARPDNLDWKKNPHVNFRRSNSSITSSRQELLYELLSGIQADEDSARLLLQTYDIDEECDSEDENAFTPQTPLR # PVEDLNPPHETNAPQDSAAFNSPLRPSHSENPFLSTPLRVKYFPNLSPSILRQLLRSPSPNFYSSDGSFEAVSASPLSLSIPSSLELQNVRKTSCANP # QAGGPSSLIYPLTPPLTARIPCTDSHETPVRMLRSPLYLDVVSTPGLHIEGVDLDSVPDIRACLSSMTPFTAIESHQNRRQRQLFMNSAADPSAVFTT # TPNSQCVIQGIRAKTASGVKAVPLAETTASFGLPSTPASPLLQTSRTARISQNRRTPKPGRVLQREFVELLEARAMEEEKMAQVLDMMAKRLERLALQ # RRRLVALLIKETRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g485 ### # start gene g486 Scaffold_5 AUGUSTUS gene 2463978 2464898 0.93 - . g486 Scaffold_5 AUGUSTUS transcript 2463978 2464898 0.93 - . g486.t1 Scaffold_5 AUGUSTUS stop_codon 2463978 2463980 . - 0 transcript_id "g486.t1"; gene_id "g486"; Scaffold_5 AUGUSTUS CDS 2463978 2464898 0.93 - 0 transcript_id "g486.t1"; gene_id "g486"; Scaffold_5 AUGUSTUS start_codon 2464896 2464898 . - 0 transcript_id "g486.t1"; gene_id "g486"; # protein sequence = [MPRSISTTAITPSTSRPVPRSDSPPSPPSPVSDSFSRRLSSPLATGISPTRPTTIRRAMQTTLPASPHSTESPPHRSV # SRVQPAFAAAAARMSSLMPTLNGSDEDSLLLATAIPLPDGDSDSDEHSINLMSFSAPYEIHHLPPASDSQVHSVSPNSADLNPIIGVSNALSTDSVTE # LAQGGGAPVVEDALRARAEQAESAAERLLELVEPEDDIPHPILPPSLLVGSPVSNGLSTPGKSKPPPVSVAQFPVTPKNRASIVMRQAALFQDSPAYN # GRAPSLLDVLQDRSKETGWWLKRKTCKNSPHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g486 ### # start gene g487 Scaffold_5 AUGUSTUS gene 2470523 2471546 0.43 + . g487 Scaffold_5 AUGUSTUS transcript 2470523 2471546 0.43 + . g487.t1 Scaffold_5 AUGUSTUS start_codon 2470523 2470525 . + 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_5 AUGUSTUS CDS 2470523 2470697 0.74 + 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_5 AUGUSTUS CDS 2470781 2471080 0.51 + 2 transcript_id "g487.t1"; gene_id "g487"; Scaffold_5 AUGUSTUS CDS 2471152 2471546 0.81 + 2 transcript_id "g487.t1"; gene_id "g487"; Scaffold_5 AUGUSTUS stop_codon 2471544 2471546 . + 0 transcript_id "g487.t1"; gene_id "g487"; # protein sequence = [MLAQAQRQQQAQNRRSSLGFNPPATAGPLSTGFDIRAATLNAQMRRANQAEQQAQLGVVMARYDDGSEATLPPTPSST # TVISGGTSLGHPSSNNISGSTTQSKSDSATSWRRGGGKGNSVLANRSVTSPAVKVTPPPSEGTPPPPGAAFSAAVTASKFLNDNDDSSSTSSDKSVGS # HSSPTTPHSSSSNEMSLSLREEASKKLYEGLGIGRPASAVSNKDAPSQQYAEALSNLGSHRMVSQPLRQPRGPPSGLDELQPKNFATRIRRQAIGGLG # MLMDARERRDIVEVY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g487 ### # start gene g488 Scaffold_5 AUGUSTUS gene 2474931 2475236 0.51 + . g488 Scaffold_5 AUGUSTUS transcript 2474931 2475236 0.51 + . g488.t1 Scaffold_5 AUGUSTUS start_codon 2474931 2474933 . + 0 transcript_id "g488.t1"; gene_id "g488"; Scaffold_5 AUGUSTUS CDS 2474931 2475236 0.51 + 0 transcript_id "g488.t1"; gene_id "g488"; Scaffold_5 AUGUSTUS stop_codon 2475234 2475236 . + 0 transcript_id "g488.t1"; gene_id "g488"; # protein sequence = [MTIQARSSKKRKQHGQDESADTFNEAVNLEMFSDEEDREDVDSDNGEVDEFPEIDAGSDESGEEDETYESEEDTGLVK # KGAAAARKNSCTSFQKRRLSSQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g488 ### # start gene g489 Scaffold_5 AUGUSTUS gene 2484694 2486160 0.22 - . g489 Scaffold_5 AUGUSTUS transcript 2484694 2486160 0.22 - . g489.t1 Scaffold_5 AUGUSTUS stop_codon 2484694 2484696 . - 0 transcript_id "g489.t1"; gene_id "g489"; Scaffold_5 AUGUSTUS CDS 2484694 2484983 0.55 - 2 transcript_id "g489.t1"; gene_id "g489"; Scaffold_5 AUGUSTUS CDS 2485214 2485560 0.48 - 1 transcript_id "g489.t1"; gene_id "g489"; Scaffold_5 AUGUSTUS CDS 2485651 2485931 0.94 - 0 transcript_id "g489.t1"; gene_id "g489"; Scaffold_5 AUGUSTUS CDS 2486017 2486160 0.48 - 0 transcript_id "g489.t1"; gene_id "g489"; Scaffold_5 AUGUSTUS start_codon 2486158 2486160 . - 0 transcript_id "g489.t1"; gene_id "g489"; # protein sequence = [MNEIPSASSSSSSVPNMLPLVSPTSGYPPPAPLSSRQVPLPSKVPIAENQSQAILPLSWVSKLLQRSSTGHFVYLGQG # GDSFNVDSQLNEKSYKHQSQSDPLDFPKIRTGNDVGDFDYNGNMGRGLQLLAVEAITMAHNQAPGYENSYGQGGRSDKVDDGGYIAGHNMSFGRSLSG # VQGYGEGYPGVDGGGYRGGYTGGYGGRYGGEYGGRYGGEYGGGYRGEYGGGYGGGYGSGYKKWIRRWIRISADGSTFPHADACLNQLSNINSRWREKP # KSSRRESEIFRSLQLAILKIHSKSHVPTTEEDFINEELAEFEHDRYADDEDDENADAEDEDADNNGEDVTLTSREYKRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g489 ### # start gene g490 Scaffold_5 AUGUSTUS gene 2488742 2489113 0.87 - . g490 Scaffold_5 AUGUSTUS transcript 2488742 2489113 0.87 - . g490.t1 Scaffold_5 AUGUSTUS stop_codon 2488742 2488744 . - 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_5 AUGUSTUS CDS 2488742 2489113 0.87 - 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_5 AUGUSTUS start_codon 2489111 2489113 . - 0 transcript_id "g490.t1"; gene_id "g490"; # protein sequence = [MKSERTLLSTSPLERRFLFFSPEQTGAAQHASAVSELSSEEETFTPPPTVPPISILFDRMGFQSQDSEGIHQVLFTPY # KPAKTKEPFPLDYQGRSKWTENERSLAQDCVTPDSLESYASKVGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g490 ### # start gene g491 Scaffold_5 AUGUSTUS gene 2489415 2490858 0.36 + . g491 Scaffold_5 AUGUSTUS transcript 2489415 2490858 0.36 + . g491.t1 Scaffold_5 AUGUSTUS start_codon 2489415 2489417 . + 0 transcript_id "g491.t1"; gene_id "g491"; Scaffold_5 AUGUSTUS CDS 2489415 2489425 0.45 + 0 transcript_id "g491.t1"; gene_id "g491"; Scaffold_5 AUGUSTUS CDS 2490357 2490858 0.52 + 1 transcript_id "g491.t1"; gene_id "g491"; Scaffold_5 AUGUSTUS stop_codon 2490856 2490858 . + 0 transcript_id "g491.t1"; gene_id "g491"; # protein sequence = [MGEIKNPNVSADSNVNASGNPNPNVSVNANVNASKNPNPNPNVSVDSNVNASGNPNLNASENPNSNASESPNPNASEN # LSVNVSENLNVNGNAWVNADVDVRVNGKVNGNAWANVNADVKNVDADANANANVDSNANVDPNANVENANVDPNVDSNANANVDPMTRLNFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g491 ### # start gene g492 Scaffold_5 AUGUSTUS gene 2493007 2493870 0.2 + . g492 Scaffold_5 AUGUSTUS transcript 2493007 2493870 0.2 + . g492.t1 Scaffold_5 AUGUSTUS start_codon 2493007 2493009 . + 0 transcript_id "g492.t1"; gene_id "g492"; Scaffold_5 AUGUSTUS CDS 2493007 2493870 0.2 + 0 transcript_id "g492.t1"; gene_id "g492"; Scaffold_5 AUGUSTUS stop_codon 2493868 2493870 . + 0 transcript_id "g492.t1"; gene_id "g492"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIQGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g492 ### # start gene g493 Scaffold_5 AUGUSTUS gene 2493924 2494532 0.59 + . g493 Scaffold_5 AUGUSTUS transcript 2493924 2494532 0.59 + . g493.t1 Scaffold_5 AUGUSTUS start_codon 2493924 2493926 . + 0 transcript_id "g493.t1"; gene_id "g493"; Scaffold_5 AUGUSTUS CDS 2493924 2494532 0.59 + 0 transcript_id "g493.t1"; gene_id "g493"; Scaffold_5 AUGUSTUS stop_codon 2494530 2494532 . + 0 transcript_id "g493.t1"; gene_id "g493"; # protein sequence = [MKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTD # HFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELS # DRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g493 ### # start gene g494 Scaffold_5 AUGUSTUS gene 2494562 2495759 0.7 + . g494 Scaffold_5 AUGUSTUS transcript 2494562 2495759 0.7 + . g494.t1 Scaffold_5 AUGUSTUS start_codon 2494562 2494564 . + 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_5 AUGUSTUS CDS 2494562 2495147 0.75 + 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_5 AUGUSTUS CDS 2495254 2495759 0.73 + 2 transcript_id "g494.t1"; gene_id "g494"; Scaffold_5 AUGUSTUS stop_codon 2495757 2495759 . + 0 transcript_id "g494.t1"; gene_id "g494"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVQLRSLAGSADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAV # TPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAISSVIRETF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g494 ### # start gene g495 Scaffold_5 AUGUSTUS gene 2495984 2496289 0.91 + . g495 Scaffold_5 AUGUSTUS transcript 2495984 2496289 0.91 + . g495.t1 Scaffold_5 AUGUSTUS start_codon 2495984 2495986 . + 0 transcript_id "g495.t1"; gene_id "g495"; Scaffold_5 AUGUSTUS CDS 2495984 2496289 0.91 + 0 transcript_id "g495.t1"; gene_id "g495"; Scaffold_5 AUGUSTUS stop_codon 2496287 2496289 . + 0 transcript_id "g495.t1"; gene_id "g495"; # protein sequence = [MSVSSDQGEDEYAISFHFDEKQNIVLDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQ # VFCVWRDGVLGEFDDQLNNDNSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g495 ### # start gene g496 Scaffold_5 AUGUSTUS gene 2496317 2497751 0.9 + . g496 Scaffold_5 AUGUSTUS transcript 2496317 2497751 0.9 + . g496.t1 Scaffold_5 AUGUSTUS start_codon 2496317 2496319 . + 0 transcript_id "g496.t1"; gene_id "g496"; Scaffold_5 AUGUSTUS CDS 2496317 2496339 0.9 + 0 transcript_id "g496.t1"; gene_id "g496"; Scaffold_5 AUGUSTUS CDS 2496395 2497751 0.92 + 1 transcript_id "g496.t1"; gene_id "g496"; Scaffold_5 AUGUSTUS stop_codon 2497749 2497751 . + 0 transcript_id "g496.t1"; gene_id "g496"; # protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY # ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFR # IERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWNKKELMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIP # IPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLS # RDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKDHQLDMNYQKEVTKLFQKILELDDLFGNISKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g496 ### # start gene g497 Scaffold_5 AUGUSTUS gene 2497865 2500036 0.58 + . g497 Scaffold_5 AUGUSTUS transcript 2497865 2500036 0.58 + . g497.t1 Scaffold_5 AUGUSTUS start_codon 2497865 2497867 . + 0 transcript_id "g497.t1"; gene_id "g497"; Scaffold_5 AUGUSTUS CDS 2497865 2500036 0.58 + 0 transcript_id "g497.t1"; gene_id "g497"; Scaffold_5 AUGUSTUS stop_codon 2500034 2500036 . + 0 transcript_id "g497.t1"; gene_id "g497"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIK # KFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQ # KVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKI # ERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVR # RRVDANKVAELRRLNENIDIQLKIGISNQVNWSRLGILELKRVWIERCIQDIEDLWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g497 ### # start gene g498 Scaffold_5 AUGUSTUS gene 2500074 2500331 0.57 + . g498 Scaffold_5 AUGUSTUS transcript 2500074 2500331 0.57 + . g498.t1 Scaffold_5 AUGUSTUS start_codon 2500074 2500076 . + 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_5 AUGUSTUS CDS 2500074 2500331 0.57 + 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_5 AUGUSTUS stop_codon 2500329 2500331 . + 0 transcript_id "g498.t1"; gene_id "g498"; # protein sequence = [MDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEE # LSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g498 ### # start gene g499 Scaffold_5 AUGUSTUS gene 2500592 2501367 0.37 - . g499 Scaffold_5 AUGUSTUS transcript 2500592 2501367 0.37 - . g499.t1 Scaffold_5 AUGUSTUS stop_codon 2500592 2500594 . - 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_5 AUGUSTUS CDS 2500592 2500807 0.74 - 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_5 AUGUSTUS CDS 2500867 2501018 0.99 - 2 transcript_id "g499.t1"; gene_id "g499"; Scaffold_5 AUGUSTUS CDS 2501100 2501235 0.6 - 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_5 AUGUSTUS CDS 2501341 2501367 0.51 - 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_5 AUGUSTUS start_codon 2501365 2501367 . - 0 transcript_id "g499.t1"; gene_id "g499"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLHLEKSPRFWSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g499 ### # start gene g500 Scaffold_5 AUGUSTUS gene 2504295 2504997 0.39 - . g500 Scaffold_5 AUGUSTUS transcript 2504295 2504997 0.39 - . g500.t1 Scaffold_5 AUGUSTUS stop_codon 2504295 2504297 . - 0 transcript_id "g500.t1"; gene_id "g500"; Scaffold_5 AUGUSTUS CDS 2504295 2504731 0.97 - 2 transcript_id "g500.t1"; gene_id "g500"; Scaffold_5 AUGUSTUS CDS 2504790 2504997 0.4 - 0 transcript_id "g500.t1"; gene_id "g500"; Scaffold_5 AUGUSTUS start_codon 2504995 2504997 . - 0 transcript_id "g500.t1"; gene_id "g500"; # protein sequence = [MRMVSSKDLDVFASLRGKESSAVALKATTSSPPLEIQSSTSVSKAFVAPPRLIRRNRELENLKADASSFLASPRSAHS # KDSDNELLSGFPSAGSAPVASSSTKVSIGKGEPKSKTTVKVVEDSKADRPLPAGMAYKRIRLPPRSRKNTSIASKGKARQIVVTDEGSTSNEVESEDE # AEDEDIAPPPKRLKTTSSISGRIFILHFSSHFINLIRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g500 ### # start gene g501 Scaffold_5 AUGUSTUS gene 2510990 2511650 0.49 + . g501 Scaffold_5 AUGUSTUS transcript 2510990 2511650 0.49 + . g501.t1 Scaffold_5 AUGUSTUS start_codon 2510990 2510992 . + 0 transcript_id "g501.t1"; gene_id "g501"; Scaffold_5 AUGUSTUS CDS 2510990 2511197 0.49 + 0 transcript_id "g501.t1"; gene_id "g501"; Scaffold_5 AUGUSTUS CDS 2511256 2511650 0.99 + 2 transcript_id "g501.t1"; gene_id "g501"; Scaffold_5 AUGUSTUS stop_codon 2511648 2511650 . + 0 transcript_id "g501.t1"; gene_id "g501"; # protein sequence = [MRMVSSKDLDVFASLRGKESSAVALKATTSSPPLEIQSSTSVSKAFVAPPRLIRRNRELENLKADASSFLASPRSAHS # KDSDNELLSGFPSAGSAPVASSSTKVSIGKGEPKSKTTVKVVEDSKADRPLPAGMAYKRIRLPPRSRKNTSIASKGKARQIVVTDEGSTSNEVESEDE # AEDVAFHGSALQHHPEITSIPRYI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g501 ### # start gene g502 Scaffold_5 AUGUSTUS gene 2513985 2514602 0.99 - . g502 Scaffold_5 AUGUSTUS transcript 2513985 2514602 0.99 - . g502.t1 Scaffold_5 AUGUSTUS stop_codon 2513985 2513987 . - 0 transcript_id "g502.t1"; gene_id "g502"; Scaffold_5 AUGUSTUS CDS 2513985 2514602 0.99 - 0 transcript_id "g502.t1"; gene_id "g502"; Scaffold_5 AUGUSTUS start_codon 2514600 2514602 . - 0 transcript_id "g502.t1"; gene_id "g502"; # protein sequence = [MVRTEYRDNVAKYQFPEIPGSDDWDWAQRVSFLYCTTYRTLTDCIFFTDRRTWQDWGLRCARKTAFHAAVQHYTRILG # IVCYESTQPIVYNNSSDSPAINILNDGSVPPPSPGGYGGWSGSGGYELEPGPDGGVDIVYGGNGTGATAEGTNTMSPAAAAALGVGEKESGLKTALGF # TPPEGLVGAHLRARKTKSRKVMVGLAGDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g502 ### # start gene g503 Scaffold_5 AUGUSTUS gene 2514931 2517394 0.45 - . g503 Scaffold_5 AUGUSTUS transcript 2514931 2517394 0.45 - . g503.t1 Scaffold_5 AUGUSTUS stop_codon 2514931 2514933 . - 0 transcript_id "g503.t1"; gene_id "g503"; Scaffold_5 AUGUSTUS CDS 2514931 2515985 0.51 - 2 transcript_id "g503.t1"; gene_id "g503"; Scaffold_5 AUGUSTUS CDS 2516080 2517394 0.89 - 0 transcript_id "g503.t1"; gene_id "g503"; Scaffold_5 AUGUSTUS start_codon 2517392 2517394 . - 0 transcript_id "g503.t1"; gene_id "g503"; # protein sequence = [MAGSILDSNSSPTSLTAAGKRPETTSNDSHNQPYLAPNSHNPRTFPSTLSLDDHDHDVASPPYRPEASTSSLHGQDLL # LHPNHPYSSYPPSPAYRSQANMSDELHLDGDRRATGDTKWEGELSDTKPKVHYPDIEPVPVVSGDAISPAANKGHLRLDEIPSRDFNRSGTNSPADAM # SLAGTDDEEDHSDYDWSGEDDLVDEEAKFEQQMGVKPKKTGWGFKRIVTLLFSSLLGSTLVAGILVTPGILIHFYWFNNNPTSHRKYVEQNVQAWLFW # AAANLLLSWYLAVIVDLVPTLATFIIAAVWGHVSEVFKSRVELYNSVKNTFKPVLYAASAWASWVIIFGHIFNLYDTVDTSQSRAGYTQRLYQVVEFL # FFFVLVICAQKMLSHAIAFAFHRTAFKERLDEVQYSLKVIEQLRNYRPKHDRFGRQSGARSSGWAWEEDGYGADADNDYDDRTVVGTSSRKSTLGSTF # GFSNKGKNKNKRQSGNFPSPSGGGDHELGVFSSATSPHGRSPSSPSPDTSRPMTPSTAAPFIFNHTNSPAGISPSENGGRGTPHRYPPGSGMNTASPR # PSLDSNHGAGASETLAAAAKVLKSAVLHDARNIRGDADQIGNGGGGAIGLGHVGSSSEAKRLARAIYLKFRPLGQGRTYLLPSDFHPAFPDTTTAQAA # FRVFDKDNNGDLSRAEIKTTLLKVYKERRFLARSMRDVGIALKSLDGILLFFALVIVFFISLSVFGVQVGDSLSSVYTLGIGASFVFKASASSAFDAI # MFLFVTQSVIFLEFSSLRLITSFSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g503 ### # start gene g504 Scaffold_5 AUGUSTUS gene 2521787 2522761 0.46 + . g504 Scaffold_5 AUGUSTUS transcript 2521787 2522761 0.46 + . g504.t1 Scaffold_5 AUGUSTUS start_codon 2521787 2521789 . + 0 transcript_id "g504.t1"; gene_id "g504"; Scaffold_5 AUGUSTUS CDS 2521787 2522761 0.46 + 0 transcript_id "g504.t1"; gene_id "g504"; Scaffold_5 AUGUSTUS stop_codon 2522759 2522761 . + 0 transcript_id "g504.t1"; gene_id "g504"; # protein sequence = [MLAYDRTIVALNSARLGGTSFPIVHALIDAANNNNQIVFMFTVLANITQEPPSLPPLEHASAHILNSPVFERKYAKAY # LTSHTPAISLRKQIASGARQALEEQYLSIIQRTVHSHPSEAQLGGDPSTANLVRAFCAVRFYRQGEWLSGLELVKGTPVWAQVFFLVRVGEVSEAFQV # LMRVKDAVDAREPGFIDAFRIWADSTERSLPRSIRDQLAGVYNAHMLQAQTTDPFKLALYKLVARLDVGRRSIPNVTTTTEDWLWMQFAMVDESSSDE # NDESSLASLTKVLLAYGERHFEPATGTGGQKSGLWASVLLMCGQFERVSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g504 ### # start gene g505 Scaffold_5 AUGUSTUS gene 2529310 2530077 1 + . g505 Scaffold_5 AUGUSTUS transcript 2529310 2530077 1 + . g505.t1 Scaffold_5 AUGUSTUS start_codon 2529310 2529312 . + 0 transcript_id "g505.t1"; gene_id "g505"; Scaffold_5 AUGUSTUS CDS 2529310 2530077 1 + 0 transcript_id "g505.t1"; gene_id "g505"; Scaffold_5 AUGUSTUS stop_codon 2530075 2530077 . + 0 transcript_id "g505.t1"; gene_id "g505"; # protein sequence = [MSLRTNPPRKADNRPTKPTAACAHREHIFDKDDVKDRYHDPDGSKYRVCKDQPCPNRYDKITTGYIPSFARLIDRKQE # DLILGRGAPPEQVASSSSQKPEGTPEAAPAPEPEYPVFPPPPSPVLDRPSSPISSLPRSSPPPPDPEDPDPGAEVSDPESDDDDDNMSKVFKAFDKVS # TLKSDGSNWDTWKNRVELATRSIGFSNHLTSNPKDDTEAWEAKKDDDGNLLNAIVGRLSDQIYRRYKNYENVFDYGKIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g505 ### # start gene g506 Scaffold_5 AUGUSTUS gene 2531835 2533790 0.16 + . g506 Scaffold_5 AUGUSTUS transcript 2531835 2533790 0.16 + . g506.t1 Scaffold_5 AUGUSTUS start_codon 2531835 2531837 . + 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_5 AUGUSTUS CDS 2531835 2532575 0.16 + 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_5 AUGUSTUS CDS 2532685 2532804 0.59 + 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_5 AUGUSTUS CDS 2532888 2533790 0.71 + 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_5 AUGUSTUS stop_codon 2533788 2533790 . + 0 transcript_id "g506.t1"; gene_id "g506"; # protein sequence = [MGYTVYVWNRTPKKANGMISPWEKRFGTIPDISNFHIFGSTVYVKREKEPGKLDPQAQEGRWVGIEPESNGYFIYWPD # RHTVSTERNVKFSDRQIQPVEGEDQDLGNLETSITESEQPIIPVPEEIAEPINPDIITGKRVRKPTKKIQDIINGLGEPNRELRHLTASLGQVTGEII # ADPTSVAEAMRTSRLSQWREAMNEEIRRLQQRGTYDIVIPPDDANILTSKWVFRTKRDEQGKVTGHRARLVNMFIHQMDVKSAYLYGKLDDNEQIYMK # APPGVDIEVKAGQSVSTRSNFDHAVFYRTDPFCIIFIHVDDMTMLTKTMAVMDTLKKKIRDQIEVVDSGEIHWLLGIEIRRSLHTRSIHLSQRAYIDA # ILSRYGFADVKPLSIPFNPHIHLTKDQMPTTVEDITYMRDKPYREAVGALQYLSVATRPDITYAVGILAKFLQNPGITHWNAVKRVYAYLKYTRDLWL # TFGGTQAEIEGYTDADGMSQEDRHAISGYVFMLNGGAVSWSSKRQDTISLSTTEAEYIALTHAAKEAIWFRNLLSELFGPITKPIILNADNQSAIDLA # KDDRFHARTKHIDIQYHFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g506 ### # start gene g507 Scaffold_5 AUGUSTUS gene 2538731 2541483 0.59 - . g507 Scaffold_5 AUGUSTUS transcript 2538731 2541483 0.59 - . g507.t1 Scaffold_5 AUGUSTUS stop_codon 2538731 2538733 . - 0 transcript_id "g507.t1"; gene_id "g507"; Scaffold_5 AUGUSTUS CDS 2538731 2539158 0.97 - 2 transcript_id "g507.t1"; gene_id "g507"; Scaffold_5 AUGUSTUS CDS 2539988 2540323 0.96 - 2 transcript_id "g507.t1"; gene_id "g507"; Scaffold_5 AUGUSTUS CDS 2540503 2540801 0.65 - 1 transcript_id "g507.t1"; gene_id "g507"; Scaffold_5 AUGUSTUS CDS 2540891 2541483 0.81 - 0 transcript_id "g507.t1"; gene_id "g507"; Scaffold_5 AUGUSTUS start_codon 2541481 2541483 . - 0 transcript_id "g507.t1"; gene_id "g507"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGNNPNVVLLLNLLVTHLLTSIW # TGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSS # ESKSKVKEPEVFDGSDPRKLKTGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTN # WDSAALKWAYGRGLAERIKDEMAPSGSSAPFTPKPKPFSGGKPNNNGKPQNFRIPANPAVSAPRSTILVQMGKSFPPKERRMKNNLCLFCGGKHQIAD # CNKRKARESKGRAAEVEETPEATIEVVEEDRKTIRSSXVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPP # LGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLIRSSRRSEKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g507 ### # start gene g508 Scaffold_5 AUGUSTUS gene 2544569 2544778 0.86 + . g508 Scaffold_5 AUGUSTUS transcript 2544569 2544778 0.86 + . g508.t1 Scaffold_5 AUGUSTUS start_codon 2544569 2544571 . + 0 transcript_id "g508.t1"; gene_id "g508"; Scaffold_5 AUGUSTUS CDS 2544569 2544778 0.86 + 0 transcript_id "g508.t1"; gene_id "g508"; Scaffold_5 AUGUSTUS stop_codon 2544776 2544778 . + 0 transcript_id "g508.t1"; gene_id "g508"; # protein sequence = [MLYDDEDLGGHEPGQQQNQQTDEDGGSSESDNNLYESSEPERDWQDEIDTEKDWDMKIVGVEVANGDEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g508 ### # start gene g509 Scaffold_5 AUGUSTUS gene 2545172 2546453 0.61 + . g509 Scaffold_5 AUGUSTUS transcript 2545172 2546453 0.61 + . g509.t1 Scaffold_5 AUGUSTUS start_codon 2545172 2545174 . + 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_5 AUGUSTUS CDS 2545172 2545528 0.61 + 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_5 AUGUSTUS CDS 2545590 2546453 1 + 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_5 AUGUSTUS stop_codon 2546451 2546453 . + 0 transcript_id "g509.t1"; gene_id "g509"; # protein sequence = [MLRLLKKEIGEEETRKMLKEYNDDEDSDDDDGKDTDNEDGDNDNDENQDDRSVQRRTRSETASSRTRSTAPSTSNSAS # ISRAQSTISSGPSGLSRSQLKNVSNVRSNPRIPQAQGSGGQVKLSAPGPSSSLIPPGRSAFSPAPPSFGPQVSRKIPPASPLHSSPTTSSSTFSTGLA # SSRSPASTVHTTPPPPSSSLFLSSTSHSASTTRTRISSISKKPWATSPMTKLPTKIGSSAVSFLNPSLPTSSSSSFSSYSSSKPLSIMSSTFASSLSS # MSTVSTPTLGRSTSALSFSGSETLPKHTIPILADSIPLGAAESRPMKALPHRKTQTQIQTFNSETTSTTASTTSKPTLSHNSRTRTKITTTSAETVRD # GLGSKSRASTDSMNLDANQNNDVELGEDIPESSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g509 ### # start gene g510 Scaffold_5 AUGUSTUS gene 2552628 2553098 0.91 - . g510 Scaffold_5 AUGUSTUS transcript 2552628 2553098 0.91 - . g510.t1 Scaffold_5 AUGUSTUS stop_codon 2552628 2552630 . - 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_5 AUGUSTUS CDS 2552628 2553098 0.91 - 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_5 AUGUSTUS start_codon 2553096 2553098 . - 0 transcript_id "g510.t1"; gene_id "g510"; # protein sequence = [MQWSHPITNGDLPPPSRAHTATLVDRKIYVFGGGQAASYSDSVYILDTVTRKWTKPIISGAIRDPNTGEVIGSAPGPP # GSGGSNHSNGTNSRSSPISSTVYGEIPAPRRAHTAVYYNGKIWMFGGGNGMMALNDVWTLDVSKMIWERMNVRVETVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g510 ### # start gene g511 Scaffold_5 AUGUSTUS gene 2555655 2556168 0.84 + . g511 Scaffold_5 AUGUSTUS transcript 2555655 2556168 0.84 + . g511.t1 Scaffold_5 AUGUSTUS start_codon 2555655 2555657 . + 0 transcript_id "g511.t1"; gene_id "g511"; Scaffold_5 AUGUSTUS CDS 2555655 2555862 0.87 + 0 transcript_id "g511.t1"; gene_id "g511"; Scaffold_5 AUGUSTUS CDS 2555927 2556168 0.84 + 2 transcript_id "g511.t1"; gene_id "g511"; Scaffold_5 AUGUSTUS stop_codon 2556166 2556168 . + 0 transcript_id "g511.t1"; gene_id "g511"; # protein sequence = [MYSSYNIGTTVWSALASGLLTGKYNDGIPEGSRFDVEKSFFSGTLKELQSPEGQEKIRKVKELTKLAQEELQTTPSAL # ALAWVARNPNTSTVILGATKPEQLLENLKAIEVIPKLTPEILEKIEAILGNKPGGVVSSCLLVLLPCVTYM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g511 ### # start gene g512 Scaffold_5 AUGUSTUS gene 2558939 2559505 0.64 - . g512 Scaffold_5 AUGUSTUS transcript 2558939 2559505 0.64 - . g512.t1 Scaffold_5 AUGUSTUS stop_codon 2558939 2558941 . - 0 transcript_id "g512.t1"; gene_id "g512"; Scaffold_5 AUGUSTUS CDS 2558939 2559505 0.64 - 0 transcript_id "g512.t1"; gene_id "g512"; Scaffold_5 AUGUSTUS start_codon 2559503 2559505 . - 0 transcript_id "g512.t1"; gene_id "g512"; # protein sequence = [MSSLSRSQLLQSATAFCDVFAQKKDLNVILSHFSTTHQVSAVEHGEKALAPFLGRSFEGLDGIRAYFETIAALLSYED # MEFSEFTVDTEARRVACKGKAKFTWNQTKESWDEMFAYLLDFDDSGKITHYQVWADSGAAYLARNGQLDKIRKVCKQSSFFRDVNEPFRRVSRSYGAT # LSIHRTTLGRSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g512 ### # start gene g513 Scaffold_5 AUGUSTUS gene 2560466 2562019 0.42 - . g513 Scaffold_5 AUGUSTUS transcript 2560466 2562019 0.42 - . g513.t1 Scaffold_5 AUGUSTUS stop_codon 2560466 2560468 . - 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_5 AUGUSTUS CDS 2560466 2560799 0.98 - 1 transcript_id "g513.t1"; gene_id "g513"; Scaffold_5 AUGUSTUS CDS 2561484 2562019 0.45 - 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_5 AUGUSTUS start_codon 2562017 2562019 . - 0 transcript_id "g513.t1"; gene_id "g513"; # protein sequence = [MDICRSAGVKRKRSEDPGPIASSSRQRLDDRGWTSAGYDTSLDRNTDEERYEQQQFSNLMRTSSIRTPMSNDISLPPT # PSDTVPGHVLSNFRGDPALTLNSGKQALPSFEQLVKSQGYTELPTQISLDINAWSTGRNHSIDEYSGYDFLGEDLFALLGSVVKPLEQPSPHTFEENA # QAFAWRHWGCVTSKVLSNVKSEHPEASDVDGFEDLRPEDQDKVTKAWEVGNVADEDIPETARKADGDGDEEEEDDKPKKKSRATKKKADDDGEEKPKK # PRATKAKAQVSASSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g513 ### # start gene g514 Scaffold_5 AUGUSTUS gene 2563943 2564913 0.5 - . g514 Scaffold_5 AUGUSTUS transcript 2563943 2564913 0.5 - . g514.t1 Scaffold_5 AUGUSTUS stop_codon 2563943 2563945 . - 0 transcript_id "g514.t1"; gene_id "g514"; Scaffold_5 AUGUSTUS CDS 2563943 2564168 0.85 - 1 transcript_id "g514.t1"; gene_id "g514"; Scaffold_5 AUGUSTUS CDS 2564219 2564913 0.55 - 0 transcript_id "g514.t1"; gene_id "g514"; Scaffold_5 AUGUSTUS start_codon 2564911 2564913 . - 0 transcript_id "g514.t1"; gene_id "g514"; # protein sequence = [MARYITTLTGATSSISIDMSNRNHAHTVSHRANFAAVRGVPMLSVLPVLTYLVKDINDNAASARQCDPSNHPKVKQDP # HVVSRQSNSVELRLAKVEETILKLLPMAQAFEAWLRANNQLSTPGLPCVVCSYNNHVVSDFLAWFTSFRIDPDSTASNLQSPISRSPPVEDRPSTSTS # YRASNAIKDLCVNDVSESSYTPQYDPDLMESSSSYGPEKWSDRYSHLSKDSYGHLRYTGGAASFMLVDALASLQNHAAIDASSNSTLSAKTDIQLPFF # APDKTFRKQPALYVFRSFQKLKLTKVLRQAAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g514 ### # start gene g515 Scaffold_5 AUGUSTUS gene 2566954 2567751 0.53 + . g515 Scaffold_5 AUGUSTUS transcript 2566954 2567751 0.53 + . g515.t1 Scaffold_5 AUGUSTUS start_codon 2566954 2566956 . + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_5 AUGUSTUS CDS 2566954 2567751 0.53 + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_5 AUGUSTUS stop_codon 2567749 2567751 . + 0 transcript_id "g515.t1"; gene_id "g515"; # protein sequence = [MAPLCYDPDSLDELEVALPSSPLITLSSNAYLQPPLTRRGTGPGMIAFLPPSSAYKPNIENTLDPEPVQKWAEEGFAV # VGVTSGEGWSIEEALTKGVEALLSLEELDTRDKFAVYGEFLHTASADKSVCTILHISCLVYDPNAVSEVLLRIQQANDTRLSCIVAIGNPEKLPPVPT # YLHLPPTADYPQIPNTISHRFTKSPYFLLPQSSEYVPGEATLAHSRVLEFLRRILGGPVFDIEAIWEEHTYFEFEVRSVAKTMGTMVVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g515 ### # start gene g516 Scaffold_5 AUGUSTUS gene 2580930 2582400 0.69 + . g516 Scaffold_5 AUGUSTUS transcript 2580930 2582400 0.69 + . g516.t1 Scaffold_5 AUGUSTUS start_codon 2580930 2580932 . + 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_5 AUGUSTUS CDS 2580930 2581031 0.69 + 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_5 AUGUSTUS CDS 2581126 2582400 0.96 + 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_5 AUGUSTUS stop_codon 2582398 2582400 . + 0 transcript_id "g516.t1"; gene_id "g516"; # protein sequence = [MCKGVAVMRRRSDAWLNATQILKVAGFDKPQRTRITDPNGISLGTWIPLERGFSLAKQYNCDTLLRPLIDFQPAAKSP # PLAPKHLVSATAPRPARRTATGDGPGGSVVNTRSSRRQAHQEVDQASEGQETLSVVGTEDGSMTPSPSEASSSSRTPSPINSPGPYSLNTVGSSRQRR # KSIDDRYNEYEDEVPDGGINDARAYGDQILEYFISDTNQVPAILINPPIDFDPNMAIDDDGHTSLHWACAMGRLRIVKLLLTAGADIFKVNKAGQTPL # MRSVMFANNYDVRKFPELYELLHRSTLNIDNYNRTVFHHVVDVAMSKGKTHAARYYMETILTRLAEYPKELADVINFQDEDGETALTMAARCRSKRLV # KLLIDHGADPKIVNNDGKSTEDYILEDERFRSSPVPPSRAMTMSFRNAQVAFLPPNAPPTIHSGHRMAIVRLFTIPSPDSEQVHGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g516 ### # start gene g517 Scaffold_5 AUGUSTUS gene 2582565 2583113 0.36 + . g517 Scaffold_5 AUGUSTUS transcript 2582565 2583113 0.36 + . g517.t1 Scaffold_5 AUGUSTUS start_codon 2582565 2582567 . + 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_5 AUGUSTUS CDS 2582565 2583113 0.36 + 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_5 AUGUSTUS stop_codon 2583111 2583113 . + 0 transcript_id "g517.t1"; gene_id "g517"; # protein sequence = [MGHTKQSLSALEKELNDRMCRRYRMGCEKWVKDEEGREIRIRDASGGVLELTPGTATFIINGGPSSEDPLLNNDDGTA # SKRQVGIQIDETVSDLLVLHDNIPTDPEALKRACDGLREELGAHRKRRKVIFDELVEFQAEAGTKGRMKDYRRLIGAGCGGIPPSEVDGVLGMLLEVC # GFCGGC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g517 ### # start gene g518 Scaffold_5 AUGUSTUS gene 2584431 2584904 0.42 + . g518 Scaffold_5 AUGUSTUS transcript 2584431 2584904 0.42 + . g518.t1 Scaffold_5 AUGUSTUS start_codon 2584431 2584433 . + 0 transcript_id "g518.t1"; gene_id "g518"; Scaffold_5 AUGUSTUS CDS 2584431 2584904 0.42 + 0 transcript_id "g518.t1"; gene_id "g518"; Scaffold_5 AUGUSTUS stop_codon 2584902 2584904 . + 0 transcript_id "g518.t1"; gene_id "g518"; # protein sequence = [MQNGLCDMNEFDIDDYEYYEKVENGDWNWITPNFIAFASPVDQNWIKRQKEAAKDPASPSALASSTNSNLALQGKLPT # PFLNCLDYFEKRNIKMVVRLNNQLYDRTTFLDRGIDHMELYFDDGTNPTDEIVRTFLDVADRVIEDGGVVAVHVREHSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g518 ### # start gene g519 Scaffold_5 AUGUSTUS gene 2585024 2586042 0.29 + . g519 Scaffold_5 AUGUSTUS transcript 2585024 2586042 0.29 + . g519.t1 Scaffold_5 AUGUSTUS start_codon 2585024 2585026 . + 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_5 AUGUSTUS CDS 2585024 2585472 0.3 + 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_5 AUGUSTUS CDS 2585565 2586042 0.51 + 1 transcript_id "g519.t1"; gene_id "g519"; Scaffold_5 AUGUSTUS stop_codon 2586040 2586042 . + 0 transcript_id "g519.t1"; gene_id "g519"; # protein sequence = [MRIVRPGSVVGPQQQYLYLKQLEWSKWAAMDEARKIQSAAAAATPPTITLVTPATPPADIDEEQLPRPTTPTGSAMPL # PPVTPSRHVAAAAARAREIAPPGQPRKTPNAKRSAPAHDSDDEDDPLGIRSDSDSDEMNDILPSLHTIVPAPAASNESDTFNAGAAVIRKAGTTSTGA # AVKPGAAGRSVVASPTKPTTGQRPNKIPRLAMGKSTVSLAAKAAAAKEVPKPILPRIAVATRSKLNPAPSPTPSRLPTLVPARGRLATHSNSTSDAAA # AALLHSKKSPAATDLKTKESADAPAWMATGKAAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g519 ### # start gene g520 Scaffold_5 AUGUSTUS gene 2586410 2587296 0.36 - . g520 Scaffold_5 AUGUSTUS transcript 2586410 2587296 0.36 - . g520.t1 Scaffold_5 AUGUSTUS stop_codon 2586410 2586412 . - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_5 AUGUSTUS CDS 2586410 2586802 0.69 - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_5 AUGUSTUS CDS 2586946 2587296 0.37 - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_5 AUGUSTUS start_codon 2587294 2587296 . - 0 transcript_id "g520.t1"; gene_id "g520"; # protein sequence = [MGMEVLMNPGPSFPDPLNIPADVAKLRQNVDVEKELGYVFKAITQTRIELKGEVPLIGFCGAPWTLFAYMIEGGGSKT # FTKAKTWLFKYPKESEALLIQIADVCVDFLVGQVKAGAQGVREKLANQNIPQVPMTLFAKGANYALGELAQDSGYDVLGLDWCIEPSVARRTVNGKVA # LQGNMDPNVLYGGREAIESAVKRMCKEFQDGNNGGVSAWIANLGHGITPGVDPEDVRWYFECIHKYSASKQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g520 ### # start gene g521 Scaffold_5 AUGUSTUS gene 2588317 2589009 1 + . g521 Scaffold_5 AUGUSTUS transcript 2588317 2589009 1 + . g521.t1 Scaffold_5 AUGUSTUS start_codon 2588317 2588319 . + 0 transcript_id "g521.t1"; gene_id "g521"; Scaffold_5 AUGUSTUS CDS 2588317 2589009 1 + 0 transcript_id "g521.t1"; gene_id "g521"; Scaffold_5 AUGUSTUS stop_codon 2589007 2589009 . + 0 transcript_id "g521.t1"; gene_id "g521"; # protein sequence = [MPIFSDKSFDDSLKESILRALKDQPNENERNRESKEKVGDENDLASPRDSEHSNHKREDAMGESADNIREEKNTKAEE # ARILINGAINTNPPIRSNSSCAGNHNPADTTSPSPQSHLSVNGTKEFDNTPDVKDPTVSPPSLTRRSSSNLSSLSSVSSRSPSVIAETYTDKTTIVRV # PVPASLPESVPDDGRSHTQDGSSMSQTERSIARTTQQTTEGSSDVVMSNAMAIK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g521 ### # start gene g522 Scaffold_5 AUGUSTUS gene 2602785 2603243 0.53 + . g522 Scaffold_5 AUGUSTUS transcript 2602785 2603243 0.53 + . g522.t1 Scaffold_5 AUGUSTUS start_codon 2602785 2602787 . + 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_5 AUGUSTUS CDS 2602785 2603243 0.53 + 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_5 AUGUSTUS stop_codon 2603241 2603243 . + 0 transcript_id "g522.t1"; gene_id "g522"; # protein sequence = [MYQRCRALDIPHRKTGKLVVAKDNQRPYIENLHLKALRSQWPPYSNAIDDSPVLPTRLISGDESRVMEPNLSQDISAA # LWCPETGIVDSHSFMESLEHDISESEVGNWPMQPVSSGWTLTEALNKCQRQNEDGWCRLLLETTRAREQKVILS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g522 ### # start gene g523 Scaffold_5 AUGUSTUS gene 2604879 2605835 0.69 - . g523 Scaffold_5 AUGUSTUS transcript 2604879 2605835 0.69 - . g523.t1 Scaffold_5 AUGUSTUS stop_codon 2604879 2604881 . - 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_5 AUGUSTUS CDS 2604879 2605835 0.69 - 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_5 AUGUSTUS start_codon 2605833 2605835 . - 0 transcript_id "g523.t1"; gene_id "g523"; # protein sequence = [MLPYMPGPAENVNDQLTATRRSELDEYLRSLCDLNKAGAKYILEHKVVREFLSLKPGDVESETEPRMQEIETLFATDD # DEQYGNDDEYDEVRDTLGRMKVEDDRKSAGSEYGEDEGYAPSPQRTYDRHPYARVDERRPDDNNLRLHAHTQNHQRNGSTSSFNRTSSPYTSNSRSNS # PIPERGESPLLDGEYSSRHSTGKTHNASSPSVSSVRSTNAPTVGRARSHSNANNPPISAANPQTAFVKIKIFDRVADDLIAIRVHPLVTHLELMDKVQ # TRLGGEVSNLRFRDSMSNAFVALDDDNQLRAWMDGTDKHVLYAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g523 ### # start gene g524 Scaffold_5 AUGUSTUS gene 2608081 2609535 0.55 + . g524 Scaffold_5 AUGUSTUS transcript 2608081 2609535 0.55 + . g524.t1 Scaffold_5 AUGUSTUS start_codon 2608081 2608083 . + 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_5 AUGUSTUS CDS 2608081 2608251 0.58 + 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_5 AUGUSTUS CDS 2608353 2608754 0.99 + 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_5 AUGUSTUS CDS 2608792 2608927 0.95 + 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_5 AUGUSTUS CDS 2609192 2609535 0.96 + 2 transcript_id "g524.t1"; gene_id "g524"; Scaffold_5 AUGUSTUS stop_codon 2609533 2609535 . + 0 transcript_id "g524.t1"; gene_id "g524"; # protein sequence = [MQASSNQTQKEKLELDLKTQIKKLQRMRDQIKTWYASNDIKDKSALVENRKLIETVSQMEKFKACEKEMKTKAFSKEG # LTQAAKLDPKEQEKEEIMAWLQTKVEELQMQIEQAEAEIESLQGSGKKRGKSSSTAGRAEELEHLNDRRKWHISRLEIVLRLLNNGSLFTEKAVALKD # DALPTSWKATRYILCEEDFDEYEGIYDELNLDEEEEKFRGLVHDDEDSDESDDASEGAFISKAQPITNILKTTVPHPAPVLAAPPPRPAVTLPPIRYA # AAAAAAIAPVPTPPSATKAAASTNSGPNATPAFSIPTSSSQASQDQVSVVPSSPSLTHPSVTSPMLFLCGIGIATV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g524 ### # start gene g525 Scaffold_5 AUGUSTUS gene 2618351 2619271 0.91 - . g525 Scaffold_5 AUGUSTUS transcript 2618351 2619271 0.91 - . g525.t1 Scaffold_5 AUGUSTUS stop_codon 2618351 2618353 . - 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_5 AUGUSTUS CDS 2618351 2619271 0.91 - 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_5 AUGUSTUS start_codon 2619269 2619271 . - 0 transcript_id "g525.t1"; gene_id "g525"; # protein sequence = [MTPASRISNIPEAENVHGPLHNVHAPNMTVTKGPKLKGLETFGKDVLEIEKPQQPVLEDPEMDLVHIMLERERKGWET # QKNPESLYVRQVLPYTTGKLPSPIPPLYGGKFKRGSSYKKSSAYSAPMLHPNTISEGGQQDDVEVFTANPIPDNMSNEDVYYHLCHVIANTTIVEDAW # SAYSTILTIHSPEDRRRGDPPIPFEHLHRLCRLLSQNQPKTRTQFLRLLSILYTLRKHGGMVHKFEWNALIANAGTGWRGSKAKDFQLALDVFDDMVS # GEPPGSSFSLSDYPPLSTPPQPIEPDIFPTIH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g525 ### # start gene g526 Scaffold_5 AUGUSTUS gene 2620239 2620661 0.98 - . g526 Scaffold_5 AUGUSTUS transcript 2620239 2620661 0.98 - . g526.t1 Scaffold_5 AUGUSTUS stop_codon 2620239 2620241 . - 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_5 AUGUSTUS CDS 2620239 2620661 0.98 - 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_5 AUGUSTUS start_codon 2620659 2620661 . - 0 transcript_id "g526.t1"; gene_id "g526"; # protein sequence = [MPKKHAEDGGKSISRELERIRKYCTVVRVLAHTQIRKTGLSQKKAHLMEIQVNGGSIADKVEFAHGLFEKPVEVSSVF # EQDECVDIIAVTKGHGFEGVTHRWGTKKLPRKTHKGLRKVACIGAWHPSKVMFSVARAGQST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g526 ### # start gene g527 Scaffold_5 AUGUSTUS gene 2623348 2624205 0.9 + . g527 Scaffold_5 AUGUSTUS transcript 2623348 2624205 0.9 + . g527.t1 Scaffold_5 AUGUSTUS start_codon 2623348 2623350 . + 0 transcript_id "g527.t1"; gene_id "g527"; Scaffold_5 AUGUSTUS CDS 2623348 2624205 0.9 + 0 transcript_id "g527.t1"; gene_id "g527"; Scaffold_5 AUGUSTUS stop_codon 2624203 2624205 . + 0 transcript_id "g527.t1"; gene_id "g527"; # protein sequence = [MIVVDEDPFDHEVSSSSSAPVEEDEVGSLYAQIRTLQDALTTVSQENEDLRSSVQTLNQLSRHHTVSLNRMSRNVDNG # LVEIARLQSELLDKNSVLTRLPASLRLTEDLSRENTVLRLQIEELTSRLEISHGDVAAQELIAEELTRETERLKQQLDNLREASTHVPSVAGDEELQN # LINEDLSRENRQLRNQASELQETLSQLQIPNDELDSLKGITRVLTRENKRLQRRVREMESLSTAQEGMRQQVEQLNRDNERLRRELAQVRRPRQNTTD # VPPPAYEDIGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g527 ### # start gene g528 Scaffold_5 AUGUSTUS gene 2625115 2625924 1 + . g528 Scaffold_5 AUGUSTUS transcript 2625115 2625924 1 + . g528.t1 Scaffold_5 AUGUSTUS start_codon 2625115 2625117 . + 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_5 AUGUSTUS CDS 2625115 2625924 1 + 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_5 AUGUSTUS stop_codon 2625922 2625924 . + 0 transcript_id "g528.t1"; gene_id "g528"; # protein sequence = [MGSDTPGEAPPTSEPSNSPLVEAENDGRNRDDGGNKDASSGYPWKWTIDIKHIDESEDEGGGSSQKTESSGDKWSKPT # DPEPLFSEQRDGHIPHTLASPSHETELLLSQDAFSDSLSKLAPSSFGHSHRTSASPTPSPTFLRQRVSKHIKCVESDGEFERETDRSSYSSSPVKHPI # NTPQTRSSTTPPTSDAEDEMPSRKAKTHSKGKSVAIMNPLVLQPAVDLDVSKAKGKRSQSNKVKVHYKLPSYVLILTNSACRLRRKKNVEIQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g528 ### # start gene g529 Scaffold_5 AUGUSTUS gene 2626036 2629091 0.11 + . g529 Scaffold_5 AUGUSTUS transcript 2626036 2629091 0.11 + . g529.t1 Scaffold_5 AUGUSTUS start_codon 2626036 2626038 . + 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_5 AUGUSTUS CDS 2626036 2627166 0.84 + 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_5 AUGUSTUS CDS 2627238 2627666 0.64 + 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_5 AUGUSTUS CDS 2627719 2627946 0.22 + 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_5 AUGUSTUS CDS 2628072 2628432 0.71 + 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_5 AUGUSTUS CDS 2628474 2628761 0.9 + 2 transcript_id "g529.t1"; gene_id "g529"; Scaffold_5 AUGUSTUS CDS 2628814 2629091 0.69 + 2 transcript_id "g529.t1"; gene_id "g529"; Scaffold_5 AUGUSTUS stop_codon 2629089 2629091 . + 0 transcript_id "g529.t1"; gene_id "g529"; # protein sequence = [MILRALISGISAGNTPAPLKGEDSMDPISEFSEYSSPRSNRSAVVPADTKLTEAETPRTSMPELPDGADSDEEQLPDI # DQLLKSLQEKKLLALQQQGQLRSSALASDDDDDLEIVDNPSTSIQVAIQKEADARKSGRPGITASTRILQKHAGISSSRRTGEVASASQARNSRELNE # VLLKRVNAENTRRTQQKTEEWISRGGKPLGPEIRASERHGLDWYAQKALEDLKKTDAENGNHHQGGTDDQEDEEWTSLRGSASPALVEQDSSNEYEEN # EGDDEEGFEDDQDITMVNEDTQDEDIPTQVDLPHRRAVRPIVNSDTEDEDNNENLFARRHSLGKVLVQDSMILDQDSDKVSPVPQFARRQSDSSYDGG # LPKTSHELLNHGPSPGRRSSVHNLEEGLSSRLSVSLDGYATDEDKENPRSPLKTLSVSEIGPFTPAAVSFAIRLERATSTASIADKPPDPLLSPRVSR # ESQMSGFSQFSDGEGFRPKKLEAGFSGFFDSQIPSSSFSPLLGSLTEPGQSNNFFDKLRRNNPLALTQEVGLQPALEVDESLKRQADEVFEREQELII # ETVNASTSKKPELYINDQGCALSFRNKNAISSQGLTRPPFRELSMSEAESTEDTPVRRNRLHRLKKRDESGSSSSAQLSNIFGERSISPPLPSPRPRR # HRPVESQIRKIGRRLEKSEFIEGEAQESDEDEMFGFRKVEEDEEDGEHLDHTDSRRQSSGEISVSVLSISYALYSSSSREQRQADDAHVEDVAHKLAQ # GHFRNGKRSRGQASIDNSDDDDEEDETGRRVRWKMKKEPELRGDIKSLAGQDATRAFAEQYQAAINSDGDPELAFLQGDDANDIIMTGPNYGQDDDDD # ANEDDEDDENTVNTSDIMRQLREAAKRGKVRANSLVNLMLYH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g529 ### # start gene g530 Scaffold_5 AUGUSTUS gene 2631785 2632425 0.41 - . g530 Scaffold_5 AUGUSTUS transcript 2631785 2632425 0.41 - . g530.t1 Scaffold_5 AUGUSTUS stop_codon 2631785 2631787 . - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_5 AUGUSTUS CDS 2631785 2632225 0.82 - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_5 AUGUSTUS CDS 2632315 2632425 0.42 - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_5 AUGUSTUS start_codon 2632423 2632425 . - 0 transcript_id "g530.t1"; gene_id "g530"; # protein sequence = [MSLLFDLFEVAILIGSCFLLNYVTEDSKTNWAEGVMLALSAWFYPQQPEIGIMLSRTSIAEVYKESSFGGNAHNIGSS # PLSSVASPSVSTLYDTATATVTTTMSNSQVTAAAASPIPTSGLSEELQRLVKLYGVLVDENKKLQGDIENALSSVSNPSRTSVATLPKETTKSTRQRR # SRYVKDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g530 ### # start gene g531 Scaffold_5 AUGUSTUS gene 2637890 2638319 0.68 - . g531 Scaffold_5 AUGUSTUS transcript 2637890 2638319 0.68 - . g531.t1 Scaffold_5 AUGUSTUS stop_codon 2637890 2637892 . - 0 transcript_id "g531.t1"; gene_id "g531"; Scaffold_5 AUGUSTUS CDS 2637890 2638260 0.86 - 2 transcript_id "g531.t1"; gene_id "g531"; Scaffold_5 AUGUSTUS CDS 2638304 2638319 0.7 - 0 transcript_id "g531.t1"; gene_id "g531"; Scaffold_5 AUGUSTUS start_codon 2638317 2638319 . - 0 transcript_id "g531.t1"; gene_id "g531"; # protein sequence = [MSLLISDAWNHHQIRTAGHKTLIALYELSREHAKTRGYWTGDPGDNVETASHPSYGLEDELEQGAPGDHQVSEEDGDD # IRVNENEDITDVHSILTGMGFDIEQEDGNWGIEVYCEAVLKLKVYVETQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g531 ### # start gene g532 Scaffold_5 AUGUSTUS gene 2639876 2640229 0.4 - . g532 Scaffold_5 AUGUSTUS transcript 2639876 2640229 0.4 - . g532.t1 Scaffold_5 AUGUSTUS stop_codon 2639876 2639878 . - 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_5 AUGUSTUS CDS 2639876 2640229 0.4 - 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_5 AUGUSTUS start_codon 2640227 2640229 . - 0 transcript_id "g532.t1"; gene_id "g532"; # protein sequence = [MRTSCPPVASGPKNTSSERAHSASTSTSASSSSTAEPAPSASSSSTAEPAPSATVPAYSAHVKAAQTFAKCVSGFTWA # KLSSRPSSRLASTHNYQSGSILCLSVNFLFKSNIGSYIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g532 ### # start gene g533 Scaffold_5 AUGUSTUS gene 2644132 2644725 1 - . g533 Scaffold_5 AUGUSTUS transcript 2644132 2644725 1 - . g533.t1 Scaffold_5 AUGUSTUS stop_codon 2644132 2644134 . - 0 transcript_id "g533.t1"; gene_id "g533"; Scaffold_5 AUGUSTUS CDS 2644132 2644725 1 - 0 transcript_id "g533.t1"; gene_id "g533"; Scaffold_5 AUGUSTUS start_codon 2644723 2644725 . - 0 transcript_id "g533.t1"; gene_id "g533"; # protein sequence = [MTSTSSGNDAYVTGSSSSKGKERSMTPQPEDDLCPFPPNRRLRCVDLPASDDYSAQLFKGGLDAEMQLDPEAGQEDDN # DDMEVNYILTDPVEPDSDKTNAYASTFFPHILILIPLTLYSTDSYLTPRSKKQPTAGSSTSINKKDRDRVPRGSSDGMTTTADSGFFESTTPPPFPRH # TKNPPTTSLMAPLIQILLLDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g533 ### # start gene g534 Scaffold_5 AUGUSTUS gene 2647167 2648063 0.39 - . g534 Scaffold_5 AUGUSTUS transcript 2647167 2648063 0.39 - . g534.t1 Scaffold_5 AUGUSTUS stop_codon 2647167 2647169 . - 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_5 AUGUSTUS CDS 2647167 2647592 0.89 - 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_5 AUGUSTUS CDS 2647642 2647802 0.39 - 2 transcript_id "g534.t1"; gene_id "g534"; Scaffold_5 AUGUSTUS CDS 2647901 2648063 0.59 - 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_5 AUGUSTUS start_codon 2648061 2648063 . - 0 transcript_id "g534.t1"; gene_id "g534"; # protein sequence = [MAPPFIAYYGALQAGDNESYLLQTAYEQISLYRDVLRDDDGLWRHVALVAGRTQHTHNFISGNGWAAAGMLRVLETLN # HSSMTTDFADQTANLTQWIQEILSSSWQYQLENGTLLNTIDDSNSFADSSGTALLASVTYRMAVYTNDTSLIPNADKAFQLVESNIDGDGWLRDTVDP # ETFDSPSAADSASPEGQAFVLLLQAAYSDYAEAVISGQVIPSSNSSSSSGSEGSGDDDDDGSILRRCRLVRSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g534 ### # start gene g535 Scaffold_5 AUGUSTUS gene 2652608 2653108 0.49 - . g535 Scaffold_5 AUGUSTUS transcript 2652608 2653108 0.49 - . g535.t1 Scaffold_5 AUGUSTUS stop_codon 2652608 2652610 . - 0 transcript_id "g535.t1"; gene_id "g535"; Scaffold_5 AUGUSTUS CDS 2652608 2653108 0.49 - 0 transcript_id "g535.t1"; gene_id "g535"; Scaffold_5 AUGUSTUS start_codon 2653106 2653108 . - 0 transcript_id "g535.t1"; gene_id "g535"; # protein sequence = [MNRTSEFLRNLSPEMRQWLRKVTRRQDASGSNRQQRIQLAEYRQKVAEDKTRKQEEQAQKRAKAAREIDAISPIQTVT # ELDFRVSLPVGSNGYLNVSDITKQLKWHKVHGAKDAITTVESKWGKRPQKLILLRSCIEMLVHARASVLSEESTSVEEEDDLEITVQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g535 ### # start gene g536 Scaffold_5 AUGUSTUS gene 2653575 2655807 0.38 - . g536 Scaffold_5 AUGUSTUS transcript 2653575 2655807 0.38 - . g536.t1 Scaffold_5 AUGUSTUS stop_codon 2653575 2653577 . - 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_5 AUGUSTUS CDS 2653575 2654584 0.47 - 2 transcript_id "g536.t1"; gene_id "g536"; Scaffold_5 AUGUSTUS CDS 2654700 2655807 0.74 - 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_5 AUGUSTUS start_codon 2655805 2655807 . - 0 transcript_id "g536.t1"; gene_id "g536"; # protein sequence = [MFIVQKIATPRKTTQPINFLCELGTVCLEHEIPMVVDVVRGQDYLFRASQSELGKSLRKLQSTNPTRLISILYLSCMV # HKADNAVVKYGKHKRTSKKTRQERSKAAREASLRSRAPTSPISDHPHKNTENPTDNYKENDDPQPGSSARMPKADLRADKLKKDVDKHRKKSTYWKGK # TVVLRGSLSETKKELNKHIEEEEQIKKIANGERQKMSRQIENLEDALESEMKRRKLDAEEQETQNAQWREQVRDHRRQIVALKKKIGRIPSRLATAIN # RIARTYNMNVENDRKFFLKNDGVVTDETRDIFLDLVSIEEVPANKVTRVFKRIASAFGIEVEGDVSRRSVGRIAKEGGVASKLQFGKAVLDPSTKVIQ # ADQKLQFFLGLKMAVNHTSETQVGCWIETVEDIFHLLFESGMCSKDDARIFWNLVTGFHSDHAADQKKLFELLKKWKERCDRELRGERAVKRLTDLEY # ACLIFQGSQALVQQVGGPAAWEVLTPKERSRRLEAMRNQIIRDIGEAEFAKLSEAEKAEVDFFLWAGCCMHKEMNAFKGGCVGLDNFWKEHPELEPPK # LLPNRDNAAAINKAAGTGAADRALECSERGAVKVASLAGSIFRHKDRKRGQQDTLRFFFDHKLGFNVSFPDTSNTRFQSHAEACAVIIIYLDLFIEFL # TYVKQNKGSGKLNHMEQNVFDGLQDIPTRHEFVISHFTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g536 ### # start gene g537 Scaffold_5 AUGUSTUS gene 2659559 2661122 0.64 - . g537 Scaffold_5 AUGUSTUS transcript 2659559 2661122 0.64 - . g537.t1 Scaffold_5 AUGUSTUS stop_codon 2659559 2659561 . - 0 transcript_id "g537.t1"; gene_id "g537"; Scaffold_5 AUGUSTUS CDS 2659559 2660588 1 - 1 transcript_id "g537.t1"; gene_id "g537"; Scaffold_5 AUGUSTUS CDS 2660922 2661056 0.89 - 1 transcript_id "g537.t1"; gene_id "g537"; Scaffold_5 AUGUSTUS CDS 2661115 2661122 0.64 - 0 transcript_id "g537.t1"; gene_id "g537"; Scaffold_5 AUGUSTUS start_codon 2661120 2661122 . - 0 transcript_id "g537.t1"; gene_id "g537"; # protein sequence = [MYSLYKQGMFTLGFKGVEQYTNGVPSATVGNVKSPRPAMWDMLARAKCSHSLKSDSSGSSDDGQVRSSGFIHASQTQT # SDRQHQQEFEDSESDEDEDADEDEEEREDQAKELPVRPDLGASILNRPQSSLSSHRYRTPMAGSLAMSPPPNHSIPAIQPLPGFDTPSAFAEPSPTSI # PSSLYPVGSSYVGFSESSREGMTSPPQGLFPAHPQYRHQAQSLPLGQYGVVRPASTLAMERAVESVQSQLAAVTERLEILESVSPLPSRSYLGASPRG # TPTWGVGRGSPPHESHTEWDLDDLGMWTSVLNPISRAIERLKQLSRFFARNENRSPSMIVLRRLCLDVSFLFCIFGLIRFLWKRSGVRRREVNAALRV # LWRAILGRDERIMIDKGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g537 ### # start gene g538 Scaffold_5 AUGUSTUS gene 2661622 2662068 0.81 - . g538 Scaffold_5 AUGUSTUS transcript 2661622 2662068 0.81 - . g538.t1 Scaffold_5 AUGUSTUS stop_codon 2661622 2661624 . - 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_5 AUGUSTUS CDS 2661622 2662068 0.81 - 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_5 AUGUSTUS start_codon 2662066 2662068 . - 0 transcript_id "g538.t1"; gene_id "g538"; # protein sequence = [MPLALNEFISSWYFGFAEVGPYTLSYVSATPLDSSIVFNTGYLATDNAVLQNQCSVDGSKTTDISIIRPTGEMAGAEG # TIAPSGWTLNYIIDDGTEFEFLIVPTGVNPDIAIYQRWTGLISGGKKGEESYEGVATFEWLNPGLNVYPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g538 ### # start gene g539 Scaffold_5 AUGUSTUS gene 2662656 2665439 0.31 + . g539 Scaffold_5 AUGUSTUS transcript 2662656 2665439 0.31 + . g539.t1 Scaffold_5 AUGUSTUS start_codon 2662656 2662658 . + 0 transcript_id "g539.t1"; gene_id "g539"; Scaffold_5 AUGUSTUS CDS 2662656 2662711 0.32 + 0 transcript_id "g539.t1"; gene_id "g539"; Scaffold_5 AUGUSTUS CDS 2663927 2665439 0.9 + 1 transcript_id "g539.t1"; gene_id "g539"; Scaffold_5 AUGUSTUS stop_codon 2665437 2665439 . + 0 transcript_id "g539.t1"; gene_id "g539"; # protein sequence = [MGEAVMNLGRTGTEVQVRDIYPSSSSTTWAPPPQPTQPDYSAYWAAVQQQQQQQPQAGSYAPQQWPAQPRPPPEQNPL # YANYGYGPQNQWQRQQQQQQQQQQQFHAPPPVVQPPPPPQAAPGYNPYQPAVNYAQPYIPQAPQAMTQIQAPYNSMARPLQVPSQPMFNPHIPPQPVP # SMQQQQQRHVNHASPQHQPPAKRQRFDGPSHNQQPQQRQNGPQQQFQPPLPPNQPSGAFSGGRGGGPGSNQMPLGGRGGRGGNLGNMTRGRGSSMNAG # RGGGMGNRNTRGGASFNVGPNNSGRGGNGAGLRGHNSRGHLGPSKDFHNRRGGGSFNAGAGGSFSHQNPSFRGRGYSHSNSNRPQRHDGNNANVSTKE # SSAPGVVSGKKDENRRTLTDFKMMGLEIPELSWIWGIKHDDDSHAEEIDQSSQATVKMEEDETIIMASADSIESDAKIEPRRSNTAREAEHKETDTDS # KVIVSGSAPHSRIRIYFHTPVSADDSHPIVPNSLSLGTAPSDSRKGKAQKVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g539 ### # start gene g540 Scaffold_5 AUGUSTUS gene 2665486 2665737 0.19 + . g540 Scaffold_5 AUGUSTUS transcript 2665486 2665737 0.19 + . g540.t1 Scaffold_5 AUGUSTUS start_codon 2665486 2665488 . + 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_5 AUGUSTUS CDS 2665486 2665737 0.19 + 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_5 AUGUSTUS stop_codon 2665735 2665737 . + 0 transcript_id "g540.t1"; gene_id "g540"; # protein sequence = [MNDDRSSVAASVTHSVAESGSEADWLMAAITDGEQTQPDPDAEGDEDDDERLHVSEIVEYHDNMSELGEVDDHGGECR # LLCVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g540 ### # start gene g541 Scaffold_5 AUGUSTUS gene 2665779 2666941 0.16 + . g541 Scaffold_5 AUGUSTUS transcript 2665779 2666941 0.16 + . g541.t1 Scaffold_5 AUGUSTUS start_codon 2665779 2665781 . + 0 transcript_id "g541.t1"; gene_id "g541"; Scaffold_5 AUGUSTUS CDS 2665779 2666447 0.16 + 0 transcript_id "g541.t1"; gene_id "g541"; Scaffold_5 AUGUSTUS CDS 2666615 2666941 0.31 + 0 transcript_id "g541.t1"; gene_id "g541"; Scaffold_5 AUGUSTUS stop_codon 2666939 2666941 . + 0 transcript_id "g541.t1"; gene_id "g541"; # protein sequence = [MTHTTNSLSKASQGKDDGAASENHTFSASVDVTANVSEENEANDGKVEGTDNADSISAIGSPSHALVDVHSLSYIDDT # HSMASNTASVFETISHVSVPYASCSHSGEHVDRTERANPQVQPIAAPTENPTKTAASSDSTENTTTTAASSDLQSKSQLESSERGDSEHLPEPPASPV # SNTLLSASSSSTYGDSNSHNSDKDQLATQAPSANRLSISYSNGNRRIVEGLSDVTKSYVPLPFHEKSEQDGSDPTLPPFINDSASTTLTLVAHLDTKR # PLSEPRWVRTGDIQEWLRSMFGRMFWVSGDAADGWEKKITVVDPDPVSSFTCIPTVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g541 ### # start gene g542 Scaffold_5 AUGUSTUS gene 2667556 2668177 0.26 - . g542 Scaffold_5 AUGUSTUS transcript 2667556 2668177 0.26 - . g542.t1 Scaffold_5 AUGUSTUS stop_codon 2667556 2667558 . - 0 transcript_id "g542.t1"; gene_id "g542"; Scaffold_5 AUGUSTUS CDS 2667556 2667818 0.96 - 2 transcript_id "g542.t1"; gene_id "g542"; Scaffold_5 AUGUSTUS CDS 2668123 2668177 0.26 - 0 transcript_id "g542.t1"; gene_id "g542"; Scaffold_5 AUGUSTUS start_codon 2668175 2668177 . - 0 transcript_id "g542.t1"; gene_id "g542"; # protein sequence = [MAFNRPVPVNRLVSAIADSSLEDLIKHGLHALRETLQQDKDLNVNNTSIGIVGAPSVHENTTGISFRILEGETIQPFL # DTMVPKDVPATAPAPAATTDEDVQMTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g542 ### # start gene g543 Scaffold_5 AUGUSTUS gene 2671744 2672199 0.72 - . g543 Scaffold_5 AUGUSTUS transcript 2671744 2672199 0.72 - . g543.t1 Scaffold_5 AUGUSTUS stop_codon 2671744 2671746 . - 0 transcript_id "g543.t1"; gene_id "g543"; Scaffold_5 AUGUSTUS CDS 2671744 2672199 0.72 - 0 transcript_id "g543.t1"; gene_id "g543"; Scaffold_5 AUGUSTUS start_codon 2672197 2672199 . - 0 transcript_id "g543.t1"; gene_id "g543"; # protein sequence = [MEWGHRVLGRLIGVAFVGPLVFFAVKKRISKPLANKLGGLALLIGAQGGLGWYMVKSGLDDALMETPGAVPRVSQYRL # AAHLGLALLLYAGMFSSGLAIVKEWKYATGAQWMGLTTSAFNEALNSPAVMRFKARSWVLTGLIFLTALSGKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g543 ### # start gene g544 Scaffold_5 AUGUSTUS gene 2677207 2678067 0.76 + . g544 Scaffold_5 AUGUSTUS transcript 2677207 2678067 0.76 + . g544.t1 Scaffold_5 AUGUSTUS start_codon 2677207 2677209 . + 0 transcript_id "g544.t1"; gene_id "g544"; Scaffold_5 AUGUSTUS CDS 2677207 2678067 0.76 + 0 transcript_id "g544.t1"; gene_id "g544"; Scaffold_5 AUGUSTUS stop_codon 2678065 2678067 . + 0 transcript_id "g544.t1"; gene_id "g544"; # protein sequence = [MSVKSPVSPAPPTPNVISTSTEAPNSPTVSSDAVHPGVPNGTSEGSPVLIAESTAAVTAPFEPSTHTPANAAPSSPQE # PSVDSAPSTETEVPPSEDSRSIEASTHTPAVAPATLSSEPSVDTPPATSAGPSVEASTHGPVVVPPSADADFNTTHVVTPTSTPAVEAVTTAIAVPTT # AASNDTEAASSVEPTTPTKKVFPVNGTGDLNASTPAGSPAPRASTSSILSTPSKRNSRILSFPSRGTPTPESSPSSKFDSPSIRAKRKSIFGKMSIKN # IFGKDKEKEKEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g544 ### # start gene g545 Scaffold_5 AUGUSTUS gene 2679563 2679850 0.39 - . g545 Scaffold_5 AUGUSTUS transcript 2679563 2679850 0.39 - . g545.t1 Scaffold_5 AUGUSTUS stop_codon 2679563 2679565 . - 0 transcript_id "g545.t1"; gene_id "g545"; Scaffold_5 AUGUSTUS CDS 2679563 2679850 0.39 - 0 transcript_id "g545.t1"; gene_id "g545"; Scaffold_5 AUGUSTUS start_codon 2679848 2679850 . - 0 transcript_id "g545.t1"; gene_id "g545"; # protein sequence = [MDIALQSLSTLHRQITILDAPGHKDFIPNMISGASQADCALLVVDAAIGEFEAGFDRGGQTREHILLVRSLGVSQVIV # AVNKLDQVRSYSNIPFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g545 ### # start gene g546 Scaffold_5 AUGUSTUS gene 2681084 2682626 0.23 - . g546 Scaffold_5 AUGUSTUS transcript 2681084 2682626 0.23 - . g546.t1 Scaffold_5 AUGUSTUS stop_codon 2681084 2681086 . - 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_5 AUGUSTUS CDS 2681084 2682159 0.59 - 2 transcript_id "g546.t1"; gene_id "g546"; Scaffold_5 AUGUSTUS CDS 2682275 2682626 0.32 - 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_5 AUGUSTUS start_codon 2682624 2682626 . - 0 transcript_id "g546.t1"; gene_id "g546"; # protein sequence = [MQKYGDDTNDFGLGGRSRMPLIHLAQQQQQMMEQQQRQQQWEVQRQQMLQEEPEQITVEELHEEDNGNVDDESTRRLS # TISERTERTELSPYWPRRDYLPPPRTVSTFTDSSYGNLIVSPSGSAVHRLSTYEPAPSIASSGSYTQSSPPHPPSEAVPPLDTIPDIPDSHSSVVPPP # LPPKPTNQSSSTKQTSSVQQPSSPAPSSQPRAKQSKLAQLASSRASTRTKSSASLGTEVAGSIKTYPALRPESHRPPSSISTSTSTSNSTALPVPPPD # LRSIPRVPSSSGSITTPVSSPSQRSDRPRDTITSSLPSSTSLKVRQAVDAALELEALDRELAASRKTRRTHLEKKLPTDQSELNTPTRPPASTSPKVA # AGVPRNSTTSLSTRPTSKLVLLAQAKAQKAEAQHTISKAPLARPPPPNHLPPEHTEYLTPIANGSSVTTAITTSYQTLTVSLIRLDPRPWRLRCGAPR # RPKLY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g546 ### # start gene g547 Scaffold_5 AUGUSTUS gene 2688605 2690275 0.87 + . g547 Scaffold_5 AUGUSTUS transcript 2688605 2690275 0.87 + . g547.t1 Scaffold_5 AUGUSTUS start_codon 2688605 2688607 . + 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_5 AUGUSTUS CDS 2688605 2689681 0.87 + 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_5 AUGUSTUS CDS 2689739 2690275 1 + 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_5 AUGUSTUS stop_codon 2690273 2690275 . + 0 transcript_id "g547.t1"; gene_id "g547"; # protein sequence = [MVCQSLLETNVSLNCLDIDNYNPLVYATLRGSVDCVKVLLDHGNASPQPTTPNGDLIPLSLASQSGHVDVVQLLLERG # AQCLANSNGEYPIHLAARAGHVDVCKLLLNHIGWDVPDKYHEWTPLFHAARYGRDQCVRVLIDAGARVNLADELGHFAMHYAAWYGHYQCLTYLIEES # ACVPLLPINTKILERSPGSDDPMSVESEIDLIPSLSLPPPIMPHRVYGHNYLDRSHLVQVSIGHSLGQNRDFSGVRLHHRLISPAFRDEYLLTTAPLK # LVMTTAPQVTSAPYSISLPPQDESGVFIFQTPSLDSLTLEFSVYPNFGTKTIGCAVALPSLFAGMESNEAFTLPILDQRLHIVGEVSFEINIISSFDG # VTLEVGGDVETYWKSTGISIIPHSLSPWPQRSYLIGSAQTSPSSQSLSTTSSQASTISSVRGKFLTVVIQVTRDLQPVVYTDWLLPDSDFDLSVCDVT # LEQFESLAKRSGRNIDEMTVLPSSNLPALISQAMMSLVRLLKVISLCILSIAIAILLPLSVRFSPPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g547 ### # start gene g548 Scaffold_5 AUGUSTUS gene 2692303 2693805 0.87 - . g548 Scaffold_5 AUGUSTUS transcript 2692303 2693805 0.87 - . g548.t1 Scaffold_5 AUGUSTUS stop_codon 2692303 2692305 . - 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_5 AUGUSTUS CDS 2692303 2693805 0.87 - 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_5 AUGUSTUS start_codon 2693803 2693805 . - 0 transcript_id "g548.t1"; gene_id "g548"; # protein sequence = [MWGPTLDSARPVAFDSAQFSGPELNYPVHEKELLAIVRSLRKWRADCLGMHIHVLTDHRTLENFETQKDLSRCQLRWQ # EELSQFDLEIAYIAGEKNSAADALSRIKAGALPSDSIASQSSEEATHCVEAWKSNPFVCSSVLSLSADATFLKQIQEGHESDPFVKKLVEGGSLVPGI # ERKNGLWFLDNRLIIPDYLSLREDLFHLAHDTCGHFGADKSYSMLADSYYWPNMRRDLCKHYIPGCEDCQRNKGRTAKNGKGPLHPLPVPEACCDSVA # MDFIGPLPLDQGFNCILTMTDRLGSDLKIIPTTVDITAPALARLVFDTWYCDNGLPLEWVSDRDKLFVSEFWSVLNKLSGVKIKMSSSFHPETDGSSE # RSNKTVNQAIRFYVERNQIGWVNALPKIRFDIMNSVNASTGLSMFQLRYGRSPRVLPHIVPDSDFKRSNPSQIASDAHSLLVDIATTVREARDNLTLA # KVVQAYQADKNRGPCELFKAGDLVMLSTWH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g548 ### # start gene g549 Scaffold_5 AUGUSTUS gene 2701185 2701864 0.66 + . g549 Scaffold_5 AUGUSTUS transcript 2701185 2701864 0.66 + . g549.t1 Scaffold_5 AUGUSTUS start_codon 2701185 2701187 . + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_5 AUGUSTUS CDS 2701185 2701256 0.66 + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_5 AUGUSTUS CDS 2701355 2701864 0.66 + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_5 AUGUSTUS stop_codon 2701862 2701864 . + 0 transcript_id "g549.t1"; gene_id "g549"; # protein sequence = [MSATSTERPSSSKPNQRNKRAPYLSFGDETASNIRTPEGRQPEVQGPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFA # YSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAVSEQSRTSSRRLPTPPVHLPSSPETRKFTLQSPE # EPSYEYAQLGAYTRNTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g549 ### # start gene g550 Scaffold_5 AUGUSTUS gene 2703537 2704544 0.82 + . g550 Scaffold_5 AUGUSTUS transcript 2703537 2704544 0.82 + . g550.t1 Scaffold_5 AUGUSTUS start_codon 2703537 2703539 . + 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_5 AUGUSTUS CDS 2703537 2704544 0.82 + 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_5 AUGUSTUS stop_codon 2704542 2704544 . + 0 transcript_id "g550.t1"; gene_id "g550"; # protein sequence = [MREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPE # GGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRG # ELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKD # KCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRSWPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g550 ### # start gene g551 Scaffold_5 AUGUSTUS gene 2715930 2716424 1 + . g551 Scaffold_5 AUGUSTUS transcript 2715930 2716424 1 + . g551.t1 Scaffold_5 AUGUSTUS start_codon 2715930 2715932 . + 0 transcript_id "g551.t1"; gene_id "g551"; Scaffold_5 AUGUSTUS CDS 2715930 2716424 1 + 0 transcript_id "g551.t1"; gene_id "g551"; Scaffold_5 AUGUSTUS stop_codon 2716422 2716424 . + 0 transcript_id "g551.t1"; gene_id "g551"; # protein sequence = [MAPSHSDLLAESLSKLETCQNQANGKADSGHPEGNSVSIGTPRIHEGYGFRPPSGISTPLIASASAASESLVPDSNGL # GWPGKSVIYNRISPEYCPAKSTYSRLTATNEEKAAREKKLAEAVRTILDCIGEDPNREGLLKTPERYAKAVMWMTKGYEDRLTGAM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g551 ### # start gene g552 Scaffold_5 AUGUSTUS gene 2717186 2718764 0.16 - . g552 Scaffold_5 AUGUSTUS transcript 2717186 2718764 0.16 - . g552.t1 Scaffold_5 AUGUSTUS stop_codon 2717186 2717188 . - 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_5 AUGUSTUS CDS 2717186 2717746 0.88 - 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_5 AUGUSTUS CDS 2717796 2717963 0.35 - 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_5 AUGUSTUS CDS 2718075 2718764 0.19 - 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_5 AUGUSTUS start_codon 2718762 2718764 . - 0 transcript_id "g552.t1"; gene_id "g552"; # protein sequence = [MSVEPKETTLHPPPSPPLGNERAIEESGPHVLPTMPPPSEPSQKPSAQELRVTAAQSRSDKTDDKNGRSNESPRATNG # SAAASPRHRSASPSTRPGTRNHSTESRTSAGRSRSERDKVELSGDKREREHGPRRDSLTHNRSDRSGRERTTTGDSDRDRERRDRHGDKERDRDRDRE # KERDREKDRDRHGDRHRRDDKNHTRDARKDRDGRTAESGNQAAVADPRVQTRPDADRGSKRSSRKDAHREERSRRPGDKIERDRNERPRDSDRRRRDG # ENPDNRADSSEKQVEGKRPPEGPQGETKRVERLDIPLRSGLKPPFPPNTPSAPRAMSSSDARNSGKADNGSGRRDNTSGTNSVPVEGVWVVYVPGLAT # RKLVPDRHPIMDNQEKTTETPEKDHLMVCRCPQTCSSRLTLYLIDREKDTLETSSQGPEQSTSKRLKLNRNRYIGESANMAKKTLPINPQAGDRLQGR # KD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g552 ### # start gene g553 Scaffold_5 AUGUSTUS gene 2720160 2720886 0.76 - . g553 Scaffold_5 AUGUSTUS transcript 2720160 2720886 0.76 - . g553.t1 Scaffold_5 AUGUSTUS stop_codon 2720160 2720162 . - 0 transcript_id "g553.t1"; gene_id "g553"; Scaffold_5 AUGUSTUS CDS 2720160 2720474 0.98 - 0 transcript_id "g553.t1"; gene_id "g553"; Scaffold_5 AUGUSTUS CDS 2720659 2720886 0.76 - 0 transcript_id "g553.t1"; gene_id "g553"; Scaffold_5 AUGUSTUS start_codon 2720884 2720886 . - 0 transcript_id "g553.t1"; gene_id "g553"; # protein sequence = [MQEQERLANEEAEKRLKAALTAKREPSVIQSRIASPMPSMSRELASEAKPMPDILSTSEYVSMEVDASSAAPAAPEAG # FLCHVLAAVYLRSLPPGARYDEEISALRSLSRQEDSKYIAYDKSSDRSKRILASSHRIKRERFNSFASTLLQEFKEQTTSRAFTVKRLAREKTHWFTT # GNLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g553 ### # start gene g554 Scaffold_5 AUGUSTUS gene 2722916 2724167 0.33 - . g554 Scaffold_5 AUGUSTUS transcript 2722916 2724167 0.33 - . g554.t1 Scaffold_5 AUGUSTUS stop_codon 2722916 2722918 . - 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_5 AUGUSTUS CDS 2722916 2723531 0.97 - 1 transcript_id "g554.t1"; gene_id "g554"; Scaffold_5 AUGUSTUS CDS 2723588 2723712 0.86 - 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_5 AUGUSTUS CDS 2723760 2724167 0.39 - 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_5 AUGUSTUS start_codon 2724165 2724167 . - 0 transcript_id "g554.t1"; gene_id "g554"; # protein sequence = [MLIAPHCNPSDAECHNVLETTYSTLLASTLTMWTYKQTLSAEGFVTFIRSVLDNLPSTSSPNRTSNFAIFGEHLVDLI # WSVDAELDEVLVDVKATIAAYDGQSADKPQAVLGKANRVKQSAEADKATIVLIVKKLLQYGVLSANVCRERLDTAILEGVGLMVKANLDKKEIRTRTG # LFYKQNKFNLLREQSEGYSKLTVELTSALGIGHLPSTGRPQDPYDSIQHRAHAVWGKIIGLIGFFDLDPNKALDILLDVMSVNLASHYTFFLALLSFS # PWARSPLQHDQLPLSEGQFKGKTLDEILELVNPRRMSSEKDINGGSRVLAQILGFKLNYYQPAEAHEPPKSLYLTAAILIREGFVALEDLYPHVRRCS # LKIVTLEFNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g554 ### # start gene g555 Scaffold_5 AUGUSTUS gene 2726106 2727157 0.45 + . g555 Scaffold_5 AUGUSTUS transcript 2726106 2727157 0.45 + . g555.t1 Scaffold_5 AUGUSTUS start_codon 2726106 2726108 . + 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_5 AUGUSTUS CDS 2726106 2726674 0.45 + 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_5 AUGUSTUS CDS 2726731 2727157 1 + 1 transcript_id "g555.t1"; gene_id "g555"; Scaffold_5 AUGUSTUS stop_codon 2727155 2727157 . + 0 transcript_id "g555.t1"; gene_id "g555"; # protein sequence = [MDFLVNRKHKALTPDATNELDDLSQVPTSQSQEVEIDLYVHRKGVSLAADAITSDELFDLSQVPTSQSQEVEVDLSMY # RKYNAKEHHSHPPSDEIVPCSQSQDFDGIFLEAVSPRRKRVLRELEQARQVATATDLSSGSGSRTSPTGCDERYNRLLEPFFLETNLVPSQSVFHSPV # EVQSMTDEAIKSLIENTIPYAAQEAISESPNIERPESNHAMVPINDEDIQSLFESEGLPITDNVINGRDGTKVELPSMPPSQAASVTESDSGDEQWMM # QGLNTDARRPVLTSEVSRDPARPLTQREVQSWQTDVSAYSYPRDVLDFLDMLEGGPD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g555 ### # start gene g556 Scaffold_5 AUGUSTUS gene 2732149 2733922 0.57 + . g556 Scaffold_5 AUGUSTUS transcript 2732149 2733922 0.57 + . g556.t1 Scaffold_5 AUGUSTUS start_codon 2732149 2732151 . + 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_5 AUGUSTUS CDS 2732149 2733273 0.57 + 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_5 AUGUSTUS CDS 2733335 2733922 1 + 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_5 AUGUSTUS stop_codon 2733920 2733922 . + 0 transcript_id "g556.t1"; gene_id "g556"; # protein sequence = [MLREKDRYNQSRYDNDPDLRIARERDAASAATSLQRRSSFNQGYPTPSSVGFPPTGANPGGYPPGFATSDRLGYGGAG # GYPSSVNAPSPGMGYQRERKYSVGGGLSEQFADLGIDHDDRLPNAPLTRPRKYSTHEAVAERARRMSGNFGVERPSSAYGNAPGAYPVPTASSNAGFR # AGVPYSNPSPGLRSVEPSYMQAPRPSSPYATSNYPPMSASQDPYGARAASPYHRAASPFGRSTSPFAAGGGDVYPPGHIMEGRPIGSGARSRATTPIP # GMPPGMPASVAFPSTAGPYPQPGMSNNMSPHMSPMMAGVPTSGTLAAPECFSRPINAAHPYTPFEPMKIQDMDLFLESLPRMPIVLQTHDVYNADWTR # LMDDVRLAWAGRLPTPGTSVNGRPPKRATLVAKLIELWNHSFFERRGVELVLYKGRERRSGSQYGAFDIPHDEFDDDTSSSSDSDSGSSGEDDQPPTG # FYGGYPPEMPDARQRRRAAKAEKRRRRKEKKYRRRQREKRYSLWLTRLPQGGPGGYMSTTGSVTPSTFPPHSPVMPGSAFRGPSPGPGYTSSYPGMMQ # QV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g556 ### # start gene g557 Scaffold_5 AUGUSTUS gene 2734109 2735545 0.4 - . g557 Scaffold_5 AUGUSTUS transcript 2734109 2735545 0.4 - . g557.t1 Scaffold_5 AUGUSTUS stop_codon 2734109 2734111 . - 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_5 AUGUSTUS CDS 2734109 2735065 0.66 - 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_5 AUGUSTUS CDS 2735120 2735545 0.4 - 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_5 AUGUSTUS start_codon 2735543 2735545 . - 0 transcript_id "g557.t1"; gene_id "g557"; # protein sequence = [MDIKFEIGQPFKPYEQLMGFFQRQGECLVFFDFCDQFIENSRKHIPEPFHHLMTDDDSPIIDFYPSTFEIDMNGKRMA # WQGVALLPFIDPVRLLEAMKEPYTKLTEDEIRRNTWGNNSIFTSDAHPIHPFYEQLYGKRRPKEPLQIDHNLTKGVSGSVLPNPECLPGSTYLTPLVE # QNLPDIKNDRSLSVFYFFPKQLTPHRSVLLPGVTRSPRMLSANDLEHARNGGRGRGRGSGYDRGGRDRGGNDRNDPFHSRPPNYGNGRGNSREPYRGQ # YRGDNGSYNDRGRGRPSPNNSYSNGYGNGRDVSSASNNSYGGYGGYGGGPARDYGNGPTGGYGSAPTGGYGVGNVRGGYGGTSRGYSGSAGNAGGGGA # RDYEGYGGYGNAGGAGGGPAAYRNNGGYGNAGGNFPGASRGRGSYGDDNHSRYPANGYTNPSHGNGGYSNATQGGPYNTPSRGRGRGW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g557 ### # start gene g558 Scaffold_5 AUGUSTUS gene 2735764 2736902 0.25 - . g558 Scaffold_5 AUGUSTUS transcript 2735764 2736902 0.25 - . g558.t1 Scaffold_5 AUGUSTUS stop_codon 2735764 2735766 . - 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_5 AUGUSTUS CDS 2735764 2736722 0.65 - 2 transcript_id "g558.t1"; gene_id "g558"; Scaffold_5 AUGUSTUS CDS 2736794 2736902 0.25 - 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_5 AUGUSTUS start_codon 2736900 2736902 . - 0 transcript_id "g558.t1"; gene_id "g558"; # protein sequence = [MGGYVTNHGRLELPRVQIILEGLAKREDDIFRRRREGEERQEANAKRRKLEEENSKNGFTAGPSSSLSLTASTSSLTN # NTTVAHPSLPPRPDFAARADSIGLGAKPNAESIQNIPAATQALAGSNHDVVANRRAIRMANMSAAEVLKAELAGLVPVKPTASNVDNVPNVLLPSGPE # PSMIISDATATPSVDITMTVDSEDEVPGFGAQSVTDENAPSVSTDFDIPFSEKNNVGTFENGTVGADDVEADPNLAGTKRKLDEMNIEETDETVVVDD # DEPPVDGPHSSLAFKVNPDGTVSQEDTVKCVALSMDGLRLLIQSELDFRLWEPGYRDRYYRQKFDVEPNDKEFRRQYVFNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g558 ### # start gene g559 Scaffold_5 AUGUSTUS gene 2738764 2739018 0.69 - . g559 Scaffold_5 AUGUSTUS transcript 2738764 2739018 0.69 - . g559.t1 Scaffold_5 AUGUSTUS stop_codon 2738764 2738766 . - 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_5 AUGUSTUS CDS 2738764 2739018 0.69 - 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_5 AUGUSTUS start_codon 2739016 2739018 . - 0 transcript_id "g559.t1"; gene_id "g559"; # protein sequence = [MYVSFDLMAWGFGKPKCEKMRRPRDFGLSDEPSVPPAPSRMFVGASFDVDAAAEGVLFDSEIGFLGVADPFGLEEDDP # VVPDTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g559 ### # start gene g560 Scaffold_5 AUGUSTUS gene 2742282 2743589 0.99 + . g560 Scaffold_5 AUGUSTUS transcript 2742282 2743589 0.99 + . g560.t1 Scaffold_5 AUGUSTUS start_codon 2742282 2742284 . + 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_5 AUGUSTUS CDS 2742282 2743589 0.99 + 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_5 AUGUSTUS stop_codon 2743587 2743589 . + 0 transcript_id "g560.t1"; gene_id "g560"; # protein sequence = [MERCGGDRGKGFFWSLDEAHQHTLESQDSKLLSGAAEQASKSRKKDKTLEPPLKRSVKGDTKGVLPPPLNSTPLPMQN # SSDSSAATTTTISHYNVSSSSTAQTSTLPQRSSMVSTPITSAGAATSPYSALTQPWNIFARPNTDVLTFTPSLSTALSAPAITTFNIPTAPATSTNLT # SVPVTSTSSLVTVPASLLPTSVTVPSLSVSTSTMPKKLAPSVPDIAIPIVLGPVPPTHPSYSASHPNNSAKEGYMILHERKLILDPDVFSSLTKEMLV # ELEKMGASKAIEILTGHLVRVLKERRKNRKSARGRGRGGKGAGGPGRKSATAGTTVKPSSSVPAASTSLSSAQTCDVSDVPATMVVETSLAANPNPLI # PVPIMQAPVGDPGSPIVVVDSDDDGPATKKRKLGEGPSSPFVDLVVLKPVVPTFGASLTTIQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g560 ### # start gene g561 Scaffold_5 AUGUSTUS gene 2744023 2745309 0.89 - . g561 Scaffold_5 AUGUSTUS transcript 2744023 2745309 0.89 - . g561.t1 Scaffold_5 AUGUSTUS stop_codon 2744023 2744025 . - 0 transcript_id "g561.t1"; gene_id "g561"; Scaffold_5 AUGUSTUS CDS 2744023 2745309 0.89 - 0 transcript_id "g561.t1"; gene_id "g561"; Scaffold_5 AUGUSTUS start_codon 2745307 2745309 . - 0 transcript_id "g561.t1"; gene_id "g561"; # protein sequence = [MHSVPSEVYSHSRPATPPPPHVKDEKDEPATNDSTSTSTSLSIDLQDETTVAEVTDILVTSERFDDVQIPHTTGIKPL # FGGSVPDVEYLPTPRNTPPSPNTLSTPSTFISCLAGKTSSPHESRVLSINQSSHPPPPHLSISSDSSSSNLDLLPSSRNFPQTSNSAKISKRRRQAPA # SSLTSPSRSCIGKRLSFGQTSLCSQTTANVEPTRRPEPETVRSSGVKKEQVVKKEEAVKEKCKEEKVVKKETTARELVKKEKAQEVKEEKVAKHEEKS # VKREKVVREEKHVIREKRMKRRLDLIPSERNAARNPRPEKRHRLFLNEIHVNLWINDIQRISYLDKSYQVLDHIDGLKLFNVLVDIEERRFEVTLELL # GAGNPSLAKSLGQLRKHRTRYDTMFDLKIRYKASQLVDYFAQKYNVANPHDGGRQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g561 ### # start gene g562 Scaffold_5 AUGUSTUS gene 2747836 2748246 0.58 - . g562 Scaffold_5 AUGUSTUS transcript 2747836 2748246 0.58 - . g562.t1 Scaffold_5 AUGUSTUS stop_codon 2747836 2747838 . - 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_5 AUGUSTUS CDS 2747836 2748246 0.58 - 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_5 AUGUSTUS start_codon 2748244 2748246 . - 0 transcript_id "g562.t1"; gene_id "g562"; # protein sequence = [MQQYLPSVGPTPESLSRPRRNAVDISALTSNTRTSPIPSRFGRRNAIDYTSSLVKSDWWHAGQPHAFVPRHNYGANPA # VPFGSAEQVQAGVAMSELENHQDLNHSSALITSFLPRDWMPKRPFVRLVINVSGTSPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g562 ### # start gene g563 Scaffold_5 AUGUSTUS gene 2751542 2752003 0.48 - . g563 Scaffold_5 AUGUSTUS transcript 2751542 2752003 0.48 - . g563.t1 Scaffold_5 AUGUSTUS stop_codon 2751542 2751544 . - 0 transcript_id "g563.t1"; gene_id "g563"; Scaffold_5 AUGUSTUS CDS 2751542 2751823 0.81 - 0 transcript_id "g563.t1"; gene_id "g563"; Scaffold_5 AUGUSTUS CDS 2751923 2752003 0.53 - 0 transcript_id "g563.t1"; gene_id "g563"; Scaffold_5 AUGUSTUS start_codon 2752001 2752003 . - 0 transcript_id "g563.t1"; gene_id "g563"; # protein sequence = [MLYAQKINDLWDMTVGWRSGWKTFAKESTPTSPISTSFNTMSPSTIPFTSTLRQTSRSSYTSVITEATFPRRPDASAA # TDLAMTFKDALSLSPPTGPPPALSVASINKPEISRSIKLVCG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g563 ### # start gene g564 Scaffold_5 AUGUSTUS gene 2752245 2752958 0.71 - . g564 Scaffold_5 AUGUSTUS transcript 2752245 2752958 0.71 - . g564.t1 Scaffold_5 AUGUSTUS stop_codon 2752245 2752247 . - 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_5 AUGUSTUS CDS 2752245 2752958 0.71 - 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_5 AUGUSTUS start_codon 2752956 2752958 . - 0 transcript_id "g564.t1"; gene_id "g564"; # protein sequence = [MDAPDATKSAHRREGAFSPSSEDTAAQFVTINVAEAETVIPPSLRRVDQHIQPIHDNVIESGTSITEVHPLKPPAFAS # SISAGSSSSSFGTVQSVGFGNATDQLQPGVTANPIQEDAWVDVHTVERSPSFEASVEHPRLSAEHSHHTRTIASHATSQSLSVDEHTTTTSVSRSSSV # SPALPRSHSPSINSQADSRSSSLSPAPSPPPKKFPTLNHNWSKADEPTAHSFREEFGPNIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g564 ### # start gene g565 Scaffold_5 AUGUSTUS gene 2755787 2756803 0.74 + . g565 Scaffold_5 AUGUSTUS transcript 2755787 2756803 0.74 + . g565.t1 Scaffold_5 AUGUSTUS start_codon 2755787 2755789 . + 0 transcript_id "g565.t1"; gene_id "g565"; Scaffold_5 AUGUSTUS CDS 2755787 2756803 0.74 + 0 transcript_id "g565.t1"; gene_id "g565"; Scaffold_5 AUGUSTUS stop_codon 2756801 2756803 . + 0 transcript_id "g565.t1"; gene_id "g565"; # protein sequence = [MVLLPVACIRYRGDESAYGSTPISLYFHSMFIFNRTPNLIYFALSLSGACREELGYDPTVRRVQGKDRTGPCYIFTID # GKQYITTEAITVRKAKFLLGCAARVFKVQQVLNDEGDLDTEVKVIKDYWLPEDSCTELEIRLAIEANVQKVNVVPNLDRSAFNKYFVRIEACEKVPVP # STTEKGQTPDSTSNFIRGQTLPSDIKRFTVSTQSSTYQRVMSVSIPASIMMESGAERQRRQETVIREATATHLARLDRRTYAPKVHCRQLSEYAGKPL # DQMMDWDIILKALESLIIGKLVHPLLAVNLNYSPSSFIYAFCWLCSSRHQRCECVGKRWECQAY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g565 ### # start gene g566 Scaffold_5 AUGUSTUS gene 2756943 2757479 0.42 + . g566 Scaffold_5 AUGUSTUS transcript 2756943 2757479 0.42 + . g566.t1 Scaffold_5 AUGUSTUS start_codon 2756943 2756945 . + 0 transcript_id "g566.t1"; gene_id "g566"; Scaffold_5 AUGUSTUS CDS 2756943 2757479 0.42 + 0 transcript_id "g566.t1"; gene_id "g566"; Scaffold_5 AUGUSTUS stop_codon 2757477 2757479 . + 0 transcript_id "g566.t1"; gene_id "g566"; # protein sequence = [MTDRYLFRPPTHKFNFERVPSFPFWYHYIHDIESVLWVFTYFLLTKWPASESPPSEEQQNARDEFFSRAFIFGKRKEF # IDGDMDMNNRAVASTLPNFYSDWAWASHFAEVVKKKCCALQQSLPIDFKNAFHPSLCSDFQQAFIHCATEGWTGAVTHRGRAKQSAEDDSEKETKKSK # VT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g566 ### # start gene g567 Scaffold_5 AUGUSTUS gene 2759289 2759804 0.43 - . g567 Scaffold_5 AUGUSTUS transcript 2759289 2759804 0.43 - . g567.t1 Scaffold_5 AUGUSTUS stop_codon 2759289 2759291 . - 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_5 AUGUSTUS CDS 2759289 2759804 0.43 - 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_5 AUGUSTUS start_codon 2759802 2759804 . - 0 transcript_id "g567.t1"; gene_id "g567"; # protein sequence = [MSSKKTDREKTVIVIVGGGIGGLALLNALSASINPEKHTVVLVDARPAHMHLISSLRLIVSDADDLLKQAVHPYGDHT # FRNKFAGNGSFVHGSVTSVKFGDGGKGGQLILDSGEVVDYDLLVLATGSSWPRPLGFPTESKSAIENHIMARRAEFAEAKDILLVGGGSVGIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g567 ### # start gene g568 Scaffold_5 AUGUSTUS gene 2762742 2763059 0.53 + . g568 Scaffold_5 AUGUSTUS transcript 2762742 2763059 0.53 + . g568.t1 Scaffold_5 AUGUSTUS start_codon 2762742 2762744 . + 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_5 AUGUSTUS CDS 2762742 2763059 0.53 + 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_5 AUGUSTUS stop_codon 2763057 2763059 . + 0 transcript_id "g568.t1"; gene_id "g568"; # protein sequence = [MSMRFPVVGAMPMSPDESFDVDENGNVDWRLAWLKEIGHLQQVTAEQEKAGADPEWYRMMLVRVRTALMPPMMNPEAM # HMAPMVPPNGTVDPSQQSAQPQQQQSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g568 ### # start gene g569 Scaffold_5 AUGUSTUS gene 2764125 2764418 0.74 - . g569 Scaffold_5 AUGUSTUS transcript 2764125 2764418 0.74 - . g569.t1 Scaffold_5 AUGUSTUS stop_codon 2764125 2764127 . - 0 transcript_id "g569.t1"; gene_id "g569"; Scaffold_5 AUGUSTUS CDS 2764125 2764418 0.74 - 0 transcript_id "g569.t1"; gene_id "g569"; Scaffold_5 AUGUSTUS start_codon 2764416 2764418 . - 0 transcript_id "g569.t1"; gene_id "g569"; # protein sequence = [MVVRMSGQEEEERAEKDDGRAQNGLTLLGAYADSDEETKVEMDSDEEDEDVAEVSPEVLLELMKKAQSGNSWMDDSKD # DDRVDWGDGDSEAEQEEEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g569 ### # start gene g570 Scaffold_5 AUGUSTUS gene 2768697 2770437 0.32 - . g570 Scaffold_5 AUGUSTUS transcript 2768697 2770437 0.32 - . g570.t1 Scaffold_5 AUGUSTUS stop_codon 2768697 2768699 . - 0 transcript_id "g570.t1"; gene_id "g570"; Scaffold_5 AUGUSTUS CDS 2768697 2769044 0.99 - 0 transcript_id "g570.t1"; gene_id "g570"; Scaffold_5 AUGUSTUS CDS 2769096 2769510 0.34 - 1 transcript_id "g570.t1"; gene_id "g570"; Scaffold_5 AUGUSTUS CDS 2770376 2770437 0.77 - 0 transcript_id "g570.t1"; gene_id "g570"; Scaffold_5 AUGUSTUS start_codon 2770435 2770437 . - 0 transcript_id "g570.t1"; gene_id "g570"; # protein sequence = [MFGLQEIPTALVSKADSPENKSGSISNHIEGLHPGPELSGIIRPIGTPNIVEADVFPPARSQAPDPSIFLPYIPEDIS # FEEEYEEYISDLGWTDEQTDGSSFGSASAWARFPEEFAADITDGISDSESIVTIGDLGDETRLDPSRDDPDVVDENLNNWEHMSPKTMAALPKSPAGR # SPASRSPAGRSPADKRRSSSGGGLRPVKPFGLDDEDGVVLDDEDEDGEEEEVLHAPRELSAFAAGEGVDEVEYAYGLVVFISQMIGQKLNFLQSVRQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g570 ### # start gene g571 Scaffold_5 AUGUSTUS gene 2770903 2771208 0.55 - . g571 Scaffold_5 AUGUSTUS transcript 2770903 2771208 0.55 - . g571.t1 Scaffold_5 AUGUSTUS stop_codon 2770903 2770905 . - 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_5 AUGUSTUS CDS 2770903 2771208 0.55 - 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_5 AUGUSTUS start_codon 2771206 2771208 . - 0 transcript_id "g571.t1"; gene_id "g571"; # protein sequence = [MWRTREDCMTHESGLEHLPGSEGEFASSTFTNPSAQYDSVKEDPEAAELLPDLALLDVKIAEATAALENAGTASEKRK # AKERREDLMRLKRVEQIYVSFVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g571 ### # start gene g572 Scaffold_5 AUGUSTUS gene 2776867 2777835 0.51 + . g572 Scaffold_5 AUGUSTUS transcript 2776867 2777835 0.51 + . g572.t1 Scaffold_5 AUGUSTUS start_codon 2776867 2776869 . + 0 transcript_id "g572.t1"; gene_id "g572"; Scaffold_5 AUGUSTUS CDS 2776867 2777835 0.51 + 0 transcript_id "g572.t1"; gene_id "g572"; Scaffold_5 AUGUSTUS stop_codon 2777833 2777835 . + 0 transcript_id "g572.t1"; gene_id "g572"; # protein sequence = [MANHIDVDPARIPCPNFSSNLYEVIRKALIADANTPDITNDEQAILQLRGQWEAENTILRAQYQAQLHEEQTANEQWG # AEEEEFSRQREAKEREKEAEIAKEIEKKRTPLPNFQQGVGHHSVPHHYHPYAEKLTTARKYVPLWYFLSDAEKEAKERMREVVDNNRFEFASDPTEAS # NSSLTLVSTTSIRASPNAIPDIQLTWNQVMRSKSGFLSSLSLGAFPSRHINMFAQFFANMEMHPELRKTNGERTMALYQAETRLSWYKENEKGAPFDL # AVIMEETLNECRNEIRSQDHAKALKGMFPPPLLTTEHPTNCHLPPPPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g572 ### # start gene g573 Scaffold_5 AUGUSTUS gene 2778235 2778777 0.87 + . g573 Scaffold_5 AUGUSTUS transcript 2778235 2778777 0.87 + . g573.t1 Scaffold_5 AUGUSTUS start_codon 2778235 2778237 . + 0 transcript_id "g573.t1"; gene_id "g573"; Scaffold_5 AUGUSTUS CDS 2778235 2778777 0.87 + 0 transcript_id "g573.t1"; gene_id "g573"; Scaffold_5 AUGUSTUS stop_codon 2778775 2778777 . + 0 transcript_id "g573.t1"; gene_id "g573"; # protein sequence = [MHQTFRDPFVRQTNRSYRGATGALAETDMTSVDAHAPHFGTGSKGSSATGTKAGTWKSQRAHTRDSNYAQTGSALMAA # PAKRTQRNIDAQAVPTPVTVLRAALKASETHIHTPLVAGAWHKALSELGLLSKYPTLLNSICHGFKIGILLIYHTFSPPNKLQDLESIRAFESIAENE # ISLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g573 ### # start gene g574 Scaffold_5 AUGUSTUS gene 2789659 2791654 0.1 - . g574 Scaffold_5 AUGUSTUS transcript 2789659 2791654 0.1 - . g574.t1 Scaffold_5 AUGUSTUS stop_codon 2789659 2789661 . - 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_5 AUGUSTUS CDS 2789659 2790432 0.52 - 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_5 AUGUSTUS CDS 2791502 2791654 0.3 - 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_5 AUGUSTUS start_codon 2791652 2791654 . - 0 transcript_id "g574.t1"; gene_id "g574"; # protein sequence = [MSNLPLSANMDVDETAIDEGLYSRQLYVDFLVNLCARSDYPTSSATCWGTKKSLRESLQSPEFFITDFAKFDRPSTLH # AGFQALSEFHAQHKRFPKPRNAHDADAVVAIAKKLNADADENIVTQLAFQATGDLSPVIAVIGAFVAQEALKACSAKFHPMQQHMYFDSLESLPDVLP # SEAECQPTGSRYDGQVAVFGKTFQEKISNHRQFLVGSGAIGCEMLKNWSMMGLASGPKGAIQVTDLDTIEKSNLNRQFLFRPKDLGRFKAEVAATVVS # DMNKDLAGKITTRQDAVGPDTEGAISLNSSHRFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g574 ### # start gene g575 Scaffold_5 AUGUSTUS gene 2795525 2796382 0.94 - . g575 Scaffold_5 AUGUSTUS transcript 2795525 2796382 0.94 - . g575.t1 Scaffold_5 AUGUSTUS stop_codon 2795525 2795527 . - 0 transcript_id "g575.t1"; gene_id "g575"; Scaffold_5 AUGUSTUS CDS 2795525 2796382 0.94 - 0 transcript_id "g575.t1"; gene_id "g575"; Scaffold_5 AUGUSTUS start_codon 2796380 2796382 . - 0 transcript_id "g575.t1"; gene_id "g575"; # protein sequence = [MGRHSSHSISPHRRSNRDRVREGTDRDRESRTEYREEDRKRYRSRSRDRDEVKKDYTSSRRDKERDRSFSRDRDKKRY # LYLLSMLPSHLNVHFYFRRKRDKSEERKARKAEKKRIKEEEEARQIAELSVYSATDNPFHDVNLGQQFRWHKKNEKERKQGLSLAEAQRKDAIRKQEA # KEELERLNKRRAEREVEQRLREEEEMRMQRLQESAQMSDWLSKEGDFQLEQERSRAAIRIKEKRAKAVDFLALNLKYVTLDDDSEDEEEDAGLEIDLD # EPYNILDVGDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g575 ### # start gene g576 Scaffold_5 AUGUSTUS gene 2799030 2799680 0.44 - . g576 Scaffold_5 AUGUSTUS transcript 2799030 2799680 0.44 - . g576.t1 Scaffold_5 AUGUSTUS stop_codon 2799030 2799032 . - 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_5 AUGUSTUS CDS 2799030 2799211 0.78 - 2 transcript_id "g576.t1"; gene_id "g576"; Scaffold_5 AUGUSTUS CDS 2799659 2799680 0.44 - 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_5 AUGUSTUS start_codon 2799678 2799680 . - 0 transcript_id "g576.t1"; gene_id "g576"; # protein sequence = [MNKFSSRYAHEFKKEFEAAQKTNAALSGGAPAEAPLVEEKKDEAEKEKVDEEEKKDETKDEKKEEEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g576 ### # start gene g577 Scaffold_5 AUGUSTUS gene 2801901 2804063 0.92 - . g577 Scaffold_5 AUGUSTUS transcript 2801901 2804063 0.92 - . g577.t1 Scaffold_5 AUGUSTUS stop_codon 2801901 2801903 . - 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_5 AUGUSTUS CDS 2801901 2804063 0.92 - 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_5 AUGUSTUS start_codon 2804061 2804063 . - 0 transcript_id "g577.t1"; gene_id "g577"; # protein sequence = [MVEGANINKSLLAWGIASMLFVKAEELSDTFLTENSKLTRLLKFALGGNCKTVMIVCVAPTSNHFDDHTQYSYIRRTS # YEKSRQRSSHEMSSTLIGTSGAMSKAINRLNAEVAELKAKLAGKNSTENEVVKRKRLEASAEVERAKNDLKVKVEQTKASIVDGAACSGRLSVAKAKL # GAIRSRLAKISILESSSPSPLSADLEAERSFLEALAGPEEQALRTDSVLNTRIHRSSNANAMFDATMRAVSERRSDKLDEVSIENVKLDAACRKAEMD # KLKAEEERNVLANAVDEVAQVMVGLIGMLGRCNAMVGESSRLLQTPGDDGDVHGATQNVSAMLLKLKEKNDDAFQKLIGHSTENYSNSSDNFRGYGMS # FTRRISSGPAAMQTTTKAGSRRSSTHGASSSFSLSSPGRHKTPRRSLRSSLAAQPYRRTSDKERRGLKTSKNVHWRDETGQGDLDDSGLKTVPAIALT # VIPASPLVDNQSSTSSTSSFKASPHRSSSLGGGSESEWEDDNEKTDENVSVNLSMSLPASSRDSMSSSSAVPRLYGSLGKRPRPNRLDPSFLRSKLRT # PALGSLAEDDENTQNGSPRRTSQPLGDRSLNSLDNEFNMNESSSKAYHGSPSKRMPATPRSAMKSRRRSNLGVRSEKSRRRSSLIPQLSPPGGESNKP # RRIILASPGKRPKRLSISRNSGVSSFRLKPSLPNLPLADTSADISMSRLKPTWR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g577 ### # start gene g578 Scaffold_5 AUGUSTUS gene 2807882 2809550 0.33 - . g578 Scaffold_5 AUGUSTUS transcript 2807882 2809550 0.33 - . g578.t1 Scaffold_5 AUGUSTUS stop_codon 2807882 2807884 . - 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_5 AUGUSTUS CDS 2807882 2808272 0.56 - 1 transcript_id "g578.t1"; gene_id "g578"; Scaffold_5 AUGUSTUS CDS 2808868 2809550 0.42 - 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_5 AUGUSTUS start_codon 2809548 2809550 . - 0 transcript_id "g578.t1"; gene_id "g578"; # protein sequence = [MALKQEVGSLPDNVEVVSVNVQLKSLRNDIETSFTLLDRIDCLAALSEALCTCDDALSDLLEHIDSFPATPLGPLSSS # YTNLSSLIPEEQLSDRLSFTKSTIEAVTNAFEVVKGDPRAIVENERVLQTWSELEEMGNDRVHVTKSRPSSVMSTQSSGHDSRVSLNKSQLRFQPGPS # TSAKARKSGSYATLSVSSSTPRGRLNVPSPTPSQSRRAFSGSDEPGTRSNQSFIRDHFADSFRLLAPPDSPGMHTSGEERWISSATLLEEREQNTPPG # PPRTPEPRGPLLPSFSLSTPSGHSPQSMMSTPSTRGSPLTPLQFMRRAEPEAPFFARPETPTKSPSRPRTIPTTPARQSVWRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g578 ### # start gene g579 Scaffold_5 AUGUSTUS gene 2809762 2811469 0.4 - . g579 Scaffold_5 AUGUSTUS transcript 2809762 2811469 0.4 - . g579.t1 Scaffold_5 AUGUSTUS stop_codon 2809762 2809764 . - 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_5 AUGUSTUS CDS 2809762 2810199 0.88 - 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_5 AUGUSTUS CDS 2810322 2810705 0.52 - 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_5 AUGUSTUS CDS 2810816 2811469 0.84 - 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_5 AUGUSTUS start_codon 2811467 2811469 . - 0 transcript_id "g579.t1"; gene_id "g579"; # protein sequence = [MDATLKEVEAIRREAVDEIDRCRWRQDTTINVNGAPPTPESPSTVPLPSDSLQQYTELEHQMTQLGARLQTAVDDPLT # SLSTTLELPLKEHLSQSVQNLKSHSIRVQRMIDLLRSIHKQTTVMNGIREEFNALQLRLDDIMTRYESKTENVLDDTPIDEQVSDTDESLSSEFTATR # SNTMVLLTTLPSEFHLLAHHRKSLSLSALFLPSISHLQHGPKKVHHFHLSQIAKELDASTSALLNEIDQASSQFTTLHGTFTGLQNAIDVINSLTKMT # ADIEQSSSTHRSRLNRSLTAVREIHRRLESAPGILDSNVHDRVLLSRTRGISQLEGQITSWEANIESLRARVFRQEEEERRRLEQARLAEEEERARLE # MEQQEETERIRLNEIRLAEEAQAKEEQKKLALEEAEKARLEKERIEMVSKLKDTEGKLLAERKLHAEKERMAAEEARMARLEREKLDEERNHAIKELE # AANISLEEGKQACTNSCIGPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g579 ### # start gene g580 Scaffold_5 AUGUSTUS gene 2812236 2813388 0.69 - . g580 Scaffold_5 AUGUSTUS transcript 2812236 2813388 0.69 - . g580.t1 Scaffold_5 AUGUSTUS stop_codon 2812236 2812238 . - 0 transcript_id "g580.t1"; gene_id "g580"; Scaffold_5 AUGUSTUS CDS 2812236 2812871 0.86 - 0 transcript_id "g580.t1"; gene_id "g580"; Scaffold_5 AUGUSTUS CDS 2813110 2813388 0.69 - 0 transcript_id "g580.t1"; gene_id "g580"; Scaffold_5 AUGUSTUS start_codon 2813386 2813388 . - 0 transcript_id "g580.t1"; gene_id "g580"; # protein sequence = [MFEDTTIPGDGSSGTTASQADSIHINSINAVNLQPELPEVPTKARAGGDEEALESHQVIELQIFSERKAWIEEKIKVR # KRICYLMQAQSISPIQKTAATQRNLSPEDTDLIELTLTTIYALDKLLHLLRDRSETLDLLGVRISWEENRISSWVERRKIIADLQAFLESRAQWSASV # YDNPPKTDPTLEDHRRGSVSSLASVASDTSINSPAFSRSTRFRLAELLSRDAATLSARVSSLRHGSVAASGKFLDKLIDNSRKPVPEVLLDEQDRIDE # KCVNDMENIGKFVLNVVMQWRKYGCPFLDF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g580 ### # start gene g581 Scaffold_5 AUGUSTUS gene 2818531 2819262 0.99 - . g581 Scaffold_5 AUGUSTUS transcript 2818531 2819262 0.99 - . g581.t1 Scaffold_5 AUGUSTUS stop_codon 2818531 2818533 . - 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_5 AUGUSTUS CDS 2818531 2819262 0.99 - 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_5 AUGUSTUS start_codon 2819260 2819262 . - 0 transcript_id "g581.t1"; gene_id "g581"; # protein sequence = [MAVPDTTTIPTPTSSTHPSTTSNPLPERRPTFPNFPLSTHITFLSGLTAVLLVPYLLFSRRIRQTTDKATRELTSLRR # DTKSIHRRVNDLELLVSNVQAGSNEVVNDLRKEIRDVRKELNSVCGIVDAERQRVDGLMSQTDQINAERELVLSLNQQATKATHDTEHLMNQFKIELN # EAKREAHDAKQLYTALHANLIELKQNLDQTRNMLQKANKLSNDKSATATAQYPIQFAVLLEEAKINR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g581 ### # start gene g582 Scaffold_5 AUGUSTUS gene 2819777 2820241 0.59 + . g582 Scaffold_5 AUGUSTUS transcript 2819777 2820241 0.59 + . g582.t1 Scaffold_5 AUGUSTUS start_codon 2819777 2819779 . + 0 transcript_id "g582.t1"; gene_id "g582"; Scaffold_5 AUGUSTUS CDS 2819777 2820241 0.59 + 0 transcript_id "g582.t1"; gene_id "g582"; Scaffold_5 AUGUSTUS stop_codon 2820239 2820241 . + 0 transcript_id "g582.t1"; gene_id "g582"; # protein sequence = [MVAQSESQSTHPPALNSTASYRISRPLLVGPSSPIYPGSPYPIRLQGPVCKGFGRGGKDLGCPTANLPDDDKGGIGTG # VQEMRGKVDTGVFYGFAKVIPPSSNDHIDHTTLPMVMSLGWNPFYKNERLTAEIHILHEFENDFYGYDMKVLVLGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g582 ### # start gene g583 Scaffold_5 AUGUSTUS gene 2827756 2830000 0.12 - . g583 Scaffold_5 AUGUSTUS transcript 2827756 2830000 0.12 - . g583.t1 Scaffold_5 AUGUSTUS stop_codon 2827756 2827758 . - 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_5 AUGUSTUS CDS 2827756 2828380 1 - 1 transcript_id "g583.t1"; gene_id "g583"; Scaffold_5 AUGUSTUS CDS 2828747 2828892 0.25 - 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_5 AUGUSTUS CDS 2828960 2829410 0.49 - 1 transcript_id "g583.t1"; gene_id "g583"; Scaffold_5 AUGUSTUS CDS 2829564 2830000 0.56 - 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_5 AUGUSTUS start_codon 2829998 2830000 . - 0 transcript_id "g583.t1"; gene_id "g583"; # protein sequence = [MGPALSVRSKEIVAGYASMAGNSDIEQIHKEKGVNIPADASVEMCPHASAARAAARMADDLAHAAKGKEISSKAAAAA # GCPFHKAALEQTAKAAGVAPHPVPVSTASTSVSSSTRTGAYDYEAFYNTELEKKHKDKSLSVLQQHQPSIPCSRTLDRYGHGAGGTRNIAGNGAVHLG # LERELATLHRKDAALIFSSCYVANDATLSTLGTKLPGCVMFSDKSNHASMIQGMRHSTAKRVIFKHNDLEDLENKLKEYPKETPKIIAFESVYSMCGS # ISPISEICDLAEKYGALTFLDEVHAVGLYGPRGAGVAEHLDYEAQLAHGENPDPIPGSVMDRIDIITGQYTPGPSHILPVLVGDAALAKAASDKLLYD # HSIYVQAINYPTVAVGEERLRITVTQRHTVEQIDKLVAAVDQVFTDLNINRIKDWKALGGRATVGVPGEDDVVEPIWTKEQLGEETGTTPKTLRDGEK # DVVDPQGVFVARSRFDHLLGPISGPLRSGYQVAAPAVTPNTTTSSAASVVPKTMKTGTKLMDFAPRARDIPVPPPSKLSAVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g583 ### # start gene g584 Scaffold_5 AUGUSTUS gene 2832608 2833369 0.88 - . g584 Scaffold_5 AUGUSTUS transcript 2832608 2833369 0.88 - . g584.t1 Scaffold_5 AUGUSTUS stop_codon 2832608 2832610 . - 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_5 AUGUSTUS CDS 2832608 2833369 0.88 - 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_5 AUGUSTUS start_codon 2833367 2833369 . - 0 transcript_id "g584.t1"; gene_id "g584"; # protein sequence = [MARALGTRRDYTEGQAFDRERQEQDKIKRQVEREERERRKEEDRAKMAEQKAKWDAERREKDRLRRREEDRLRREREE # GGGGDSRRKQDNGSNMPPPPPPARDRSRERYRGRDRSPPRRPRQDSRSRSPRRRSPSPLTRSSRRRSPSASRSPSRSRSPPRVRRRSVSTPRRRSGSP # PSPPHGNRRDQRSVTAPSRRRRSPSDSVSPPRVRVEVKGRGRSPSPRDSRRGRSRSRSVSSDSAMSVSTRSSSRSRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g584 ### # start gene g585 Scaffold_5 AUGUSTUS gene 2834472 2835584 0.49 + . g585 Scaffold_5 AUGUSTUS transcript 2834472 2835584 0.49 + . g585.t1 Scaffold_5 AUGUSTUS start_codon 2834472 2834474 . + 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_5 AUGUSTUS CDS 2834472 2835131 0.49 + 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_5 AUGUSTUS CDS 2835204 2835584 1 + 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_5 AUGUSTUS stop_codon 2835582 2835584 . + 0 transcript_id "g585.t1"; gene_id "g585"; # protein sequence = [MISTSLFQSQSVSPSNPPATSPPPAVMLHGYGAGLGFYFNNFLPMAQWAARHNSSVYALDWLGMGRSSRPPFHIKASK # KDIPARVAEAESFFVDSLEDWRQQMHLEKMTLIGHSLGAYFSVVYALKYPQRVERLILLSPAGVPRGPDHTVPSSEVDPPTTTSSEDRAELASNAKVE # QVEANQRTAKAKESRSRRILTHLWEEGFSPFQVVRTMGVWAPWMYSSRRFSTLSEEETRDMHDYILNITLAKGSGEYCISHILAPGAHARMPLVDRIA # ALHKDIPVTFAYGDQDWMDPEGGAESVERLRQAGHGQGKMYIVNNAGHHGKHSSTRVLKMTLSTVSSCSIPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g585 ### # start gene g586 Scaffold_5 AUGUSTUS gene 2837358 2837558 0.54 + . g586 Scaffold_5 AUGUSTUS transcript 2837358 2837558 0.54 + . g586.t1 Scaffold_5 AUGUSTUS start_codon 2837358 2837360 . + 0 transcript_id "g586.t1"; gene_id "g586"; Scaffold_5 AUGUSTUS CDS 2837358 2837558 0.54 + 0 transcript_id "g586.t1"; gene_id "g586"; Scaffold_5 AUGUSTUS stop_codon 2837556 2837558 . + 0 transcript_id "g586.t1"; gene_id "g586"; # protein sequence = [MATAARKSLTIGLIPADGIGKEVIPAARTAIEALGSDIPTPKFVDLIAGFETFTRTGVALPEETVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g586 ### # start gene g587 Scaffold_5 AUGUSTUS gene 2841983 2843500 0.27 + . g587 Scaffold_5 AUGUSTUS transcript 2841983 2843500 0.27 + . g587.t1 Scaffold_5 AUGUSTUS start_codon 2841983 2841985 . + 0 transcript_id "g587.t1"; gene_id "g587"; Scaffold_5 AUGUSTUS CDS 2841983 2842389 0.63 + 0 transcript_id "g587.t1"; gene_id "g587"; Scaffold_5 AUGUSTUS CDS 2842521 2843003 0.3 + 1 transcript_id "g587.t1"; gene_id "g587"; Scaffold_5 AUGUSTUS CDS 2843071 2843500 0.37 + 1 transcript_id "g587.t1"; gene_id "g587"; Scaffold_5 AUGUSTUS stop_codon 2843498 2843500 . + 0 transcript_id "g587.t1"; gene_id "g587"; # protein sequence = [MSQRPLRRQKPIGHGGFPDEHLSTKAGSSPAAWPSASLAAATAWGTNVSHESHPMKTAVKEQKSSTASKSVNWAGGWG # GNDAGWGGGAADGWGGGIPEEDEEDEEYGDEEWDEEEEQEWEQEEPGWARQLTPVLGVKPNLSHQQHTQILNSLLSQPSSQNGYLAAAQQQQKLRQQQ # PAVNPYHQKPMPHPKQTAGAFAAAPPSQWPSNSKKEKKSQNEPSRHQRSQSEYQDTWGAASTGIWGKDSSGKGNDTGVRAKDYGGWGQDSVGWENDAG # GRSKDVGDWGKILSDGKTVLASGVHFTPRSSKGGGGWGSESFAPSFRGSESSKVSIANLWGSDKPRDTSYTMPSKTLAHAYNGTTTSLNTGLPRNKIN # EYTNVQFHDSKGAALMPAQQALFGRARKAKDRIHWMFPPNKDERVESLLTWIETVSRDLGTYGVSPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g587 ### # start gene g588 Scaffold_5 AUGUSTUS gene 2849196 2850768 0.14 + . g588 Scaffold_5 AUGUSTUS transcript 2849196 2850768 0.14 + . g588.t1 Scaffold_5 AUGUSTUS start_codon 2849196 2849198 . + 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_5 AUGUSTUS CDS 2849196 2849378 0.32 + 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_5 AUGUSTUS CDS 2849505 2849969 0.37 + 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_5 AUGUSTUS CDS 2850025 2850768 0.67 + 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_5 AUGUSTUS stop_codon 2850766 2850768 . + 0 transcript_id "g588.t1"; gene_id "g588"; # protein sequence = [MCRERYLETIKAKGQVNKGKAKAKAEDDDGNSGQETEGDEPREAIARSEWTKEEDEELVRMCRIRYKKLKNSTLSTDT # NRGSHPVSITNDQPSKPSAPPPPDLSPNAYLSLAPSGSRHALSFITSDSHPPILQLAPTSIAQSSTSPNVSVAQPSESSLALAKPRPKPKSKAKTNVP # PQSMTSHTNTTHNSHDNEQQPFSSNSAVVTSSVISSSATAPPRPARKRPSHRRAAVLSTAITENLETLQPTRGVTSVLSQAQIRGWEAEGHSSIESQV # TGWGAEKGWEAGPQVSEREADGLVQGWEGEGRVRELEANTNPALKIITGAAAEVMSDIEGPDPSERAGSHSLATGSPLSRKRRREELSDTMSLTPSKN # TVSVQNKNSSETGVESATNIEHGIGNTSTPQRRPARKKNAQGKVPPIGVWSLCHLPLVVYLQLQRVVVQHLEDQQGWLGRVERCHSINDHD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g588 ### # start gene g589 Scaffold_5 AUGUSTUS gene 2853118 2853867 0.71 - . g589 Scaffold_5 AUGUSTUS transcript 2853118 2853867 0.71 - . g589.t1 Scaffold_5 AUGUSTUS stop_codon 2853118 2853120 . - 0 transcript_id "g589.t1"; gene_id "g589"; Scaffold_5 AUGUSTUS CDS 2853118 2853867 0.71 - 0 transcript_id "g589.t1"; gene_id "g589"; Scaffold_5 AUGUSTUS start_codon 2853865 2853867 . - 0 transcript_id "g589.t1"; gene_id "g589"; # protein sequence = [MSQYFDIYIVILDSKVLVGLCMLSFRFPKMDIDPNIRHSDILNAIISVGHLVPEEPTGNKEQEQYSLPSALDTPVSYP # NAFKLPGHHPSRSNHLGPTEPVSASEFILPFHTRELGEGESSLYSSPDLYGQVSSTSSLTDAIPWTACPEITNGVVIHDVAAPHATSSQAEQYDPKVV # EFYNQYGMQGVIASVESYSSPFHTHTGLLPGMEIQHLDPGRSGIQNDLTVPRPRWNDSSDNYWGPDSRPSPDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g589 ### # start gene g590 Scaffold_5 AUGUSTUS gene 2858413 2858994 1 - . g590 Scaffold_5 AUGUSTUS transcript 2858413 2858994 1 - . g590.t1 Scaffold_5 AUGUSTUS stop_codon 2858413 2858415 . - 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_5 AUGUSTUS CDS 2858413 2858994 1 - 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_5 AUGUSTUS start_codon 2858992 2858994 . - 0 transcript_id "g590.t1"; gene_id "g590"; # protein sequence = [MSLSNDEVVATHEKKQRKEKVQKAKKAKSDESDFRPAENIVRKKVADIIEMEIDRKKKKKKEKKDKDKDKDKDKEPVV # DLEGAKEIKSFIQGAPEIEMVKQAEGEFEVISEKNKEGKRKGRERRRNSELDSEGAPTARRNKRKREESENADTEDMQGEDSKKKKPRNNTGFPDPVE # EALLSDQARLGQFVPIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g590 ### # start gene g591 Scaffold_5 AUGUSTUS gene 2860601 2861224 0.97 + . g591 Scaffold_5 AUGUSTUS transcript 2860601 2861224 0.97 + . g591.t1 Scaffold_5 AUGUSTUS start_codon 2860601 2860603 . + 0 transcript_id "g591.t1"; gene_id "g591"; Scaffold_5 AUGUSTUS CDS 2860601 2861224 0.97 + 0 transcript_id "g591.t1"; gene_id "g591"; Scaffold_5 AUGUSTUS stop_codon 2861222 2861224 . + 0 transcript_id "g591.t1"; gene_id "g591"; # protein sequence = [MLSSVRSAAKHGCRRLLGGYSGYATPSQPFNPLYPSVSAQSWPSSANGLMDELDHPPSAEGGYSRAHLTPKALGEDST # HMPPGRIPQYKLHCFSSRNNTIVTFTDPRGNPIAWYSGGSCGFKRGQRASYEAGYQCAVRIFKIIENTAATKGMVRIALFFNGFGQGRDAMQKALMTS # EGGNVKVLVEVVGDRTPIKIGGTRSKKMRRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g591 ### # start gene g592 Scaffold_5 AUGUSTUS gene 2865688 2866791 1 + . g592 Scaffold_5 AUGUSTUS transcript 2865688 2866791 1 + . g592.t1 Scaffold_5 AUGUSTUS start_codon 2865688 2865690 . + 0 transcript_id "g592.t1"; gene_id "g592"; Scaffold_5 AUGUSTUS CDS 2865688 2866791 1 + 0 transcript_id "g592.t1"; gene_id "g592"; Scaffold_5 AUGUSTUS stop_codon 2866789 2866791 . + 0 transcript_id "g592.t1"; gene_id "g592"; # protein sequence = [MTYVTSLPGTTADSYRPSDSTASTLDHSASFTTEAQSPLNQNLNIQDSASESSSLSVLTLSPVLNPENVDHSLHDARD # PNSSSLSHILSTDFEAHPTSNAPNFTDKYSSPPSPQLSPDTLSEGRSSFVEDSIAMNSSRLTGQQLQIFNLPSSTTSREALIFSLSSPSATVPAIKSL # SVNEIMLPEGYNNPDLYQNAHRDYPTMEPPSIGSQRLSVTTNFSLELSPHSPPSAPRPALMTLPNSGPEHDIPAIGALTSMHNLLTSLSQDQISGPTF # NTKNDAQEDESGYAHCKSGPEYSTLEPMLPSSSPDNTVLTSSSPPNSSPPQLFSSSPSGTPTTMPMSIVTERRSPPPVGPFKVHLAEIDSKML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g592 ### # start gene g593 Scaffold_5 AUGUSTUS gene 2880602 2881682 0.42 - . g593 Scaffold_5 AUGUSTUS transcript 2880602 2881682 0.42 - . g593.t1 Scaffold_5 AUGUSTUS stop_codon 2880602 2880604 . - 0 transcript_id "g593.t1"; gene_id "g593"; Scaffold_5 AUGUSTUS CDS 2880602 2881082 1 - 1 transcript_id "g593.t1"; gene_id "g593"; Scaffold_5 AUGUSTUS CDS 2881173 2881453 0.92 - 0 transcript_id "g593.t1"; gene_id "g593"; Scaffold_5 AUGUSTUS CDS 2881539 2881682 0.42 - 0 transcript_id "g593.t1"; gene_id "g593"; Scaffold_5 AUGUSTUS start_codon 2881680 2881682 . - 0 transcript_id "g593.t1"; gene_id "g593"; # protein sequence = [MNEIPSASSSSSSVPNMLPLVSPTSGYPPPAPLSSRQVPLPSKVPIAENQSQAILPLSWVSKLLQRSSTGHFVYLGQG # GDSFNVDSQLNEKSYKHQSQSDPLDFPKIRTGNDVGDFDYNGNMGRGLQLLAVEAITMAHNQAPGYENSYGQGGRSDKVDDGGYIAGHNMSFGRSLSG # VQGYGEGYPGVDGGGYRGGYTGGYGGRYGGEYGGRYGGEYGGGYRGEYGGGYGGGYGSGYKKWIRRWIRISADGSTFPHADGVNMEALVGVHKEVGYA # SSSVDNIPSQRTISNKFPFRGNRFKSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g593 ### # start gene g594 Scaffold_5 AUGUSTUS gene 2884264 2884635 0.8 - . g594 Scaffold_5 AUGUSTUS transcript 2884264 2884635 0.8 - . g594.t1 Scaffold_5 AUGUSTUS stop_codon 2884264 2884266 . - 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_5 AUGUSTUS CDS 2884264 2884635 0.8 - 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_5 AUGUSTUS start_codon 2884633 2884635 . - 0 transcript_id "g594.t1"; gene_id "g594"; # protein sequence = [MKSERTLLSTSPLERRFLFFSPEQTGAAQHASAVSELSSEEETFTPPPTVPPISILFDRMGFQSQDSEGIHQVLFTPY # KPAKTKEPFPLDYQGRSKWTENERSLAQDCVTPDSLESYASKVGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g594 ### # start gene g595 Scaffold_5 AUGUSTUS gene 2884937 2886380 0.31 + . g595 Scaffold_5 AUGUSTUS transcript 2884937 2886380 0.31 + . g595.t1 Scaffold_5 AUGUSTUS start_codon 2884937 2884939 . + 0 transcript_id "g595.t1"; gene_id "g595"; Scaffold_5 AUGUSTUS CDS 2884937 2884947 0.4 + 0 transcript_id "g595.t1"; gene_id "g595"; Scaffold_5 AUGUSTUS CDS 2885879 2886380 0.54 + 1 transcript_id "g595.t1"; gene_id "g595"; Scaffold_5 AUGUSTUS stop_codon 2886378 2886380 . + 0 transcript_id "g595.t1"; gene_id "g595"; # protein sequence = [MGEIKNPNVSADSNVNASGNPNPNVSVNANVNASKNPNPNPNVSVDSNVNASGNPNLNASENPNSNASESPNPNASEN # LSVNVSENLNVNGNAWVNADVDVRVNGKVNGNAWANVNADVKNVDADANANANVDSNANVDPNANVENANVDPNVDSNANANVDPMTRLNFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g595 ### # start gene g596 Scaffold_5 AUGUSTUS gene 2888529 2889392 0.36 + . g596 Scaffold_5 AUGUSTUS transcript 2888529 2889392 0.36 + . g596.t1 Scaffold_5 AUGUSTUS start_codon 2888529 2888531 . + 0 transcript_id "g596.t1"; gene_id "g596"; Scaffold_5 AUGUSTUS CDS 2888529 2889392 0.36 + 0 transcript_id "g596.t1"; gene_id "g596"; Scaffold_5 AUGUSTUS stop_codon 2889390 2889392 . + 0 transcript_id "g596.t1"; gene_id "g596"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIQGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g596 ### # start gene g597 Scaffold_5 AUGUSTUS gene 2889446 2891518 0.14 + . g597 Scaffold_5 AUGUSTUS transcript 2889446 2891518 0.14 + . g597.t1 Scaffold_5 AUGUSTUS start_codon 2889446 2889448 . + 0 transcript_id "g597.t1"; gene_id "g597"; Scaffold_5 AUGUSTUS CDS 2889446 2890020 0.32 + 0 transcript_id "g597.t1"; gene_id "g597"; Scaffold_5 AUGUSTUS CDS 2890167 2890319 0.37 + 1 transcript_id "g597.t1"; gene_id "g597"; Scaffold_5 AUGUSTUS CDS 2890399 2891518 0.49 + 1 transcript_id "g597.t1"; gene_id "g597"; Scaffold_5 AUGUSTUS stop_codon 2891516 2891518 . + 0 transcript_id "g597.t1"; gene_id "g597"; # protein sequence = [MKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTD # HFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELS # DRLGNLEAHREDDVRVLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTMKIPYDHVQPRTYRPIQINTPTKVPRDQTNQIDS # HGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDL # WQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVV # IDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV # GTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGEHDSKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g597 ### # start gene g598 Scaffold_5 AUGUSTUS gene 2891843 2894148 0.37 + . g598 Scaffold_5 AUGUSTUS transcript 2891843 2894148 0.37 + . g598.t1 Scaffold_5 AUGUSTUS start_codon 2891843 2891845 . + 0 transcript_id "g598.t1"; gene_id "g598"; Scaffold_5 AUGUSTUS CDS 2891843 2891865 0.75 + 0 transcript_id "g598.t1"; gene_id "g598"; Scaffold_5 AUGUSTUS CDS 2891921 2892494 0.43 + 1 transcript_id "g598.t1"; gene_id "g598"; Scaffold_5 AUGUSTUS CDS 2892607 2894148 0.59 + 0 transcript_id "g598.t1"; gene_id "g598"; Scaffold_5 AUGUSTUS stop_codon 2894146 2894148 . + 0 transcript_id "g598.t1"; gene_id "g598"; # protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY # ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFR # IERHIHGDPLLELPELSKHPKPFEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVI # KKDGKSLRLVHSLEPLNKVTIQHSGVPPASRLARSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPH # VTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPS # CRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKF # FNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRIT # PGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFELQRSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g598 ### # start gene g599 Scaffold_5 AUGUSTUS gene 2894258 2895658 0.37 + . g599 Scaffold_5 AUGUSTUS transcript 2894258 2895658 0.37 + . g599.t1 Scaffold_5 AUGUSTUS start_codon 2894258 2894260 . + 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_5 AUGUSTUS CDS 2894258 2895658 0.37 + 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_5 AUGUSTUS stop_codon 2895656 2895658 . + 0 transcript_id "g599.t1"; gene_id "g599"; # protein sequence = [MLESKDATCEVFVRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIEKYLSNPSDESLGEMSKDERIKFIRLIKK # FQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQK # VHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIE # RAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRR # RVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRRTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g599 ### # start gene g600 Scaffold_5 AUGUSTUS gene 2896099 2896622 0.31 - . g600 Scaffold_5 AUGUSTUS transcript 2896099 2896622 0.31 - . g600.t1 Scaffold_5 AUGUSTUS stop_codon 2896099 2896101 . - 0 transcript_id "g600.t1"; gene_id "g600"; Scaffold_5 AUGUSTUS CDS 2896099 2896526 1 - 2 transcript_id "g600.t1"; gene_id "g600"; Scaffold_5 AUGUSTUS CDS 2896604 2896622 0.31 - 0 transcript_id "g600.t1"; gene_id "g600"; Scaffold_5 AUGUSTUS start_codon 2896620 2896622 . - 0 transcript_id "g600.t1"; gene_id "g600"; # protein sequence = [MFLLTVLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSI # LKSRQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g600 ### # start gene g601 Scaffold_5 AUGUSTUS gene 2898580 2900539 0.27 - . g601 Scaffold_5 AUGUSTUS transcript 2898580 2900539 0.27 - . g601.t1 Scaffold_5 AUGUSTUS stop_codon 2898580 2898582 . - 0 transcript_id "g601.t1"; gene_id "g601"; Scaffold_5 AUGUSTUS CDS 2898580 2899127 0.95 - 2 transcript_id "g601.t1"; gene_id "g601"; Scaffold_5 AUGUSTUS CDS 2899893 2900273 0.57 - 2 transcript_id "g601.t1"; gene_id "g601"; Scaffold_5 AUGUSTUS CDS 2900332 2900539 0.46 - 0 transcript_id "g601.t1"; gene_id "g601"; Scaffold_5 AUGUSTUS start_codon 2900537 2900539 . - 0 transcript_id "g601.t1"; gene_id "g601"; # protein sequence = [MRMVSSKDLDVFASLRGKESSAVALKATTSSPPLEIQSSTSVSKAFVAPPRLIRRNRELENLKADASSFLASPRSAHS # KDSDNELLSGFPSAGSAPVASSSTKVSIGKGEPKSKTTVKVVEDSKADRPLPAGMAYKRIRLPPRSRKNTSIASKGKARQIVVTDEGSTSNEVESEDE # AEDEDIAPPPKRLKTTSSISDLAISLRRAIDLNDQLKQLESLFDSTRDLFLRSVLDLQNAGEDPIVVLEALKAAEPNRRAISLNEWTLMATLFRWPSP # FNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGASSQVGGSIPMELDLPAIESLAEPALSPEKGA # EPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g601 ### # start gene g602 Scaffold_5 AUGUSTUS gene 2907106 2907549 0.79 + . g602 Scaffold_5 AUGUSTUS transcript 2907106 2907549 0.79 + . g602.t1 Scaffold_5 AUGUSTUS start_codon 2907106 2907108 . + 0 transcript_id "g602.t1"; gene_id "g602"; Scaffold_5 AUGUSTUS CDS 2907106 2907549 0.79 + 0 transcript_id "g602.t1"; gene_id "g602"; Scaffold_5 AUGUSTUS stop_codon 2907547 2907549 . + 0 transcript_id "g602.t1"; gene_id "g602"; # protein sequence = [MFWDHDAKWAIQAVGASHIDFRFSIHQPIVGYRSFKEGISSLKQVTGRAQRDVQRYLIPLISGAVIPKFITALRALMD # FRYAGQAPRFNQASTLRVQTALNEFHENKDIIQDLKARLIPKEFLSSTGRSQNWNSCKVLRPAFLPLDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g602 ### # start gene g603 Scaffold_5 AUGUSTUS gene 2913443 2915192 0.14 - . g603 Scaffold_5 AUGUSTUS transcript 2913443 2915192 0.14 - . g603.t1 Scaffold_5 AUGUSTUS stop_codon 2913443 2913445 . - 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_5 AUGUSTUS CDS 2913443 2914024 1 - 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_5 AUGUSTUS CDS 2914590 2914734 0.19 - 1 transcript_id "g603.t1"; gene_id "g603"; Scaffold_5 AUGUSTUS CDS 2914812 2914966 0.56 - 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_5 AUGUSTUS CDS 2915136 2915192 0.45 - 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_5 AUGUSTUS start_codon 2915190 2915192 . - 0 transcript_id "g603.t1"; gene_id "g603"; # protein sequence = [MSTQNQNRSQNTTRQDTRRELSAKAAESIIADPAQRKDALNYLLAVGLLKPLKNSKGALIFRAVTRSEHTTRKKLFWG # ISEELRMKVCGLSPIFRVSELIDTSGIWVKHLKAKSNFHQTLPAFGNSLWDSGAIDDNDSADEKRSKKKRKHHSSDNERDEERSSRRKNKKSRTVDDS # ELEDDSSSGKNAKRKKGLSSDDSDATSSKASRRKSKMKRMDSDVSDKESSDEKSTNKRRPKGKKSRYASDSSSDSDDSRSHRSKPRSMKRSPSPFFSF # DEAGSSVYRAIREERVSDGLKRLVADAHPSSSAKAGGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g603 ### # start gene g604 Scaffold_5 AUGUSTUS gene 2915537 2916292 0.99 - . g604 Scaffold_5 AUGUSTUS transcript 2915537 2916292 0.99 - . g604.t1 Scaffold_5 AUGUSTUS stop_codon 2915537 2915539 . - 0 transcript_id "g604.t1"; gene_id "g604"; Scaffold_5 AUGUSTUS CDS 2915537 2916292 0.99 - 0 transcript_id "g604.t1"; gene_id "g604"; Scaffold_5 AUGUSTUS start_codon 2916290 2916292 . - 0 transcript_id "g604.t1"; gene_id "g604"; # protein sequence = [MTELTSLRLFVDPTASWVLQDISLSRLVHFACPFNLDPHVSNFLKNTPALLELEVDSTPCGLGRPASALAPSSVTQLQ # HFVGSSLAAEVTIPSRPVQSVQLTTGDLTEEVATRLSESTAGIAILSATTSSAPATLLQLLSQRMQCLVHVQLLTTYSFPEAPDVVSCHFICFTTSFS # YHTSQTFYERIAGALNAFPDLQTFELSGMHWGSKELKDSDRHRVWQSQPLKSELDSSPEYLEIDPYSDLFSHIEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g604 ### # start gene g605 Scaffold_5 AUGUSTUS gene 2917727 2918359 0.86 + . g605 Scaffold_5 AUGUSTUS transcript 2917727 2918359 0.86 + . g605.t1 Scaffold_5 AUGUSTUS start_codon 2917727 2917729 . + 0 transcript_id "g605.t1"; gene_id "g605"; Scaffold_5 AUGUSTUS CDS 2917727 2918359 0.86 + 0 transcript_id "g605.t1"; gene_id "g605"; Scaffold_5 AUGUSTUS stop_codon 2918357 2918359 . + 0 transcript_id "g605.t1"; gene_id "g605"; # protein sequence = [MLSDNLQKRSQVAHLVRNTLHDSGKVVLIRLHIGLMITPYLGFVEIETPVLLRSSPEGAREFLVPTRTKDVSDFPAFY # ALQQSPQQPKQLLIASGTVDKYFQIAKCFRDEDGRKDRQPEFTQIDMEMAYVSWGPMDSISTSSSGSQCSGTWRIGGSEVRDVVETIIKKIWKKIENV # DLPSCFPVMTYNEAMTRASTIKYEPPVVLLIGNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g605 ### # start gene g606 Scaffold_5 AUGUSTUS gene 2919920 2920750 0.98 - . g606 Scaffold_5 AUGUSTUS transcript 2919920 2920750 0.98 - . g606.t1 Scaffold_5 AUGUSTUS stop_codon 2919920 2919922 . - 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_5 AUGUSTUS CDS 2919920 2920750 0.98 - 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_5 AUGUSTUS start_codon 2920748 2920750 . - 0 transcript_id "g606.t1"; gene_id "g606"; # protein sequence = [MCLVVRSTLDVYDKFTSKACGALLEFSCILSLTSCLFAFRSDPVIEPMLQSVPDPFDSYGPPQSEDQIFSILPPLSIM # PSAPSSTTTPLTRTPELENMEGPPSASSSTSWSQNPNTVLFPSESSAWADVPSSPSSSSPRSVSPTTPIRRHSLPASTGHSSRKAESKLRSVLSVIDE # ANSRHSTEEVISSHYVPQVENSNLNDTTLIQPQPQKQTSFSWTSPFSYGRSPYVEEDTNGDTTPRNSTFLSSPQTPTGRPVPELDADSSTIGETTVPV # PF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g606 ### # start gene g607 Scaffold_5 AUGUSTUS gene 2926907 2927653 0.34 + . g607 Scaffold_5 AUGUSTUS transcript 2926907 2927653 0.34 + . g607.t1 Scaffold_5 AUGUSTUS start_codon 2926907 2926909 . + 0 transcript_id "g607.t1"; gene_id "g607"; Scaffold_5 AUGUSTUS CDS 2926907 2927653 0.34 + 0 transcript_id "g607.t1"; gene_id "g607"; Scaffold_5 AUGUSTUS stop_codon 2927651 2927653 . + 0 transcript_id "g607.t1"; gene_id "g607"; # protein sequence = [MQILLGVLIINLMFAIATARARSTSRRRGFDEEIERVGSSMGPYFHSLSSPTNGSSHSSPASVNIPSPITNVPEGQES # SPTLASAHTFNYGSPRLSAGQIPSPRYDSYDFGLSNNLNNYQGPAQPQWNGQQAGVDIYSAENLYGSSNGVYPSPLENYPVFETTGTHEMHNGMNRLS # TTPPTSSFNASGLPFRGLEFIRNYSPGGYLAGDNFMGEPESLWQSYDPLSFNVNPDLPFTLGDPDVHGTGTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g607 ### # start gene g608 Scaffold_5 AUGUSTUS gene 2937717 2939232 0.34 + . g608 Scaffold_5 AUGUSTUS transcript 2937717 2939232 0.34 + . g608.t1 Scaffold_5 AUGUSTUS start_codon 2937717 2937719 . + 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_5 AUGUSTUS CDS 2937717 2938346 0.34 + 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_5 AUGUSTUS CDS 2938495 2939232 0.55 + 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_5 AUGUSTUS stop_codon 2939230 2939232 . + 0 transcript_id "g608.t1"; gene_id "g608"; # protein sequence = [MKVLSKKEIVAKKEVAHTIGERQILQRSLESPFLVGLKFSFQTEHDLYLVTDFKSGGELFWHLQRETRFSEERARFYV # AELILALEHLHKYDIVYRDLKPENILLDATGHVALCDFGLSKANLRADELTTTFCGTTEYLAPEILLDEHGYSKIVDFWSLGVLLFEMCCGWSPFYAE # DTQQMYKNICFGKIRFPKGVINEDGKQFVKEVSIKVTPPFKPVVESDESTSNFDPEFTEKSIADVGLNEDDYADFAEDDPSESWVSQSLGASSFLPGG # HVHNGPLGSEKTGKTPPMTPISPMTTVTTLPNGTAHTTHKSTKHKSSRSGGGLSRNGSSASAKSNRSSKSSLNRVANGIDIHANGRQHKKQRQPAGTP # LTNSVQENFRGFTYSGGESVSSHADIFASRKVEDDDNDEDYVDVDEEPEGGTEDEFEDFGKSAGRYANLRKKGMGFTDLDDMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g608 ### # start gene g609 Scaffold_5 AUGUSTUS gene 2942075 2942891 0.37 - . g609 Scaffold_5 AUGUSTUS transcript 2942075 2942891 0.37 - . g609.t1 Scaffold_5 AUGUSTUS stop_codon 2942075 2942077 . - 0 transcript_id "g609.t1"; gene_id "g609"; Scaffold_5 AUGUSTUS CDS 2942075 2942498 0.74 - 1 transcript_id "g609.t1"; gene_id "g609"; Scaffold_5 AUGUSTUS CDS 2942596 2942891 0.38 - 0 transcript_id "g609.t1"; gene_id "g609"; Scaffold_5 AUGUSTUS start_codon 2942889 2942891 . - 0 transcript_id "g609.t1"; gene_id "g609"; # protein sequence = [MSIEQDPSVPAPTSKKDASKPRRRFIGSKSSKPTSSSNPSNSVLRNQIPAEIIEDPQLNAIIEKVLPRNYSFEIHKTI # HHVRKNGSKMVALQMPEGLQIFTPALTTIMGDVTYGACCVDDYTALALGCDMLIHYGHSCLVPSNFTQEIKTLYVFVEIGIDSVHVHQTIRANLPSDR # DAFQDALMTIGMGEGGEQEIKAGERIPIAGPGLRIEASPHKSVEEKDRDVAVILAEQKDLNPD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g609 ### # start gene g610 Scaffold_5 AUGUSTUS gene 2945517 2946422 0.92 - . g610 Scaffold_5 AUGUSTUS transcript 2945517 2946422 0.92 - . g610.t1 Scaffold_5 AUGUSTUS stop_codon 2945517 2945519 . - 0 transcript_id "g610.t1"; gene_id "g610"; Scaffold_5 AUGUSTUS CDS 2945517 2946422 0.92 - 0 transcript_id "g610.t1"; gene_id "g610"; Scaffold_5 AUGUSTUS start_codon 2946420 2946422 . - 0 transcript_id "g610.t1"; gene_id "g610"; # protein sequence = [MSDPVGQVRVCYTPLASAIVDTPEASLIACTGGKTSPFTRAIYKDFGDGKLHPPRLATATLEAIDSIQARNIFPQDLP # AYQRASVTARTNGVVSPFWRDWPLAEPCEFLTPEPLHYWHKMFWDHDAKWAIQAVGASHIDFRFSIHQPIVGYRSFKEGISSLKQMTGRAQRDVQRYL # IPLISGAVIPKFVTALRALMDFRYAGQAPRFNQASTLRVQTALNEFHENKDIIQDLKARVIPKEFLSSTGKSQNWNLCKVLRQHSASGPIMQWTADTT # EHAHITPVKDPARSGNIMTSKSRYADT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g610 ### # start gene g611 Scaffold_5 AUGUSTUS gene 2947798 2949193 0.2 - . g611 Scaffold_5 AUGUSTUS transcript 2947798 2949193 0.2 - . g611.t1 Scaffold_5 AUGUSTUS stop_codon 2947798 2947800 . - 0 transcript_id "g611.t1"; gene_id "g611"; Scaffold_5 AUGUSTUS CDS 2947798 2948325 0.46 - 0 transcript_id "g611.t1"; gene_id "g611"; Scaffold_5 AUGUSTUS CDS 2948496 2948532 0.29 - 1 transcript_id "g611.t1"; gene_id "g611"; Scaffold_5 AUGUSTUS CDS 2948634 2949193 0.25 - 0 transcript_id "g611.t1"; gene_id "g611"; Scaffold_5 AUGUSTUS start_codon 2949191 2949193 . - 0 transcript_id "g611.t1"; gene_id "g611"; # protein sequence = [MSDDEEKKILLRSATAALKAGGDLVFSVKVCLNQSLGERPFIINVPHLGESGSAEAFHTASYSSSQTILSLNHSPTMN # DYGVDEEEDVTIQPLNAPNLRPDASSGSESSSSGRVSKTLSMRLGETAVTDPDEPKALTPLIISKAIVNPALCSPTSLARTDDGTTWRVVLEIIPCPW # KTRSSMVNYPHDGVLVGATLAVLQRKGLAVQLHVSNFIKLWLDLYWRPTPDDSALPMLEAFTRNGLMTMFPGPAERIIDMIYGRKEQKDSGFSPKGGR # SRDPGMSLNPPSAPPPTHLWTVWWTREVESTASSSSTASPASGSRGGLEVEPTASPTSRPYGGLARWSPPPSSTASRLRSGLTREGLRWTCQREELSE # TE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g611 ### # start gene g612 Scaffold_5 AUGUSTUS gene 2956187 2956954 0.6 + . g612 Scaffold_5 AUGUSTUS transcript 2956187 2956954 0.6 + . g612.t1 Scaffold_5 AUGUSTUS start_codon 2956187 2956189 . + 0 transcript_id "g612.t1"; gene_id "g612"; Scaffold_5 AUGUSTUS CDS 2956187 2956954 0.6 + 0 transcript_id "g612.t1"; gene_id "g612"; Scaffold_5 AUGUSTUS stop_codon 2956952 2956954 . + 0 transcript_id "g612.t1"; gene_id "g612"; # protein sequence = [MRLRDRMEKLEESVRRYRNRAHSAEGLIRQYPEDEGLYEIDLPSLSSMQDRLNESEALVRRLATFAHRLYVADPANLL # HYHNTYVGGLIEAVVALLSRGLTHPPEQMRPVVELALDYLSQGRLTHGELHLRSTSSLLYYYSNAADRVDGLYQEMFSHSRFSSDDAFLTAAQHAGYV # DAPPGSLEPPLHRRMFSFGHPIPFPQTPLSDHIPAVPSMDSIMLDWERMIANYVSEVLGYPVPSFVAPPAEEVPNPGVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g612 ### # start gene g613 Scaffold_5 AUGUSTUS gene 2957741 2960695 0.97 - . g613 Scaffold_5 AUGUSTUS transcript 2957741 2960695 0.97 - . g613.t1 Scaffold_5 AUGUSTUS stop_codon 2957741 2957743 . - 0 transcript_id "g613.t1"; gene_id "g613"; Scaffold_5 AUGUSTUS CDS 2957741 2960695 0.97 - 0 transcript_id "g613.t1"; gene_id "g613"; Scaffold_5 AUGUSTUS start_codon 2960693 2960695 . - 0 transcript_id "g613.t1"; gene_id "g613"; # protein sequence = [MKEESPTEEILRASDSNDPERVQQPKDPESGNPSRDKGGRQELDEEVSKRQETEELKKSIPIQYQDYLDVFSPGEART # LPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSFPRGSSCPCLPRKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVD # QLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEESHVEHVRKVLER # LRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWSWTPQCSSAF # ELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDH # NNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATILMNEDLLVKRVREAPKDTT # IIEALRRIARNEEEALVWEDGLIKRGGRIYVPEVGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYIRSCHSCLRAKASRSKPYG # NLRPLPIGQRPWSSISLDHITQLPTTAGPEKYDAILVVVCRLTKQAIYVPCHTTDNAEDFANLFITHVFSKHGMPSDITSDRGSLFVSQFWRELCRTL # GIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPIAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHA # YLQERIRVANEAYAKYANQRRQEAPDWKEGDHVWLNMENVRTRRPMKKLDHKWTGPYSILAKIGTHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKR # QNSPPPPIFVKGESEHFRREHFGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g613 ### # start gene g614 Scaffold_5 AUGUSTUS gene 2967631 2970279 0.85 + . g614 Scaffold_5 AUGUSTUS transcript 2967631 2970279 0.85 + . g614.t1 Scaffold_5 AUGUSTUS start_codon 2967631 2967633 . + 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_5 AUGUSTUS CDS 2967631 2970279 0.85 + 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_5 AUGUSTUS stop_codon 2970277 2970279 . + 0 transcript_id "g614.t1"; gene_id "g614"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSVLWLSTGFLKRVPASAAPRVPRNQFVMFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNH # VRCAPLHKPIDVFNIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLA # ATHTETPILELPELEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEM # VPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKL # NEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDI # LIFSNDLEEHRRMVREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g614 ### # start gene g615 Scaffold_5 AUGUSTUS gene 2972625 2973674 1 + . g615 Scaffold_5 AUGUSTUS transcript 2972625 2973674 1 + . g615.t1 Scaffold_5 AUGUSTUS start_codon 2972625 2972627 . + 0 transcript_id "g615.t1"; gene_id "g615"; Scaffold_5 AUGUSTUS CDS 2972625 2973674 1 + 0 transcript_id "g615.t1"; gene_id "g615"; Scaffold_5 AUGUSTUS stop_codon 2973672 2973674 . + 0 transcript_id "g615.t1"; gene_id "g615"; # protein sequence = [MRAQQIQQNEWASFIQDYVKASSPADDWLNKAPENALRKWPDFKVVFLDRFPAPEATSATPQEFDHQLIAMRITDNEL # LLRVEEAGYKYIEFAAELLRIAKLAGIDQTFASISSVHANLPRALHNRVGEDHANWSSFVSAIKKVSKAEIEENLEQDKCIRELERVAAAAEQVVYRP # RAQLPPVPETLSKSLGQSLARVNLGPVLSRPMSNRPVASLTEEQCAVLLANSTRLPHHPNTEQGRVDYGKQCAEWAHTHGNISVTYNTPVPLKPGTVA # VRSGECYRCGKLGHRSRECTGVDQILKREGDWRALCGQELPQLGTTMNINLVSSFDSELEEMLRMGSGNGEGSTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g615 ### # start gene g616 Scaffold_5 AUGUSTUS gene 2973803 2975351 0.12 + . g616 Scaffold_5 AUGUSTUS transcript 2973803 2975351 0.12 + . g616.t1 Scaffold_5 AUGUSTUS start_codon 2973803 2973805 . + 0 transcript_id "g616.t1"; gene_id "g616"; Scaffold_5 AUGUSTUS CDS 2973803 2975160 0.14 + 0 transcript_id "g616.t1"; gene_id "g616"; Scaffold_5 AUGUSTUS CDS 2975270 2975351 0.25 + 1 transcript_id "g616.t1"; gene_id "g616"; Scaffold_5 AUGUSTUS stop_codon 2975349 2975351 . + 0 transcript_id "g616.t1"; gene_id "g616"; # protein sequence = [MSVGLQAPSGEKLTLEALVDGGAMVAALDEKLFEHVKDRFPGWEPSVKRLRMANGVVVSARAQWRGRVILQGEEVEGV # LQVFNSGGGWDMLFRKPLLQAFGAVHDFGDDSVRVRKKAVEVFQEGLGKEVAVKSIPEDETAAVQHMSEDKVYTSDGASAKAQTPRFRDVKHSVLKSN # KLMPINGSFSDLPFDGESLGFETHGEMLARLWEQKRCLQEKDILQRKLANGMLRQQEERRRSEYRANRREEDRRLQEKLRQEAEERKRQKDYEQAREG # TKERWTARRFWRLGGGLSKFKFVCRKGRFTLLRRQQPEWKRIVWNHHTWARSRAYRDLKRQEAALRANSVGGGNAPPLRGVSIDKPNPGNVVNPCPTE # NIVANIPVCMIDEAADIKGMGHDAIPDALDTRTQEMDLFTRNNGPNGAFLPERVAEVVRLVQLGNHLTIEQTLCAQELIRDARSHRVKSMPRASIPPR # GTPKIHSLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g616 ### # start gene g617 Scaffold_5 AUGUSTUS gene 2979735 2980310 1 - . g617 Scaffold_5 AUGUSTUS transcript 2979735 2980310 1 - . g617.t1 Scaffold_5 AUGUSTUS stop_codon 2979735 2979737 . - 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_5 AUGUSTUS CDS 2979735 2980310 1 - 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_5 AUGUSTUS start_codon 2980308 2980310 . - 0 transcript_id "g617.t1"; gene_id "g617"; # protein sequence = [MSFGSDPESFLEYALSLPDPVGPDPETSDSSDQSSPSDHNSEQESVQSGTNSDPDQSSYDSEFPGPFDYDYLHQSSDF # DSDHPGPYDLRYLHSYPSSSASDSVESFHSFTSDNSEAPELRPGDDGSGHPHLGPDGRLLDSERERRRVLGLCFYCGGEHMKIDCLKLQARTGQNYDA # DNSESDVPGSDDGSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g617 ### # start gene g618 Scaffold_5 AUGUSTUS gene 2985243 2987352 0.35 + . g618 Scaffold_5 AUGUSTUS transcript 2985243 2987352 0.35 + . g618.t1 Scaffold_5 AUGUSTUS start_codon 2985243 2985245 . + 0 transcript_id "g618.t1"; gene_id "g618"; Scaffold_5 AUGUSTUS CDS 2985243 2985850 0.37 + 0 transcript_id "g618.t1"; gene_id "g618"; Scaffold_5 AUGUSTUS CDS 2985999 2987352 0.85 + 1 transcript_id "g618.t1"; gene_id "g618"; Scaffold_5 AUGUSTUS stop_codon 2987350 2987352 . + 0 transcript_id "g618.t1"; gene_id "g618"; # protein sequence = [MVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNG # TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSDRLGNLKHTEKMMSVLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIEDVNESDDEDAIKLIPSSRPTN # QINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRP # RTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSD # HPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQ # VLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g618 ### # start gene g619 Scaffold_5 AUGUSTUS gene 2987677 2989393 0.35 + . g619 Scaffold_5 AUGUSTUS transcript 2987677 2989393 0.35 + . g619.t1 Scaffold_5 AUGUSTUS start_codon 2987677 2987679 . + 0 transcript_id "g619.t1"; gene_id "g619"; Scaffold_5 AUGUSTUS CDS 2987677 2987699 0.8 + 0 transcript_id "g619.t1"; gene_id "g619"; Scaffold_5 AUGUSTUS CDS 2987756 2988072 0.58 + 1 transcript_id "g619.t1"; gene_id "g619"; Scaffold_5 AUGUSTUS CDS 2988183 2989393 0.42 + 2 transcript_id "g619.t1"; gene_id "g619"; Scaffold_5 AUGUSTUS stop_codon 2989391 2989393 . + 0 transcript_id "g619.t1"; gene_id "g619"; # protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY # ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEEQEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEII # DKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCV # IKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYI # LRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQ # VVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g619 ### # start gene g620 Scaffold_5 AUGUSTUS gene 2991921 2993807 0.22 - . g620 Scaffold_5 AUGUSTUS transcript 2991921 2993807 0.22 - . g620.t1 Scaffold_5 AUGUSTUS stop_codon 2991921 2991923 . - 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_5 AUGUSTUS CDS 2991921 2992556 0.83 - 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_5 AUGUSTUS CDS 2992911 2993807 0.25 - 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_5 AUGUSTUS start_codon 2993805 2993807 . - 0 transcript_id "g620.t1"; gene_id "g620"; # protein sequence = [MIPPRSSAANGVAERANRTVLDGVRTFLVDAGFPPSMWAEAALTFCYVNAFIPSSRFPNEVPIEIYTKKRHDVSHLRP # FGCKCWVTLDAIQMDGKLGVRAVEGRFVGYIGRRGYRVWLPQTKTFHESRSVEFEEGDPRRSAPAVPDEVDGEVFVDVDVGPAPNAVPDSPANKNQID # IPNASIPSTPTTPSTPSYDGIPELFAAQPSFQPLALPIQEPEAGPRRGTRIREPSARQLQSEESTQRERSAFERNLAWAHDSGGIDELDENSNPLAMV # ANSPFAFGAESSDKWVPNTYNRLYVPEGFIKEGEEHKVCKLNKSIYGTMQGSHDWQDTLGKGYEEDGYIASKADPCVRYRRIDDEYTLSTTYGDDVNG # ASSTEDGRKKAIADLGKRWESSEVNSGVLLGMTISQDPISKSITISQKSYFERMLEHFGMENVHIRCTPLDPKAKIVESTNPLPELDRKFMSDKPYRS # FVGSLLWGLARQGPTSRSPQISSLVSNLILVLSIGKLASG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g620 ### # start gene g621 Scaffold_5 AUGUSTUS gene 2996424 2996966 0.99 + . g621 Scaffold_5 AUGUSTUS transcript 2996424 2996966 0.99 + . g621.t1 Scaffold_5 AUGUSTUS start_codon 2996424 2996426 . + 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_5 AUGUSTUS CDS 2996424 2996966 0.99 + 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_5 AUGUSTUS stop_codon 2996964 2996966 . + 0 transcript_id "g621.t1"; gene_id "g621"; # protein sequence = [MATKRPEVNPEDYVDEDGGKPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIR # RNHMLEAKNATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLEEMSKDERIKFIRLIKKFQVDDQGRLYHRKLINL # INHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g621 ### # start gene g622 Scaffold_5 AUGUSTUS gene 2997230 2997929 0.29 + . g622 Scaffold_5 AUGUSTUS transcript 2997230 2997929 0.29 + . g622.t1 Scaffold_5 AUGUSTUS start_codon 2997230 2997232 . + 0 transcript_id "g622.t1"; gene_id "g622"; Scaffold_5 AUGUSTUS CDS 2997230 2997275 0.33 + 0 transcript_id "g622.t1"; gene_id "g622"; Scaffold_5 AUGUSTUS CDS 2997409 2997609 0.36 + 2 transcript_id "g622.t1"; gene_id "g622"; Scaffold_5 AUGUSTUS CDS 2997661 2997929 0.68 + 2 transcript_id "g622.t1"; gene_id "g622"; Scaffold_5 AUGUSTUS stop_codon 2997927 2997929 . + 0 transcript_id "g622.t1"; gene_id "g622"; # protein sequence = [MDVNTSSMEGIHCLCAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPR # RGLGLESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKIAELRRFKRKYRHTIKIGISNQVNWSRLGILELKRVWIERCIQE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g622 ### # start gene g623 Scaffold_5 AUGUSTUS gene 2998501 2999310 0.22 - . g623 Scaffold_5 AUGUSTUS transcript 2998501 2999310 0.22 - . g623.t1 Scaffold_5 AUGUSTUS stop_codon 2998501 2998503 . - 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_5 AUGUSTUS CDS 2998501 2998928 1 - 2 transcript_id "g623.t1"; gene_id "g623"; Scaffold_5 AUGUSTUS CDS 2999003 2999124 0.35 - 1 transcript_id "g623.t1"; gene_id "g623"; Scaffold_5 AUGUSTUS CDS 2999291 2999310 0.35 - 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_5 AUGUSTUS start_codon 2999308 2999310 . - 0 transcript_id "g623.t1"; gene_id "g623"; # protein sequence = [MKNKLDYTPYPTTGSNKGSNKDEKSAVNDVSPRFIATQTVMFLLTVCLTHSKHINHALAQVVSTNLDTPPAPLESQST # KFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTENAVPVPKTVERATTPFTRG # VTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g623 ### # start gene g624 Scaffold_5 AUGUSTUS gene 2999767 3000252 0.87 + . g624 Scaffold_5 AUGUSTUS transcript 2999767 3000252 0.87 + . g624.t1 Scaffold_5 AUGUSTUS start_codon 2999767 2999769 . + 0 transcript_id "g624.t1"; gene_id "g624"; Scaffold_5 AUGUSTUS CDS 2999767 3000252 0.87 + 0 transcript_id "g624.t1"; gene_id "g624"; Scaffold_5 AUGUSTUS stop_codon 3000250 3000252 . + 0 transcript_id "g624.t1"; gene_id "g624"; # protein sequence = [MLIDGKEIAPHTSSFSRNHLTAAPANPGVVSDLAHLATIMAMITPQTPAHLKTATPPPDITIPIKNTPSKLLRFLEYA # ETNVGVEHATQHLLRLQEEGYGPDILDQVDDKDLKILGIKHGDVLRLKRAAPLWLNGPDANAKSLLQLREHQHQHLFPQVVHQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g624 ### # start gene g625 Scaffold_5 AUGUSTUS gene 3001788 3002503 0.58 - . g625 Scaffold_5 AUGUSTUS transcript 3001788 3002503 0.58 - . g625.t1 Scaffold_5 AUGUSTUS stop_codon 3001788 3001790 . - 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_5 AUGUSTUS CDS 3001788 3002072 0.71 - 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_5 AUGUSTUS CDS 3002111 3002272 0.58 - 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_5 AUGUSTUS CDS 3002336 3002503 0.71 - 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_5 AUGUSTUS start_codon 3002501 3002503 . - 0 transcript_id "g625.t1"; gene_id "g625"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLPVTLRSHVRQISNLTARQSIID # TLCLGHKLFPDIVSDSHFEQHLKFMAFANDAHSFQNTFVRNRLLDRARSVHSDHEASTRSDNSRFIRKSKKKATRFASSRDVKREPRSVRFDSDVEVN # SSDLISINLIYQFRSDELSLRGRVGVWN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g625 ### # start gene g626 Scaffold_5 AUGUSTUS gene 3004774 3005475 0.51 - . g626 Scaffold_5 AUGUSTUS transcript 3004774 3005475 0.51 - . g626.t1 Scaffold_5 AUGUSTUS stop_codon 3004774 3004776 . - 0 transcript_id "g626.t1"; gene_id "g626"; Scaffold_5 AUGUSTUS CDS 3004774 3005475 0.51 - 0 transcript_id "g626.t1"; gene_id "g626"; Scaffold_5 AUGUSTUS start_codon 3005473 3005475 . - 0 transcript_id "g626.t1"; gene_id "g626"; # protein sequence = [MRLVPSKDLDVFASLHGKVSPAVASKISTPSPPLEIKPSTSVPKAPVAPPRLIRRNRELESLKADASTFCEYQLNSLI # YYLYSFNLVVVSSPRSTYSKDSDNELLSGFPSAGSASRAFSSSTKVPMGRKEPKPKTTIKVVEDSKASKPTPSAMVYKRVRLPPRSRKIAPTTAKGKS # QQVVVSEDDSASNEVESEDEEEDEDEEEDSAPPPKRPKTTSSISGNISSLLFSFLFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g626 ### # start gene g627 Scaffold_5 AUGUSTUS gene 3019069 3019452 0.78 - . g627 Scaffold_5 AUGUSTUS transcript 3019069 3019452 0.78 - . g627.t1 Scaffold_5 AUGUSTUS stop_codon 3019069 3019071 . - 0 transcript_id "g627.t1"; gene_id "g627"; Scaffold_5 AUGUSTUS CDS 3019069 3019452 0.78 - 0 transcript_id "g627.t1"; gene_id "g627"; Scaffold_5 AUGUSTUS start_codon 3019450 3019452 . - 0 transcript_id "g627.t1"; gene_id "g627"; # protein sequence = [MTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNA # STGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVSFERKSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g627 ### # start gene g628 Scaffold_5 AUGUSTUS gene 3026533 3027197 0.21 + . g628 Scaffold_5 AUGUSTUS transcript 3026533 3027197 0.21 + . g628.t1 Scaffold_5 AUGUSTUS start_codon 3026533 3026535 . + 0 transcript_id "g628.t1"; gene_id "g628"; Scaffold_5 AUGUSTUS CDS 3026533 3026581 0.21 + 0 transcript_id "g628.t1"; gene_id "g628"; Scaffold_5 AUGUSTUS CDS 3026641 3027197 0.62 + 2 transcript_id "g628.t1"; gene_id "g628"; Scaffold_5 AUGUSTUS stop_codon 3027195 3027197 . + 0 transcript_id "g628.t1"; gene_id "g628"; # protein sequence = [MNALNALHVATTSSTLNLTSSLRRAQELRMQLDGLGTLFDQARQSFLRSFLDLQQAGQDPIVVLEALKAAEPQRESIS # VEDWTVLATLFQWSSPFNLNGLNFDNRTPAEWIDLLRSLHSGASSATVTADGHLVDASQPPAAAVEVSEALDPQGSPPSTVIEQTSGVENLASLSEGS # PIQTELDLPQIESLTESTLSPEKGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g628 ### # start gene g629 Scaffold_5 AUGUSTUS gene 3028288 3029740 0.52 + . g629 Scaffold_5 AUGUSTUS transcript 3028288 3029740 0.52 + . g629.t1 Scaffold_5 AUGUSTUS start_codon 3028288 3028290 . + 0 transcript_id "g629.t1"; gene_id "g629"; Scaffold_5 AUGUSTUS CDS 3028288 3028455 0.64 + 0 transcript_id "g629.t1"; gene_id "g629"; Scaffold_5 AUGUSTUS CDS 3029096 3029231 0.91 + 0 transcript_id "g629.t1"; gene_id "g629"; Scaffold_5 AUGUSTUS CDS 3029313 3029740 1 + 2 transcript_id "g629.t1"; gene_id "g629"; Scaffold_5 AUGUSTUS stop_codon 3029738 3029740 . + 0 transcript_id "g629.t1"; gene_id "g629"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKEEKS # AVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKS # RQDSGSDSSVSDASFATAQSIPTTGSEDTVVTPTEMAVPVPKAVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g629 ### # start gene g630 Scaffold_5 AUGUSTUS gene 3032737 3033567 0.81 - . g630 Scaffold_5 AUGUSTUS transcript 3032737 3033567 0.81 - . g630.t1 Scaffold_5 AUGUSTUS stop_codon 3032737 3032739 . - 0 transcript_id "g630.t1"; gene_id "g630"; Scaffold_5 AUGUSTUS CDS 3032737 3033567 0.81 - 0 transcript_id "g630.t1"; gene_id "g630"; Scaffold_5 AUGUSTUS start_codon 3033565 3033567 . - 0 transcript_id "g630.t1"; gene_id "g630"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQMTLEVVTYTKQLKKLMI # LN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g630 ### # start gene g631 Scaffold_5 AUGUSTUS gene 3033813 3035118 0.81 - . g631 Scaffold_5 AUGUSTUS transcript 3033813 3035118 0.81 - . g631.t1 Scaffold_5 AUGUSTUS stop_codon 3033813 3033815 . - 0 transcript_id "g631.t1"; gene_id "g631"; Scaffold_5 AUGUSTUS CDS 3033813 3035040 0.9 - 1 transcript_id "g631.t1"; gene_id "g631"; Scaffold_5 AUGUSTUS CDS 3035096 3035118 0.81 - 0 transcript_id "g631.t1"; gene_id "g631"; Scaffold_5 AUGUSTUS start_codon 3035116 3035118 . - 0 transcript_id "g631.t1"; gene_id "g631"; # protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY # ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFR # IERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNI # PIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQL # SRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTIFYEMKYHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g631 ### # start gene g632 Scaffold_5 AUGUSTUS gene 3035472 3037455 0.28 - . g632 Scaffold_5 AUGUSTUS transcript 3035472 3037455 0.28 - . g632.t1 Scaffold_5 AUGUSTUS stop_codon 3035472 3035474 . - 0 transcript_id "g632.t1"; gene_id "g632"; Scaffold_5 AUGUSTUS CDS 3035472 3036654 0.45 - 1 transcript_id "g632.t1"; gene_id "g632"; Scaffold_5 AUGUSTUS CDS 3036941 3037455 0.48 - 0 transcript_id "g632.t1"; gene_id "g632"; Scaffold_5 AUGUSTUS start_codon 3037453 3037455 . - 0 transcript_id "g632.t1"; gene_id "g632"; # protein sequence = [MTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMP # EGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVHDED # VNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAA # LSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDD # ERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPF # KFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGEND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g632 ### # start gene g633 Scaffold_5 AUGUSTUS gene 3037535 3038432 0.62 - . g633 Scaffold_5 AUGUSTUS transcript 3037535 3038432 0.62 - . g633.t1 Scaffold_5 AUGUSTUS stop_codon 3037535 3037537 . - 0 transcript_id "g633.t1"; gene_id "g633"; Scaffold_5 AUGUSTUS CDS 3037535 3038040 0.88 - 2 transcript_id "g633.t1"; gene_id "g633"; Scaffold_5 AUGUSTUS CDS 3038111 3038432 0.63 - 0 transcript_id "g633.t1"; gene_id "g633"; Scaffold_5 AUGUSTUS start_codon 3038430 3038432 . - 0 transcript_id "g633.t1"; gene_id "g633"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFSAICEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDP # FKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTENNSNGCV # E] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g633 ### # start gene g634 Scaffold_5 AUGUSTUS gene 3040973 3041941 0.43 - . g634 Scaffold_5 AUGUSTUS transcript 3040973 3041941 0.43 - . g634.t1 Scaffold_5 AUGUSTUS stop_codon 3040973 3040975 . - 0 transcript_id "g634.t1"; gene_id "g634"; Scaffold_5 AUGUSTUS CDS 3040973 3041244 0.57 - 2 transcript_id "g634.t1"; gene_id "g634"; Scaffold_5 AUGUSTUS CDS 3041360 3041791 0.56 - 2 transcript_id "g634.t1"; gene_id "g634"; Scaffold_5 AUGUSTUS CDS 3041863 3041941 0.69 - 0 transcript_id "g634.t1"; gene_id "g634"; Scaffold_5 AUGUSTUS start_codon 3041939 3041941 . - 0 transcript_id "g634.t1"; gene_id "g634"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRPIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGVDNNND # DLDDDSGGLPRGEPGDPSGPGWSRRSRRSLVDLVDPVPQSLLTSPTSNVLCWKLLSGFKGSIETLGTVLAALGHPSDSSESKSKVKEPEVFDVVSQRN # GLSLISSPGPRLAAGLDVVLHGPCKGATGQLRRYDAQGEAEDALGNLKMKETENTGSTNIGSTPWLLAPTGILRPEMGLWMRPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g634 ### # start gene g635 Scaffold_5 AUGUSTUS gene 3049099 3049890 0.39 - . g635 Scaffold_5 AUGUSTUS transcript 3049099 3049890 0.39 - . g635.t1 Scaffold_5 AUGUSTUS stop_codon 3049099 3049101 . - 0 transcript_id "g635.t1"; gene_id "g635"; Scaffold_5 AUGUSTUS CDS 3049099 3049890 0.39 - 0 transcript_id "g635.t1"; gene_id "g635"; Scaffold_5 AUGUSTUS start_codon 3049888 3049890 . - 0 transcript_id "g635.t1"; gene_id "g635"; # protein sequence = [MRKIPFRRKLGGVLKGFSQWFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEI # RQHLITVNIAQGIAPTLKEAIKRAISVDVYLHNPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPH # RETTLPLLWTPRTSGSSLPRQIHGTQTRPRPTPATSTSTDIRYGTRAILPIPNESVQITSLTPTSAPAPVAATPSPPNQDFSNQIGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g635 ### # start gene g636 Scaffold_5 AUGUSTUS gene 3056555 3057784 0.61 + . g636 Scaffold_5 AUGUSTUS transcript 3056555 3057784 0.61 + . g636.t1 Scaffold_5 AUGUSTUS start_codon 3056555 3056557 . + 0 transcript_id "g636.t1"; gene_id "g636"; Scaffold_5 AUGUSTUS CDS 3056555 3057784 0.61 + 0 transcript_id "g636.t1"; gene_id "g636"; Scaffold_5 AUGUSTUS stop_codon 3057782 3057784 . + 0 transcript_id "g636.t1"; gene_id "g636"; # protein sequence = [MERPHLRLTKGGEQELLDEVGNGAGGFEVDQGELRSPATPSPTTIRAALAGSQPARLTSRSYNSFIILTRFPFSDLDE # DKEYATLVDSGATRCFIDKTVAMRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDW # KELCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQRPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQ # PGPHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYP # DLPTLDIESLNIPKIPSRSGLTPKGSIRRNNFRESSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g636 ### # start gene g637 Scaffold_5 AUGUSTUS gene 3073511 3074263 0.18 + . g637 Scaffold_5 AUGUSTUS transcript 3073511 3074263 0.18 + . g637.t1 Scaffold_5 AUGUSTUS start_codon 3073511 3073513 . + 0 transcript_id "g637.t1"; gene_id "g637"; Scaffold_5 AUGUSTUS CDS 3073511 3074263 0.18 + 0 transcript_id "g637.t1"; gene_id "g637"; Scaffold_5 AUGUSTUS stop_codon 3074261 3074263 . + 0 transcript_id "g637.t1"; gene_id "g637"; # protein sequence = [MVAQHPFAFAATSGELWVPQSYKQAMRRPDLWTAPMETEVRTLIQKECWELVPLPPNANLTGGRWTYAIKFDATGNLL # KRKARYVAQGYTQIQGLDYDKTYGGVARMESVRLVLAITAALKLSLFQVDFTAAFLNSPITHDVYMKQPEGFTEPGSEHLVCKLKKSIYGTMQGSHDW # QATLSAGYKADGYTTSRADPCIRYKRIQDEYTITSTYGDDVCGGSSTRAGRDEAIANLGKRWEANEVTSGVLLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g637 ### # start gene g638 Scaffold_5 AUGUSTUS gene 3097183 3097669 0.27 - . g638 Scaffold_5 AUGUSTUS transcript 3097183 3097669 0.27 - . g638.t1 Scaffold_5 AUGUSTUS stop_codon 3097183 3097185 . - 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_5 AUGUSTUS CDS 3097183 3097392 0.99 - 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_5 AUGUSTUS CDS 3097493 3097669 0.27 - 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_5 AUGUSTUS start_codon 3097667 3097669 . - 0 transcript_id "g638.t1"; gene_id "g638"; # protein sequence = [MASAAETMGMTLPGSSSFPAESQEKRAECASIGPAMYELVSRNILPREIMTRSAFENAMVLTMILGGSTNAVLHLIAI # AHSVGITLTIDDFQNVSDRTPFLADIKPSGKYLMEDVYKIGGIPSKSIAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g638 ### # start gene g639 Scaffold_5 AUGUSTUS gene 3105204 3106737 0.65 + . g639 Scaffold_5 AUGUSTUS transcript 3105204 3106737 0.65 + . g639.t1 Scaffold_5 AUGUSTUS start_codon 3105204 3105206 . + 0 transcript_id "g639.t1"; gene_id "g639"; Scaffold_5 AUGUSTUS CDS 3105204 3105254 0.65 + 0 transcript_id "g639.t1"; gene_id "g639"; Scaffold_5 AUGUSTUS CDS 3105346 3105659 0.74 + 0 transcript_id "g639.t1"; gene_id "g639"; Scaffold_5 AUGUSTUS CDS 3105804 3106737 0.99 + 1 transcript_id "g639.t1"; gene_id "g639"; Scaffold_5 AUGUSTUS stop_codon 3106735 3106737 . + 0 transcript_id "g639.t1"; gene_id "g639"; # protein sequence = [MDLSLGLPQASTVNEELVVGGLGTGKTSLLRLLLETADLSPTATVDQRAAVDRFLSGSPKPTQSIHTACVEICESKYD # RVLFSVIDSPGLDFMEGRELKLERQVSSVIKYIDAQYADTLSEVCIYLIDPSSIMTVAERRIKSSLPTKTRSETTVSYRTPPDLIPDTSSDSEDEESP # LTMAPAEIRVIRRLAARCNVLPTIAKSDSLTDDALKNAKEAVRRSLSEAGLDFGIFGPPQISTPKKARAARFAGDLNDATDASNTEDEDEERQSRPVI # KLRRPTVGRALSRSRSRRDLSQAAEDEHRPVSPDMESVASVRFSAHIVAKPDLTTLMPFALIAPEITALNRRNTSTDDQMLNTAPSSPIQQSEDGHAL # SVESSRRHSYLQGPPPDALKNVFIRKFRWGTVDVLDPDHCDFSALRTAVLSTHLKVSPCT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g639 ### # start gene g640 Scaffold_5 AUGUSTUS gene 3110300 3110662 0.6 + . g640 Scaffold_5 AUGUSTUS transcript 3110300 3110662 0.6 + . g640.t1 Scaffold_5 AUGUSTUS start_codon 3110300 3110302 . + 0 transcript_id "g640.t1"; gene_id "g640"; Scaffold_5 AUGUSTUS CDS 3110300 3110662 0.6 + 0 transcript_id "g640.t1"; gene_id "g640"; Scaffold_5 AUGUSTUS stop_codon 3110660 3110662 . + 0 transcript_id "g640.t1"; gene_id "g640"; # protein sequence = [MPNVVMMNATAVEDLIIHEDHAGQQRVAGVVTNWTLVALNHDTQSCMDPNTITCPVVVSATGHDGPMGAFSAKRLVSA # GLLKELGNMRGLDMNRSEPAIVNNTREVAPGLIMAGMIAFLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g640 ### # start gene g641 Scaffold_5 AUGUSTUS gene 3111072 3111506 0.46 + . g641 Scaffold_5 AUGUSTUS transcript 3111072 3111506 0.46 + . g641.t1 Scaffold_5 AUGUSTUS start_codon 3111072 3111074 . + 0 transcript_id "g641.t1"; gene_id "g641"; Scaffold_5 AUGUSTUS CDS 3111072 3111506 0.46 + 0 transcript_id "g641.t1"; gene_id "g641"; Scaffold_5 AUGUSTUS stop_codon 3111504 3111506 . + 0 transcript_id "g641.t1"; gene_id "g641"; # protein sequence = [MGFTLPSPDSPAEQAKTLMNQKKNIETEIESHISVLKANQSTMQTPLVDPDGFPRADIDIYAVRGARVRIIELRNDLK # DVTAAIGKALEAVYDRSQSESVGKREMSEESSSSKEPKAFAKVDGVAPGSPAADAVCGHSLLNVNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g641 ### # start gene g642 Scaffold_5 AUGUSTUS gene 3127845 3128465 0.63 + . g642 Scaffold_5 AUGUSTUS transcript 3127845 3128465 0.63 + . g642.t1 Scaffold_5 AUGUSTUS start_codon 3127845 3127847 . + 0 transcript_id "g642.t1"; gene_id "g642"; Scaffold_5 AUGUSTUS CDS 3127845 3128465 0.63 + 0 transcript_id "g642.t1"; gene_id "g642"; Scaffold_5 AUGUSTUS stop_codon 3128463 3128465 . + 0 transcript_id "g642.t1"; gene_id "g642"; # protein sequence = [MRSVSSSILSNLRKATSDEGYAASSATNDGSRGSGSGKALAANGKPLFKARGLPSTHEKPDIVPRTTRAASLRAGFPL # EKSPGPRKPPTKETRQTFANVPGHKRTDTIPVASTAAPAIAPRLTKAAALRLGLPPPPPTVRRQSSNSFEGVPGHKRRESIVVASTQEPTVKPKLNKS # ASLRVSKDKPHQLRSCVRIFFPLSTRWSVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g642 ### # start gene g643 Scaffold_5 AUGUSTUS gene 3148926 3149322 0.35 - . g643 Scaffold_5 AUGUSTUS transcript 3148926 3149322 0.35 - . g643.t1 Scaffold_5 AUGUSTUS stop_codon 3148926 3148928 . - 0 transcript_id "g643.t1"; gene_id "g643"; Scaffold_5 AUGUSTUS CDS 3148926 3149249 0.68 - 0 transcript_id "g643.t1"; gene_id "g643"; Scaffold_5 AUGUSTUS CDS 3149296 3149322 0.36 - 0 transcript_id "g643.t1"; gene_id "g643"; Scaffold_5 AUGUSTUS start_codon 3149320 3149322 . - 0 transcript_id "g643.t1"; gene_id "g643"; # protein sequence = [MWKSVSRLSRKEQQLRDSNASLEEAKEEIKELEKQVEEARDKIAKIDKEISESGSTLSNLRENIRLRKLVTQIQETQT # EIDSYDMEEAAKAKRTFQDKWKIAKNKEETLQLEVHIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g643 ### # start gene g644 Scaffold_5 AUGUSTUS gene 3149733 3150105 0.34 - . g644 Scaffold_5 AUGUSTUS transcript 3149733 3150105 0.34 - . g644.t1 Scaffold_5 AUGUSTUS stop_codon 3149733 3149735 . - 0 transcript_id "g644.t1"; gene_id "g644"; Scaffold_5 AUGUSTUS CDS 3149733 3149934 0.57 - 1 transcript_id "g644.t1"; gene_id "g644"; Scaffold_5 AUGUSTUS CDS 3150023 3150105 0.54 - 0 transcript_id "g644.t1"; gene_id "g644"; Scaffold_5 AUGUSTUS start_codon 3150103 3150105 . - 0 transcript_id "g644.t1"; gene_id "g644"; # protein sequence = [MEEQVAKAETTAMETKEIAEQVEQRLLREYGKTIARLQAEVERLKQDVKSIENELAASGSTKSTEDIQNEIEALSSEM # YVCPPRLNIHYNSDLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g644 ### # start gene g645 Scaffold_5 AUGUSTUS gene 3157305 3157859 0.53 + . g645 Scaffold_5 AUGUSTUS transcript 3157305 3157859 0.53 + . g645.t1 Scaffold_5 AUGUSTUS start_codon 3157305 3157307 . + 0 transcript_id "g645.t1"; gene_id "g645"; Scaffold_5 AUGUSTUS CDS 3157305 3157859 0.53 + 0 transcript_id "g645.t1"; gene_id "g645"; Scaffold_5 AUGUSTUS stop_codon 3157857 3157859 . + 0 transcript_id "g645.t1"; gene_id "g645"; # protein sequence = [MNERRLAYEGAVTLAEEEKMAHVTNLVLKQQTVEYRTEREHLLGRQKRAKMKAIREAKRVKMQAKMEAQAEMEAQAKT # EVQAETETEARTAVVQLDSEQDPVTAQPESVEVKTDTPEESASLEPVETKTDAPEVVQSQQVVEKSEQTTKFRPSQSESASEVATAGFLALVVDVDRI # CIGTNFSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g645 ### # start gene g646 Scaffold_5 AUGUSTUS gene 3166253 3166816 0.99 + . g646 Scaffold_5 AUGUSTUS transcript 3166253 3166816 0.99 + . g646.t1 Scaffold_5 AUGUSTUS start_codon 3166253 3166255 . + 0 transcript_id "g646.t1"; gene_id "g646"; Scaffold_5 AUGUSTUS CDS 3166253 3166816 0.99 + 0 transcript_id "g646.t1"; gene_id "g646"; Scaffold_5 AUGUSTUS stop_codon 3166814 3166816 . + 0 transcript_id "g646.t1"; gene_id "g646"; # protein sequence = [MESRRSTQTDTLLKYNDSLVRLLIREQRDLERAADALEARMDELQGPPPALLIIQTAVSRNKRCLLAYHSHRIDRLRD # LYWDVGGALPHILNNQDIRSKFSPHEVDYLRQYNNSLMEFRSEFSHELDITASITNPPKDLHVLVNVVKDCGVIQTELGSINFQKGQRFMVRRADIEH # LIIQGYLEEVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g646 ### # start gene g647 Scaffold_5 AUGUSTUS gene 3168995 3171383 0.89 - . g647 Scaffold_5 AUGUSTUS transcript 3168995 3171383 0.89 - . g647.t1 Scaffold_5 AUGUSTUS stop_codon 3168995 3168997 . - 0 transcript_id "g647.t1"; gene_id "g647"; Scaffold_5 AUGUSTUS CDS 3168995 3169748 1 - 1 transcript_id "g647.t1"; gene_id "g647"; Scaffold_5 AUGUSTUS CDS 3169845 3169951 0.9 - 0 transcript_id "g647.t1"; gene_id "g647"; Scaffold_5 AUGUSTUS CDS 3170011 3170411 0.98 - 2 transcript_id "g647.t1"; gene_id "g647"; Scaffold_5 AUGUSTUS CDS 3170843 3171383 1 - 0 transcript_id "g647.t1"; gene_id "g647"; Scaffold_5 AUGUSTUS start_codon 3171381 3171383 . - 0 transcript_id "g647.t1"; gene_id "g647"; # protein sequence = [MLQNSGWNEGEALGQDVVRRRRIQRGDPSPWVKIEEGQEEKEETVVEVPLGDGEITETRKIPIIDLTASDSESDSEPE # DDSPTDTLINFQRQAAASLSASGRKALLTPLPTVLKSDRLGIGLKAKTAGPYKESVKRVTHNTAALAAHFRRAEEARARKEKWGKGRRGFARRDKEEQ # VRRRSVAGLYDYGPSGSTLQANIIAEWRKHFIVEESMLELDTTIITPAPVFETSGHVARFADWMVKDVKTGDVIRADHLVKNVLEARLAGDKEARGQA # AAPAKEDEKDKKKKKSKTAKAAAVQLADDVAKSYEVTLAQLDNFSGAELGELCRKFNIRNPDTDNEVTEPQEFNLIYLRPETAQGHFLNFSRLLDYNN # GRVPFASAQIGRSFRNEISPRAGLLRVREFTMAEIEHFVDPQNKSHPRFKEMRDVVLVLLDRHVQSSGNTTLIKMSIGEAVEKGIIANETLAYFMARI # YLFLLKIGINPDRLRFRQHMSNEMAHYATDCWDAEIQNSTGWTECVGCADRAAYDLTVHSARTGHPLVVREALKEPIVTEKEVPEFNKKALGKTFKQD # AGVLQKHVESLDEAALSKLKSELAEGCVCFDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g647 ### # start gene g648 Scaffold_5 AUGUSTUS gene 3172939 3173388 0.94 + . g648 Scaffold_5 AUGUSTUS transcript 3172939 3173388 0.94 + . g648.t1 Scaffold_5 AUGUSTUS start_codon 3172939 3172941 . + 0 transcript_id "g648.t1"; gene_id "g648"; Scaffold_5 AUGUSTUS CDS 3172939 3173388 0.94 + 0 transcript_id "g648.t1"; gene_id "g648"; Scaffold_5 AUGUSTUS stop_codon 3173386 3173388 . + 0 transcript_id "g648.t1"; gene_id "g648"; # protein sequence = [MQRILSFEADRRTVNITINSFNTELSKDERARLFPAIGRLFPEGNNQLAKADEIDQVRSVCENVGEYRQFFADAGSSS # DEDSGILSQLEDRFFQTEVHLNKMAFLQQFQYGVFYAYMKLKEQEIRNITWIAECIAQNAKDRIQDFIPIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g648 ### # start gene g649 Scaffold_5 AUGUSTUS gene 3175334 3175966 0.64 - . g649 Scaffold_5 AUGUSTUS transcript 3175334 3175966 0.64 - . g649.t1 Scaffold_5 AUGUSTUS stop_codon 3175334 3175336 . - 0 transcript_id "g649.t1"; gene_id "g649"; Scaffold_5 AUGUSTUS CDS 3175334 3175966 0.64 - 0 transcript_id "g649.t1"; gene_id "g649"; Scaffold_5 AUGUSTUS start_codon 3175964 3175966 . - 0 transcript_id "g649.t1"; gene_id "g649"; # protein sequence = [MVVSQVRPNPLFQGILLTISPCSSNFIDRLPSSSSSVSGTLHSKNVFETMLMNDDVCDHEAVILVHQPGVCVFFFSTK # TFSVAKCTVQLHASDLRQLPKTSHIARSISDASSSRQYAYVPAMYTSDEDEHHLEFAQSVSQKCHARLINILAGQGGDVDFQTGGQKSVVVVNLPGVE # GSQSESRINGMVEHGALGPSMLRYSPQQCLCDLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g649 ### # start gene g650 Scaffold_5 AUGUSTUS gene 3187139 3188674 0.9 + . g650 Scaffold_5 AUGUSTUS transcript 3187139 3188674 0.9 + . g650.t1 Scaffold_5 AUGUSTUS start_codon 3187139 3187141 . + 0 transcript_id "g650.t1"; gene_id "g650"; Scaffold_5 AUGUSTUS CDS 3187139 3188674 0.9 + 0 transcript_id "g650.t1"; gene_id "g650"; Scaffold_5 AUGUSTUS stop_codon 3188672 3188674 . + 0 transcript_id "g650.t1"; gene_id "g650"; # protein sequence = [MLQALENGGRDQYAIYDSRAAVHEKTLRLREALLDVKEAIRLAPNRWQCYSRAARLFLLIRKFEEASKMVDIALQKID # PSDDKNRATLVALQSQVIESRKRLSCHIGMLPVELLSSIFQYMVEEEPVLVIKISRVCRHWRTVALGDAALWSTLVLSKKDPNRKSKCWIQRSRGRIR # ELCLRRTLSDKVDWSLEKLGGIQWDYIRTCQLEDIDIFKQLEKAGALHVISQLETLVIRDKLMDSREEFVSYLSDNLRHLTIDGALHVWLSDLQVHSL # VSLETIRLGERFIGDLFQLLTKNLSLQSLVVNSPFSAFSEYPEATITLAHLTVLDYCSGSTQLFKFLRLPSLQVISIQTCVQTKNVIQCLLDSGTSQL # KSITFDSCAHLPASELIRILSTNPFVASLTLKKFGGGTVTPILDMLGSSEQLCPALTHLDLSSSSEISSHLLVRIVSSRITAVVESLLNQNEETGRPR # VEKIHSLIVDGCTGIDSDTIPWFCERVPHFSYVTRQWNGRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g650 ### # start gene g651 Scaffold_5 AUGUSTUS gene 3198866 3199840 0.85 + . g651 Scaffold_5 AUGUSTUS transcript 3198866 3199840 0.85 + . g651.t1 Scaffold_5 AUGUSTUS start_codon 3198866 3198868 . + 0 transcript_id "g651.t1"; gene_id "g651"; Scaffold_5 AUGUSTUS CDS 3198866 3199840 0.85 + 0 transcript_id "g651.t1"; gene_id "g651"; Scaffold_5 AUGUSTUS stop_codon 3199838 3199840 . + 0 transcript_id "g651.t1"; gene_id "g651"; # protein sequence = [MLLRILVLKTPLCAFPTQFSIFKLTLYRSAGTQTSNVIVSVTSSPSHDRHLSHTTTSTGSKKRRTKRSKQAIATYDDL # VDSQEQSKQAKRHSDNVPNFSHFPAGEDVSIETSSPRFYTSTVSSSSSPSLSPSSSPLISSTIPKDGEPYPLPISQEYNPRHPPALPIIAQQAFTSMS # DSLLPNVTTTGPQLNPSERGIVHLSPIPSSSNGNSTKRFDRSSTKPISRQYGSNSSGSSSNASSSLSNYYTPEEISSGDDSQFSSQKSGSTSSSSRNG # GLSRSDDVSVYSQASEPRVSVRFQHIQDAHGHHIVTGREGKLTRCEDEVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g651 ### # start gene g652 Scaffold_5 AUGUSTUS gene 3200398 3201111 0.96 + . g652 Scaffold_5 AUGUSTUS transcript 3200398 3201111 0.96 + . g652.t1 Scaffold_5 AUGUSTUS start_codon 3200398 3200400 . + 0 transcript_id "g652.t1"; gene_id "g652"; Scaffold_5 AUGUSTUS CDS 3200398 3201111 0.96 + 0 transcript_id "g652.t1"; gene_id "g652"; Scaffold_5 AUGUSTUS stop_codon 3201109 3201111 . + 0 transcript_id "g652.t1"; gene_id "g652"; # protein sequence = [MEFELESDFFNPLYPRSSSNPASTTSAPSGSDSPDSIKTHSSGSDGTSSSGAQTGSSESEITVVPNSSSTAARSAEDS # NFTTSIATSSNSSGVTTVTNSSTLPQSPLEETDPLEALQPRSGHPPVHGLVGDYSWTPNTEDIIESTTTRSKPLLALERLRRLSQMPGASDNTLPILH # LAPLLDSMRRLVDRFARVVMLMVNTKSCPGAPNGGVSMMDVFAVMAQINEQLGDAPDLELS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g652 ### # start gene g653 Scaffold_5 AUGUSTUS gene 3203618 3204675 0.13 + . g653 Scaffold_5 AUGUSTUS transcript 3203618 3204675 0.13 + . g653.t1 Scaffold_5 AUGUSTUS start_codon 3203618 3203620 . + 0 transcript_id "g653.t1"; gene_id "g653"; Scaffold_5 AUGUSTUS CDS 3203618 3204113 0.13 + 0 transcript_id "g653.t1"; gene_id "g653"; Scaffold_5 AUGUSTUS CDS 3204152 3204675 0.5 + 2 transcript_id "g653.t1"; gene_id "g653"; Scaffold_5 AUGUSTUS stop_codon 3204673 3204675 . + 0 transcript_id "g653.t1"; gene_id "g653"; # protein sequence = [MVPSETSTSPAHSRSNSSLGSLQAKSTSEVDFIVEALANSSQRSSSAHSIDESRSPRKTTTGLFPVADSQYPVRPIKV # PEIDTQTPLTHQTSQPSPKSSNPAIQPPLNSTSETKPIEYKSLPLLTSKAEKLSLRVLIVEVRLSSFCFVPFLDSFSVQRITILIDSFNTTNGQEGLD # KVMSDRNFDCVLMDINMPILNGLEASERIREFEKAFPSSDVQRLSLKLNGRIPIFAVSASLYEHQRSKLSDAGMDGWILKPIDFKRLATILKGVTDLA # QRERDRYTPGGNWEVGGWLAMSPTPSDAPLRAYRDRHEFSFPLQAFLLRVYYSSSYILSNCASSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g653 ### # start gene g654 Scaffold_5 AUGUSTUS gene 3209631 3210839 0.92 - . g654 Scaffold_5 AUGUSTUS transcript 3209631 3210839 0.92 - . g654.t1 Scaffold_5 AUGUSTUS stop_codon 3209631 3209633 . - 0 transcript_id "g654.t1"; gene_id "g654"; Scaffold_5 AUGUSTUS CDS 3209631 3210839 0.92 - 0 transcript_id "g654.t1"; gene_id "g654"; Scaffold_5 AUGUSTUS start_codon 3210837 3210839 . - 0 transcript_id "g654.t1"; gene_id "g654"; # protein sequence = [MDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPELEPPAENP # HIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLP # AHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRL # QGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRL # EKHDLYLRPKNANLNNNRLNTSDSSSQKGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g654 ### # start gene g655 Scaffold_5 AUGUSTUS gene 3211204 3212280 0.59 - . g655 Scaffold_5 AUGUSTUS transcript 3211204 3212280 0.59 - . g655.t1 Scaffold_5 AUGUSTUS stop_codon 3211204 3211206 . - 0 transcript_id "g655.t1"; gene_id "g655"; Scaffold_5 AUGUSTUS CDS 3211204 3212280 0.59 - 0 transcript_id "g655.t1"; gene_id "g655"; Scaffold_5 AUGUSTUS start_codon 3212278 3212280 . - 0 transcript_id "g655.t1"; gene_id "g655"; # protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFNAENPP # FGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAI # SVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPHRETTCRYCGRRGHLEAVCQDKFMGL # GRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g655 ### # start gene g656 Scaffold_5 AUGUSTUS gene 3215785 3218262 0.4 + . g656 Scaffold_5 AUGUSTUS transcript 3215785 3218262 0.4 + . g656.t1 Scaffold_5 AUGUSTUS start_codon 3215785 3215787 . + 0 transcript_id "g656.t1"; gene_id "g656"; Scaffold_5 AUGUSTUS CDS 3215785 3218262 0.4 + 0 transcript_id "g656.t1"; gene_id "g656"; Scaffold_5 AUGUSTUS stop_codon 3218260 3218262 . + 0 transcript_id "g656.t1"; gene_id "g656"; # protein sequence = [MNSIFADLIAAGKVAVYLDDILIFSASLQEHRKIVHEVLERLAKNDLYLRPEKCEFEQTSIEYLGLIISEGEVRMDPV # KVEAVKNWPAPTCLRDVRGFLGFANFYRRFIDGFAKKARALNDLTKKGVGWSWGTNEQVAFEALKEAFTTAPILVLWDPDKPTRIEVDASGFATGGAL # LQQQGDGLWHPVAFRSASMDPAERNYEIYDREMLAIIEALKDWRHFLEGLPNPFEIVTDHRNLEYWRTAQDLSRRQARWALWLSRFDFTLTHRAGKAN # AQADALSRVSQLEVMDADDNQQQIVLRPEHFLRAATAVLFQNPLEERIRKASERESEVLEGLRKLKTHGPHKLVNGLAEWEEKEGIVYYKGRVYVPPD # PQLRRDVVAQCHDALTAGHPGKHRTLELVSRQFWWPTVRSFVDKYVEGCDNCQRRRVRPQPQSSLEPLPVPGGPWQDIGVDLIGELPMTQDGHNAAIT # FTDHYSKMIHCFPTTTELTAEGVADFYYKEIFRLHGLPRRFISDRGPQFAADIMKALLKRLGIESALTTSYHPETNGQTERANQEIERYIRMYVSRRQ # DDWDRLLPTAEFVINSRVHFAHDKAPFEVLYGYTPEFSIPIGSWKEYPSITDRLDALRHAREDAEAALRMSKQRIADTIAEHPNQPSFEVGQPVWLSV # NNLKIRRKSEKLGSRRLGPFEVIEKTGAHTYRLALPTWMKIHDNINVKRLAPWKGNEVNGILPAPPEPEVIDGEEFYDVDRILDSRIHGRWKKLQYLV # RWKGYDEGHDTWENEENVVGSSDEAINEFYAAHPNAPRKISATIFHSLPWQPMVNFTEVNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g656 ### # start gene g657 Scaffold_5 AUGUSTUS gene 3221125 3221526 0.59 + . g657 Scaffold_5 AUGUSTUS transcript 3221125 3221526 0.59 + . g657.t1 Scaffold_5 AUGUSTUS start_codon 3221125 3221127 . + 0 transcript_id "g657.t1"; gene_id "g657"; Scaffold_5 AUGUSTUS CDS 3221125 3221526 0.59 + 0 transcript_id "g657.t1"; gene_id "g657"; Scaffold_5 AUGUSTUS stop_codon 3221524 3221526 . + 0 transcript_id "g657.t1"; gene_id "g657"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDL # DTGDHDDQDPPVDPDDPGADNNMTIWMTIPAVYRVVSLVVPAVLVDLVDLVLLIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g657 ### # start gene g658 Scaffold_5 AUGUSTUS gene 3224780 3225394 0.7 + . g658 Scaffold_5 AUGUSTUS transcript 3224780 3225394 0.7 + . g658.t1 Scaffold_5 AUGUSTUS start_codon 3224780 3224782 . + 0 transcript_id "g658.t1"; gene_id "g658"; Scaffold_5 AUGUSTUS CDS 3224780 3225394 0.7 + 0 transcript_id "g658.t1"; gene_id "g658"; Scaffold_5 AUGUSTUS stop_codon 3225392 3225394 . + 0 transcript_id "g658.t1"; gene_id "g658"; # protein sequence = [MVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFVLSLLTNNSLRLFELPSGRPGFTSLDYHGYRSPTPSII # LALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVLITAIFAFKSSLLSMIIHSPAISARTALSKLYVVNTPGPRSETLFVTTLPLALSVVAI # SPAVTALRLVETSAGSGPTMGFHLHGLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g658 ### # start gene g659 Scaffold_5 AUGUSTUS gene 3235574 3237016 0.96 + . g659 Scaffold_5 AUGUSTUS transcript 3235574 3237016 0.96 + . g659.t1 Scaffold_5 AUGUSTUS start_codon 3235574 3235576 . + 0 transcript_id "g659.t1"; gene_id "g659"; Scaffold_5 AUGUSTUS CDS 3235574 3235748 1 + 0 transcript_id "g659.t1"; gene_id "g659"; Scaffold_5 AUGUSTUS CDS 3235823 3235858 1 + 2 transcript_id "g659.t1"; gene_id "g659"; Scaffold_5 AUGUSTUS CDS 3236829 3237016 0.96 + 2 transcript_id "g659.t1"; gene_id "g659"; Scaffold_5 AUGUSTUS stop_codon 3237014 3237016 . + 0 transcript_id "g659.t1"; gene_id "g659"; # protein sequence = [MFSPSGPKSEQELIGSFATPTGSPSRESPVTETEDEEEGQSLRLSALEFMLSLCEARPNSSPTSPTGVNVDPIVQRLL # KLLNPEADPTQVQRHVQEQVITTLAMVADASEATFAKVGVTWTIGLFLLGFELF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g659 ### # start gene g660 Scaffold_5 AUGUSTUS gene 3237407 3238264 0.33 + . g660 Scaffold_5 AUGUSTUS transcript 3237407 3238264 0.33 + . g660.t1 Scaffold_5 AUGUSTUS start_codon 3237407 3237409 . + 0 transcript_id "g660.t1"; gene_id "g660"; Scaffold_5 AUGUSTUS CDS 3237407 3237431 0.49 + 0 transcript_id "g660.t1"; gene_id "g660"; Scaffold_5 AUGUSTUS CDS 3237521 3237758 0.68 + 2 transcript_id "g660.t1"; gene_id "g660"; Scaffold_5 AUGUSTUS CDS 3237895 3238264 0.76 + 1 transcript_id "g660.t1"; gene_id "g660"; Scaffold_5 AUGUSTUS stop_codon 3238262 3238264 . + 0 transcript_id "g660.t1"; gene_id "g660"; # protein sequence = [MPDLLTTANEDEEKVEERDGWETVNMDGQTFGIRTAAIEEKCQAFETMVIFASTLNARYAPYLAQSLEITLPALRFYF # HDGVREACAFVISDEQDSTFLASLYKALDDCVKLLGGPSVLNADYVNAIVQATKRQLHTLAQKRRSRAARPSSFLDDDREDLALLEEMEDFALEEMAK # VLSMLNSNHELLVAISSVKELGTNQYQTELEEDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g660 ### # start gene g661 Scaffold_5 AUGUSTUS gene 3249641 3250687 0.59 + . g661 Scaffold_5 AUGUSTUS transcript 3249641 3250687 0.59 + . g661.t1 Scaffold_5 AUGUSTUS start_codon 3249641 3249643 . + 0 transcript_id "g661.t1"; gene_id "g661"; Scaffold_5 AUGUSTUS CDS 3249641 3250687 0.59 + 0 transcript_id "g661.t1"; gene_id "g661"; Scaffold_5 AUGUSTUS stop_codon 3250685 3250687 . + 0 transcript_id "g661.t1"; gene_id "g661"; # protein sequence = [MQTSTKRQKRSQRKDDDNALDWAQNSFDEIDDPDLDVIDDAHFVTAQTPVSRMAQQVRMRNEMEELRRWLEEDERDSR # NDESEDGGDSRNDPWGRAVSSTTSQSAMMTLSPTSEEGGLSYPEPLKEDKFDDDFTVFVSAPAQDSVPNPSHPASASPSKSHQDFISEGSFPSFASFG # DSSFTAAYPFDDESSGLYGDTSFDSLAPPDQHSGIMYHSLGSASDLGDLPNEEAFPAHSSPHMQADNDHKEADDSDDGLPTQSEIRASAHRIFGTLSS # PSSSSAKRLEADAAEETNAKFDEFDDDMDFDLTHMVSAIQGMKAEISGMENEDDRRKAAARVALGLVYGLDRRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g661 ### # start gene g662 Scaffold_5 AUGUSTUS gene 3253310 3255632 0.58 + . g662 Scaffold_5 AUGUSTUS transcript 3253310 3255632 0.58 + . g662.t1 Scaffold_5 AUGUSTUS start_codon 3253310 3253312 . + 0 transcript_id "g662.t1"; gene_id "g662"; Scaffold_5 AUGUSTUS CDS 3253310 3254662 0.64 + 0 transcript_id "g662.t1"; gene_id "g662"; Scaffold_5 AUGUSTUS CDS 3254748 3255632 0.89 + 0 transcript_id "g662.t1"; gene_id "g662"; Scaffold_5 AUGUSTUS stop_codon 3255630 3255632 . + 0 transcript_id "g662.t1"; gene_id "g662"; # protein sequence = [MKPGAAFEMIEEDLMFPGGAIRVDDENESIPENFNSHPVESTLFSDSGARQHSSASSISSFYFASGPEIRNRNRPRSS # SSTDSSSTATDIANSHIVEKTFRRRSVPVKGSDQRRNTTLDYATLTSLMGLGDGENNLVISETEDENHYQELDRKRYSGSDWDSLLANTSSSPRNSSV # EEQDRTTHDPLAVPSPANQAAGVTSPSRCSPLPLPSPSSSAPALPSFLASPTTAFMSMPSVIPNTMGRGLEAEAIVEDEEGEKNATWASVNDDRTANG # QLDTSAESHMPSHFQEPTDSTIMPVKPQLSEIHTPSIPASSKSTPLRHPLSVSTGSLTDLQLSSPYSPNPYAKLNYVTSSNSPSSPKRPLSTSNNGFG # TSSSIHLPSMSFSQSMHSLSSSSPHSLNAAVDADKESRIISSGSTAAPFLLRTLPKPPVNPRDHSMLEMIYNEMNAARFVLILFPLDLRTHPPVIFTF # PPIPVVEQSRSSDPDPDPDEDAQDAIRPSPLSAGTVHTARGRSMSNASNVSSRLTGSPTPSSVRTAYFEGLPDHWINMRQIVKRESPYVIYDGSRLSA # LSPSTRASILSSSIKQPTSSSLASSTASARTGSMKEEDSAAADADRSYSEIDPPRGTHDMFSPRPHNPDHDVRFRLPNTTMNIDLRSLNLHLALRVTE # ILACSETMWEWVLDYQEQARNKKIIQEKKTRARSRSIGPVRPPSRDQPSEPESSEARLKTALTELTRETYEDMLRRFYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g662 ### # start gene g663 Scaffold_5 AUGUSTUS gene 3257396 3258049 0.54 - . g663 Scaffold_5 AUGUSTUS transcript 3257396 3258049 0.54 - . g663.t1 Scaffold_5 AUGUSTUS stop_codon 3257396 3257398 . - 0 transcript_id "g663.t1"; gene_id "g663"; Scaffold_5 AUGUSTUS CDS 3257396 3258049 0.54 - 0 transcript_id "g663.t1"; gene_id "g663"; Scaffold_5 AUGUSTUS start_codon 3258047 3258049 . - 0 transcript_id "g663.t1"; gene_id "g663"; # protein sequence = [MPGGLSIGSTAGGNAKEDEDSVEEDESSRGGRAQVGDKRRRRASSNAGPPPPSSSSNRGGPTGSPHSVNSTIPPHLSI # SSGTNASQSQPSSAHPGTSPQMSMGASPTSPQQGHAVPPTNSNPQYASSYGHHTHHPSQHPSHQQQSPDGGMYGGTPAHMMPAGNYSYPGNQSNATGG # QQQLGGLAAAAAQHGHWGTAQQQQQQQPQQVAGQNTHYTRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g663 ### # start gene g664 Scaffold_5 AUGUSTUS gene 3265690 3266529 0.72 - . g664 Scaffold_5 AUGUSTUS transcript 3265690 3266529 0.72 - . g664.t1 Scaffold_5 AUGUSTUS stop_codon 3265690 3265692 . - 0 transcript_id "g664.t1"; gene_id "g664"; Scaffold_5 AUGUSTUS CDS 3265690 3266529 0.72 - 0 transcript_id "g664.t1"; gene_id "g664"; Scaffold_5 AUGUSTUS start_codon 3266527 3266529 . - 0 transcript_id "g664.t1"; gene_id "g664"; # protein sequence = [MDVDEVPGLASTSTPVLVEREKSIDRMVESPSSQTPLPTDEHLMSSFGASTSGEGSRRSSSSEDISGTSNGLARRNGK # RPVAADFVDFDAAPRDRHGSGIKRSTGSFASISTMRRCVIDLSDSEGEADGEDVQIKPAAVPPGTTNSRYSTPPTSSAAAATPDFRTMSPAALAVKEL # EIQKMRQMIAEREQGRRMKLKVGSTEQICANFKLKTWQKLEAMSNPDSIPVKQEEEDLLSSLAIPVTQSPSMESSGISPMHHRMFISLIISVRSHREH # HILVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g664 ### # start gene g665 Scaffold_5 AUGUSTUS gene 3267099 3267815 0.86 - . g665 Scaffold_5 AUGUSTUS transcript 3267099 3267815 0.86 - . g665.t1 Scaffold_5 AUGUSTUS stop_codon 3267099 3267101 . - 0 transcript_id "g665.t1"; gene_id "g665"; Scaffold_5 AUGUSTUS CDS 3267099 3267815 0.86 - 0 transcript_id "g665.t1"; gene_id "g665"; Scaffold_5 AUGUSTUS start_codon 3267813 3267815 . - 0 transcript_id "g665.t1"; gene_id "g665"; # protein sequence = [MFGLLSSQSTGAESSKDVAPVASTEDAASSLRAAALLTLKSSKRRKVNPDQAQSSTLPIRPAAVDNSVQLDYGQDDAE # TDIASSPPEKPSLNQQPPPSIKIPEVDMEDGQVREEGEISDSEEVSPVIAAASVQSKTTTPSPTSNRPSPPRPSNNRHVPSSTFALKVETSSSSLLDR # MSAVPHGPSSKSPQRVEVTNGEHTYFVDVDHVRPGLESWSWFNLPKPSGLKFFHLFSESRTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g665 ### # start gene g666 Scaffold_5 AUGUSTUS gene 3272150 3273293 0.3 - . g666 Scaffold_5 AUGUSTUS transcript 3272150 3273293 0.3 - . g666.t1 Scaffold_5 AUGUSTUS stop_codon 3272150 3272152 . - 0 transcript_id "g666.t1"; gene_id "g666"; Scaffold_5 AUGUSTUS CDS 3272150 3272922 0.93 - 2 transcript_id "g666.t1"; gene_id "g666"; Scaffold_5 AUGUSTUS CDS 3272978 3273293 0.3 - 0 transcript_id "g666.t1"; gene_id "g666"; Scaffold_5 AUGUSTUS start_codon 3273291 3273293 . - 0 transcript_id "g666.t1"; gene_id "g666"; # protein sequence = [MKNDALAGGVYVFEGESAFLWPTPEPGTVPIFRLYNQNSSDHFYTMSSDEVPEMMNAGWAYDTAPNHTAGYVYPYSIC # GAAPIYRLFDPTSVDHFYTMDCRKSECANGTVAQSSAIPYLLPSTITASPESQVSATTSSSCANIANAVPLLRAYSSGGTDHFYTTNSTEMNNSVAVN # AYSFEGDATFLWPTQETSTVPLYRLWNLNSSDHFYTIDKNEVNQALAMGFTFDTEAQNVGYVYPYSICGASPIYRLFSSFGSDHFYTMNQAESMSAPG # YVLEGIAGYALLPSADGQRQTSASPFLLPLSLQASPVSISLSPIPAFTTSIAIDTGAPSGLPSTAIVQSVSCHVFLSVTALVAFWIAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g666 ### # start gene g667 Scaffold_5 AUGUSTUS gene 3276386 3276680 0.56 + . g667 Scaffold_5 AUGUSTUS transcript 3276386 3276680 0.56 + . g667.t1 Scaffold_5 AUGUSTUS start_codon 3276386 3276388 . + 0 transcript_id "g667.t1"; gene_id "g667"; Scaffold_5 AUGUSTUS CDS 3276386 3276432 0.56 + 0 transcript_id "g667.t1"; gene_id "g667"; Scaffold_5 AUGUSTUS CDS 3276491 3276680 0.99 + 1 transcript_id "g667.t1"; gene_id "g667"; Scaffold_5 AUGUSTUS stop_codon 3276678 3276680 . + 0 transcript_id "g667.t1"; gene_id "g667"; # protein sequence = [MADSRPAIEALGSMMWYLQQLNIDKDITMRNFNIYDPMKRGEGLVLDGQTLAHIEVRKTFAHVVYWFYKDMRAGPTEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g667 ### # start gene g668 Scaffold_5 AUGUSTUS gene 3279509 3280735 0.96 - . g668 Scaffold_5 AUGUSTUS transcript 3279509 3280735 0.96 - . g668.t1 Scaffold_5 AUGUSTUS stop_codon 3279509 3279511 . - 0 transcript_id "g668.t1"; gene_id "g668"; Scaffold_5 AUGUSTUS CDS 3279509 3280735 0.96 - 0 transcript_id "g668.t1"; gene_id "g668"; Scaffold_5 AUGUSTUS start_codon 3280733 3280735 . - 0 transcript_id "g668.t1"; gene_id "g668"; # protein sequence = [MNNALAGGVYALEGDSAFLWSTPQPGTIPLFRLYNDISTDHFYTMSYDELPEMMENGWAYDSAPNHTAGYVYPYSICG # AAPIYRLFNPTIVDHFYTMDVAESQNAVKTGYQDQGIAGFAILPAANGNVVQSSAVPYLLPSAVTASPESQVSATSSSDCANNANAIPLLRAFSSTGK # DHFYTTNSTEMNGVAIAQDAYSFEGDATFLWSTQETSTVPLYRLYSQTANDHFYTIDANETSEAIASGYAFDTDSHIAGYVYPYSICGASPMYRLYSS # SSSDHFYTMSQAESQSASASGYILEGIVGFALLPSVDGQPQTATVSASPLLLPASLEPSAVSIPSASSSDSGFPTTIAIGPTTSFSSTPGSISTTSIS # GHSTNKAIHQSAVSLCGAFGVYMLVAARTTAIFSIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g668 ### # start gene g669 Scaffold_5 AUGUSTUS gene 3281264 3282289 0.97 - . g669 Scaffold_5 AUGUSTUS transcript 3281264 3282289 0.97 - . g669.t1 Scaffold_5 AUGUSTUS stop_codon 3281264 3281266 . - 0 transcript_id "g669.t1"; gene_id "g669"; Scaffold_5 AUGUSTUS CDS 3281264 3282289 0.97 - 0 transcript_id "g669.t1"; gene_id "g669"; Scaffold_5 AUGUSTUS start_codon 3282287 3282289 . - 0 transcript_id "g669.t1"; gene_id "g669"; # protein sequence = [MSSDELPEMMSLGWTNDTALNQTAGYVYPYSTCGAAPIYRLFNPSTIDHFYTMDVAESQNAVQVGYQDQGIAGFAILS # SADGSSVQNSAVPYLLPSTITATPESQASPVSSSSCANSADAIPFLRAYASTGTDHFYTTNSTEMNNARGSYSFEGDAAFLWSTQEASTVPLYRLFNQ # NLNDHFYTMDANESNEALSSGYAFDTDSHIAGYVYPYSICGASPIYRLYSSTLADHFYTLSQNESASAAGYVLEGIAGFALLPSADGQPQTATVSASP # LLLPVTLDPSPISISSTFVAAYSTTIDIDPVSTSAASNSGNKAIARRGVSCYGFLSVLISGLVTAVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g669 ### # start gene g670 Scaffold_5 AUGUSTUS gene 3283198 3284232 0.66 - . g670 Scaffold_5 AUGUSTUS transcript 3283198 3284232 0.66 - . g670.t1 Scaffold_5 AUGUSTUS stop_codon 3283198 3283200 . - 0 transcript_id "g670.t1"; gene_id "g670"; Scaffold_5 AUGUSTUS CDS 3283198 3284232 0.66 - 0 transcript_id "g670.t1"; gene_id "g670"; Scaffold_5 AUGUSTUS start_codon 3284230 3284232 . - 0 transcript_id "g670.t1"; gene_id "g670"; # protein sequence = [MSSDELPEMMARGWAYDTAPNHTAGYVYPFSICGAAPIYRLFNPTITDHFYTMDIAECQSAAKDNGYQDQGIAGFAIL # PSANGSVVKIVASAVPNLLPSTVTASPESQVSVTPSAGCANNTNAIPFMRAISTADTDHFYTTNSTEMNVVAIAQNTYLFEGDTVFLWPTQESSTVPL # YRLYSQTARDHFYTIDANELSEALLEGYVFDTDSHIAGYVYPYSICGASPIYRLYSSFSSDHYYTMTQAESASATASFGYIVQGIAGFALLPSTDGQL # RTVTLSASPFLLPVSIEPSPTSSLRLPAFLTTVSITPSSLSFPSKALVQSVVSRREILGLSVLTAVWMIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g670 ### # start gene g671 Scaffold_5 AUGUSTUS gene 3285612 3286085 0.99 + . g671 Scaffold_5 AUGUSTUS transcript 3285612 3286085 0.99 + . g671.t1 Scaffold_5 AUGUSTUS start_codon 3285612 3285614 . + 0 transcript_id "g671.t1"; gene_id "g671"; Scaffold_5 AUGUSTUS CDS 3285612 3286085 0.99 + 0 transcript_id "g671.t1"; gene_id "g671"; Scaffold_5 AUGUSTUS stop_codon 3286083 3286085 . + 0 transcript_id "g671.t1"; gene_id "g671"; # protein sequence = [MQQIEGQVGLLFTDTEPEEVIEWFADFAQPDFARAGNVASRTVILPAGPVMMHHSDPPVPFPHDEDPQLRRLGLTTKM # ERGVPTLQAPHKLCQKGKVLTAEQAQLLKLTGEKMVTFRVGLIARWDAATGEVTQVEGPRLTQDEIISGDAEDEGAMSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g671 ### # start gene g672 Scaffold_5 AUGUSTUS gene 3288035 3288743 0.57 + . g672 Scaffold_5 AUGUSTUS transcript 3288035 3288743 0.57 + . g672.t1 Scaffold_5 AUGUSTUS start_codon 3288035 3288037 . + 0 transcript_id "g672.t1"; gene_id "g672"; Scaffold_5 AUGUSTUS CDS 3288035 3288181 0.57 + 0 transcript_id "g672.t1"; gene_id "g672"; Scaffold_5 AUGUSTUS CDS 3288249 3288743 0.96 + 0 transcript_id "g672.t1"; gene_id "g672"; Scaffold_5 AUGUSTUS stop_codon 3288741 3288743 . + 0 transcript_id "g672.t1"; gene_id "g672"; # protein sequence = [MRATGIFGLVVSVEASLTIFRAKIVIYDLKKDVRFTLTQRWDRSPGSLAFSKEGDFIYFTADDHALVKVFVLPIPSTP # AKSTTDPSLSPKYLNPVTIVEDGASSGLQTLPYGRILISKSSFTSPNDVFLVKGLDALQAQITQSDGTARFTGEIDQVTNFTAPDLEGKNLSKGENFW # FKGANDIDVQGWILKPKGWKHGEKKAFPILLLIHGGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g672 ### # start gene g673 Scaffold_5 AUGUSTUS gene 3291952 3294123 0.31 + . g673 Scaffold_5 AUGUSTUS transcript 3291952 3294123 0.31 + . g673.t1 Scaffold_5 AUGUSTUS start_codon 3291952 3291954 . + 0 transcript_id "g673.t1"; gene_id "g673"; Scaffold_5 AUGUSTUS CDS 3291952 3294123 0.31 + 0 transcript_id "g673.t1"; gene_id "g673"; Scaffold_5 AUGUSTUS stop_codon 3294121 3294123 . + 0 transcript_id "g673.t1"; gene_id "g673"; # protein sequence = [MTPERWAEYQSTTKQQLISGKVVRSLVCGQSSQCLFMLTIACKLVPLSRHSPLPELQAFVSLFRPNRIIPNTLDPSLK # NLDWAGIDRVFESCCRKPQHTSANFHHAIPPAPIAHEFDLGLFQPQSDDDEDDIAVKNIVADATNDADLKARAMAKKWLVDPGYGLDPSALKGRNGRR # VDVLRSWLGLRKWDNHQGSSPLTHSDAAKGKQKVEDRRQSQSGQQKSRGIPRDVRNRSSSDNEFDSSADEDNHARTAHKLFAPSDEGKDHLVQKYWES # SSFSFQLSDEEDVAEVQVSLTPNAANERRLEPGQQSKIRIERTMISSPVRAVALKSYKAKNRTSLIPVDFVTSTPSLKRRSCPRPDPFVPSQSPLIAQ # ARSLHFSPSSPAHSPSPFNKLAHRPETPHKQGIRPKKLAKRTLDSPIHLISSSPSSKSGSRSQESKHSPSNTRERRRSGTTKGGVNSSPPLSSPLNNR # KRASRQPEITDLAASEERPRKRFKEVPNIPNMEPQALDQPLKEVKNISRPSNSPKNPLVLSSNDASFLSRESDQKNLNRVQCASNSPRTGSSKVLRAA # VTIPALITSKYISPSRSRRNPYVRVCRSSPHRNKSELLDIQLRAARKAASALFPNVPPAFEAKCLKLKQRRDHARLKETVSVDYASAEMKMNKRRVEE # FDKKIRNNPTWNGQDNAVDWERSRMLERRATEDLRQGKKPTFPTLECVQGLDNNDDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g673 ### # start gene g674 Scaffold_5 AUGUSTUS gene 3298554 3299207 0.77 + . g674 Scaffold_5 AUGUSTUS transcript 3298554 3299207 0.77 + . g674.t1 Scaffold_5 AUGUSTUS start_codon 3298554 3298556 . + 0 transcript_id "g674.t1"; gene_id "g674"; Scaffold_5 AUGUSTUS CDS 3298554 3299207 0.77 + 0 transcript_id "g674.t1"; gene_id "g674"; Scaffold_5 AUGUSTUS stop_codon 3299205 3299207 . + 0 transcript_id "g674.t1"; gene_id "g674"; # protein sequence = [MLFGNTPNIPRLPDEKQLVGKENWRLYKREILFAVQSRGLTGYIDGMIPRPNSYPGLIYPSAQTTTPLFSSTPCLEEW # EACDRLIAGAIVSNITNPVGLGIDETKRASETWTALIKRFEKCNEQCIYLADMNIQQEKFNPVKLTMEDHEKQMRNLIKKVHNLGGTATDAQFHRIVI # SSMPSDWRQDIRSIPGASSADVFAYLHTLWYKKEEVEGGRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g674 ### # start gene g675 Scaffold_5 AUGUSTUS gene 3304645 3305226 0.55 - . g675 Scaffold_5 AUGUSTUS transcript 3304645 3305226 0.55 - . g675.t1 Scaffold_5 AUGUSTUS stop_codon 3304645 3304647 . - 0 transcript_id "g675.t1"; gene_id "g675"; Scaffold_5 AUGUSTUS CDS 3304645 3305226 0.55 - 0 transcript_id "g675.t1"; gene_id "g675"; Scaffold_5 AUGUSTUS start_codon 3305224 3305226 . - 0 transcript_id "g675.t1"; gene_id "g675"; # protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVSLSMVFLIMLLPIVVPNLFRRSSGLSVKR # SPWNFTIPLDHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLAETSSSTSMNST # FPSRGNPFSSVSLQGTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g675 ### # start gene g676 Scaffold_5 AUGUSTUS gene 3305778 3308689 0.1 - . g676 Scaffold_5 AUGUSTUS transcript 3305778 3308689 0.1 - . g676.t1 Scaffold_5 AUGUSTUS stop_codon 3305778 3305780 . - 0 transcript_id "g676.t1"; gene_id "g676"; Scaffold_5 AUGUSTUS CDS 3305778 3306796 0.95 - 2 transcript_id "g676.t1"; gene_id "g676"; Scaffold_5 AUGUSTUS CDS 3306850 3307197 0.72 - 2 transcript_id "g676.t1"; gene_id "g676"; Scaffold_5 AUGUSTUS CDS 3308045 3308372 0.4 - 0 transcript_id "g676.t1"; gene_id "g676"; Scaffold_5 AUGUSTUS CDS 3308456 3308689 0.33 - 0 transcript_id "g676.t1"; gene_id "g676"; Scaffold_5 AUGUSTUS start_codon 3308687 3308689 . - 0 transcript_id "g676.t1"; gene_id "g676"; # protein sequence = [MKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRSVRL # PSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEA # TVRLLKRNRKTKVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATG # AITPSSSPHGAPVLFVPKKDGKLRLCVDFHLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSD # MLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVRGRLRTSSPSWVLQTSIV # VLFIISDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTH # DKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLHADRSDGQNFYINLIWSFASDRGNSARNLIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g676 ### # start gene g677 Scaffold_5 AUGUSTUS gene 3327820 3328353 0.7 - . g677 Scaffold_5 AUGUSTUS transcript 3327820 3328353 0.7 - . g677.t1 Scaffold_5 AUGUSTUS stop_codon 3327820 3327822 . - 0 transcript_id "g677.t1"; gene_id "g677"; Scaffold_5 AUGUSTUS CDS 3327820 3328353 0.7 - 0 transcript_id "g677.t1"; gene_id "g677"; Scaffold_5 AUGUSTUS start_codon 3328351 3328353 . - 0 transcript_id "g677.t1"; gene_id "g677"; # protein sequence = [MEPILLRAIHSEVADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEK # ELVALKDFIDKQLATGAITPSSSPHGAPVLLSRRKTANFAFASISVDSIVSPKRIVTHSHSFQIFSTLRKELKYTPNRISLTLIIWLESLKVVKIMYT # A] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g677 ### # start gene g678 Scaffold_5 AUGUSTUS gene 3329302 3330204 0.66 - . g678 Scaffold_5 AUGUSTUS transcript 3329302 3330204 0.66 - . g678.t1 Scaffold_5 AUGUSTUS stop_codon 3329302 3329304 . - 0 transcript_id "g678.t1"; gene_id "g678"; Scaffold_5 AUGUSTUS CDS 3329302 3329954 0.69 - 2 transcript_id "g678.t1"; gene_id "g678"; Scaffold_5 AUGUSTUS CDS 3330078 3330204 0.86 - 0 transcript_id "g678.t1"; gene_id "g678"; Scaffold_5 AUGUSTUS start_codon 3330202 3330204 . - 0 transcript_id "g678.t1"; gene_id "g678"; # protein sequence = [MLELLSGFKGSIETLGTILAALGRPSDSSESKSKVKEPEVFDAKEWFVPDILNPDLDSLPAWTSSFKALVKELQDNFG # VYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDKMARLPEPATLADYRQEVLCIDNRYWKREETRKREAGKPF # IAWNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPRTLRIPANPAVSAPRSTILVQMGKSFPLRRKEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g678 ### # start gene g679 Scaffold_5 AUGUSTUS gene 3334072 3336600 0.03 + . g679 Scaffold_5 AUGUSTUS transcript 3334072 3336600 0.03 + . g679.t1 Scaffold_5 AUGUSTUS start_codon 3334072 3334074 . + 0 transcript_id "g679.t1"; gene_id "g679"; Scaffold_5 AUGUSTUS CDS 3334072 3334440 0.07 + 0 transcript_id "g679.t1"; gene_id "g679"; Scaffold_5 AUGUSTUS CDS 3335538 3335859 0.22 + 0 transcript_id "g679.t1"; gene_id "g679"; Scaffold_5 AUGUSTUS CDS 3335979 3336123 0.44 + 2 transcript_id "g679.t1"; gene_id "g679"; Scaffold_5 AUGUSTUS CDS 3336216 3336600 0.47 + 1 transcript_id "g679.t1"; gene_id "g679"; Scaffold_5 AUGUSTUS stop_codon 3336598 3336600 . + 0 transcript_id "g679.t1"; gene_id "g679"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKM # RQALRVFDLVKKPNWDQFKKDLKNMFPQSVGDVSSPCLRPPFRHSEKMRIFRLLFDAELKKLMDEPKMITNSDAVRLFLAPMTPAVRRGVLDTVVKDV # SVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQMLSIASSSPPINNPNSFKSLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGA # DIMTQFERNTTPRSSNGTQWACFLCKSTEHFMNECPHLLEFTKRGWMMPEGGDSKCYKLRDNARMPRDNPNIPRYKKIEQMAKDLGCDRAESYFANME # DDKDDKVMDQQMNPNVNLAAIGIVKEAKKGYGQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g679 ### # start gene g680 Scaffold_5 AUGUSTUS gene 3338587 3339621 0.77 - . g680 Scaffold_5 AUGUSTUS transcript 3338587 3339621 0.77 - . g680.t1 Scaffold_5 AUGUSTUS stop_codon 3338587 3338589 . - 0 transcript_id "g680.t1"; gene_id "g680"; Scaffold_5 AUGUSTUS CDS 3338587 3339621 0.77 - 0 transcript_id "g680.t1"; gene_id "g680"; Scaffold_5 AUGUSTUS start_codon 3339619 3339621 . - 0 transcript_id "g680.t1"; gene_id "g680"; # protein sequence = [MENHLSDRYGSYEWKVMPFGLTNACCFPTFVNDIFSDMLDVCVIYLDDILIYSDMLEEHREHVKEVLRWLRKHWLYAN # PDKCEFNMDTVEYLGYILSPDRLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFDRRFIYNYSDIVVPMTRLTRKGAPWIWDNDCQEAFENLQIAFTS # APILAHWEPNHPIIVETDASDYAIVAILSIQTVDGEIHPLAFLSRTLHAAELNYDTHDKELLAIFKAFKAWCHYLEGSGDPVDVVTNHKNLEYFSTTK # ILTRRQVRWSEYLHQFNMVIRFRLGKLGEKPDSITRRWDIYPKEGDIGYAQVNPHNFRPIFTNEQLTTSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g680 ### # start gene g681 Scaffold_5 AUGUSTUS gene 3350954 3351688 0.63 + . g681 Scaffold_5 AUGUSTUS transcript 3350954 3351688 0.63 + . g681.t1 Scaffold_5 AUGUSTUS start_codon 3350954 3350956 . + 0 transcript_id "g681.t1"; gene_id "g681"; Scaffold_5 AUGUSTUS CDS 3350954 3351688 0.63 + 0 transcript_id "g681.t1"; gene_id "g681"; Scaffold_5 AUGUSTUS stop_codon 3351686 3351688 . + 0 transcript_id "g681.t1"; gene_id "g681"; # protein sequence = [MPINTPLHEWGEFSPYTSCSDSCNPNEVSSHSCFDIIDRVLRLAENWDAPGPLSYIRLGLRSTELAKRDPLRLFSIAS # HFGWEYERNWAAQHSLMIDISSLSDSDTQNTLEGMSSKDLLRLLKLRHRRKEEFRAYLDDPDRFSVGNSDILCTQCHEARVDNETWKILKEVMVAELE # RRPLGDSIVGYDVDGIGGENSTGGILTWPEAEACFKATCEKGCGSLNYDECATLKQIQGGIDSLPWDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g681 ### # start gene g682 Scaffold_5 AUGUSTUS gene 3356545 3357141 0.78 + . g682 Scaffold_5 AUGUSTUS transcript 3356545 3357141 0.78 + . g682.t1 Scaffold_5 AUGUSTUS start_codon 3356545 3356547 . + 0 transcript_id "g682.t1"; gene_id "g682"; Scaffold_5 AUGUSTUS CDS 3356545 3357141 0.78 + 0 transcript_id "g682.t1"; gene_id "g682"; Scaffold_5 AUGUSTUS stop_codon 3357139 3357141 . + 0 transcript_id "g682.t1"; gene_id "g682"; # protein sequence = [MSHELTVRLMSGPIPYSDSSSSISSQRKSSSSWTSQARNPVSLRLYKVLGTNFDDEATREALQTLSELYVNSSSSGST # VDASSKVKETPKSNAHFDGALLEDGEDEDDDEEERAQSSIGTSKLVENTPGEAAARARKNLKRDMELRLAEGSRHFLKVLSEVDEVCTHFPIAVSLFI # YPMSYSETGRPPKTRFGNAYKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g682 ### # start gene g683 Scaffold_5 AUGUSTUS gene 3360472 3361192 0.65 + . g683 Scaffold_5 AUGUSTUS transcript 3360472 3361192 0.65 + . g683.t1 Scaffold_5 AUGUSTUS start_codon 3360472 3360474 . + 0 transcript_id "g683.t1"; gene_id "g683"; Scaffold_5 AUGUSTUS CDS 3360472 3360772 0.65 + 0 transcript_id "g683.t1"; gene_id "g683"; Scaffold_5 AUGUSTUS CDS 3360816 3361192 0.65 + 2 transcript_id "g683.t1"; gene_id "g683"; Scaffold_5 AUGUSTUS stop_codon 3361190 3361192 . + 0 transcript_id "g683.t1"; gene_id "g683"; # protein sequence = [MCQLLNADEYNQHWKSLLSWELDQLATDKQKIILWQVKVKVLDWAQGQFSILVPGIRENYPRLDIGDVIHLREVLVDW # KTGSGFAFEGRVIRLKKREGFILPDFSCPTLKTHIETFIIQEPSFQADEEVPPVLNLSFITNARPSVVMDVAVSTLASALDPNGKRDVAHRWLFPEMD # DLHLNLPVPSTPPNITGEVWVDNGLNAEQRVNFLPCKSISSAYPPSVSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g683 ### # start gene g684 Scaffold_5 AUGUSTUS gene 3364427 3364996 0.91 - . g684 Scaffold_5 AUGUSTUS transcript 3364427 3364996 0.91 - . g684.t1 Scaffold_5 AUGUSTUS stop_codon 3364427 3364429 . - 0 transcript_id "g684.t1"; gene_id "g684"; Scaffold_5 AUGUSTUS CDS 3364427 3364996 0.91 - 0 transcript_id "g684.t1"; gene_id "g684"; Scaffold_5 AUGUSTUS start_codon 3364994 3364996 . - 0 transcript_id "g684.t1"; gene_id "g684"; # protein sequence = [MGATETSSPPFRSFAAEHEKQSLLLTLDFAAPTPTNFHKVKLGDTQFAELPPNSKLTGTAPYHSYGQMTETQFPGWED # LARILAVSSFCSSAVIETDINFPRLAIKGVLFLETDENQQDSAERIRKEAEFYDQHLGKFQGKFVPTHYGLWHAPTSQWGGEVLIAVMEWGGMELGAF # LRDKPKSATLAIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g684 ### # start gene g685 Scaffold_5 AUGUSTUS gene 3365602 3366681 0.99 - . g685 Scaffold_5 AUGUSTUS transcript 3365602 3366681 0.99 - . g685.t1 Scaffold_5 AUGUSTUS stop_codon 3365602 3365604 . - 0 transcript_id "g685.t1"; gene_id "g685"; Scaffold_5 AUGUSTUS CDS 3365602 3366681 0.99 - 0 transcript_id "g685.t1"; gene_id "g685"; Scaffold_5 AUGUSTUS start_codon 3366679 3366681 . - 0 transcript_id "g685.t1"; gene_id "g685"; # protein sequence = [MTPNFARISSEDLAQLQSSVQILDLPSRQEFSKVEARFADKSSRTNRLKSFLPRRNYDYIKLCLETPKLKGVVVTDFE # LVSKDIVLGGKGDLFLLSPESHPSLHVLLWKGRVVVPQDQVYDVLQYCHRKSDHGDFSGTLAIVREYYTFVPSILVRGFVDACPTCTAKRALNNVFSY # AAPDINNAISFSNSFDLLAVSNSQDEELSTLPTSSPFIFSGLDFEDSDPMELPVPPPLFSRLSTGSRGSHDGLPQSLPMSREVSLFQGIPNGWQYFTD # YDVAHKDFVEHKDEVMSQQLKPPAHQKRPRIPSIAPLNTTNTNSGGRVDVNKAKEKGVRANVQIRNEVGFVCCSVVFSLTFSSGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g685 ### # start gene g686 Scaffold_5 AUGUSTUS gene 3373403 3373747 0.38 - . g686 Scaffold_5 AUGUSTUS transcript 3373403 3373747 0.38 - . g686.t1 Scaffold_5 AUGUSTUS stop_codon 3373403 3373405 . - 0 transcript_id "g686.t1"; gene_id "g686"; Scaffold_5 AUGUSTUS CDS 3373403 3373747 0.38 - 0 transcript_id "g686.t1"; gene_id "g686"; Scaffold_5 AUGUSTUS start_codon 3373745 3373747 . - 0 transcript_id "g686.t1"; gene_id "g686"; # protein sequence = [MNNSNNRPRSPKSTEGPTPTFKLIHPTPAATFDIVEKVGVDDRVHEQTNLDDPSLFTDNNALTSSPEAINTELPPEPV # TSLSPRAHGVDFAYTTSLRRVNTFRTTNGTGRTLSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g686 ### # start gene g687 Scaffold_5 AUGUSTUS gene 3377299 3377586 0.65 - . g687 Scaffold_5 AUGUSTUS transcript 3377299 3377586 0.65 - . g687.t1 Scaffold_5 AUGUSTUS stop_codon 3377299 3377301 . - 0 transcript_id "g687.t1"; gene_id "g687"; Scaffold_5 AUGUSTUS CDS 3377299 3377586 0.65 - 0 transcript_id "g687.t1"; gene_id "g687"; Scaffold_5 AUGUSTUS start_codon 3377584 3377586 . - 0 transcript_id "g687.t1"; gene_id "g687"; # protein sequence = [MPPERSPKKQSPSTPSTPRKARTHGSGATTELSSPKSPTKTQIKNKWLKWCADNRWDPATDLGYKQKIGTQEVHRSDG # KVSQVSFHSAQANRTDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g687 ### # start gene g688 Scaffold_5 AUGUSTUS gene 3383143 3384024 0.68 - . g688 Scaffold_5 AUGUSTUS transcript 3383143 3384024 0.68 - . g688.t1 Scaffold_5 AUGUSTUS stop_codon 3383143 3383145 . - 0 transcript_id "g688.t1"; gene_id "g688"; Scaffold_5 AUGUSTUS CDS 3383143 3384024 0.68 - 0 transcript_id "g688.t1"; gene_id "g688"; Scaffold_5 AUGUSTUS start_codon 3384022 3384024 . - 0 transcript_id "g688.t1"; gene_id "g688"; # protein sequence = [MGRIIERCSKLKELHFRDKHVSSDDYQSSAPMVAPVLQTLSLSLSQTWAPHRNNSQDCVDVVFSSLTCPSLNSLLIEA # SHEYCSSWPEKNLNAFISRSSFHLTVLSIKYIPLLDTKLLKLLRILPSIIHLTIDDSLPSSSNRDDASARSVFPSPITPHLLQQLNAFPTNHMAIPAV # LIRRLETLDMTFSGSVAPGSRSMSKPCFSDRDFVDMVTSRWVPRAEGHCDFGSSGSASRSTSRPATANSLESNNPACGTTCLRSVVLRFKNRGVDEEV # YEPLKHLEKAGMRIVVAGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g688 ### # start gene g689 Scaffold_5 AUGUSTUS gene 3391944 3392759 0.27 - . g689 Scaffold_5 AUGUSTUS transcript 3391944 3392759 0.27 - . g689.t1 Scaffold_5 AUGUSTUS stop_codon 3391944 3391946 . - 0 transcript_id "g689.t1"; gene_id "g689"; Scaffold_5 AUGUSTUS CDS 3391944 3392759 0.27 - 0 transcript_id "g689.t1"; gene_id "g689"; Scaffold_5 AUGUSTUS start_codon 3392757 3392759 . - 0 transcript_id "g689.t1"; gene_id "g689"; # protein sequence = [MFLITAIFAFKSFATFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPV # RPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHP # EADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVSSFERKSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g689 ### # start gene g690 Scaffold_5 AUGUSTUS gene 3395325 3397010 0.48 - . g690 Scaffold_5 AUGUSTUS transcript 3395325 3397010 0.48 - . g690.t1 Scaffold_5 AUGUSTUS stop_codon 3395325 3395327 . - 0 transcript_id "g690.t1"; gene_id "g690"; Scaffold_5 AUGUSTUS CDS 3395325 3395654 1 - 0 transcript_id "g690.t1"; gene_id "g690"; Scaffold_5 AUGUSTUS CDS 3395738 3396134 0.77 - 1 transcript_id "g690.t1"; gene_id "g690"; Scaffold_5 AUGUSTUS CDS 3396224 3396685 0.73 - 1 transcript_id "g690.t1"; gene_id "g690"; Scaffold_5 AUGUSTUS CDS 3396793 3397010 0.67 - 0 transcript_id "g690.t1"; gene_id "g690"; Scaffold_5 AUGUSTUS start_codon 3397008 3397010 . - 0 transcript_id "g690.t1"; gene_id "g690"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEENNNSIQHLVHCHSPPY # GKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRA # MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAE # DSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAEAHKDEMARLPEPATLADYRQKFFVLTIVIGNARKLESVRLPSGSSAPFTPKPK # PFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g690 ### # start gene g691 Scaffold_5 AUGUSTUS gene 3411458 3412053 0.74 - . g691 Scaffold_5 AUGUSTUS transcript 3411458 3412053 0.74 - . g691.t1 Scaffold_5 AUGUSTUS stop_codon 3411458 3411460 . - 0 transcript_id "g691.t1"; gene_id "g691"; Scaffold_5 AUGUSTUS CDS 3411458 3411812 0.74 - 1 transcript_id "g691.t1"; gene_id "g691"; Scaffold_5 AUGUSTUS CDS 3411902 3412053 0.74 - 0 transcript_id "g691.t1"; gene_id "g691"; Scaffold_5 AUGUSTUS start_codon 3412051 3412053 . - 0 transcript_id "g691.t1"; gene_id "g691"; # protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTGSAKEWFVPDILDPDLDSLPAWTSSFK # ALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAEAHQGRNGAFARAGDARRLPSRSSSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g691 ### # start gene g692 Scaffold_5 AUGUSTUS gene 3422315 3422870 0.23 + . g692 Scaffold_5 AUGUSTUS transcript 3422315 3422870 0.23 + . g692.t1 Scaffold_5 AUGUSTUS start_codon 3422315 3422317 . + 0 transcript_id "g692.t1"; gene_id "g692"; Scaffold_5 AUGUSTUS CDS 3422315 3422580 0.29 + 0 transcript_id "g692.t1"; gene_id "g692"; Scaffold_5 AUGUSTUS CDS 3422648 3422870 0.53 + 1 transcript_id "g692.t1"; gene_id "g692"; Scaffold_5 AUGUSTUS stop_codon 3422868 3422870 . + 0 transcript_id "g692.t1"; gene_id "g692"; # protein sequence = [MTYDKVAKYLDPDLYYEIQRRTIDSEKLGRTGGTVYSCHNYMAIQHLENTDACRSFCSQLELIRNHQYEMAFVYSQMG # YWIETESNTFCLVHGTMLPAEKTAAQMRTRTRLRDGQPAGGGSDVPVSNGQHKPTRERDNRRAAEHVRIQREREQRDAYWNIAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g692 ### # start gene g693 Scaffold_5 AUGUSTUS gene 3430683 3431965 0.41 + . g693 Scaffold_5 AUGUSTUS transcript 3430683 3431965 0.41 + . g693.t1 Scaffold_5 AUGUSTUS start_codon 3430683 3430685 . + 0 transcript_id "g693.t1"; gene_id "g693"; Scaffold_5 AUGUSTUS CDS 3430683 3430850 0.85 + 0 transcript_id "g693.t1"; gene_id "g693"; Scaffold_5 AUGUSTUS CDS 3430910 3430936 0.49 + 0 transcript_id "g693.t1"; gene_id "g693"; Scaffold_5 AUGUSTUS CDS 3431489 3431624 0.86 + 0 transcript_id "g693.t1"; gene_id "g693"; Scaffold_5 AUGUSTUS CDS 3431706 3431965 0.93 + 2 transcript_id "g693.t1"; gene_id "g693"; Scaffold_5 AUGUSTUS stop_codon 3431963 3431965 . + 0 transcript_id "g693.t1"; gene_id "g693"; # protein sequence = [MPIHHKKDLDIAQVAEPHLGALQQLLASFKGKKTNNPDKATISVLRRSTEYLHDLLEKPVTLRSHNRRSTPYPTTGSN # KGSNKEEKSAVNDVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIA # DEACSIFEKSPRFWFRLFCF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g693 ### # start gene g694 Scaffold_5 AUGUSTUS gene 3432391 3433503 0.52 - . g694 Scaffold_5 AUGUSTUS transcript 3432391 3433503 0.52 - . g694.t1 Scaffold_5 AUGUSTUS stop_codon 3432391 3432393 . - 0 transcript_id "g694.t1"; gene_id "g694"; Scaffold_5 AUGUSTUS CDS 3432391 3433503 0.52 - 0 transcript_id "g694.t1"; gene_id "g694"; Scaffold_5 AUGUSTUS start_codon 3433501 3433503 . - 0 transcript_id "g694.t1"; gene_id "g694"; # protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE # VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDI # VESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIR # RTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g694 ### # start gene g695 Scaffold_5 AUGUSTUS gene 3433746 3434819 0.97 - . g695 Scaffold_5 AUGUSTUS transcript 3433746 3434819 0.97 - . g695.t1 Scaffold_5 AUGUSTUS stop_codon 3433746 3433748 . - 0 transcript_id "g695.t1"; gene_id "g695"; Scaffold_5 AUGUSTUS CDS 3433746 3434819 0.97 - 0 transcript_id "g695.t1"; gene_id "g695"; Scaffold_5 AUGUSTUS start_codon 3434817 3434819 . - 0 transcript_id "g695.t1"; gene_id "g695"; # protein sequence = [MASCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLA # VDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVR # NYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEE # RSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESWVKCQKMNGLNLLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g695 ### # start gene g696 Scaffold_5 AUGUSTUS gene 3436036 3437438 0.9 - . g696 Scaffold_5 AUGUSTUS transcript 3436036 3437438 0.9 - . g696.t1 Scaffold_5 AUGUSTUS stop_codon 3436036 3436038 . - 0 transcript_id "g696.t1"; gene_id "g696"; Scaffold_5 AUGUSTUS CDS 3436036 3436655 0.97 - 2 transcript_id "g696.t1"; gene_id "g696"; Scaffold_5 AUGUSTUS CDS 3436730 3437438 0.91 - 0 transcript_id "g696.t1"; gene_id "g696"; Scaffold_5 AUGUSTUS start_codon 3437436 3437438 . - 0 transcript_id "g696.t1"; gene_id "g696"; # protein sequence = [MFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDE # EIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSE # ITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEI # IDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTS # ETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g696 ### # start gene g697 Scaffold_5 AUGUSTUS gene 3437497 3438156 0.78 - . g697 Scaffold_5 AUGUSTUS transcript 3437497 3438156 0.78 - . g697.t1 Scaffold_5 AUGUSTUS stop_codon 3437497 3437499 . - 0 transcript_id "g697.t1"; gene_id "g697"; Scaffold_5 AUGUSTUS CDS 3437497 3438156 0.78 - 0 transcript_id "g697.t1"; gene_id "g697"; Scaffold_5 AUGUSTUS start_codon 3438154 3438156 . - 0 transcript_id "g697.t1"; gene_id "g697"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKLLCARYAIGESVQGLKRITTYQLYPKMEKLKFWTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g697 ### # start gene g698 Scaffold_5 AUGUSTUS gene 3438186 3438521 0.51 - . g698 Scaffold_5 AUGUSTUS transcript 3438186 3438521 0.51 - . g698.t1 Scaffold_5 AUGUSTUS stop_codon 3438186 3438188 . - 0 transcript_id "g698.t1"; gene_id "g698"; Scaffold_5 AUGUSTUS CDS 3438186 3438521 0.51 - 0 transcript_id "g698.t1"; gene_id "g698"; Scaffold_5 AUGUSTUS start_codon 3438519 3438521 . - 0 transcript_id "g698.t1"; gene_id "g698"; # protein sequence = [MEARGMDLTVTSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWM # TRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g698 ### # start gene g699 Scaffold_5 AUGUSTUS gene 3439312 3440179 0.84 + . g699 Scaffold_5 AUGUSTUS transcript 3439312 3440179 0.84 + . g699.t1 Scaffold_5 AUGUSTUS start_codon 3439312 3439314 . + 0 transcript_id "g699.t1"; gene_id "g699"; Scaffold_5 AUGUSTUS CDS 3439312 3439889 0.84 + 0 transcript_id "g699.t1"; gene_id "g699"; Scaffold_5 AUGUSTUS CDS 3440014 3440179 0.99 + 1 transcript_id "g699.t1"; gene_id "g699"; Scaffold_5 AUGUSTUS stop_codon 3440177 3440179 . + 0 transcript_id "g699.t1"; gene_id "g699"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVSSPDPSPWTTPVVAPARGRSTTRIDSPILQAIAPVRGNTPQRRAASESPRDPPPHFDL # DTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGVLVDLVDLVLPYLLTSPTSNVLCWNSSRGSRAPLRPLVPSSPLS # AAPLTALNPRAKSRSQSGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGVYDAQGEAEDALVTLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g699 ### # start gene g700 Scaffold_5 AUGUSTUS gene 3441630 3442253 0.98 + . g700 Scaffold_5 AUGUSTUS transcript 3441630 3442253 0.98 + . g700.t1 Scaffold_5 AUGUSTUS start_codon 3441630 3441632 . + 0 transcript_id "g700.t1"; gene_id "g700"; Scaffold_5 AUGUSTUS CDS 3441630 3442253 0.98 + 0 transcript_id "g700.t1"; gene_id "g700"; Scaffold_5 AUGUSTUS stop_codon 3442251 3442253 . + 0 transcript_id "g700.t1"; gene_id "g700"; # protein sequence = [MEPILLRAIHSEVAARAADRSSTTPTALHSILLSRRVAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGHIYPL # SEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEW # KTTFRTRYGSYEWKVMPFGLTNAPAAFQRVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g700 ### # start gene g701 Scaffold_5 AUGUSTUS gene 3444576 3445235 0.77 + . g701 Scaffold_5 AUGUSTUS transcript 3444576 3445235 0.77 + . g701.t1 Scaffold_5 AUGUSTUS start_codon 3444576 3444578 . + 0 transcript_id "g701.t1"; gene_id "g701"; Scaffold_5 AUGUSTUS CDS 3444576 3445235 0.77 + 0 transcript_id "g701.t1"; gene_id "g701"; Scaffold_5 AUGUSTUS stop_codon 3445233 3445235 . + 0 transcript_id "g701.t1"; gene_id "g701"; # protein sequence = [MKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSENILVLSRSS # VDLVLCLTSSKLPDYLRRIHLVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADEL # HAGRTGTRIPRSIPFETWTLITKKSFYSFPRFRRAPPKFTSCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g701 ### # start gene g702 Scaffold_5 AUGUSTUS gene 3447963 3448801 0.06 - . g702 Scaffold_5 AUGUSTUS transcript 3447963 3448801 0.06 - . g702.t1 Scaffold_5 AUGUSTUS stop_codon 3447963 3447965 . - 0 transcript_id "g702.t1"; gene_id "g702"; Scaffold_5 AUGUSTUS CDS 3447963 3448264 0.08 - 2 transcript_id "g702.t1"; gene_id "g702"; Scaffold_5 AUGUSTUS CDS 3448324 3448801 0.06 - 0 transcript_id "g702.t1"; gene_id "g702"; Scaffold_5 AUGUSTUS start_codon 3448799 3448801 . - 0 transcript_id "g702.t1"; gene_id "g702"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKM # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNKTVVKDVSVTSMSDRRK # EDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLELN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g702 ### # start gene g703 Scaffold_5 AUGUSTUS gene 3451419 3453196 0.22 + . g703 Scaffold_5 AUGUSTUS transcript 3451419 3453196 0.22 + . g703.t1 Scaffold_5 AUGUSTUS start_codon 3451419 3451421 . + 0 transcript_id "g703.t1"; gene_id "g703"; Scaffold_5 AUGUSTUS CDS 3451419 3452189 0.36 + 0 transcript_id "g703.t1"; gene_id "g703"; Scaffold_5 AUGUSTUS CDS 3452258 3453196 0.22 + 0 transcript_id "g703.t1"; gene_id "g703"; Scaffold_5 AUGUSTUS stop_codon 3453194 3453196 . + 0 transcript_id "g703.t1"; gene_id "g703"; # protein sequence = [MLDKKDTVEAGQQELQEFLALQQGEAVVAAKPKCDCSPLPVAGSSRKKVQSDAPKKRSRHRTPVAATIPGSPLRIRLV # VPPSRPVVASSSPPVRPHSSPSLMEVLHRDLPMQGPSDLVRLAAAAEVHPGLVQQAGSSSPVRTPIKGAGQDLLSSTMPPILRPALVPRNPASYPYRA # ENQCLAAWVHLLESQLADSQRENSSLTSALRDTSHALESRQWEVEQLRSSSQEFLQHQEEYRRIIDQFNTLDRALSGPSDQHFQKVEEELRITKKDRD # DATGKLSTSSHRISKLTTALLYQHGITDEGNALSTRQCAHLEELQEEVHRTRGPAAFVKRMIKEYPDEGYYEVVLPPLSQLEGDLVKVRADLHRVATL # AHRLYRSDPATVLHHHNRYIGAIIEAVIAFLRRALETKDPDVMAHNVQLALDYMQTARGIHGDLHIRSLSSIQWFFNNAVNQDKGLYILMLENSRFDS # DHPFLTAAQHAGFTSPPPDSLEPPLHRRMLSLSMALPHRGGAGRWDDLVPAIPSDDQLMLDWEQLMLQYMHHITNTPLPAPDVATSIRRWAQVASHRG # S] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g703 ### # start gene g704 Scaffold_5 AUGUSTUS gene 3460618 3461001 0.75 + . g704 Scaffold_5 AUGUSTUS transcript 3460618 3461001 0.75 + . g704.t1 Scaffold_5 AUGUSTUS start_codon 3460618 3460620 . + 0 transcript_id "g704.t1"; gene_id "g704"; Scaffold_5 AUGUSTUS CDS 3460618 3461001 0.75 + 0 transcript_id "g704.t1"; gene_id "g704"; Scaffold_5 AUGUSTUS stop_codon 3460999 3461001 . + 0 transcript_id "g704.t1"; gene_id "g704"; # protein sequence = [MSATSMERPSSSKTESKKQKSALSHGNMTQAQKSNQAASSTVIMVAAGQRLMSIPEQSFGDETVSNIRTPEGCQPEVQ # GPPPVEPGMGPPQWRYTSMGYAQPASSPMGGFAYSHLGNERTSPDRYSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g704 ### # start gene g705 Scaffold_5 AUGUSTUS gene 3476476 3478450 0.14 + . g705 Scaffold_5 AUGUSTUS transcript 3476476 3478450 0.14 + . g705.t1 Scaffold_5 AUGUSTUS start_codon 3476476 3476478 . + 0 transcript_id "g705.t1"; gene_id "g705"; Scaffold_5 AUGUSTUS CDS 3476476 3476686 0.47 + 0 transcript_id "g705.t1"; gene_id "g705"; Scaffold_5 AUGUSTUS CDS 3476750 3477142 0.87 + 2 transcript_id "g705.t1"; gene_id "g705"; Scaffold_5 AUGUSTUS CDS 3477196 3477302 0.29 + 2 transcript_id "g705.t1"; gene_id "g705"; Scaffold_5 AUGUSTUS CDS 3477449 3477581 0.73 + 0 transcript_id "g705.t1"; gene_id "g705"; Scaffold_5 AUGUSTUS CDS 3477903 3478450 0.97 + 2 transcript_id "g705.t1"; gene_id "g705"; Scaffold_5 AUGUSTUS stop_codon 3478448 3478450 . + 0 transcript_id "g705.t1"; gene_id "g705"; # protein sequence = [MMRSVPSKDLDVFASLRGKVSPVVASKISTLSPPLEIKSSTSVPKAPVAPPRLIRRNRELESLKADASTFFSSPRSTR # SRDSDNELLSGFPSAVSASRASSSTKVSTDRKEPKPKTTVKVVEDSKASKPTSSAMVYKRVRLPSRSRKIAPTTAKGKSRQVVVSDDDSASNEVESED # EEEDEDEEEDSAPPPKRLKTTSSLPASLPRRSVKRVTVPKRVSKAAAKSAPERPSDSTFRPNSAALNRENPLLAINPDFVELGSILETQNARFTMQDL # MQVNRVIHLAISLRRAIDLNDQLKQLESLFDSTRDLFLRSILDLQNAGEDPIVVLEALKAAEPNRRAISLNEWTLMATLFRWPSPFNLSGLDFDNRTP # GEWIDLLRSIHSGESTAHIDDKGHLVESSPPPDSATEALEGLKEVERGSADEGTSSQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g705 ### # start gene g706 Scaffold_5 AUGUSTUS gene 3480292 3480758 0.41 + . g706 Scaffold_5 AUGUSTUS transcript 3480292 3480758 0.41 + . g706.t1 Scaffold_5 AUGUSTUS start_codon 3480292 3480294 . + 0 transcript_id "g706.t1"; gene_id "g706"; Scaffold_5 AUGUSTUS CDS 3480292 3480466 0.41 + 0 transcript_id "g706.t1"; gene_id "g706"; Scaffold_5 AUGUSTUS CDS 3480541 3480758 0.78 + 2 transcript_id "g706.t1"; gene_id "g706"; Scaffold_5 AUGUSTUS stop_codon 3480756 3480758 . + 0 transcript_id "g706.t1"; gene_id "g706"; # protein sequence = [MFCIHDSFHVVESSQHSLPTTGSNKGSNKEEKSAVNDVSPRSARFIATLTVMFLLTVCLTHSKHINHALAQVVSSNLD # TPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g706 ### # start gene g707 Scaffold_5 AUGUSTUS gene 3481221 3482335 0.24 - . g707 Scaffold_5 AUGUSTUS transcript 3481221 3482335 0.24 - . g707.t1 Scaffold_5 AUGUSTUS stop_codon 3481221 3481223 . - 0 transcript_id "g707.t1"; gene_id "g707"; Scaffold_5 AUGUSTUS CDS 3481221 3481666 0.35 - 2 transcript_id "g707.t1"; gene_id "g707"; Scaffold_5 AUGUSTUS CDS 3481741 3482335 0.24 - 0 transcript_id "g707.t1"; gene_id "g707"; Scaffold_5 AUGUSTUS start_codon 3482333 3482335 . - 0 transcript_id "g707.t1"; gene_id "g707"; # protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE # VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDI # VESTWLVNPPNRILTRDELIGYQLRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFR # VLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMSPENDYIFDAIPHLRLSDTDSDENSVRERINN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g707 ### # start gene g708 Scaffold_5 AUGUSTUS gene 3482580 3483652 0.29 - . g708 Scaffold_5 AUGUSTUS transcript 3482580 3483652 0.29 - . g708.t1 Scaffold_5 AUGUSTUS stop_codon 3482580 3482582 . - 0 transcript_id "g708.t1"; gene_id "g708"; Scaffold_5 AUGUSTUS CDS 3482580 3483094 0.93 - 2 transcript_id "g708.t1"; gene_id "g708"; Scaffold_5 AUGUSTUS CDS 3483187 3483652 0.29 - 0 transcript_id "g708.t1"; gene_id "g708"; Scaffold_5 AUGUSTUS start_codon 3483650 3483652 . - 0 transcript_id "g708.t1"; gene_id "g708"; # protein sequence = [MASCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLA # VDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKACATHGPDGLSRITPGGWQTKR # PELNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDE # EFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESWVKCQNMNGLNLLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g708 ### # start gene g709 Scaffold_5 AUGUSTUS gene 3484681 3486276 0.74 - . g709 Scaffold_5 AUGUSTUS transcript 3484681 3486276 0.74 - . g709.t1 Scaffold_5 AUGUSTUS stop_codon 3484681 3484683 . - 0 transcript_id "g709.t1"; gene_id "g709"; Scaffold_5 AUGUSTUS CDS 3484681 3485492 0.8 - 2 transcript_id "g709.t1"; gene_id "g709"; Scaffold_5 AUGUSTUS CDS 3485607 3486276 0.75 - 0 transcript_id "g709.t1"; gene_id "g709"; Scaffold_5 AUGUSTUS start_codon 3486274 3486276 . - 0 transcript_id "g709.t1"; gene_id "g709"; # protein sequence = [MFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDE # EIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSE # ITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDK # QVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKN # SQRTRKRIVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVE # KPINLNTEEVFTKYKPVDKRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g709 ### # start gene g710 Scaffold_5 AUGUSTUS gene 3486324 3486998 0.59 - . g710 Scaffold_5 AUGUSTUS transcript 3486324 3486998 0.59 - . g710.t1 Scaffold_5 AUGUSTUS stop_codon 3486324 3486326 . - 0 transcript_id "g710.t1"; gene_id "g710"; Scaffold_5 AUGUSTUS CDS 3486324 3486998 0.59 - 0 transcript_id "g710.t1"; gene_id "g710"; Scaffold_5 AUGUSTUS start_codon 3486996 3486998 . - 0 transcript_id "g710.t1"; gene_id "g710"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKLLCARYAIGESVQGLKRITTYQLYPKMEKLKFWTIHLGYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g710 ### # start gene g711 Scaffold_5 AUGUSTUS gene 3487028 3487297 0.58 - . g711 Scaffold_5 AUGUSTUS transcript 3487028 3487297 0.58 - . g711.t1 Scaffold_5 AUGUSTUS stop_codon 3487028 3487030 . - 0 transcript_id "g711.t1"; gene_id "g711"; Scaffold_5 AUGUSTUS CDS 3487028 3487297 0.58 - 0 transcript_id "g711.t1"; gene_id "g711"; Scaffold_5 AUGUSTUS start_codon 3487295 3487297 . - 0 transcript_id "g711.t1"; gene_id "g711"; # protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR # VFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g711 ### # start gene g712 Scaffold_5 AUGUSTUS gene 3487684 3488547 0.78 - . g712 Scaffold_5 AUGUSTUS transcript 3487684 3488547 0.78 - . g712.t1 Scaffold_5 AUGUSTUS stop_codon 3487684 3487686 . - 0 transcript_id "g712.t1"; gene_id "g712"; Scaffold_5 AUGUSTUS CDS 3487684 3488547 0.78 - 0 transcript_id "g712.t1"; gene_id "g712"; Scaffold_5 AUGUSTUS start_codon 3488545 3488547 . - 0 transcript_id "g712.t1"; gene_id "g712"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIQGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g712 ### # start gene g713 Scaffold_5 AUGUSTUS gene 3494500 3495523 0.43 + . g713 Scaffold_5 AUGUSTUS transcript 3494500 3495523 0.43 + . g713.t1 Scaffold_5 AUGUSTUS start_codon 3494500 3494502 . + 0 transcript_id "g713.t1"; gene_id "g713"; Scaffold_5 AUGUSTUS CDS 3494500 3495160 0.43 + 0 transcript_id "g713.t1"; gene_id "g713"; Scaffold_5 AUGUSTUS CDS 3495249 3495523 0.43 + 2 transcript_id "g713.t1"; gene_id "g713"; Scaffold_5 AUGUSTUS stop_codon 3495521 3495523 . + 0 transcript_id "g713.t1"; gene_id "g713"; # protein sequence = [MFASWDITTRLTFNKENNANNIRRDLQRAAHLRDPENIRSPSPVTSELTIQLEEWEKICTNPIRFDSLKHLIPDFILE # WMKSRKIQEVKDKREREEDTSREAEEEKKKKRRLAEPLVPVVKNPLIPFQASFHDALYEIAHVSPIPLPFFSNDALQFISARAHSLPHKKFKSNDPRK # SGYFIDIEALKKMLRIKYANDDQLEGLDYILFIKCVNNYMRFEMTKLYAFWKPAELRIRNEQYLEFTGFIQSVYDSEWTKVESQVEFEDTMAKARGGS # LWYSYPFQSHTTSDTSPPYQGSPIGDMPPLSEKHHHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g713 ### # start gene g714 Scaffold_5 AUGUSTUS gene 3498404 3498814 0.84 - . g714 Scaffold_5 AUGUSTUS transcript 3498404 3498814 0.84 - . g714.t1 Scaffold_5 AUGUSTUS stop_codon 3498404 3498406 . - 0 transcript_id "g714.t1"; gene_id "g714"; Scaffold_5 AUGUSTUS CDS 3498404 3498814 0.84 - 0 transcript_id "g714.t1"; gene_id "g714"; Scaffold_5 AUGUSTUS start_codon 3498812 3498814 . - 0 transcript_id "g714.t1"; gene_id "g714"; # protein sequence = [MCLKNAADCSTRFQSLGKPGVQTLLYETFEMLSLGKLIYFTLAKLLDQMQRAATGVQQLSICVGRRPLWRDKRPLQRL # LDNDGFLFQDLRELTIDDRSNIANITQFIQCHVAITGLDYRSHRTGGRAALDFNELPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g714 ### # start gene g715 Scaffold_5 AUGUSTUS gene 3503840 3505384 0.66 + . g715 Scaffold_5 AUGUSTUS transcript 3503840 3505384 0.66 + . g715.t1 Scaffold_5 AUGUSTUS start_codon 3503840 3503842 . + 0 transcript_id "g715.t1"; gene_id "g715"; Scaffold_5 AUGUSTUS CDS 3503840 3505384 0.66 + 0 transcript_id "g715.t1"; gene_id "g715"; Scaffold_5 AUGUSTUS stop_codon 3505382 3505384 . + 0 transcript_id "g715.t1"; gene_id "g715"; # protein sequence = [MPMPVPTVAESRAATQPDNLFTPMANGGDRLANFPAEPQIPVPPRGRAQTPYHPTVPPPDDDDDEEEEDESAPPVVVP # SVAGSAHPPSVSQHRRRHSEPLHHQNIPPPPPPVDPTRPSAFDRPLWSPSGNPLPEPPRDLFDSEAYKAVLNIPRGTDLFTALYGYQRNQVQQPGQSV # PSDLNPQRTRTGLFGRKNSKGGGLFRTLTGTRGRKQTLSEIQPQDVARDRVRLGDVRLVPFPVPVERVNGETPSTQGAFKHVPPSEDRYLPTTLPGAE # VNATATEGVIPPPPVLEEQPGGNPPFLVMPGPSAAPATGPSQINAPFPVMTAPPRAPSAGPQQQQQQQPNFPPESPVRHVYHPPLIFTQYSPTYQGFF # PHSPHRVLHNNNIYPTATHLHEALKYLPAHPTIANQIRLCVNLNDVYPLSAANTAYVRPDWGAIFLDEMEMVLELKFRQHAELRNLLIEGIDGQKGRE # IVYRDEHDTFWGDGGGEGRGVNELGKILAKVRDRLIDDRERGLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g715 ### # start gene g716 Scaffold_5 AUGUSTUS gene 3506658 3508050 0.58 + . g716 Scaffold_5 AUGUSTUS transcript 3506658 3508050 0.58 + . g716.t1 Scaffold_5 AUGUSTUS start_codon 3506658 3506660 . + 0 transcript_id "g716.t1"; gene_id "g716"; Scaffold_5 AUGUSTUS CDS 3506658 3507186 0.58 + 0 transcript_id "g716.t1"; gene_id "g716"; Scaffold_5 AUGUSTUS CDS 3507287 3508050 0.58 + 2 transcript_id "g716.t1"; gene_id "g716"; Scaffold_5 AUGUSTUS stop_codon 3508048 3508050 . + 0 transcript_id "g716.t1"; gene_id "g716"; # protein sequence = [MPELKRTKISHIEGKPHVLDLKEIAKWVKEAGGTSRDENLDFIQWSQAAKNFYQFECLRDEDLGKEAPRALFYVEHFA # FFINQQDSEDFFAYWLKVETRLRKEHQSKLYAFDSDTYEREWTLVRAERISDSKYATSPSIPTSTQTSSSSRAPAPGALSTTSQKPFPSGNKERTAAP # SRLEGRVYAGTGISEDNAEAATRSIAAPSAAAPLTTHSSGNAPFSPLSPREDSRESLASPPLIFHDFADSIFTRRALPGSSAEHLELFERIVTPYNAN # AFEHELKAHNLLDRHPLLVNILRNGAPLGEMPQLTKSIIIPNHTSVAKFPQVVKDYLAEEKSKGRMSGPFSLKEIESIMRGPIVSSPLIVAEQVQAPG # IPTKFRVCRHLSKEGKDEDGNRFPSVNSFIAKDLFPTSFDTASKVAELVSLTSPSTFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g716 ### # start gene g717 Scaffold_5 AUGUSTUS gene 3509550 3510964 0.64 + . g717 Scaffold_5 AUGUSTUS transcript 3509550 3510964 0.64 + . g717.t1 Scaffold_5 AUGUSTUS start_codon 3509550 3509552 . + 0 transcript_id "g717.t1"; gene_id "g717"; Scaffold_5 AUGUSTUS CDS 3509550 3510088 0.64 + 0 transcript_id "g717.t1"; gene_id "g717"; Scaffold_5 AUGUSTUS CDS 3510397 3510964 0.64 + 1 transcript_id "g717.t1"; gene_id "g717"; Scaffold_5 AUGUSTUS stop_codon 3510962 3510964 . + 0 transcript_id "g717.t1"; gene_id "g717"; # protein sequence = [MPKTTTSLSVEPTYSILPLPISLPNPSNNHNFNKPFVHNPFSDPFAMSSPQPQGLPQQLKYELTNRKPKKGCEITPNP # LRPNVRAADRIHAWNTPYSIQKRLHESTSLPAKVIELGDQIMARGTVKTTKEVYAAGLLRYNQFSDLMGISEDDRMPASDRLIIGFIGHYAGKVSGKS # ISNCITFTSKPASVHFHIPWTKTTKEEGASVVATSPLGDNMEFMCPSKAVQRHLAKNADIPEDFSLFGYIDENGKPQHMVKKVFLEFCFDIWNHAALQ # SVLGHSFRIGGAVWLLLAGVPPEIVAATGGWTSLAFLLYWRRLETIIPQHITKAYEKSQWNTLRDKVDSFRKANKISNKFIEACVTGNEIEIEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g717 ### # start gene g718 Scaffold_5 AUGUSTUS gene 3527322 3528023 0.94 + . g718 Scaffold_5 AUGUSTUS transcript 3527322 3528023 0.94 + . g718.t1 Scaffold_5 AUGUSTUS start_codon 3527322 3527324 . + 0 transcript_id "g718.t1"; gene_id "g718"; Scaffold_5 AUGUSTUS CDS 3527322 3528023 0.94 + 0 transcript_id "g718.t1"; gene_id "g718"; Scaffold_5 AUGUSTUS stop_codon 3528021 3528023 . + 0 transcript_id "g718.t1"; gene_id "g718"; # protein sequence = [MESETFLASNTVSEYLKKAEDRLREEEDRIERYLHTKTRKELISKCEHVLIREHSELMWDSFQKLLDFDQDEDLQRMY # ALLSRIPEGLEPLRKRFEGHVKQAGLSSISKLVGEGGNADSIDPKVYVDALLEVHKKNSETVARSFKSEAGFAASLDKACREFVNRNAATGTSSTKSP # ELIAKHADMLLRKNNKMAEEEDLEGALNRVVIQSTVLRLYFKTVDHFIDGPIQISRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g718 ### # start gene g719 Scaffold_5 AUGUSTUS gene 3531327 3532385 0.99 - . g719 Scaffold_5 AUGUSTUS transcript 3531327 3532385 0.99 - . g719.t1 Scaffold_5 AUGUSTUS stop_codon 3531327 3531329 . - 0 transcript_id "g719.t1"; gene_id "g719"; Scaffold_5 AUGUSTUS CDS 3531327 3532385 0.99 - 0 transcript_id "g719.t1"; gene_id "g719"; Scaffold_5 AUGUSTUS start_codon 3532383 3532385 . - 0 transcript_id "g719.t1"; gene_id "g719"; # protein sequence = [MDKIVVAAPKFQVSRNEQGEITSGEPIGVPLYLLLDLLSNTAAGYDLFRNTRFNDALKALLDSWGKYLQSSKSNNTLN # NSDEGWFSKLGLETLDNGRGIFNDIYECPDETAVNRGFTSWDAFFTRKFKPGARPIQPQPDFPNFFIYNACESTVLRKATGIKEHDQFWLKGQPYSIN # DMLATIQDDRVAQSFIGGTVYQAFLSPYDYHRWHSPVNGTIREIQIIPGTYYAALPDEGAEKSDPDFQPGDPRGAIIRSQAWLTQAATRAIIYIDADN # KDIGCVVFIGVGMVEVSTCQVTVKVGGGVKVGDELGMFHFGGSTHALIFGPDVKLKFFDYVQANEHLHVNIPLAAVEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g719 ### # start gene g720 Scaffold_5 AUGUSTUS gene 3534608 3536401 0.06 + . g720 Scaffold_5 AUGUSTUS transcript 3534608 3536401 0.06 + . g720.t1 Scaffold_5 AUGUSTUS start_codon 3534608 3534610 . + 0 transcript_id "g720.t1"; gene_id "g720"; Scaffold_5 AUGUSTUS CDS 3534608 3534619 0.24 + 0 transcript_id "g720.t1"; gene_id "g720"; Scaffold_5 AUGUSTUS CDS 3534718 3535065 0.39 + 0 transcript_id "g720.t1"; gene_id "g720"; Scaffold_5 AUGUSTUS CDS 3535163 3536401 0.26 + 0 transcript_id "g720.t1"; gene_id "g720"; Scaffold_5 AUGUSTUS stop_codon 3536399 3536401 . + 0 transcript_id "g720.t1"; gene_id "g720"; # protein sequence = [MKLMSQRVEISQGKTGLFPQSYTAPAPTANGFTTGDDENDVPSNKTPLHPLDEESEPESSPQAPAIFVNGNEADGEVM # KATLTDVQKAIEQLKMNRTSSIDGDGARSFSFASTREIGIPIARKAVEDAEKLEMMMGGISAGNRTSAPPIEVEMSDESDGEDDEDYTHSSSFFRRHS # AIEEVDEYTEGNGTAPTQTPQVHQDLTLPEQEVDESEAQTATAPSFPSLSTNEDATDTKSISLPTPTSPGFAHSESTISTVIPIPISAITPPSIPSTP # PRTITPAAAVARSPSPMRETLVALPSPTASSFHSNSGAFHFSPHQSQHNSVSSVPSSALAIAPVTTSESSQTNSQPSQKDNEQAKEKEKTHPSEWNVD # EVVEWVRGKGFGEDVCAKFTEQEITGDVLLELDVNLLKNEIGIMAFGKRVRIANAIAELRRPPSINYDEQVLENPSSPFAGSQSVHRMMNQSLIRPVT # SFSQLSTVLTPNAFAKSIPIPVASLVPRECDFHVRIQRFVWLKRSFNCGCGFDESRKCTSYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g720 ### # start gene g721 Scaffold_5 AUGUSTUS gene 3537952 3538708 0.46 + . g721 Scaffold_5 AUGUSTUS transcript 3537952 3538708 0.46 + . g721.t1 Scaffold_5 AUGUSTUS start_codon 3537952 3537954 . + 0 transcript_id "g721.t1"; gene_id "g721"; Scaffold_5 AUGUSTUS CDS 3537952 3538209 0.47 + 0 transcript_id "g721.t1"; gene_id "g721"; Scaffold_5 AUGUSTUS CDS 3538280 3538708 0.7 + 0 transcript_id "g721.t1"; gene_id "g721"; Scaffold_5 AUGUSTUS stop_codon 3538706 3538708 . + 0 transcript_id "g721.t1"; gene_id "g721"; # protein sequence = [MVAQAMNPAPRPPSPTARDATQKALRRENPNQLSSRDARVLMGLPTNSDTKEERVKLESFFSSTTVDDASKGPAPPRP # SREARRASVPNIPIDDGLIDWANSHLPSSLQIIDTSGAICGGLTILRLAEAIKGRPSSPPVPDSAFPADPGDDKLDGLFRLFDFLLDNDVKMGSVSIN # DIRQGKRDKVLQLLKALKAWEDKRKAIAQSIGKGAMQAGGFIAPPYSLPVPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g721 ### # start gene g722 Scaffold_5 AUGUSTUS gene 3539620 3539964 0.99 + . g722 Scaffold_5 AUGUSTUS transcript 3539620 3539964 0.99 + . g722.t1 Scaffold_5 AUGUSTUS start_codon 3539620 3539622 . + 0 transcript_id "g722.t1"; gene_id "g722"; Scaffold_5 AUGUSTUS CDS 3539620 3539964 0.99 + 0 transcript_id "g722.t1"; gene_id "g722"; Scaffold_5 AUGUSTUS stop_codon 3539962 3539964 . + 0 transcript_id "g722.t1"; gene_id "g722"; # protein sequence = [MAPTPNAQHRFTFPPFPPVPTGATVISFKDFKENGIKIQEDDYDGPEVDALGISTVTIEKRHVGDFCKSNTRSAQHVV # TTGQESSTGGAPSVSKTWLQDWEEISTRKSGEFYDK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g722 ### # start gene g723 Scaffold_5 AUGUSTUS gene 3540412 3541802 0.52 + . g723 Scaffold_5 AUGUSTUS transcript 3540412 3541802 0.52 + . g723.t1 Scaffold_5 AUGUSTUS start_codon 3540412 3540414 . + 0 transcript_id "g723.t1"; gene_id "g723"; Scaffold_5 AUGUSTUS CDS 3540412 3540551 0.56 + 0 transcript_id "g723.t1"; gene_id "g723"; Scaffold_5 AUGUSTUS CDS 3540638 3541802 0.82 + 1 transcript_id "g723.t1"; gene_id "g723"; Scaffold_5 AUGUSTUS stop_codon 3541800 3541802 . + 0 transcript_id "g723.t1"; gene_id "g723"; # protein sequence = [MRAIIRIQPPFRVQKEIDYLRQQLKDRHMNRLNEFLIDPKKGVQVYLVDENLSLIPTLTRFYIKFLLKDEVFSVKSES # EIIASFNQALAIVEIAQTELPLTSQISRCLPWHDMFSGGCEELFKVDNLNVHVPTWANQSNHNLALDVVDGQIDINSTAAATIASTPDSEEQEAEDDI # VTPTIEHDLNERSVQGEFVIESVNGTMSNNLLSESDASPSVSSFSATWGSDQDTLEIATDDVRKWDVGFDKGDTGASAGWGVIDSADISWGEDDLDTW # EIPPPTTLLPILGPTALPLTHTSGVIEWSMRRIRSIVHPDAAAAATTQVSVISTSDGPSAEAVEVSLHACLSKVVMEPWIDWETQDEDGDTASPQIKA # NSRGLVVVYDEGQGVLYENDSDIRSNAFAVNDDGNTAQSPPVPHDPLKHSIVLLIEPEMRNY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g723 ### # start gene g724 Scaffold_5 AUGUSTUS gene 3543824 3544540 0.99 - . g724 Scaffold_5 AUGUSTUS transcript 3543824 3544540 0.99 - . g724.t1 Scaffold_5 AUGUSTUS stop_codon 3543824 3543826 . - 0 transcript_id "g724.t1"; gene_id "g724"; Scaffold_5 AUGUSTUS CDS 3543824 3544540 0.99 - 0 transcript_id "g724.t1"; gene_id "g724"; Scaffold_5 AUGUSTUS start_codon 3544538 3544540 . - 0 transcript_id "g724.t1"; gene_id "g724"; # protein sequence = [MYSRYLLVKSRATQGSTDEPETIPIPPRQPQQLTPFVKLDPAHPVTLGQQRIQIPEPTHQLETILRIRQAEAVEDNPD # SEDQAVFDFVESADEFIGKGKGKANDPMEIDDDDEMGFDDYSPSKGAPYQLSSSLAPTLARQQQLLPKSRPVDDWVHDSEYVQSAVSKLMPPPELSSP # GATMAVQKELKALLKEQKSCSSLKELGWFMSEEFMGDNLFQWIVELHSFDEKLPIAKDMKAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g724 ### # start gene g725 Scaffold_5 AUGUSTUS gene 3546436 3547671 0.58 - . g725 Scaffold_5 AUGUSTUS transcript 3546436 3547671 0.58 - . g725.t1 Scaffold_5 AUGUSTUS stop_codon 3546436 3546438 . - 0 transcript_id "g725.t1"; gene_id "g725"; Scaffold_5 AUGUSTUS CDS 3546436 3547671 0.58 - 0 transcript_id "g725.t1"; gene_id "g725"; Scaffold_5 AUGUSTUS start_codon 3547669 3547671 . - 0 transcript_id "g725.t1"; gene_id "g725"; # protein sequence = [MPPTSTLAAKNMNVKGRKRFVADLEDLKVACTQGFVAHGLTLKSKTMNIILDRRLNSLLGVRAGDDEGTFEAVITTSS # GEHVLNVNIMLSDTADYPKTHNCFSYSPDSHVAANIQSVIEGIVSLPSCLLVETMDKVLANLTKAMSIGSLESESDDDEDEEGEDYAVSSDDDIYMNS # TSQNLMKMARLQHDFLEIVARGYRPGLIRFSGDDFCISVSLSVIKLAESVPPRALNAWDRRLLSKTQHLVLLISGFRGVYPPSDSDATKLKFHVGLSG # IHKPSKEHAKDACRNFVLITNDAEDELRLAREKAAAEAAVMNDFEMDEEDSDADPNPATKPEIEEEEEDVPDRFDKFSLSGSLDSLMNHQFAKLVNMR # RKYGLGWAGAERLLSEAEKSQKPEQEVLENKLQVSFGNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g725 ### # start gene g726 Scaffold_5 AUGUSTUS gene 3573190 3573678 0.89 + . g726 Scaffold_5 AUGUSTUS transcript 3573190 3573678 0.89 + . g726.t1 Scaffold_5 AUGUSTUS start_codon 3573190 3573192 . + 0 transcript_id "g726.t1"; gene_id "g726"; Scaffold_5 AUGUSTUS CDS 3573190 3573678 0.89 + 0 transcript_id "g726.t1"; gene_id "g726"; Scaffold_5 AUGUSTUS stop_codon 3573676 3573678 . + 0 transcript_id "g726.t1"; gene_id "g726"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFQGYRRSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g726 ### # start gene g727 Scaffold_5 AUGUSTUS gene 3574409 3575842 0.94 + . g727 Scaffold_5 AUGUSTUS transcript 3574409 3575842 0.94 + . g727.t1 Scaffold_5 AUGUSTUS start_codon 3574409 3574411 . + 0 transcript_id "g727.t1"; gene_id "g727"; Scaffold_5 AUGUSTUS CDS 3574409 3575842 0.94 + 0 transcript_id "g727.t1"; gene_id "g727"; Scaffold_5 AUGUSTUS stop_codon 3575840 3575842 . + 0 transcript_id "g727.t1"; gene_id "g727"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g727 ### # start gene g728 Scaffold_5 AUGUSTUS gene 3579947 3580276 0.2 - . g728 Scaffold_5 AUGUSTUS transcript 3579947 3580276 0.2 - . g728.t1 Scaffold_5 AUGUSTUS stop_codon 3579947 3579949 . - 0 transcript_id "g728.t1"; gene_id "g728"; Scaffold_5 AUGUSTUS CDS 3579947 3580276 0.2 - 0 transcript_id "g728.t1"; gene_id "g728"; Scaffold_5 AUGUSTUS start_codon 3580274 3580276 . - 0 transcript_id "g728.t1"; gene_id "g728"; # protein sequence = [MVDEDTDMEFGADEDLDEEVEPEDDEFFPHPFGEGVCRKWHARDEVGAPYVCIYAQDDFDSDDAANFGEDNGKGRKKV # WHSLTSGEGIAIGKQPCEFHKIGYELDMPGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g728 ### # start gene g729 Scaffold_5 AUGUSTUS gene 3583168 3584416 0.83 - . g729 Scaffold_5 AUGUSTUS transcript 3583168 3584416 0.83 - . g729.t1 Scaffold_5 AUGUSTUS stop_codon 3583168 3583170 . - 0 transcript_id "g729.t1"; gene_id "g729"; Scaffold_5 AUGUSTUS CDS 3583168 3583763 0.98 - 2 transcript_id "g729.t1"; gene_id "g729"; Scaffold_5 AUGUSTUS CDS 3583822 3584416 0.83 - 0 transcript_id "g729.t1"; gene_id "g729"; Scaffold_5 AUGUSTUS start_codon 3584414 3584416 . - 0 transcript_id "g729.t1"; gene_id "g729"; # protein sequence = [MDVLRGLGPQGTKSMLENHWAHFIDAGDWNWLVEHGINTVRIPVSYYHFLPGHSEPEVRQLMRGTEYEAFADVYVNAW # KYVVSNIQAAHEHEIGVLIDLHAAPGAQNTDSHSGLSGGKAGLWDSNEHQRRTVQILVAMAKEIAKYDNVVGLELLNEPKNNNRLMSWYDEAIGAIRS # GLGAQAQELPIFISDAWDTNWYSKYVNDHSNLGSFLVLDHHLYRCFTSQDQNKSASQHAGEVHPSNNGPSALMLANASKETQGSIIIGEWSAALNPAS # LASYPDHESKLAAQREWGHAQWAAYEQRCAGWFFWTLKKEGGSDRGWCYYTAVEQGVLPAQADRIKAAFVSGRHSIESLRAKGMVENQRAMQAHVGWW # NQHSSHPNEFEHWRFEEGFRQGEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g729 ### # start gene g730 Scaffold_5 AUGUSTUS gene 3589555 3590416 0.89 - . g730 Scaffold_5 AUGUSTUS transcript 3589555 3590416 0.89 - . g730.t1 Scaffold_5 AUGUSTUS stop_codon 3589555 3589557 . - 0 transcript_id "g730.t1"; gene_id "g730"; Scaffold_5 AUGUSTUS CDS 3589555 3590317 0.99 - 1 transcript_id "g730.t1"; gene_id "g730"; Scaffold_5 AUGUSTUS CDS 3590367 3590416 0.89 - 0 transcript_id "g730.t1"; gene_id "g730"; Scaffold_5 AUGUSTUS start_codon 3590414 3590416 . - 0 transcript_id "g730.t1"; gene_id "g730"; # protein sequence = [MEWRMANKEAKGISGKNSYCRGVADGFYDFSKKEKRREEKEAEAAEMRRLETQREAEEAQEESEVASPFRPSSYESDS # EDDFRDAGYDDGDYGYNGNDEGSDLQAGLNTKEALEEDAVAPHFPSKEGVHDIDLDQLLKTSDERARKQAENPDIAMNKDKKKKRNTRRVKGDLMEDV # KSTTGEANEVPKNKVEEPEEPSWQSAGALIAFRQTSLLVADEYQKKQGLKLYKRGKLAALTFKDANAKQSYDKGWEDAKKIDLKTPKIKASEDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g730 ### # start gene g731 Scaffold_5 AUGUSTUS gene 3595912 3596115 0.75 + . g731 Scaffold_5 AUGUSTUS transcript 3595912 3596115 0.75 + . g731.t1 Scaffold_5 AUGUSTUS start_codon 3595912 3595914 . + 0 transcript_id "g731.t1"; gene_id "g731"; Scaffold_5 AUGUSTUS CDS 3595912 3596115 0.75 + 0 transcript_id "g731.t1"; gene_id "g731"; Scaffold_5 AUGUSTUS stop_codon 3596113 3596115 . + 0 transcript_id "g731.t1"; gene_id "g731"; # protein sequence = [MALISQAQGALDTDDNDTEYDDLDPKTIAAYEQTINDFTALTGELNQQLEVLAKVVKPGGLSGGANM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g731 ### # start gene g732 Scaffold_5 AUGUSTUS gene 3597208 3597909 0.97 - . g732 Scaffold_5 AUGUSTUS transcript 3597208 3597909 0.97 - . g732.t1 Scaffold_5 AUGUSTUS stop_codon 3597208 3597210 . - 0 transcript_id "g732.t1"; gene_id "g732"; Scaffold_5 AUGUSTUS CDS 3597208 3597909 0.97 - 0 transcript_id "g732.t1"; gene_id "g732"; Scaffold_5 AUGUSTUS start_codon 3597907 3597909 . - 0 transcript_id "g732.t1"; gene_id "g732"; # protein sequence = [MEDTTRAVTDGTWSSFELKRSDDTLYFNSLENVKLTSLSFISSSNSAEASILALGSSHVLLAGLTGSTSNREVVLLFW # DLSFSVLLASRTLPLPPYVTNEKVSITLVGALSSSNVLLLVSPTSVISGRRQSQGQSSSSSSVWVVPVTVPPSSSIANAIGRAAAAMPWLAVSDAQGD # SHDAGRSKLVNEIRSAMDRNQPENAKNAFFEWEKHTVSENSQDKPVCLTYFLSSITR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g732 ### # start gene g733 Scaffold_5 AUGUSTUS gene 3600709 3601902 0.32 - . g733 Scaffold_5 AUGUSTUS transcript 3600709 3601902 0.32 - . g733.t1 Scaffold_5 AUGUSTUS stop_codon 3600709 3600711 . - 0 transcript_id "g733.t1"; gene_id "g733"; Scaffold_5 AUGUSTUS CDS 3600709 3601704 0.5 - 0 transcript_id "g733.t1"; gene_id "g733"; Scaffold_5 AUGUSTUS CDS 3601762 3601902 0.5 - 0 transcript_id "g733.t1"; gene_id "g733"; Scaffold_5 AUGUSTUS start_codon 3601900 3601902 . - 0 transcript_id "g733.t1"; gene_id "g733"; # protein sequence = [MHPLSDAAKVITDSGSVIVAVVAKIDALEQSNDAALRSWAKDFAVAVARYRGVNRILSKWRDKPSFLEPAEVKDALVA # ADDFLLKHTHWTWDEAWLDSRWKRAALERKKIWEAEEERLRKLREEEEISTILAEAQAFLKTEVVVFDYPTEEEWEALRNQPPLQEDPAPISFFNPTL # DMPSESPDSSFGNSPLSFSDMSMSSPSSPPSAAPTPLQSPKIPVGNIDRIWDDPVLPAPQIGPSSNRADPGTQLNKELHGEPTARKIAPVSSGSGSTG # KHVGPAKSMDSASASEGHVSTSYDSTSGQASINADVVIRPRTTRATLPTTKGAKTRLNSTANNSPNSKINTQPPKTNVIASTSPKRPQFSQLTVTTSS # QVSVFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g733 ### # start gene g734 Scaffold_5 AUGUSTUS gene 3615845 3616054 0.21 - . g734 Scaffold_5 AUGUSTUS transcript 3615845 3616054 0.21 - . g734.t1 Scaffold_5 AUGUSTUS stop_codon 3615845 3615847 . - 0 transcript_id "g734.t1"; gene_id "g734"; Scaffold_5 AUGUSTUS CDS 3615845 3616054 0.21 - 0 transcript_id "g734.t1"; gene_id "g734"; Scaffold_5 AUGUSTUS start_codon 3616052 3616054 . - 0 transcript_id "g734.t1"; gene_id "g734"; # protein sequence = [MEKTQTAIEELGNESIEASAESTRINRDGSLPEDIPKADADPFDVPDGGTAAWLCAFGVRRSLFTIFMM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g734 ### # start gene g735 Scaffold_5 AUGUSTUS gene 3623384 3624007 1 - . g735 Scaffold_5 AUGUSTUS transcript 3623384 3624007 1 - . g735.t1 Scaffold_5 AUGUSTUS stop_codon 3623384 3623386 . - 0 transcript_id "g735.t1"; gene_id "g735"; Scaffold_5 AUGUSTUS CDS 3623384 3624007 1 - 0 transcript_id "g735.t1"; gene_id "g735"; Scaffold_5 AUGUSTUS start_codon 3624005 3624007 . - 0 transcript_id "g735.t1"; gene_id "g735"; # protein sequence = [MDQYVPRDFVSAPAHTDSAPSTPDRSAGKIRIPPLSVIRKPNTYTHREIFGTDDEYEDDRHQDNDPQRFLDSLDFDPH # NMTIPFPSPRKIAGSKRVVSAQNAQRLREQAGWKAGELSRASAPTQEVFQSITATPNLSGGSFEEFRAECYAQSYIATGGPPPPSIPLSVNAFGVYQP # AQSIPPTFQPCLFVNQPQETWNTSDVEMSDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g735 ### # start gene g736 Scaffold_5 AUGUSTUS gene 3625318 3626052 0.86 + . g736 Scaffold_5 AUGUSTUS transcript 3625318 3626052 0.86 + . g736.t1 Scaffold_5 AUGUSTUS start_codon 3625318 3625320 . + 0 transcript_id "g736.t1"; gene_id "g736"; Scaffold_5 AUGUSTUS CDS 3625318 3626052 0.86 + 0 transcript_id "g736.t1"; gene_id "g736"; Scaffold_5 AUGUSTUS stop_codon 3626050 3626052 . + 0 transcript_id "g736.t1"; gene_id "g736"; # protein sequence = [MATIPNLPSAYPPTPLVTSSRLPVQGHVGYDASSAAGPHTIWIPPVVDEDEEDDGENQQGFVGRSCRPVCHYNPGLGN # YDGLSDESDRGAENHQIIEIADFQSNGRASAETSSAEETDDMEMDDDERNHRHSSDGDAGTDSEEDSFNITLQTPRVPLSLQPSSATMSRSTIRLRAS # ARSVFADLERETEGRRHLSGSVLLPPLDTTSKLGQGSSPSSIDSGSLSISSGDDSAFMSLPNPHSYLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g736 ### # start gene g737 Scaffold_5 AUGUSTUS gene 3626085 3626984 0.73 + . g737 Scaffold_5 AUGUSTUS transcript 3626085 3626984 0.73 + . g737.t1 Scaffold_5 AUGUSTUS start_codon 3626085 3626087 . + 0 transcript_id "g737.t1"; gene_id "g737"; Scaffold_5 AUGUSTUS CDS 3626085 3626984 0.73 + 0 transcript_id "g737.t1"; gene_id "g737"; Scaffold_5 AUGUSTUS stop_codon 3626982 3626984 . + 0 transcript_id "g737.t1"; gene_id "g737"; # protein sequence = [MSDSSLGSAPGAGPATTTMRSISPTGRGRKRSHSRSFPPEHSQRYTRSNALKFAGSTLQRLSSTESSSSSRAPSPSND # ADVHEAVADTTLKDIRVLVHVEPISPSSASPVETQLGDVKSNNPTGENADEVQPAEGSVAGPRKRRKVVSLSSGPGHGSPPTSESEPTSRSHTGSIPK # PSDAFSSDKRKKGFLSTRTRRQLSGASTSASEGTDGPSSSDNDRSTRPASSSKGKGRSATPSSTRVSSVPTRRQFDVSHKLAGASASIRMTRSTVGLA # PTAGTGTEASANDHPLRLARAKKRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g737 ### # start gene g738 Scaffold_5 AUGUSTUS gene 3628323 3629403 0.45 + . g738 Scaffold_5 AUGUSTUS transcript 3628323 3629403 0.45 + . g738.t1 Scaffold_5 AUGUSTUS start_codon 3628323 3628325 . + 0 transcript_id "g738.t1"; gene_id "g738"; Scaffold_5 AUGUSTUS CDS 3628323 3628543 0.88 + 0 transcript_id "g738.t1"; gene_id "g738"; Scaffold_5 AUGUSTUS CDS 3628636 3628785 0.84 + 1 transcript_id "g738.t1"; gene_id "g738"; Scaffold_5 AUGUSTUS CDS 3628905 3629403 0.49 + 1 transcript_id "g738.t1"; gene_id "g738"; Scaffold_5 AUGUSTUS stop_codon 3629401 3629403 . + 0 transcript_id "g738.t1"; gene_id "g738"; # protein sequence = [MLSKQILPEPTGSSEGREGELRFESPSPSVSSQQTELTSTETDALPSEMERTASISPAPETVPSTSSLKPDWSPLEVE # ILSNKFQKNVQFPQTDHSYYYPDSNGGYPGSDSNPAVNFAFLFSSRNARNLSSHPVPTYGQSTETRYYEAPSRESLLWKVDSATEQTESMNRISGSTF # SNTRRYMPNALTSRHQIYTSDDFGQEPSPLEGFRPLQPDFEFGSHAGHFNQMTPGTALGSNAESGHINYHPSAVLGRNIPTSTMTMNSGLIYPSDTGH # PQHGKLVFASEGIKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g738 ### # start gene g739 Scaffold_5 AUGUSTUS gene 3637280 3637957 0.99 - . g739 Scaffold_5 AUGUSTUS transcript 3637280 3637957 0.99 - . g739.t1 Scaffold_5 AUGUSTUS stop_codon 3637280 3637282 . - 0 transcript_id "g739.t1"; gene_id "g739"; Scaffold_5 AUGUSTUS CDS 3637280 3637957 0.99 - 0 transcript_id "g739.t1"; gene_id "g739"; Scaffold_5 AUGUSTUS start_codon 3637955 3637957 . - 0 transcript_id "g739.t1"; gene_id "g739"; # protein sequence = [MISYYPFHSVWSYEAISKDVGANNNNAFTHCPTTSISTTSTSTSSSATSTSVSGSIATVAVQAVDTTDIPLSSNSASS # STTPASVTSSAGSASIPASGSTIILGTTFSVIHPSSNSYFGSPPMSTSISSDANGTTPGSTEGSNQTFLAPSSHTSKGLIGGIAGAAIGIVCALLALW # FFCRSSRKRKGASRTVTHTPANVEPFADREPSWYTAGIVASYPLGDLAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g739 ### # start gene g740 Scaffold_5 AUGUSTUS gene 3641750 3642232 0.49 - . g740 Scaffold_5 AUGUSTUS transcript 3641750 3642232 0.49 - . g740.t1 Scaffold_5 AUGUSTUS stop_codon 3641750 3641752 . - 0 transcript_id "g740.t1"; gene_id "g740"; Scaffold_5 AUGUSTUS CDS 3641750 3642232 0.49 - 0 transcript_id "g740.t1"; gene_id "g740"; Scaffold_5 AUGUSTUS start_codon 3642230 3642232 . - 0 transcript_id "g740.t1"; gene_id "g740"; # protein sequence = [MISYYPFHSVWSYEAISEDVGANDNNAFTHCASSTSTSASTSTSSSTPNVIASSQTTSTSPDSTSGNTVTVATQTPDT # TKQPSPSSSSNSASSATPASGISTTSFTSISGSTIILGSTFTVIYPSSISYSGSSPISTSASGNTSNTAPASGGTSGSSQPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g740 ### # start gene g741 Scaffold_5 AUGUSTUS gene 3645951 3646887 0.08 - . g741 Scaffold_5 AUGUSTUS transcript 3645951 3646887 0.08 - . g741.t1 Scaffold_5 AUGUSTUS stop_codon 3645951 3645953 . - 0 transcript_id "g741.t1"; gene_id "g741"; Scaffold_5 AUGUSTUS CDS 3645951 3646596 0.34 - 1 transcript_id "g741.t1"; gene_id "g741"; Scaffold_5 AUGUSTUS CDS 3646769 3646887 0.08 - 0 transcript_id "g741.t1"; gene_id "g741"; Scaffold_5 AUGUSTUS start_codon 3646885 3646887 . - 0 transcript_id "g741.t1"; gene_id "g741"; # protein sequence = [MAQQLVEGAKQNLSMTVHLQSLGFGEDDNDRDDDDDKEEEFKSLPLSHMSFSMTHSVVLPYPIDHVFHALSDADQMER # LQKLTPEAQKFSLLPPDIVSLPHCALSSLTHADTMPEGCPRVRDLPPSSLDQPADSEMRTFQRTQFEFSGTVSILFGLFNRALSVSGAQIIDEEAKVV # LFESGVVAQGIKEVKLRTFRPILLPDDSNGEEPRKSGTEVKETVWGTSPFGLSLLLKFLAPWIHRHHMELYSKLFEST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g741 ### # start gene g742 Scaffold_5 AUGUSTUS gene 3649132 3649542 0.77 + . g742 Scaffold_5 AUGUSTUS transcript 3649132 3649542 0.77 + . g742.t1 Scaffold_5 AUGUSTUS start_codon 3649132 3649134 . + 0 transcript_id "g742.t1"; gene_id "g742"; Scaffold_5 AUGUSTUS CDS 3649132 3649542 0.77 + 0 transcript_id "g742.t1"; gene_id "g742"; Scaffold_5 AUGUSTUS stop_codon 3649540 3649542 . + 0 transcript_id "g742.t1"; gene_id "g742"; # protein sequence = [MSIRTLLTIVLPPIPTEGLTANDVPELAERVRDQMLDALRDISVKVEPAPAEEPRDLPPPTTSSDPALVSSPSNTKEE # GAFSPPDVNPEQVLEARTSSVVSIASSDSNHREQRSEPSENGTETEEDEGMILVGRPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g742 ### # start gene g743 Scaffold_5 AUGUSTUS gene 3656112 3658069 0.4 + . g743 Scaffold_5 AUGUSTUS transcript 3656112 3658069 0.4 + . g743.t1 Scaffold_5 AUGUSTUS start_codon 3656112 3656114 . + 0 transcript_id "g743.t1"; gene_id "g743"; Scaffold_5 AUGUSTUS CDS 3656112 3656895 0.44 + 0 transcript_id "g743.t1"; gene_id "g743"; Scaffold_5 AUGUSTUS CDS 3656961 3658069 0.75 + 2 transcript_id "g743.t1"; gene_id "g743"; Scaffold_5 AUGUSTUS stop_codon 3658067 3658069 . + 0 transcript_id "g743.t1"; gene_id "g743"; # protein sequence = [MVPQDLAQFQQFVSSNTLPANIADSVTIAVSLPQKTVSYPIGSSTQPMSPINATPSTTSSHSASSLATTASTSSLGAI # STDTGSSASIATTAGGSENGTGPTKLYDSNPVKSALSSSITAPFAQEVPRLPMDYNPAMGSTIAERFLINEESWKHHTQARAILGNLIGPNGEQLTST # DPYNTTVFVGGLSPLIQEETLRTFFAPFGDIHYVSFHDIAFGILANSSNLKVKVPVGKHCGFVQFVRKADAERAIEKMQGFPIGGTSHRPPDKAAQAA # AQAAQAAAMQSQSGPQTLHNMTMPMPSSLQSDNTSVSAVSTAHLTQEQAIQLLQKLSQQTYTEQPFSFSSSPTSSSMNGANVGAYANSIARGAQGVSS # AHALERMFVNPSPTTALYSEEQLRSAHLSGREDLVGAPSYNGYFDLQTFSAQQQEQQHQGQQGQPSTRQSSSVPHAHQPRFSQHLQFPRDAVAGAVPF # SPFSPDPNATHVYHKNVFSDAQGREPHGFPPLDEPIDTGASSAARYTSSSARPPSVSQYTSFQGLMPRPGSGSTSTSPTNRTNIPVPISRPLSGQPTS # TSGVDPFEMHDLNGTLASLDLGEASLSSVMDSRPWGVKSPAGSSDSSASVQFQMTRDDVTSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g743 ### # start gene g744 Scaffold_5 AUGUSTUS gene 3660174 3661303 0.39 + . g744 Scaffold_5 AUGUSTUS transcript 3660174 3661303 0.39 + . g744.t1 Scaffold_5 AUGUSTUS start_codon 3660174 3660176 . + 0 transcript_id "g744.t1"; gene_id "g744"; Scaffold_5 AUGUSTUS CDS 3660174 3660278 0.39 + 0 transcript_id "g744.t1"; gene_id "g744"; Scaffold_5 AUGUSTUS CDS 3660431 3661303 0.85 + 0 transcript_id "g744.t1"; gene_id "g744"; Scaffold_5 AUGUSTUS stop_codon 3661301 3661303 . + 0 transcript_id "g744.t1"; gene_id "g744"; # protein sequence = [MSDADTVRRVPGSSDSSTPISWSEPPPLEEACARYLFVFFPANELRTQPSSDPVRSSEKVVNSDVILSSNDTAYEKTP # TFFTTSSQVLSQQIMKYAGKIIFHISASNWKVVFHRLRLRIHFLATHPDESSDSTDLMILGYSLLDRSRLLQIMNGTLFVVYHDSDTHCPAAELSSLL # VNMRLEGHKAIAAPLRYAIWSWIEHFPDEFNEVVKLHGKMDGASSVFDFLYNKCSGSERVLWPTLAILQCVIPERSSNLQTLGSSRANQKLAKFTEDL # RRQSSYTGKLASISLICATDICRAAMYVQPADDEVPLQMLAYDVAHEIKVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g744 ### # start gene g745 Scaffold_5 AUGUSTUS gene 3662989 3663354 0.41 + . g745 Scaffold_5 AUGUSTUS transcript 3662989 3663354 0.41 + . g745.t1 Scaffold_5 AUGUSTUS start_codon 3662989 3662991 . + 0 transcript_id "g745.t1"; gene_id "g745"; Scaffold_5 AUGUSTUS CDS 3662989 3663354 0.41 + 0 transcript_id "g745.t1"; gene_id "g745"; Scaffold_5 AUGUSTUS stop_codon 3663352 3663354 . + 0 transcript_id "g745.t1"; gene_id "g745"; # protein sequence = [MQSPAPLISIFVNDLTALLIFEDVSIRDTAREALGVDLNARLHPKILKYFDEYVPPSCNVTVVHILLHRVVQAVKLEK # ETNDGVGNHEEHASLCGPGERLLIALVSVFNSVDLRSLSQSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g745 ### # start gene g746 Scaffold_5 AUGUSTUS gene 3666773 3669075 0.1 + . g746 Scaffold_5 AUGUSTUS transcript 3666773 3669075 0.1 + . g746.t1 Scaffold_5 AUGUSTUS start_codon 3666773 3666775 . + 0 transcript_id "g746.t1"; gene_id "g746"; Scaffold_5 AUGUSTUS CDS 3666773 3667273 0.33 + 0 transcript_id "g746.t1"; gene_id "g746"; Scaffold_5 AUGUSTUS CDS 3667589 3668048 0.49 + 0 transcript_id "g746.t1"; gene_id "g746"; Scaffold_5 AUGUSTUS CDS 3668144 3669075 0.49 + 2 transcript_id "g746.t1"; gene_id "g746"; Scaffold_5 AUGUSTUS stop_codon 3669073 3669075 . + 0 transcript_id "g746.t1"; gene_id "g746"; # protein sequence = [MRFSNVPATLLHIGMLSVDAYDDELRAAAYDLLGSVCTYLNYDKSPLVAPKGKRDCWLFSARSYSNLAGFVPGTLNGF # VIDLSTRLARFAPQLTLDFISEVVASMTTNDRNKSMQVLQRINCLRYMNPWIKNLELFANPTSPLFERSGARLRDCIRVLTDLSVNLPEAIIKASPRM # PRIPSHNTGWPEVSTLIRIALIAGTETTHPLNNQLYVPEIVHVVTLVAGVGSTLIRKSVYGIIINLVQSLYLARLDEGSAPELLQLIEEMTTQEHVLN # LFGLSRLTTTSEYTSFDVDKEKSIIYQQEKLTALLIRSMDVSSGSKASAFQYSSMIQMRSFTALGALATSDVDDDFMYQMLMAFRTALLQPDNTSDIA # ALVSMLRCITKAVPGLQTDSRHIPQLFWLGVAFLQSSHMAFFEDAAALVTLTMKEMEKRGTFVGAPVAVRLLEARSPIEEPAQQFDSTLQLSCDASFS # FSLAAVLFKGMRHSGLRDSAEEALRTLLRITAHFDAQLQPDVANEDLAYIDPDALGYFIALLAASTTTADYRALLQECGIQDAVLVEDDQTVMSVSEE # ISHVPLVSIDTLGINDPNTALLATSFIGVMLTTAQGDDAESEILYSVLADIAATYPEIIQMA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g746 ### # start gene g747 Scaffold_5 AUGUSTUS gene 3671757 3672818 0.28 + . g747 Scaffold_5 AUGUSTUS transcript 3671757 3672818 0.28 + . g747.t1 Scaffold_5 AUGUSTUS start_codon 3671757 3671759 . + 0 transcript_id "g747.t1"; gene_id "g747"; Scaffold_5 AUGUSTUS CDS 3671757 3672818 0.28 + 0 transcript_id "g747.t1"; gene_id "g747"; Scaffold_5 AUGUSTUS stop_codon 3672816 3672818 . + 0 transcript_id "g747.t1"; gene_id "g747"; # protein sequence = [MCTRKDLRALFKLFREFFVEMGTMRVTLNDVILDPSIAIRVSELALDPAKAGVEKNPNGAASSSWMAPISKLFAPSSG # TRADTTAGAERAVSPSTAALSGLTRAPSNWANSRPPRFVPKLQPALSASATTVNVEFSSGVGRSITSSSATPAGPSRQESVVASTTDGGLSSAMGIFA # GAPLSSPDPWVVVPKGPRRVQSTLYRSESPVIFRQPGPDAGLNPNFLSRNVDAVIDEQNTRLPMVDEGANGEEKDIITPLMHHKLKRRGLSDSSIHST # FTGQGDDLMPSQGTSTLPSETHWPSKGSVLQALSRKVQSFKSGITDVLLLLTTTVVISAVPELALEKVDHPQELFRNLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g747 ### # start gene g748 Scaffold_5 AUGUSTUS gene 3678101 3678898 0.46 + . g748 Scaffold_5 AUGUSTUS transcript 3678101 3678898 0.46 + . g748.t1 Scaffold_5 AUGUSTUS start_codon 3678101 3678103 . + 0 transcript_id "g748.t1"; gene_id "g748"; Scaffold_5 AUGUSTUS CDS 3678101 3678898 0.46 + 0 transcript_id "g748.t1"; gene_id "g748"; Scaffold_5 AUGUSTUS stop_codon 3678896 3678898 . + 0 transcript_id "g748.t1"; gene_id "g748"; # protein sequence = [MGRIPGFQNAIFPVISLPMLTLTSNIGLVLFLFIIGMEIDGTVIKKNFKASAGISIAGLVIPLGLGAALGVGVYREFT # DPSVNFGYFLLFTAVAVGITAFPVLCRILTELQLLDTTVGVVTLAAGVGNDVVGWILLALTVALVNASSGLVALWVLLTAVGYVFFLLYPVKWGYRWL # ARKTGSLEQGTPSTVMMTVTILLVFISAFFTDIIGIHPIFGGFLAGIIIPHTNGYGIALTEKIEDIVVILLLPLVGHNLITVFISYAHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g748 ### # start gene g749 Scaffold_5 AUGUSTUS gene 3679779 3680207 0.66 + . g749 Scaffold_5 AUGUSTUS transcript 3679779 3680207 0.66 + . g749.t1 Scaffold_5 AUGUSTUS start_codon 3679779 3679781 . + 0 transcript_id "g749.t1"; gene_id "g749"; Scaffold_5 AUGUSTUS CDS 3679779 3680207 0.66 + 0 transcript_id "g749.t1"; gene_id "g749"; Scaffold_5 AUGUSTUS stop_codon 3680205 3680207 . + 0 transcript_id "g749.t1"; gene_id "g749"; # protein sequence = [MIVIPWASGSHSTDAEESEIPGVRNPFDSVFTSSESKDQIMSSVLYSEFIRNIFLTAPCDVSLFVDRGPSGTSTTSGV # GPDSLLVLPFFGGPDDRLALKMLVKICAGHEDVRAIAVRVSRGTQDENEEEFDKKHAAEVSYTM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g749 ### # start gene g750 Scaffold_5 AUGUSTUS gene 3680854 3682113 0.89 - . g750 Scaffold_5 AUGUSTUS transcript 3680854 3682113 0.89 - . g750.t1 Scaffold_5 AUGUSTUS stop_codon 3680854 3680856 . - 0 transcript_id "g750.t1"; gene_id "g750"; Scaffold_5 AUGUSTUS CDS 3680854 3682113 0.89 - 0 transcript_id "g750.t1"; gene_id "g750"; Scaffold_5 AUGUSTUS start_codon 3682111 3682113 . - 0 transcript_id "g750.t1"; gene_id "g750"; # protein sequence = [MDFSDRLKLLIRTLVPFGHRFGNLFLSLPSTELGAFNDLSMCQFPILQSFRVRDANVFCGSFYAPGPWNDGPSSENGS # RAPFAPLLTQMPALKRLEVAEISVRDGGHLTLPLNWGLLTDLNLQNGDSTTDQCHGVRVIEAFDILRKTSSLQNLQICIVLMPDHPFDSTSTGMIHLP # HLGSMRIKFMPFQPDDQSIPAQVSSVFQYISPPSLKLLSVSWTNPFPMGSALSEIPFPTLETLEIAMEMTPGALTGWLSSVPELTSFKFEDLGCPAGA # ESLFAFTSTFRNSHFFALTPSHDNPSPLCPKLTSFRMINHLFPTETRISSSALLGFVQARAPTLKTFDLFFDRDQSFAENDLIELRKLKKNGFQMRLH # YAIYPLHEEEDLPSDGLHPRPNPQPPFIAKRNQKSDMEGVFGTDRVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g750 ### # start gene g751 Scaffold_5 AUGUSTUS gene 3683113 3684678 0.54 - . g751 Scaffold_5 AUGUSTUS transcript 3683113 3684678 0.54 - . g751.t1 Scaffold_5 AUGUSTUS stop_codon 3683113 3683115 . - 0 transcript_id "g751.t1"; gene_id "g751"; Scaffold_5 AUGUSTUS CDS 3683113 3684678 0.54 - 0 transcript_id "g751.t1"; gene_id "g751"; Scaffold_5 AUGUSTUS start_codon 3684676 3684678 . - 0 transcript_id "g751.t1"; gene_id "g751"; # protein sequence = [MDEMLRLKALLAVPRTELNRLELEIARTQLVLDGLLRQKEKIKSYIEAHQALMSPIRQIPSETLADIFVWCLPADRNA # VRSLKEAPLLLTTICRNWRQVALDTPRLWTSLHIFLPPYPSDIAVSKRAIGVKTWLQRSGSLPLSISFHVKPQFGAPPTTTTTMDFSDRLKLLIRTLV # PFGHRFGDLFLSLPSTELGAFNDLSMCQFPILQSFRVRDANVFYGFFYPPGPWNDGTNSENGSRAPFAPLLTQMPALKRLEVAEISVRDGDHLTLSLN # WGLLTDLNLQNGDSTTDQRHGLRVTEAFGILRKTSSLQNLQICIVLMPDHPFDNTSTGMIHLPHLGSIRIEFIPFQFDDHTVPAQVSSVFQYISPPSL # KLFSVACYYPLPMGSGLSGMPPLSGIPFHTLKTLEIATRMTSETLTGWLSCVPELTSFKFKDLGCPAGAESLFAFTNTFRDSHLLALTPSHDNPSPLC # PKLTTFRMIIISLQKQGSRAQLCLALSRLAHPHSRLSIYSLTGTNRLRKMT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g751 ### # start gene g752 Scaffold_5 AUGUSTUS gene 3690613 3691308 1 + . g752 Scaffold_5 AUGUSTUS transcript 3690613 3691308 1 + . g752.t1 Scaffold_5 AUGUSTUS start_codon 3690613 3690615 . + 0 transcript_id "g752.t1"; gene_id "g752"; Scaffold_5 AUGUSTUS CDS 3690613 3691308 1 + 0 transcript_id "g752.t1"; gene_id "g752"; Scaffold_5 AUGUSTUS stop_codon 3691306 3691308 . + 0 transcript_id "g752.t1"; gene_id "g752"; # protein sequence = [MANNLVNVLKLHSKALEKVDPPTPSATSKYEPDSTQASLVCAAYHAALALRSPPLSVFDNTFTRVGGGGPPDWPLASA # DAYYKHSSSHHVVPQVRKPLLAINSTDDPVVVHAPTSPEEVGSGYTVVVLTEGGGHLGWFEPSSGIVLIGTDVSKLHVRRWMTKPTLEWLRLAAEVLV # HGHPDHPPRAIFVDEGGWIREVNGARQGLGCRAVEIGDLIDGTELKKEPGMLQGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g752 ### # start gene g753 Scaffold_5 AUGUSTUS gene 3700749 3702011 0.32 + . g753 Scaffold_5 AUGUSTUS transcript 3700749 3702011 0.32 + . g753.t1 Scaffold_5 AUGUSTUS start_codon 3700749 3700751 . + 0 transcript_id "g753.t1"; gene_id "g753"; Scaffold_5 AUGUSTUS CDS 3700749 3700751 0.57 + 0 transcript_id "g753.t1"; gene_id "g753"; Scaffold_5 AUGUSTUS CDS 3700981 3701391 0.51 + 0 transcript_id "g753.t1"; gene_id "g753"; Scaffold_5 AUGUSTUS CDS 3701544 3702011 0.55 + 0 transcript_id "g753.t1"; gene_id "g753"; Scaffold_5 AUGUSTUS stop_codon 3702009 3702011 . + 0 transcript_id "g753.t1"; gene_id "g753"; # protein sequence = [MLGFDADVVLWDSHPLAVGATPKQVFIDGIAQLNKPFAFPKSDVLQRAPETPNFDEETKAALKHDGLPPLEPKESISD # VVIFQNFDSLFLDMGNGVEQIFTAENYVGESQIAVVQNGKLACIGTPDVCITSVNVDSRTDGEVFDGLMDKLPTILGGNTAVIRAVDGLQFATRDALL # AYRSGVTTGVTAPCSSGLLAGLSTAFNTGAAHKLIEGAVVEDEVALHVSLSLSSSVSVSTQIATLRRLLLGGGAKGELGVQVTKVLEVRKADFVREHF # SLMQVCAGTGEDTTGYWRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g753 ### # start gene g754 Scaffold_5 AUGUSTUS gene 3705610 3705969 0.77 + . g754 Scaffold_5 AUGUSTUS transcript 3705610 3705969 0.77 + . g754.t1 Scaffold_5 AUGUSTUS start_codon 3705610 3705612 . + 0 transcript_id "g754.t1"; gene_id "g754"; Scaffold_5 AUGUSTUS CDS 3705610 3705969 0.77 + 0 transcript_id "g754.t1"; gene_id "g754"; Scaffold_5 AUGUSTUS stop_codon 3705967 3705969 . + 0 transcript_id "g754.t1"; gene_id "g754"; # protein sequence = [MVSLNWEVHLFDLKSKALQHAPETPNFEEEKKAALEFDGLPPLGPKESVSDVVIFQNFDTLFMDMGNGVKQVFAKDHL # GAPQIAVVQNGKLNYIGASEGYSSNLTMTPRTVDLLGGSLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g754 ### # start gene g755 Scaffold_5 AUGUSTUS gene 3713300 3714292 0.87 + . g755 Scaffold_5 AUGUSTUS transcript 3713300 3714292 0.87 + . g755.t1 Scaffold_5 AUGUSTUS start_codon 3713300 3713302 . + 0 transcript_id "g755.t1"; gene_id "g755"; Scaffold_5 AUGUSTUS CDS 3713300 3714292 0.87 + 0 transcript_id "g755.t1"; gene_id "g755"; Scaffold_5 AUGUSTUS stop_codon 3714290 3714292 . + 0 transcript_id "g755.t1"; gene_id "g755"; # protein sequence = [MVERAQPIEDSKVEEPQQNLSEDSSQELTTTADDYAAEATSPIDDNTKEKGTIRERQEPLYSTFPRSQKMLILIIGSF # AGLVSPLTGSIYLPALNTIAADLGVRTSLVNLTITTYQIFQGLAPSFMASLADTHGRRPTYLLAFSIYIIANLALALQDSYAALMVLRCLQSAGSSAT # IALGSAVVADMVTRAERGSWVGYAGLGISLGPALGPTIGGLLNQFLGWRSIFWFLLILGSVLLVIIFMFMPETGRAVVGNGSVKPAWWDLSLAQWLRI # RSGHHFNGTEGVEEDISTINKPKKRLNPISSLRILLEPEGGITLGFGAIFLRAISW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g755 ### # start gene g756 Scaffold_5 AUGUSTUS gene 3723207 3724760 0.57 - . g756 Scaffold_5 AUGUSTUS transcript 3723207 3724760 0.57 - . g756.t1 Scaffold_5 AUGUSTUS stop_codon 3723207 3723209 . - 0 transcript_id "g756.t1"; gene_id "g756"; Scaffold_5 AUGUSTUS CDS 3723207 3724760 0.57 - 0 transcript_id "g756.t1"; gene_id "g756"; Scaffold_5 AUGUSTUS start_codon 3724758 3724760 . - 0 transcript_id "g756.t1"; gene_id "g756"; # protein sequence = [MLDIKATPIPESSIKLRKQNTLSQLEYFGINGNPNHETPDLTSSPDWNLSSTHSYLGSTDLHSVFDRQPTEILIMIFS # FLDFSEANLLEINEGPWALARVCRRWRGIVYDCSLFWLHANLDLSYWHFTRNWPSRADLLVSTFLDKSKGLPLNVRIQWPDIEGATNHILDAVEHILK # TSHRWKSAVLNLHYALYYKLSSVIDGRFPQLESLMLKCNLPPKISRNSLPLIEVFQVAPKLRQVSIEGMPYATKNVTLPWNQLTHLNVYHDHPNPNYH # CLLLSSNLVECHIGAHCDLLQSPRGPYSSISLPHLKTLFVKGTGALVLPYVSAPNTEVLHVTDTPSAACSEACIEALQYFILGCSESLQDLTLHSDPL # DYRLAEILYSVRRLVRLHLHLTLPRGSSLFKDLIKWLSYRHVPESSSATSLTVDLLGLLPVLKSLSMRIDPSLADSESLDEMDLTVLIKMLESRRTMP # RISEAHRDFRELDSFDLEIKSYSHGTGFNGFDALNDIGLKTSVRLIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g756 ### # start gene g757 Scaffold_5 AUGUSTUS gene 3727250 3728143 0.98 + . g757 Scaffold_5 AUGUSTUS transcript 3727250 3728143 0.98 + . g757.t1 Scaffold_5 AUGUSTUS start_codon 3727250 3727252 . + 0 transcript_id "g757.t1"; gene_id "g757"; Scaffold_5 AUGUSTUS CDS 3727250 3728143 0.98 + 0 transcript_id "g757.t1"; gene_id "g757"; Scaffold_5 AUGUSTUS stop_codon 3728141 3728143 . + 0 transcript_id "g757.t1"; gene_id "g757"; # protein sequence = [MKNLLDFWGSYLRGSQSNNTLNDSDEGWFGQLGLATLENERGIFNEIYECPDYTAVNRGFTSWDAFFTRKFKPDARPI # QRPDPPFFFIFNACESTVYRISTDIKEHDQFWLKGQPYSIYDMLGRRDDEVSRSFIGGTVYQAFLSPYDYHRWHSPVDGTIREIQLVPGTYYAALPDD # GAGESDPDFQSGDPRGAIIRSQAWLTEAATRAIIHIEADNKAIGRIVFIGIGMVEVSTCQITVEEGDRVKAGDEIGMFHFGGSSHALIFERGVNLEFL # MTLFINNHLHVNRPIAGLQVPKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g757 ### # start gene g758 Scaffold_5 AUGUSTUS gene 3732223 3733128 0.89 + . g758 Scaffold_5 AUGUSTUS transcript 3732223 3733128 0.89 + . g758.t1 Scaffold_5 AUGUSTUS start_codon 3732223 3732225 . + 0 transcript_id "g758.t1"; gene_id "g758"; Scaffold_5 AUGUSTUS CDS 3732223 3733128 0.89 + 0 transcript_id "g758.t1"; gene_id "g758"; Scaffold_5 AUGUSTUS stop_codon 3733126 3733128 . + 0 transcript_id "g758.t1"; gene_id "g758"; # protein sequence = [MPKFNISLKSLLDSWGDYLQSAESNNTLNDSDEGWFGEVGLATLENDRGIFNEIYECPDETAVNRGFTSWDSFFTRKF # KPNARPIEKPEPPNFFIYNACESTVVRKTTGVEEHDQFWLKGQAYSIYDMLARRDDEVAASFIGGTVYQAFLSPYDYHRWHSPVDGTIREIQIIEGSY # YAALPDEGAGESDSDLQLGDPRGAIIRSQPWLTQASTRAIIYIDADNKDVGCLVFIGVGMVEVSTCQVSVSEGQHVNIGDELGMFRFGGSTHALIFGK # DVKLKFFDLEQDKGHRRVNTPLAALEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g758 ### # start gene g759 Scaffold_5 AUGUSTUS gene 3733600 3734013 0.87 + . g759 Scaffold_5 AUGUSTUS transcript 3733600 3734013 0.87 + . g759.t1 Scaffold_5 AUGUSTUS start_codon 3733600 3733602 . + 0 transcript_id "g759.t1"; gene_id "g759"; Scaffold_5 AUGUSTUS CDS 3733600 3734013 0.87 + 0 transcript_id "g759.t1"; gene_id "g759"; Scaffold_5 AUGUSTUS stop_codon 3734011 3734013 . + 0 transcript_id "g759.t1"; gene_id "g759"; # protein sequence = [MIFWLLLSLFSFANGQYFSEGWKPGQAFTNEPSAPAPTGASGHVGEDTPSQRGSLLDSSSISSIFAKIGVNISSIASA # AGLSSKAAYPWDPRIPLITDVNYDNTVVNEELTPEEEGNRTWLIVVYVACASSLQYIDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g759 ### # start gene g760 Scaffold_5 AUGUSTUS gene 3738773 3739858 0.3 + . g760 Scaffold_5 AUGUSTUS transcript 3738773 3739858 0.3 + . g760.t1 Scaffold_5 AUGUSTUS start_codon 3738773 3738775 . + 0 transcript_id "g760.t1"; gene_id "g760"; Scaffold_5 AUGUSTUS CDS 3738773 3739370 0.3 + 0 transcript_id "g760.t1"; gene_id "g760"; Scaffold_5 AUGUSTUS CDS 3739431 3739858 0.57 + 2 transcript_id "g760.t1"; gene_id "g760"; Scaffold_5 AUGUSTUS stop_codon 3739856 3739858 . + 0 transcript_id "g760.t1"; gene_id "g760"; # protein sequence = [MLLFSFARVLSMLFLSSILSVVTAIPMTLEAHTGQLERRKSGFRPNCQPLSIQRSYRNKKRVGPGSLKVDEVWKLRVG # SKYIFDTYLSYKDGGVKLVPRLIEDSKPFFFDRRIKGYLEAHVNFTDENSVATTLKEMSDSIGDVETNLEALDSAVRFLLAKGLVWKKDANGNKEQLK # DKLEKWSALYTEMKLLGPAGDSVERLEINVMLTENAWVMFFGESLALEAKMNSYKRIVEAAKVDNPELLEGALFPLNVVANFKDRTTTLKIWSLQADT # ELNFLGQVLELLAREKALLNSQGKPYTTAAQIHKDFIASVNKYEQRQKERAKVKGPKRAEGRQSKGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g760 ### # start gene g761 Scaffold_5 AUGUSTUS gene 3745398 3745987 1 + . g761 Scaffold_5 AUGUSTUS transcript 3745398 3745987 1 + . g761.t1 Scaffold_5 AUGUSTUS start_codon 3745398 3745400 . + 0 transcript_id "g761.t1"; gene_id "g761"; Scaffold_5 AUGUSTUS CDS 3745398 3745453 1 + 0 transcript_id "g761.t1"; gene_id "g761"; Scaffold_5 AUGUSTUS CDS 3745510 3745987 1 + 1 transcript_id "g761.t1"; gene_id "g761"; Scaffold_5 AUGUSTUS stop_codon 3745985 3745987 . + 0 transcript_id "g761.t1"; gene_id "g761"; # protein sequence = [MSFLYPDIDKPPFELSETGWGEFEVHIKLHFIPESGEKVITIYHHLKLHPWSLSGDTESIPPLEVAQKAGTVHSWQYE # EIVFNDPYQNFLNILTNNPPTPIPRTNTSGRTIPFHIGNPASFESLKGGVPEFTSLLEKDEAERLDKAKKLIIAEQEKTRALLIAKEKELARLQKMLN # G] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g761 ### # start gene g762 Scaffold_5 AUGUSTUS gene 3750127 3750901 0.3 - . g762 Scaffold_5 AUGUSTUS transcript 3750127 3750901 0.3 - . g762.t1 Scaffold_5 AUGUSTUS stop_codon 3750127 3750129 . - 0 transcript_id "g762.t1"; gene_id "g762"; Scaffold_5 AUGUSTUS CDS 3750127 3750432 0.32 - 0 transcript_id "g762.t1"; gene_id "g762"; Scaffold_5 AUGUSTUS CDS 3750536 3750901 0.3 - 0 transcript_id "g762.t1"; gene_id "g762"; Scaffold_5 AUGUSTUS start_codon 3750899 3750901 . - 0 transcript_id "g762.t1"; gene_id "g762"; # protein sequence = [MVGAWEDVQNIVDSTDVATAQIAIARLLLALRSRDSAAITTALDGARMVLGGPIAAAGVNNYRRSYEAMLDLHLTHEL # ETIYNAISSLSEQSTSVNSALMRLSEILSSRLDSTLPTFRTRESVLRKKSDAHGLLAQRLLVKLANGRLHIVPCSNLSRTKTRYSFMESAKLVKAMGD # PLHALQQLENSMQLHNLLEDEVNVVDLTNDDNEENLKKMKAKVIIKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g762 ### # start gene g763 Scaffold_5 AUGUSTUS gene 3755340 3755945 0.49 - . g763 Scaffold_5 AUGUSTUS transcript 3755340 3755945 0.49 - . g763.t1 Scaffold_5 AUGUSTUS stop_codon 3755340 3755342 . - 0 transcript_id "g763.t1"; gene_id "g763"; Scaffold_5 AUGUSTUS CDS 3755340 3755945 0.49 - 0 transcript_id "g763.t1"; gene_id "g763"; Scaffold_5 AUGUSTUS start_codon 3755943 3755945 . - 0 transcript_id "g763.t1"; gene_id "g763"; # protein sequence = [MLPPPLLAALPRPNDADAPEQFLVQLRSIIREILPRDENTRISASDNATWVLILNQLHDAFLVTFSFNDVWNAQPERV # KLVEACLETIESILNRVDGALIARKEVPGSKDIPRKLFCALFTLCHTLDLYADTDITPRDGVSMPDALRESACRTAKLILRCMGGCHSPTGDEPMWKI # MRSIIEELLSLSHGELHAIVFLAVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g763 ### # start gene g764 Scaffold_5 AUGUSTUS gene 3761136 3763059 0.39 - . g764 Scaffold_5 AUGUSTUS transcript 3761136 3763059 0.39 - . g764.t1 Scaffold_5 AUGUSTUS stop_codon 3761136 3761138 . - 0 transcript_id "g764.t1"; gene_id "g764"; Scaffold_5 AUGUSTUS CDS 3761136 3762027 0.49 - 1 transcript_id "g764.t1"; gene_id "g764"; Scaffold_5 AUGUSTUS CDS 3762503 3763059 0.39 - 0 transcript_id "g764.t1"; gene_id "g764"; Scaffold_5 AUGUSTUS start_codon 3763057 3763059 . - 0 transcript_id "g764.t1"; gene_id "g764"; # protein sequence = [MSFSLPPINDNPDGGWGPSSSNFPGQFKFKDIPPYAPYSKSDKLGRFADWNETTSDTRQNAVGMVSTQNTRTGPGGRR # REGAQAFGSGTASAFAYFHVEDESSFSLVDNKNAPPRRGGTFIRGRGTARGGVGNYNARGGAQRGGRGGFGGRGGNAQRGRRGWRDWDISESNREIKN # ALTFKLLLPGLYFDKRDGGPFDTVTVNENAADPPQDPSPPNPNNPNEKVPDTPSINSATSLSLEATYVNQNFAFQSVVETSPPPAVDFSNPNPFYGPD # ETEPLASCGYRYRVFDLSVQEDENFKICVRTEVDAYLPGSGNPREGQGLVTIRALNEFDPRAAGAGGAPDWRTKLDSQRGAVVATEMKNNSCKLAKWA # VQSILAGADLMKIGYVLYVSSVFLPTNCLVFRYVSRSNPRDAARHVILSTASMRPTDFAAQLNVSLNNGWGIVRTVADLCMKMPEGKYVLVKDPNKVQ # AQLPFSSCMTDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g764 ### # start gene g765 Scaffold_5 AUGUSTUS gene 3763416 3764223 0.6 + . g765 Scaffold_5 AUGUSTUS transcript 3763416 3764223 0.6 + . g765.t1 Scaffold_5 AUGUSTUS start_codon 3763416 3763418 . + 0 transcript_id "g765.t1"; gene_id "g765"; Scaffold_5 AUGUSTUS CDS 3763416 3763677 0.6 + 0 transcript_id "g765.t1"; gene_id "g765"; Scaffold_5 AUGUSTUS CDS 3763724 3764223 0.96 + 2 transcript_id "g765.t1"; gene_id "g765"; Scaffold_5 AUGUSTUS stop_codon 3764221 3764223 . + 0 transcript_id "g765.t1"; gene_id "g765"; # protein sequence = [MDINMPRDKDTGKAKGFAFIMYEDQRSTVLAVDNLNGAKVLERTLRVDHVKNYKQPRTKGEDGEWIEAEEQSLNAKPE # IIIGSFVMLDDDPGSESSEDSGPEIDPEDPMRDYLLEKRREAKALKKAKKSKSKGKHKDETPEERRARKERKKEKRKKKSEKSAGVLGVEKLLESFGG # GRGRDINGGRTLERFRSPGRSYRPHSRSPTGRQRHDRDSSEPHSRSPSADRYDQRYRRGSRSLDGDRDRDRSSSYRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g765 ### # start gene g766 Scaffold_5 AUGUSTUS gene 3767598 3768221 0.65 + . g766 Scaffold_5 AUGUSTUS transcript 3767598 3768221 0.65 + . g766.t1 Scaffold_5 AUGUSTUS start_codon 3767598 3767600 . + 0 transcript_id "g766.t1"; gene_id "g766"; Scaffold_5 AUGUSTUS CDS 3767598 3768221 0.65 + 0 transcript_id "g766.t1"; gene_id "g766"; Scaffold_5 AUGUSTUS stop_codon 3768219 3768221 . + 0 transcript_id "g766.t1"; gene_id "g766"; # protein sequence = [MVDYDPWNGNYTNTVVYNNTILGGFSDEKEESNETDGTSSDDVIIKYTGSQCFNKVFTHVPLPNRIGIAIGPRTWFGS # EYGNNVSLSGNVYNNRLSGAFSYAIGMTSAKNFTVENNVLFGNTSFIGARGPNCSSTDTTPSPAAFVIDQSTVSQSTTQSNFTSISDGNSLTCVQPPD # GGDYWPFGGNPLRRRLHLHLVENPLRRLLVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g766 ### # start gene g767 Scaffold_5 AUGUSTUS gene 3772693 3773073 0.83 - . g767 Scaffold_5 AUGUSTUS transcript 3772693 3773073 0.83 - . g767.t1 Scaffold_5 AUGUSTUS stop_codon 3772693 3772695 . - 0 transcript_id "g767.t1"; gene_id "g767"; Scaffold_5 AUGUSTUS CDS 3772693 3773073 0.83 - 0 transcript_id "g767.t1"; gene_id "g767"; Scaffold_5 AUGUSTUS start_codon 3773071 3773073 . - 0 transcript_id "g767.t1"; gene_id "g767"; # protein sequence = [MSLASRLLRVAARTNRGSTGLTSPRRLLVPIHTQRNAGYATETPADAVKKEEFKVASEIPPPSGIADQINDGKTDWSK # SYHGLSEQAFAKEVAEVLMAPVEPLDVEIKPGTRNFFVSCRQYSKIES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g767 ### # start gene g768 Scaffold_5 AUGUSTUS gene 3774343 3774582 0.22 - . g768 Scaffold_5 AUGUSTUS transcript 3774343 3774582 0.22 - . g768.t1 Scaffold_5 AUGUSTUS stop_codon 3774343 3774345 . - 0 transcript_id "g768.t1"; gene_id "g768"; Scaffold_5 AUGUSTUS CDS 3774343 3774582 0.22 - 0 transcript_id "g768.t1"; gene_id "g768"; Scaffold_5 AUGUSTUS start_codon 3774580 3774582 . - 0 transcript_id "g768.t1"; gene_id "g768"; # protein sequence = [MGLVPGVSLAQWIGTRLTARGLSYASRAWFKTSGVQASSTENDAEIRELENGYGPSSSPAADYAKSTQKAFADSVVRN # E] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g768 ### # start gene g769 Scaffold_5 AUGUSTUS gene 3780806 3781963 0.89 - . g769 Scaffold_5 AUGUSTUS transcript 3780806 3781963 0.89 - . g769.t1 Scaffold_5 AUGUSTUS stop_codon 3780806 3780808 . - 0 transcript_id "g769.t1"; gene_id "g769"; Scaffold_5 AUGUSTUS CDS 3780806 3781963 0.89 - 0 transcript_id "g769.t1"; gene_id "g769"; Scaffold_5 AUGUSTUS start_codon 3781961 3781963 . - 0 transcript_id "g769.t1"; gene_id "g769"; # protein sequence = [MSACVKNQNADHIHSLFPYTCVILASIYNSANNSAFNSPAGMLGHQQLPSLSPQPPHLGLGLNSGYNSNSNDFTPSNS # PSPPLSSAGIRLPNAPLSDIAEYRSNSGNMNGEYNSGEYIEYNEYDRNSNEPELGYSESYDSPYLNNYNRLPTSVSPSPHPRTPHSLPLPLSSTNSPY # LGSSHLGSPHLGSPHLGSPGNMVPSPLAEAQLLQSQASAGSSNGSTSTLMDISSSPETLVNPDSAGTKISPMLMPPSLSREFTAPVGNGQRNKSHTIS # TSTPYEAYLNASREARGQERMMYGTPRERSGSVSSAYSTHSASSASSAHSSRASSILLSARSVHASLPEIEGEDTVLVSVSGSMDELHMGLGGLHEMH # ETLDPSVLHGERV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g769 ### # start gene g770 Scaffold_5 AUGUSTUS gene 3790461 3790693 0.66 + . g770 Scaffold_5 AUGUSTUS transcript 3790461 3790693 0.66 + . g770.t1 Scaffold_5 AUGUSTUS start_codon 3790461 3790463 . + 0 transcript_id "g770.t1"; gene_id "g770"; Scaffold_5 AUGUSTUS CDS 3790461 3790463 0.66 + 0 transcript_id "g770.t1"; gene_id "g770"; Scaffold_5 AUGUSTUS CDS 3790589 3790693 0.66 + 0 transcript_id "g770.t1"; gene_id "g770"; Scaffold_5 AUGUSTUS stop_codon 3790691 3790693 . + 0 transcript_id "g770.t1"; gene_id "g770"; # protein sequence = [MYASKLKRSEGHKDLRHVSIRLCKDSEDLDAESFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g770 ### # start gene g771 Scaffold_5 AUGUSTUS gene 3795357 3796211 0.99 + . g771 Scaffold_5 AUGUSTUS transcript 3795357 3796211 0.99 + . g771.t1 Scaffold_5 AUGUSTUS start_codon 3795357 3795359 . + 0 transcript_id "g771.t1"; gene_id "g771"; Scaffold_5 AUGUSTUS CDS 3795357 3796211 0.99 + 0 transcript_id "g771.t1"; gene_id "g771"; Scaffold_5 AUGUSTUS stop_codon 3796209 3796211 . + 0 transcript_id "g771.t1"; gene_id "g771"; # protein sequence = [MTLDGQETPPLKTPARRTGRRSLGPAPPSVPVEFEDTKQVIRERRRSEKATTLAHSQTLQSLSDSDLEALLLPADTDV # SDDGKGGEAGEEDQNIVHWKDRIGMLSAGGGIPTRAIMPGTLVTPSPPGAALLLFQRKKDGILRTSSPSNASSSSTETISVEVLSPSSTTAPRPLART # MSMEERAGFIAHLEELSSAKAYVLSRADLTELRGRAPKGLYTRFLMDEEAGRNVLVVGRDEVDTERLYQTLDAEKQQAMYATRGVSMKSAAGGVVVGA # VATFTGLAFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g771 ### # start gene g772 Scaffold_5 AUGUSTUS gene 3798685 3799290 0.31 + . g772 Scaffold_5 AUGUSTUS transcript 3798685 3799290 0.31 + . g772.t1 Scaffold_5 AUGUSTUS start_codon 3798685 3798687 . + 0 transcript_id "g772.t1"; gene_id "g772"; Scaffold_5 AUGUSTUS CDS 3798685 3799290 0.31 + 0 transcript_id "g772.t1"; gene_id "g772"; Scaffold_5 AUGUSTUS stop_codon 3799288 3799290 . + 0 transcript_id "g772.t1"; gene_id "g772"; # protein sequence = [MLAVKILEAIVRIVGGVAFDRSRHVVDSGLFGACGLLGCCGGPRKSSRRDKRSGKSSDRIGYSQAESAPRSPQSDLSF # PPTIAVGTGKGSIHSSGPPPSVLKPEHALRPYREESDDETGYIMGAWQPFQNRASGYIPVADSGSTSAVPPAAIKSSGFSRVAGGRAHIDSPYAISQE # QATGSTHTFPSIGHRIAANQTPPVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g772 ### # start gene g773 Scaffold_5 AUGUSTUS gene 3800208 3801421 0.68 - . g773 Scaffold_5 AUGUSTUS transcript 3800208 3801421 0.68 - . g773.t1 Scaffold_5 AUGUSTUS stop_codon 3800208 3800210 . - 0 transcript_id "g773.t1"; gene_id "g773"; Scaffold_5 AUGUSTUS CDS 3800208 3801197 0.68 - 0 transcript_id "g773.t1"; gene_id "g773"; Scaffold_5 AUGUSTUS CDS 3801359 3801421 0.71 - 0 transcript_id "g773.t1"; gene_id "g773"; Scaffold_5 AUGUSTUS start_codon 3801419 3801421 . - 0 transcript_id "g773.t1"; gene_id "g773"; # protein sequence = [MGNRFCIIGDAWFSSQHLLSLLNFILQEFYTPLVPRSITFFQQSVSEIARSFSDSGYKASSSHRRTDSSITSRDAHRL # SSTSAMTVTYGTQLSIFVIFDKKSGWIRLADSAVGEVDLHDDSQFGPTPRESSSPTSHRKSRIIMDTSSFGKWIPPALCELPMSAPGAPLQTTKVILL # TRGRRTHILPSPLPSNSSLHIPLRIVSWRNNPTDVVPRIFEGSEPDMDGYSTPAYLQLISLGELGVEVQEFSLPSLLTKGKGKARADDILYAEQDTGG # DAGFLCTGGHWDRQRTFASNLNRSYSTLSTNSSFSTDSTQLELEKGLYCWCRKGLEDFRVFWLGGSLTADYEDEEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g773 ### # start gene g774 Scaffold_5 AUGUSTUS gene 3808593 3809503 0.27 + . g774 Scaffold_5 AUGUSTUS transcript 3808593 3809503 0.27 + . g774.t1 Scaffold_5 AUGUSTUS start_codon 3808593 3808595 . + 0 transcript_id "g774.t1"; gene_id "g774"; Scaffold_5 AUGUSTUS CDS 3808593 3808625 0.32 + 0 transcript_id "g774.t1"; gene_id "g774"; Scaffold_5 AUGUSTUS CDS 3808721 3809503 0.5 + 0 transcript_id "g774.t1"; gene_id "g774"; Scaffold_5 AUGUSTUS stop_codon 3809501 3809503 . + 0 transcript_id "g774.t1"; gene_id "g774"; # protein sequence = [MSPSSAWTGLRNVKALIAMGGWAGSMYFSSAVGSAENRTAFVKTVTDFTSKYGLDGINFECVFLNSIYAHFSLNMCSW # EYPNKQGIGCNVINTNDAGNFLEFLQELRQDPIGMKLSLSAATGIATFSGPSGDPLTDVSGFAEVLDFIAIMNYDVWGSWSAAVGPNSPLADSCAASE # NQQGSAATAVKNWNGAGMPLDKIVLGVASYGHSFVVSHDDAYMNGSTTELAPYPPLTSRPSLMEILGTMMGVLMLVVTMSLVGVSLRDISSQCLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g774 ### # start gene g775 Scaffold_5 AUGUSTUS gene 3812007 3812558 1 - . g775 Scaffold_5 AUGUSTUS transcript 3812007 3812558 1 - . g775.t1 Scaffold_5 AUGUSTUS stop_codon 3812007 3812009 . - 0 transcript_id "g775.t1"; gene_id "g775"; Scaffold_5 AUGUSTUS CDS 3812007 3812558 1 - 0 transcript_id "g775.t1"; gene_id "g775"; Scaffold_5 AUGUSTUS start_codon 3812556 3812558 . - 0 transcript_id "g775.t1"; gene_id "g775"; # protein sequence = [MLKSYQASIDLEKNVLRIQGREIPFLAEHQLPAKARGLEEEEEALNSALNASRSAGIQSFQSTVVTVALSYVLPGPST # GSQHFPGGGATLGGTPGPRLATAGAATPGASNIRAAPRSPATPSAHGPASRSSASSLSHPASGARQTHPEAKIAVLMDLGATREIAISMLDATGGNVD # AAASLMF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g775 ### # start gene g776 Scaffold_5 AUGUSTUS gene 3813032 3813409 0.61 - . g776 Scaffold_5 AUGUSTUS transcript 3813032 3813409 0.61 - . g776.t1 Scaffold_5 AUGUSTUS stop_codon 3813032 3813034 . - 0 transcript_id "g776.t1"; gene_id "g776"; Scaffold_5 AUGUSTUS CDS 3813032 3813409 0.61 - 0 transcript_id "g776.t1"; gene_id "g776"; Scaffold_5 AUGUSTUS start_codon 3813407 3813409 . - 0 transcript_id "g776.t1"; gene_id "g776"; # protein sequence = [MLSLRRKAMIAPSGQSVDHDSETMRLQLLGSPDLMSQLEQHQPEIASAARNNPARFAELLRQTRTTQQQTADLEAQQE # LSLMNADPFDVEAQRKIEERIRQQAVLDNMAHAIEWSPESFGRVTML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g776 ### # start gene g777 Scaffold_5 AUGUSTUS gene 3817474 3819410 0.33 + . g777 Scaffold_5 AUGUSTUS transcript 3817474 3819410 0.33 + . g777.t1 Scaffold_5 AUGUSTUS start_codon 3817474 3817476 . + 0 transcript_id "g777.t1"; gene_id "g777"; Scaffold_5 AUGUSTUS CDS 3817474 3818717 0.33 + 0 transcript_id "g777.t1"; gene_id "g777"; Scaffold_5 AUGUSTUS CDS 3818792 3819410 0.52 + 1 transcript_id "g777.t1"; gene_id "g777"; Scaffold_5 AUGUSTUS stop_codon 3819408 3819410 . + 0 transcript_id "g777.t1"; gene_id "g777"; # protein sequence = [MNLAIVNGTELESPHRGSYTSHQRNGKAVVDYILVSQALCTLIKNLSIEVRPVSKTDQWSDHSKLSLVISREICIMTA # NQSTQQKNPLSIPVHDERTDIIYNEVLQSAKPPHQLLRDFYGPVYYDKNPISVYTDGSCLDNGKESARAGSGICFGLRSNQNISLRVPGPGDPTNNRA # EAYTVLMLLLNVDPKRALNIYCDSTYVIRECCYWAGRHLSTGWKMSNGDLLKDICLLLKYRLALTRFIWVKGHSGIPQNELADELAKTGCTKRIPRDY # TCLMSAPWECNPGNKLAIDVQKVSTDLPEHAEPGAMNATPTILTVESGHRGRSKVGKIRHENLVKLRNCKTNAQFWMLYKSWLDPKAKDFELSLNHLY # TEFKTRLNSPMVPSLQLNHNHLSYLKHLEAMLPENNLDPTEQGAMGSDGISYKEIMDIPNENIVSFLNHCVVNKTAPSQWLYAIVIGILKPGKNASDP # SGYRLIVLECCFAKLLAYIIDRRIRSYSDLKQLIPDSQNGFRPTYRTTNNPLILRTMVDKAESLGNPLYFAYMDWTNAFPSTDRSVMWIKLFSMGVKG # PMIDWIRMLYAKIAYVVRVCGSHSEPFGGDMGVITGSPDSPNLFNLAGFDPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g777 ### # start gene g778 Scaffold_5 AUGUSTUS gene 3819912 3820696 0.82 + . g778 Scaffold_5 AUGUSTUS transcript 3819912 3820696 0.82 + . g778.t1 Scaffold_5 AUGUSTUS start_codon 3819912 3819914 . + 0 transcript_id "g778.t1"; gene_id "g778"; Scaffold_5 AUGUSTUS CDS 3819912 3820071 0.84 + 0 transcript_id "g778.t1"; gene_id "g778"; Scaffold_5 AUGUSTUS CDS 3820146 3820696 0.82 + 2 transcript_id "g778.t1"; gene_id "g778"; Scaffold_5 AUGUSTUS stop_codon 3820694 3820696 . + 0 transcript_id "g778.t1"; gene_id "g778"; # protein sequence = [MTRASPVPENESNPDTERTPADNNSPTTPNPQSQSQSQSQWSIGERRCQQLPMLKSWNTLNDGSSPSSIKPSTSTLTI # GNDVFTTLKLNTSEKKNRIVDVGKVVDANFRVLGGLHLELEKRLTDQGARVADDVAELATRVDNLEVADVVGNEDVLNDNLSQSSLPVSAGAGILRDL # KSRISALEEAPDNEESTDEHVEVLEKLVKKMRGDITNLKDKVELDRQFAKQVQSFMLRLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g778 ### # start gene g779 Scaffold_5 AUGUSTUS gene 3820980 3821669 0.54 + . g779 Scaffold_5 AUGUSTUS transcript 3820980 3821669 0.54 + . g779.t1 Scaffold_5 AUGUSTUS start_codon 3820980 3820982 . + 0 transcript_id "g779.t1"; gene_id "g779"; Scaffold_5 AUGUSTUS CDS 3820980 3821669 0.54 + 0 transcript_id "g779.t1"; gene_id "g779"; Scaffold_5 AUGUSTUS stop_codon 3821667 3821669 . + 0 transcript_id "g779.t1"; gene_id "g779"; # protein sequence = [MESIQEAYSLAQNGHTSIILEACRVLDNLPIPFTWNIPEFEDITTAYLNDLITGIQNSMEKTLQKAVISCPRTMDTLK # ERKEYDRKQKKMVFKPLTFRHYLNVPTGSHRKALIHIVTGNHQLAVERLRWDERNRPRIIREHRLCRLCKGSVEDPAHVLFECKGSLELIKLRETFMQ # KVILGLPQYAKFYPDAWMLFRTLLADTRITELFAKLAYDVLEVVYEVEIFVPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g779 ### # start gene g780 Scaffold_5 AUGUSTUS gene 3827984 3828593 0.34 - . g780 Scaffold_5 AUGUSTUS transcript 3827984 3828593 0.34 - . g780.t1 Scaffold_5 AUGUSTUS stop_codon 3827984 3827986 . - 0 transcript_id "g780.t1"; gene_id "g780"; Scaffold_5 AUGUSTUS CDS 3827984 3828436 0.91 - 0 transcript_id "g780.t1"; gene_id "g780"; Scaffold_5 AUGUSTUS CDS 3828516 3828593 0.34 - 0 transcript_id "g780.t1"; gene_id "g780"; Scaffold_5 AUGUSTUS start_codon 3828591 3828593 . - 0 transcript_id "g780.t1"; gene_id "g780"; # protein sequence = [MFVFGEVQDPLSETVNLVEDIVRSQLARGLAIRRGARYLSAEDLIFLIRHDRGKVNRLRTYLSWKDVRKHAKDSDNAA # GGGGVEEAIEDGADGASSFLSAFRHSQHYSHIHCTDKLAAKAQKITIKLPWEITTLYSEVLRQSGREDEDEEDEDDIEAHEASIQRLKVRVYICSSQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g780 ### # start gene g781 Scaffold_5 AUGUSTUS gene 3831659 3833138 0.54 + . g781 Scaffold_5 AUGUSTUS transcript 3831659 3833138 0.54 + . g781.t1 Scaffold_5 AUGUSTUS start_codon 3831659 3831661 . + 0 transcript_id "g781.t1"; gene_id "g781"; Scaffold_5 AUGUSTUS CDS 3831659 3832292 0.55 + 0 transcript_id "g781.t1"; gene_id "g781"; Scaffold_5 AUGUSTUS CDS 3832541 3832935 0.73 + 2 transcript_id "g781.t1"; gene_id "g781"; Scaffold_5 AUGUSTUS CDS 3833019 3833138 0.76 + 0 transcript_id "g781.t1"; gene_id "g781"; Scaffold_5 AUGUSTUS stop_codon 3833136 3833138 . + 0 transcript_id "g781.t1"; gene_id "g781"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQLGQPKNGLSLISRSGSRLAAGLDVLLQALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRK # YNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRSARLPSGSSAPFTPKPKPFSGGKPNNNGKPQNS # SNSGQSGGQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g781 ### # start gene g782 Scaffold_5 AUGUSTUS gene 3839016 3841123 0.26 + . g782 Scaffold_5 AUGUSTUS transcript 3839016 3841123 0.26 + . g782.t1 Scaffold_5 AUGUSTUS start_codon 3839016 3839018 . + 0 transcript_id "g782.t1"; gene_id "g782"; Scaffold_5 AUGUSTUS CDS 3839016 3839452 0.26 + 0 transcript_id "g782.t1"; gene_id "g782"; Scaffold_5 AUGUSTUS CDS 3840538 3841123 0.92 + 1 transcript_id "g782.t1"; gene_id "g782"; Scaffold_5 AUGUSTUS stop_codon 3841121 3841123 . + 0 transcript_id "g782.t1"; gene_id "g782"; # protein sequence = [MEDHLSDPYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLY # ANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVRGRLRTFSPSWVLQTSIVVLFIIIVISFYLVVDRSSKQAIFIPTHDTITSEQLAELFV # IHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFF # ANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPVTRLNFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g782 ### # start gene g783 Scaffold_5 AUGUSTUS gene 3844252 3844608 0.96 - . g783 Scaffold_5 AUGUSTUS transcript 3844252 3844608 0.96 - . g783.t1 Scaffold_5 AUGUSTUS stop_codon 3844252 3844254 . - 0 transcript_id "g783.t1"; gene_id "g783"; Scaffold_5 AUGUSTUS CDS 3844252 3844608 0.96 - 0 transcript_id "g783.t1"; gene_id "g783"; Scaffold_5 AUGUSTUS start_codon 3844606 3844608 . - 0 transcript_id "g783.t1"; gene_id "g783"; # protein sequence = [MSASRTTTTTTSATAGPSRSRPVPPPPPPASDSAAQEEEDLEDEDEDDIIRKAQARVERVRARKAAEAARKKAEEEAA # RAAAEKKRKAQEVQERAKRARQQEEEVVERRRTVGRCGDC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g783 ### # start gene g784 Scaffold_5 AUGUSTUS gene 3851650 3852162 0.25 + . g784 Scaffold_5 AUGUSTUS transcript 3851650 3852162 0.25 + . g784.t1 Scaffold_5 AUGUSTUS start_codon 3851650 3851652 . + 0 transcript_id "g784.t1"; gene_id "g784"; Scaffold_5 AUGUSTUS CDS 3851650 3852162 0.25 + 0 transcript_id "g784.t1"; gene_id "g784"; Scaffold_5 AUGUSTUS stop_codon 3852160 3852162 . + 0 transcript_id "g784.t1"; gene_id "g784"; # protein sequence = [MLAKDVDFVPQSPQKMQTFRRDNDPASAAPSPSVGVSVGTVTGMGGRRTRTHSRTRSAFALGATSTRISSRASSRERG # HSRARSVGRAEPELSQEQNQQVEMRDTDAATRATAGISLSQRNTTAEVSKEGLRMDIRARTTEEKKELLGTMLGNVDALVEGVRKAGIWGLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g784 ### # start gene g785 Scaffold_5 AUGUSTUS gene 3855552 3855842 0.92 + . g785 Scaffold_5 AUGUSTUS transcript 3855552 3855842 0.92 + . g785.t1 Scaffold_5 AUGUSTUS start_codon 3855552 3855554 . + 0 transcript_id "g785.t1"; gene_id "g785"; Scaffold_5 AUGUSTUS CDS 3855552 3855842 0.92 + 0 transcript_id "g785.t1"; gene_id "g785"; Scaffold_5 AUGUSTUS stop_codon 3855840 3855842 . + 0 transcript_id "g785.t1"; gene_id "g785"; # protein sequence = [MAQRSSSLNKFILYENKLRFYIIASNSSDSRHRIIKIDRSVQDELVIVEDDAEYTGKEMSAMLKMLDDGNKNMGGLGK # AKVIFGVAGELTQNTSYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g785 ### # start gene g786 Scaffold_5 AUGUSTUS gene 3866599 3866997 0.36 - . g786 Scaffold_5 AUGUSTUS transcript 3866599 3866997 0.36 - . g786.t1 Scaffold_5 AUGUSTUS stop_codon 3866599 3866601 . - 0 transcript_id "g786.t1"; gene_id "g786"; Scaffold_5 AUGUSTUS CDS 3866599 3866997 0.36 - 0 transcript_id "g786.t1"; gene_id "g786"; Scaffold_5 AUGUSTUS start_codon 3866995 3866997 . - 0 transcript_id "g786.t1"; gene_id "g786"; # protein sequence = [MGSVQHLDDVAGGMYSSSAHDCVRPLIEIFAFERVACMCIPSKFVHFPLIVLEKYGATSGTGKTCSLLLDLEPAFYRF # CDALEVKEGISASMDGWGLEHALAAWGAYWKESYLETSEWPMHRSMGLSRLQLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g786 ### # start gene g787 Scaffold_5 AUGUSTUS gene 3874090 3875307 0.97 + . g787 Scaffold_5 AUGUSTUS transcript 3874090 3875307 0.97 + . g787.t1 Scaffold_5 AUGUSTUS start_codon 3874090 3874092 . + 0 transcript_id "g787.t1"; gene_id "g787"; Scaffold_5 AUGUSTUS CDS 3874090 3875307 0.97 + 0 transcript_id "g787.t1"; gene_id "g787"; Scaffold_5 AUGUSTUS stop_codon 3875305 3875307 . + 0 transcript_id "g787.t1"; gene_id "g787"; # protein sequence = [MFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLE # TVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNSSALKPKVEDEFKDLLGIK # LESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWAC # FLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWM # TRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g787 ### # start gene g788 Scaffold_5 AUGUSTUS gene 3875337 3876767 0.97 + . g788 Scaffold_5 AUGUSTUS transcript 3875337 3876767 0.97 + . g788.t1 Scaffold_5 AUGUSTUS start_codon 3875337 3875339 . + 0 transcript_id "g788.t1"; gene_id "g788"; Scaffold_5 AUGUSTUS CDS 3875337 3876767 0.97 + 0 transcript_id "g788.t1"; gene_id "g788"; Scaffold_5 AUGUSTUS stop_codon 3876765 3876767 . + 0 transcript_id "g788.t1"; gene_id "g788"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGEMIQR # EIFIPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g788 ### # start gene g789 Scaffold_5 AUGUSTUS gene 3883920 3884312 0.56 + . g789 Scaffold_5 AUGUSTUS transcript 3883920 3884312 0.56 + . g789.t1 Scaffold_5 AUGUSTUS start_codon 3883920 3883922 . + 0 transcript_id "g789.t1"; gene_id "g789"; Scaffold_5 AUGUSTUS CDS 3883920 3884312 0.56 + 0 transcript_id "g789.t1"; gene_id "g789"; Scaffold_5 AUGUSTUS stop_codon 3884310 3884312 . + 0 transcript_id "g789.t1"; gene_id "g789"; # protein sequence = [MIIGNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQQKKGKAQDSKDKKENIQADVVNEPPTNKLEER # IKLNQQDRSPINLIDETNKQVDNEAIGVEEPINLNTEEVFTKYKPVDKRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g789 ### # start gene g790 Scaffold_5 AUGUSTUS gene 3884989 3887776 0.42 + . g790 Scaffold_5 AUGUSTUS transcript 3884989 3887776 0.42 + . g790.t1 Scaffold_5 AUGUSTUS start_codon 3884989 3884991 . + 0 transcript_id "g790.t1"; gene_id "g790"; Scaffold_5 AUGUSTUS CDS 3884989 3886523 0.57 + 0 transcript_id "g790.t1"; gene_id "g790"; Scaffold_5 AUGUSTUS CDS 3886660 3887776 0.59 + 1 transcript_id "g790.t1"; gene_id "g790"; Scaffold_5 AUGUSTUS stop_codon 3887774 3887776 . + 0 transcript_id "g790.t1"; gene_id "g790"; # protein sequence = [MGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKY # AGGTFSGTKAFLCCDETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIVNFAKKAAPLTKLTSNVPFEWNEKCDKAMDELK # DGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKG # MLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYL # YETAQEADDVELDVQEALDEERSYEIRRNHMLESKNATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDEFLGEMSKDE # RIKFIRLIKKFQVYDQGRLYHRNTDQPDQPQLVVEKEKCMHIQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLTSWSEARAVKH # ENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTP # RRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWGFKPGQLVQVRN # SGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDA # IPHLRLSDTDSDEELSEGEHQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g790 ### # start gene g791 Scaffold_5 AUGUSTUS gene 3890687 3891493 0.51 + . g791 Scaffold_5 AUGUSTUS transcript 3890687 3891493 0.51 + . g791.t1 Scaffold_5 AUGUSTUS start_codon 3890687 3890689 . + 0 transcript_id "g791.t1"; gene_id "g791"; Scaffold_5 AUGUSTUS CDS 3890687 3891493 0.51 + 0 transcript_id "g791.t1"; gene_id "g791"; Scaffold_5 AUGUSTUS stop_codon 3891491 3891493 . + 0 transcript_id "g791.t1"; gene_id "g791"; # protein sequence = [MLDEQDSRAIDRSKLRRFQEAQEQETLLAAKRKYVNDPPSSKVRPKKRRLAKVVGERRVEEPVVEEVPRLIRLVIPPS # RLAPSDPGSAPSASQHPSVALPLVSPHATGRLGSVQDPPPLARLADLVDQRTGSQAEVSTRSLGPGFSSIKASREDPAVPKMSPVVRPPLIPRILSQH # PYRVENERLAARVRLLESQLASSRQENATLTSALRDTSVSLEARQGELDQLRESVSSAAQQQELHDRLLDQVETLKCALPGPPNGVCHHLFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g791 ### # start gene g792 Scaffold_5 AUGUSTUS gene 3895912 3896963 0.71 + . g792 Scaffold_5 AUGUSTUS transcript 3895912 3896963 0.71 + . g792.t1 Scaffold_5 AUGUSTUS start_codon 3895912 3895914 . + 0 transcript_id "g792.t1"; gene_id "g792"; Scaffold_5 AUGUSTUS CDS 3895912 3896063 0.71 + 0 transcript_id "g792.t1"; gene_id "g792"; Scaffold_5 AUGUSTUS CDS 3896153 3896963 0.89 + 1 transcript_id "g792.t1"; gene_id "g792"; Scaffold_5 AUGUSTUS stop_codon 3896961 3896963 . + 0 transcript_id "g792.t1"; gene_id "g792"; # protein sequence = [MLELLSGFKGSIETLGTVLATLGRPSDSSESKSKVKEPEVFDGSDPRKLKTGSAKEWFVPDILDPDLDSLPAWTSSFK # ALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPKPATLADYRQEVLRIDNRYWKRE # ETRKREAGKPFVARNPKKGSSDFKTGSSNQHNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSKKERRMKNN # LCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g792 ### # start gene g793 Scaffold_5 AUGUSTUS gene 3901126 3902958 0.96 + . g793 Scaffold_5 AUGUSTUS transcript 3901126 3902958 0.96 + . g793.t1 Scaffold_5 AUGUSTUS start_codon 3901126 3901128 . + 0 transcript_id "g793.t1"; gene_id "g793"; Scaffold_5 AUGUSTUS CDS 3901126 3902958 0.96 + 0 transcript_id "g793.t1"; gene_id "g793"; Scaffold_5 AUGUSTUS stop_codon 3902956 3902958 . + 0 transcript_id "g793.t1"; gene_id "g793"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGF # LGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ # PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDN # RQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPKRRTYALRYSVNATTIQLQDTPD # YTGHSTWSVPISGGLRCALLWKNTLRDARFVPVRRSSDTHGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g793 ### # start gene g794 Scaffold_5 AUGUSTUS gene 3904402 3905301 0.83 + . g794 Scaffold_5 AUGUSTUS transcript 3904402 3905301 0.83 + . g794.t1 Scaffold_5 AUGUSTUS start_codon 3904402 3904404 . + 0 transcript_id "g794.t1"; gene_id "g794"; Scaffold_5 AUGUSTUS CDS 3904402 3904477 0.83 + 0 transcript_id "g794.t1"; gene_id "g794"; Scaffold_5 AUGUSTUS CDS 3904625 3905301 0.84 + 2 transcript_id "g794.t1"; gene_id "g794"; Scaffold_5 AUGUSTUS stop_codon 3905299 3905301 . + 0 transcript_id "g794.t1"; gene_id "g794"; # protein sequence = [MTTILNISLSLSGTSLPPFCLVAPPYVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQL # ATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVM # PFGLTNAPAAFQQFVNDIFSDMLDVCVIVYLDDILIYPDTPEEHREHVDTPKFWLDVYAVNCDIFTYRFVSRGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g794 ### # start gene g795 Scaffold_5 AUGUSTUS gene 3906872 3909058 0.99 + . g795 Scaffold_5 AUGUSTUS transcript 3906872 3909058 0.99 + . g795.t1 Scaffold_5 AUGUSTUS start_codon 3906872 3906874 . + 0 transcript_id "g795.t1"; gene_id "g795"; Scaffold_5 AUGUSTUS CDS 3906872 3909058 0.99 + 0 transcript_id "g795.t1"; gene_id "g795"; Scaffold_5 AUGUSTUS stop_codon 3909056 3909058 . + 0 transcript_id "g795.t1"; gene_id "g795"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGASWIWDSSC # QEAFENLKIAFTSAPILAHWEPNRPLIVETDASNYAIAAILSIQYADGEIHPQPSFPERFMRRNSTMIHTTKSYWPSSRPLKLGVIIWKVRVIRWTSS # PITKILSIFLLPRFSPADRSDGQNFASIQYGHSLPAGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPALRASIIM # DIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDY # VTSCTICGRNKPRRHRPYGLLKPLPVPARPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSKQLAELFVIHVFSKHGVPNHVTSDR # GSEFVSAFFRALGKVLSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDM # KSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHP # VFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAKILDSKLDRRYKRCPLRLLYSVGRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g795 ### # start gene g796 Scaffold_5 AUGUSTUS gene 3912635 3913198 0.56 - . g796 Scaffold_5 AUGUSTUS transcript 3912635 3913198 0.56 - . g796.t1 Scaffold_5 AUGUSTUS stop_codon 3912635 3912637 . - 0 transcript_id "g796.t1"; gene_id "g796"; Scaffold_5 AUGUSTUS CDS 3912635 3913198 0.56 - 0 transcript_id "g796.t1"; gene_id "g796"; Scaffold_5 AUGUSTUS start_codon 3913196 3913198 . - 0 transcript_id "g796.t1"; gene_id "g796"; # protein sequence = [MDCLLREGTPAYFLHISPTKEESPTEEMLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKS # IPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALN # KITKKNRYLYP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g796 ### # start gene g797 Scaffold_5 AUGUSTUS gene 3915045 3918700 0.25 - . g797 Scaffold_5 AUGUSTUS transcript 3915045 3918700 0.25 - . g797.t1 Scaffold_5 AUGUSTUS stop_codon 3915045 3915047 . - 0 transcript_id "g797.t1"; gene_id "g797"; Scaffold_5 AUGUSTUS CDS 3915045 3917411 0.55 - 0 transcript_id "g797.t1"; gene_id "g797"; Scaffold_5 AUGUSTUS CDS 3917534 3917570 0.28 - 1 transcript_id "g797.t1"; gene_id "g797"; Scaffold_5 AUGUSTUS CDS 3917682 3918700 0.32 - 0 transcript_id "g797.t1"; gene_id "g797"; Scaffold_5 AUGUSTUS start_codon 3918698 3918700 . - 0 transcript_id "g797.t1"; gene_id "g797"; # protein sequence = [MSATSTERPSSSESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQGP # PPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAVSE # QSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEILG # DGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSSGAVRFEPPPSRTQEYTTAHLLAPVESMPDQD # SPVRVRNGQTVYTYTPMRHMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQF # DQKGQLHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQD # LTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAPFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARV # IETLQEQLREVKKGFTAGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPSVDR # RRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSE # GSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWK # TWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIR # FNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLHGEKVLQGWLSRFPGWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g797 ### # start gene g798 Scaffold_5 AUGUSTUS gene 3926366 3928176 0.67 - . g798 Scaffold_5 AUGUSTUS transcript 3926366 3928176 0.67 - . g798.t1 Scaffold_5 AUGUSTUS stop_codon 3926366 3926368 . - 0 transcript_id "g798.t1"; gene_id "g798"; Scaffold_5 AUGUSTUS CDS 3926366 3927177 0.9 - 2 transcript_id "g798.t1"; gene_id "g798"; Scaffold_5 AUGUSTUS CDS 3927318 3928176 0.69 - 0 transcript_id "g798.t1"; gene_id "g798"; Scaffold_5 AUGUSTUS start_codon 3928174 3928176 . - 0 transcript_id "g798.t1"; gene_id "g798"; # protein sequence = [MSILFTRNDGEGGVFRPERVREILHKVKIGPGLSNNQRIHVEWLLGEYADCFALSVGEVRPVKDAVHKLNIPEGTTFP # KKVRQRSLTPPQREYLHMKINELLEAGVIERCNPEDVKCVSPLTLAQKVHEGKGLTVEELMYKLNDECVAAGLPASFDLPTRPQPPDPTERTDVAKPA # KWRICQNFMAVNKLTEIAPMPQGNIRSKQQSLSGHTYICLFDFASGFYACEVERESHPYTAFYVEGKGYFWCAKLPFGLTGAPSTFANMTARHLDDLI # ADGTIELFVDDGARKGVTVDPAKLTAIVEWKQPVDALNLASFVGLTGHFCDLIRNYARIEGPLRNLLKSVPLPQNYTKSTYRRAMESFKLEGKWTLDH # TKAFLALKKALVSEPVLKAPRWDGSSFVVTTDGCKEGFAAVVAQRFEVVHPNGTTTYKMHPVGFASKQTSSSEQNYKPFLLEFAALKFGLDKFSDMIW # GFPVEIETDCQALRDVIANNKLNAAHCRWRDGILAHHIVDVRHIPGNELASFCVKEKGRNLMGTPTNQSNTQYASSLLSNLFNSKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g798 ### # start gene g799 Scaffold_5 AUGUSTUS gene 3930440 3931080 0.4 - . g799 Scaffold_5 AUGUSTUS transcript 3930440 3931080 0.4 - . g799.t1 Scaffold_5 AUGUSTUS stop_codon 3930440 3930442 . - 0 transcript_id "g799.t1"; gene_id "g799"; Scaffold_5 AUGUSTUS CDS 3930440 3930908 0.79 - 1 transcript_id "g799.t1"; gene_id "g799"; Scaffold_5 AUGUSTUS CDS 3931022 3931080 0.4 - 0 transcript_id "g799.t1"; gene_id "g799"; Scaffold_5 AUGUSTUS start_codon 3931078 3931080 . - 0 transcript_id "g799.t1"; gene_id "g799"; # protein sequence = [MCLRQPDLRAFYCLRRIRIPTHGPLIHSRATEKVTRHIEDAVSKGAQVLVGGKVVENTNFFQPTVLSDVPSDALINDE # ETFGPLAALVKFDTEDEVIKLANATEVGLAGYFFSRDIGRAWRVAERLEVGMVAVTGLISQAVIPFGGVKESGLGREGGPHGIDEYMNEKLIVFGGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g799 ### # start gene g800 Scaffold_5 AUGUSTUS gene 3932808 3933185 0.99 + . g800 Scaffold_5 AUGUSTUS transcript 3932808 3933185 0.99 + . g800.t1 Scaffold_5 AUGUSTUS start_codon 3932808 3932810 . + 0 transcript_id "g800.t1"; gene_id "g800"; Scaffold_5 AUGUSTUS CDS 3932808 3933185 0.99 + 0 transcript_id "g800.t1"; gene_id "g800"; Scaffold_5 AUGUSTUS stop_codon 3933183 3933185 . + 0 transcript_id "g800.t1"; gene_id "g800"; # protein sequence = [MSSSSSSSSSGSASPEPSLKRRREGKSADGVEATQSSSSDSDSSDEDDAPALSHAEKRRQKKKETTRKDKGLEPPPSK # KRKTDNQKEATDSTSQRQNSVWVGNLSFKTTTDALRKFLMELERLHG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g800 ### # start gene g801 Scaffold_5 AUGUSTUS gene 3934713 3935426 0.59 - . g801 Scaffold_5 AUGUSTUS transcript 3934713 3935426 0.59 - . g801.t1 Scaffold_5 AUGUSTUS stop_codon 3934713 3934715 . - 0 transcript_id "g801.t1"; gene_id "g801"; Scaffold_5 AUGUSTUS CDS 3934713 3935426 0.59 - 0 transcript_id "g801.t1"; gene_id "g801"; Scaffold_5 AUGUSTUS start_codon 3935424 3935426 . - 0 transcript_id "g801.t1"; gene_id "g801"; # protein sequence = [MVTLYRGTPIPLIYGHEAIDSAQQVLTIFLSQNDTALLAAAPDHVFCLVTFSATWIIISNFSMHQLNGVNLGWANDKL # ISLVAEKLSHVASSPEHFPALCAHFIMRLVHAWETRNTRKPAASPAREEEKDNDEYPVRMMPQMSAERTTVEDTSSEQSSFSAPNGVQDDLQYQPQQQ # QPIQPQMQFPSPDDPNQSMLSGLGAGHEWLEASDMLMDATFWTTFMENLNSQTPGFESIPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g801 ### # start gene g802 Scaffold_5 AUGUSTUS gene 3942154 3942495 0.91 + . g802 Scaffold_5 AUGUSTUS transcript 3942154 3942495 0.91 + . g802.t1 Scaffold_5 AUGUSTUS start_codon 3942154 3942156 . + 0 transcript_id "g802.t1"; gene_id "g802"; Scaffold_5 AUGUSTUS CDS 3942154 3942495 0.91 + 0 transcript_id "g802.t1"; gene_id "g802"; Scaffold_5 AUGUSTUS stop_codon 3942493 3942495 . + 0 transcript_id "g802.t1"; gene_id "g802"; # protein sequence = [MARTHSRPSSPEPSASLIKRIKISHPTLHVATATNETLAAFASEVLESSNVAKLHKFYLESQPFHYALVGKLFQDDLL # KRVKDECLGELSFTEKETDIYKVRIVAAVFNKLSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g802 ### # start gene g803 Scaffold_5 AUGUSTUS gene 3943293 3944051 0.3 + . g803 Scaffold_5 AUGUSTUS transcript 3943293 3944051 0.3 + . g803.t1 Scaffold_5 AUGUSTUS start_codon 3943293 3943295 . + 0 transcript_id "g803.t1"; gene_id "g803"; Scaffold_5 AUGUSTUS CDS 3943293 3944051 0.3 + 0 transcript_id "g803.t1"; gene_id "g803"; Scaffold_5 AUGUSTUS stop_codon 3944049 3944051 . + 0 transcript_id "g803.t1"; gene_id "g803"; # protein sequence = [MQSLASRFVEESSLELHSFLTNSIAEALEPRLRDLDAHDGLGPDRNGKVPPHCSGVDAKNPDIVSADDATWSHFATNG # TPTTPLPLGGTLSVNGIIPPVPAASATPVVPNPPSAWTLKGPPHKWRYCTLLPPSASAPAVSITPISAHPNPSEILRKLQDELFPSQAFRAWLAIVSR # LLPIRHFVEARRFRPGLDYTLATSEEKEARLDVVLGLTPEVKDDESDEHETHAQRGWRAAEWGGWEVCFFLKTVLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g803 ### # start gene g804 Scaffold_5 AUGUSTUS gene 3944218 3944622 0.71 + . g804 Scaffold_5 AUGUSTUS transcript 3944218 3944622 0.71 + . g804.t1 Scaffold_5 AUGUSTUS start_codon 3944218 3944220 . + 0 transcript_id "g804.t1"; gene_id "g804"; Scaffold_5 AUGUSTUS CDS 3944218 3944622 0.71 + 0 transcript_id "g804.t1"; gene_id "g804"; Scaffold_5 AUGUSTUS stop_codon 3944620 3944622 . + 0 transcript_id "g804.t1"; gene_id "g804"; # protein sequence = [MENGHSNGTNGHSVDGTNGVNDKANGHPGSNGSKHSSPIGSPAPVANEEGEEAAMEVDEAEEDSTLLTVQPGFNRLLL # VLRDERVMRFVKYVSAAAEGSRWDVCAEYEVGGCRRKVTTNDQLNPPSSDLSVTIY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g804 ### # start gene g805 Scaffold_5 AUGUSTUS gene 3945916 3946407 0.93 + . g805 Scaffold_5 AUGUSTUS transcript 3945916 3946407 0.93 + . g805.t1 Scaffold_5 AUGUSTUS start_codon 3945916 3945918 . + 0 transcript_id "g805.t1"; gene_id "g805"; Scaffold_5 AUGUSTUS CDS 3945916 3946407 0.93 + 0 transcript_id "g805.t1"; gene_id "g805"; Scaffold_5 AUGUSTUS stop_codon 3946405 3946407 . + 0 transcript_id "g805.t1"; gene_id "g805"; # protein sequence = [MTSIETLSKPLQLPLTPGVLELINAHLSQLQPEQILAWAIEYLPNLYQTTAFGLTGLVAIDMLSKLTTSPPPLIFLDT # LYHFRETYELVEEVKLKYRTPLHVYKPAECRTVEDFEAKYGQKLWESDEDTYDFAVKVSPNPPFDEDRNLYICFDTGRTCTKGIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g805 ### # start gene g806 Scaffold_5 AUGUSTUS gene 3952358 3955022 0.49 + . g806 Scaffold_5 AUGUSTUS transcript 3952358 3955022 0.49 + . g806.t1 Scaffold_5 AUGUSTUS start_codon 3952358 3952360 . + 0 transcript_id "g806.t1"; gene_id "g806"; Scaffold_5 AUGUSTUS CDS 3952358 3952519 0.49 + 0 transcript_id "g806.t1"; gene_id "g806"; Scaffold_5 AUGUSTUS CDS 3952572 3955022 0.98 + 0 transcript_id "g806.t1"; gene_id "g806"; Scaffold_5 AUGUSTUS stop_codon 3955020 3955022 . + 0 transcript_id "g806.t1"; gene_id "g806"; # protein sequence = [MDSVHPDRRANLEVYVEAWLTEEEYRIAKARNILSWQESPNGSTEPETPPPTTPDVSPAPPRTGKHLLWDSTTSTPSS # QPHDNPFETPKSASQQLATTISGAASRRIASAVRSISGGSKPLSGSNIAPPSPSLMDSTNMRSPRTYKQFSKWEKQDLEAKAMMRMREANRKKEEEKE # SLPSVPPAVPKITFTPAADGGSTAKPPPPAFPLPGASTAPKSIFNAPTTSSPLASGDNKSEAVKPPASTTPSFPFSKPTPAPQPATSPASTQASVPTS # TPQVNGSANVIPAAPAKPSAFSFGPPAGVSHAASADKPKPAVGLGFPSLGPSASVAPQPAGSSSTSASSTASLSSTPAPPKFSFNMPNPASSSNAEHK # PDTPASNATSPGGVSLLSRLGGTSAPGQNNVTSSTTPSPFSFGPSPAPAVSSTATSSSPFGGAFSAAPLSSPFGGASSTPAATTASQQPSQPTNAGSS # SSAAAAAAPVKFNFFGGANKTSSPFGNSNSNTLNTTAPTTSATPSSLSGALNPLPASSANTAKPISSPFGSADKKPEEEKSTTSAPTFSFGTPASSSA # GATNGGNIFGAAKAALTSNSTSSTNPSPFGSSFGGNSAFSSGTFGSNINSKSAFGSTTTGPSNFGSSLTPSVAATVLQSGSGAFGAKPTDSDTATTPA # STSVFSKPSEAPNPGSAAAPKSAFSFGTSATQNSGSTPAAKSAFSFGTTATQNSGSAPAPKSAFSFGSSAPSSSSGSTSFGFGGQNTFGASAAAKPAG # EAQTKTAFSFGSSSSTPLVTPNATPAGDPPKSAFSFGNNSTTPAGSPAKSAFSFGSTAAPGTSGLLEGAFGMPASGQSTPSAFGGASTPNPFSAFANK # PAGSGTVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g806 ### # start gene g807 Scaffold_5 AUGUSTUS gene 3955401 3955892 0.78 - . g807 Scaffold_5 AUGUSTUS transcript 3955401 3955892 0.78 - . g807.t1 Scaffold_5 AUGUSTUS stop_codon 3955401 3955403 . - 0 transcript_id "g807.t1"; gene_id "g807"; Scaffold_5 AUGUSTUS CDS 3955401 3955892 0.78 - 0 transcript_id "g807.t1"; gene_id "g807"; Scaffold_5 AUGUSTUS start_codon 3955890 3955892 . - 0 transcript_id "g807.t1"; gene_id "g807"; # protein sequence = [MQSSALCQRCASLRKLSSYTSLPTAQTRLISSSPYGRTHVWKRRPPILPNPVVPKFPQRVIRADGTSFTHWTTSPRSL # IRLTRDTTNNPVWNTALWADNKAVEDEANTTGRMGRFNKRFEGIGGAGGTVDWMAGTGEGSGIELEGELVDPSLYVAKTKKKKKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g807 ### # start gene g808 Scaffold_5 AUGUSTUS gene 3956509 3957063 0.63 + . g808 Scaffold_5 AUGUSTUS transcript 3956509 3957063 0.63 + . g808.t1 Scaffold_5 AUGUSTUS start_codon 3956509 3956511 . + 0 transcript_id "g808.t1"; gene_id "g808"; Scaffold_5 AUGUSTUS CDS 3956509 3957063 0.63 + 0 transcript_id "g808.t1"; gene_id "g808"; Scaffold_5 AUGUSTUS stop_codon 3957061 3957063 . + 0 transcript_id "g808.t1"; gene_id "g808"; # protein sequence = [MSSSLVTGHRHFPSATSIPNTVGERESSKQGERTHCSFLRPILKSSPDDYYIPEKAPVVGAQPQTLTSRKLHPAFDTM # RWACALSHIGLIVLLALVRFPEPRQGGFEYHILPESKFQIVDDDDADLGQTLQASVKLGFGWIVTVCLFVSLSSNSSENHVIFLGLDHCPYIDNPKVG # SPPPTEPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g808 ### # start gene g809 Scaffold_5 AUGUSTUS gene 3962111 3964283 0.19 - . g809 Scaffold_5 AUGUSTUS transcript 3962111 3964283 0.19 - . g809.t1 Scaffold_5 AUGUSTUS stop_codon 3962111 3962113 . - 0 transcript_id "g809.t1"; gene_id "g809"; Scaffold_5 AUGUSTUS CDS 3962111 3962553 0.83 - 2 transcript_id "g809.t1"; gene_id "g809"; Scaffold_5 AUGUSTUS CDS 3962608 3962814 0.99 - 2 transcript_id "g809.t1"; gene_id "g809"; Scaffold_5 AUGUSTUS CDS 3962873 3963019 1 - 2 transcript_id "g809.t1"; gene_id "g809"; Scaffold_5 AUGUSTUS CDS 3963073 3963441 0.55 - 2 transcript_id "g809.t1"; gene_id "g809"; Scaffold_5 AUGUSTUS CDS 3963702 3963939 0.93 - 0 transcript_id "g809.t1"; gene_id "g809"; Scaffold_5 AUGUSTUS CDS 3963988 3964111 0.43 - 1 transcript_id "g809.t1"; gene_id "g809"; Scaffold_5 AUGUSTUS CDS 3964162 3964283 0.44 - 0 transcript_id "g809.t1"; gene_id "g809"; Scaffold_5 AUGUSTUS start_codon 3964281 3964283 . - 0 transcript_id "g809.t1"; gene_id "g809"; # protein sequence = [MFGNNAITSSWANPQQNQQQQQQQQGTSAFGQPTAFGSTGVSSTGTFGQPPQQPQANPMFGGLGGTSNTGTGAFGTRF # NLCLASTNSGSVFGAPKPATGFGAFGGGGTSTFGGGGTSAFGNTGQNTTSAFGQPANTGAFGGGTGGSIFGQPKTTSAFGTTTVQDYQQGRKTATAGS # FGQQSSFGGTQTTGGSIFGQPQNTQPAQTSSIFGAPKPTTGFGAFGNTTATNTNTGAFGATNNAFGQPQQQQPQQQPTTGFGFGQTQQQPQQQTASLF # GNTNTGGSAFGNTNPTGAFGTTAFGTNSNQQPQQQQPTGSIFGQPQPAANTGSTFGAFGNTATKPSIFGQPAQPAGQTSIFGQPAQQNQQQQQQPSIF # GTTNAGGSSLFGNNANQQQQQQQPQQPGTSLFGNNAATGTGGLFGTGTGTNLFGANNQQQQQQPQQQQTGTTGFGTSLFGAKPAAPAGGGIFGNNNAF # GAAQPTTTAQQPTLFGNTFNQSTNQQQPAAGGGFFNKAPSMGMATSMGPGGNLFGNSTFGNSTNTLAGSTTTPTNKVAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/7 # CDS introns: 0/6 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g809 ### # start gene g810 Scaffold_5 AUGUSTUS gene 3967134 3967583 0.76 + . g810 Scaffold_5 AUGUSTUS transcript 3967134 3967583 0.76 + . g810.t1 Scaffold_5 AUGUSTUS start_codon 3967134 3967136 . + 0 transcript_id "g810.t1"; gene_id "g810"; Scaffold_5 AUGUSTUS CDS 3967134 3967583 0.76 + 0 transcript_id "g810.t1"; gene_id "g810"; Scaffold_5 AUGUSTUS stop_codon 3967581 3967583 . + 0 transcript_id "g810.t1"; gene_id "g810"; # protein sequence = [MDAFPNGTNAIVAVISYTGYDMEDAMILNKSAHERGFAYGTVYKSQIIDLKDMKGASKTGAPTLHFGLGPEIKVNSRA # ENKHSCLDFLDLDGLPYVGTRLSTGDPIAAYVDDVTRRTKFVKYKGDEAAFVDEVRLIGTLCSTNYPYGGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g810 ### # start gene g811 Scaffold_5 AUGUSTUS gene 3969228 3969932 0.39 - . g811 Scaffold_5 AUGUSTUS transcript 3969228 3969932 0.39 - . g811.t1 Scaffold_5 AUGUSTUS stop_codon 3969228 3969230 . - 0 transcript_id "g811.t1"; gene_id "g811"; Scaffold_5 AUGUSTUS CDS 3969228 3969932 0.39 - 0 transcript_id "g811.t1"; gene_id "g811"; Scaffold_5 AUGUSTUS start_codon 3969930 3969932 . - 0 transcript_id "g811.t1"; gene_id "g811"; # protein sequence = [MKASNGSLSTFGNRPIPPRPPQTQMISPPSSPAYDPADISPSIFSPAAPSTPKVRQTSVLPSSGIRKTLNRDQEAAPT # LVAPSQPHQPPVADKLQQLKVSRSTSSRENVRSEFDLEDTRPLPKSTPSATSEHSAPKKIAEIQPSTIRVSPPAIETSVSERKTLSPDTATPTPGVAA # SGISMVDAQDMKRLMAKATTPEECRLIMDMFMAKVGIPVEQTEYDVPYPLSLICRSPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g811 ### # start gene g812 Scaffold_5 AUGUSTUS gene 3970150 3970893 0.38 - . g812 Scaffold_5 AUGUSTUS transcript 3970150 3970893 0.38 - . g812.t1 Scaffold_5 AUGUSTUS stop_codon 3970150 3970152 . - 0 transcript_id "g812.t1"; gene_id "g812"; Scaffold_5 AUGUSTUS CDS 3970150 3970797 0.65 - 0 transcript_id "g812.t1"; gene_id "g812"; Scaffold_5 AUGUSTUS CDS 3970888 3970893 0.55 - 0 transcript_id "g812.t1"; gene_id "g812"; Scaffold_5 AUGUSTUS start_codon 3970891 3970893 . - 0 transcript_id "g812.t1"; gene_id "g812"; # protein sequence = [MEEKDQRGGRPKPPPLPTGNPELDLPTSIPPRPFRRPSAPNVSSIVEDEEESPTTRPTHPRMRQTSVASPPPQTLLIA # NTRARSQSAAAPPVKRKTSKTALASSSTPSSAAIMQNRELRIPQVFDGPGIPQKTRKVQKNRESLDLDDVMAGSDDEEFDETEIVSPSKSFASSTPSN # MRVSARTKELMDFLNDGPPPTGSNDFGGPSYQPSTSFQGRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g812 ### # start gene g813 Scaffold_5 AUGUSTUS gene 3972463 3972840 0.66 - . g813 Scaffold_5 AUGUSTUS transcript 3972463 3972840 0.66 - . g813.t1 Scaffold_5 AUGUSTUS stop_codon 3972463 3972465 . - 0 transcript_id "g813.t1"; gene_id "g813"; Scaffold_5 AUGUSTUS CDS 3972463 3972840 0.66 - 0 transcript_id "g813.t1"; gene_id "g813"; Scaffold_5 AUGUSTUS start_codon 3972838 3972840 . - 0 transcript_id "g813.t1"; gene_id "g813"; # protein sequence = [MMPPVDSVSLKRYLKAKHLGRVEAPTTSDEYEFLVSRSSHSCMPSRPAKIRDFGDLNSDQVSQLINDGMSFWQEEKKD # EETAFSEPGNSPSPSELPADADGSGVPSRRSTDELVLSGIGFDEELL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g813 ### # start gene g814 Scaffold_5 AUGUSTUS gene 3973596 3975071 0.82 - . g814 Scaffold_5 AUGUSTUS transcript 3973596 3975071 0.82 - . g814.t1 Scaffold_5 AUGUSTUS stop_codon 3973596 3973598 . - 0 transcript_id "g814.t1"; gene_id "g814"; Scaffold_5 AUGUSTUS CDS 3973596 3975071 0.82 - 0 transcript_id "g814.t1"; gene_id "g814"; Scaffold_5 AUGUSTUS start_codon 3975069 3975071 . - 0 transcript_id "g814.t1"; gene_id "g814"; # protein sequence = [MNQRRLSSMHKYAYQWLKQAEVGATESIPLTGLFIHCPATGQAQIGEIVNNKFTPMTPIGWIKALQKMVIPEVSQTVS # APANAPPSVTPTTVADAPPHSNPVSLPPTATATKLKGHAESLVNALNSAHEHPTTPLPSLSRKNSNITGSPRTPGDANRKSLARDVLFALGSVREKRQ # RESFGESDGRTAKRTALSDIPVPVAQSTVSSNQPPMVSSFPVQAPAFNYQHPSVISQPAVPQLPSDQSNVARQDKPSDVISAVPSHQAGPSSQANVNP # DAAPVVTKPSKFVMENIPVAGPSRFVGRISQAITNFNTAITSSTLQTAPVASPPKLAPISISQNRLIPEQLPARSPPKVNVTPLFLPETPSPPTSPPP # IPNMDEESLCLAESVTVRGSDIEHVDDFRAGKGQKVTVVDCVQVPSAPGWVKRDLARRMRKSKERQEEEEQAEIESVIEILDSDEEPEPRKTKEKYSR # RSQSSREGMAPQTGRSWNFTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g814 ### # start gene g815 Scaffold_5 AUGUSTUS gene 3975545 3976144 0.42 - . g815 Scaffold_5 AUGUSTUS transcript 3975545 3976144 0.42 - . g815.t1 Scaffold_5 AUGUSTUS stop_codon 3975545 3975547 . - 0 transcript_id "g815.t1"; gene_id "g815"; Scaffold_5 AUGUSTUS CDS 3975545 3976144 0.42 - 0 transcript_id "g815.t1"; gene_id "g815"; Scaffold_5 AUGUSTUS start_codon 3976142 3976144 . - 0 transcript_id "g815.t1"; gene_id "g815"; # protein sequence = [MSMRPNANATPNHPHRTQQTNLQNLGPQSHYVAGAQARPQVPALTHQYQSRQAFPSQSSTSAHQPQFTQSYQPSQAAQ # PAQLMRNQHQSQRPQQQSAQQQSNFQPSRPSLQTSSTQSQQSITSQPALTPQIILARQRQSVTSFRCVLRNIPLIVCSHTSFAFRSAVRYPRACPSNP # YFESSATGIAIRSLHLTFSHYAN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g815 ### # start gene g816 Scaffold_5 AUGUSTUS gene 3983243 3983926 0.52 + . g816 Scaffold_5 AUGUSTUS transcript 3983243 3983926 0.52 + . g816.t1 Scaffold_5 AUGUSTUS start_codon 3983243 3983245 . + 0 transcript_id "g816.t1"; gene_id "g816"; Scaffold_5 AUGUSTUS CDS 3983243 3983926 0.52 + 0 transcript_id "g816.t1"; gene_id "g816"; Scaffold_5 AUGUSTUS stop_codon 3983924 3983926 . + 0 transcript_id "g816.t1"; gene_id "g816"; # protein sequence = [MLYARSTSNGFGVIESATDVLKLFHGGRLNPKGIVGSDQEYLSAQDGTPAARSFFAHRVKPAVYTYIISAEDDSLRFS # ETGAAFFVDFASKHALHANCCDRVRYSGEFHPRPRAKDDSWIGWQDFSDSMSDEMVDWEVLIDNNSGTYSPDKAMLPTLQALLEYNFPGFKVQALDRE # DEELTKSVQACRDYALKYRGVQVKHLQPHLEEGEESLMKCAGVSNPAIGVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g816 ### # start gene g817 Scaffold_5 AUGUSTUS gene 3984385 3985332 0.79 - . g817 Scaffold_5 AUGUSTUS transcript 3984385 3985332 0.79 - . g817.t1 Scaffold_5 AUGUSTUS stop_codon 3984385 3984387 . - 0 transcript_id "g817.t1"; gene_id "g817"; Scaffold_5 AUGUSTUS CDS 3984385 3985332 0.79 - 0 transcript_id "g817.t1"; gene_id "g817"; Scaffold_5 AUGUSTUS start_codon 3985330 3985332 . - 0 transcript_id "g817.t1"; gene_id "g817"; # protein sequence = [MGDEQRAHAGRGKTREVRNSASFISIYSPRFNDPSSFTNSTRIIDTRNWPIGSRVLEAEEEDYFNGDDEDDFVPAISH # SWSRGTGASSPIPSSNGLKRKRRMAVAGALSNKGIRTHRPPSRSPHLGSLVDYEDDEEPVSIDTSEDPSASSSSSTLAPPSSPKPSHRQIPSPPNGPP # PKRLPSVDEEDEDNMLEALVARSRPQSPAPGLMSSVDSLGPMRPAEKRRRGDDDEDDEELLGRLSKTSKKPDLGKQKDMSGGLSISLINRNKTGDDPP # KKFKLKIGMAKANSLSSPKISSPSSATQAPSEPGAKDGDTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g817 ### # start gene g818 Scaffold_5 AUGUSTUS gene 3986053 3987299 0.68 - . g818 Scaffold_5 AUGUSTUS transcript 3986053 3987299 0.68 - . g818.t1 Scaffold_5 AUGUSTUS stop_codon 3986053 3986055 . - 0 transcript_id "g818.t1"; gene_id "g818"; Scaffold_5 AUGUSTUS CDS 3986053 3986936 0.9 - 2 transcript_id "g818.t1"; gene_id "g818"; Scaffold_5 AUGUSTUS CDS 3987054 3987089 0.86 - 2 transcript_id "g818.t1"; gene_id "g818"; Scaffold_5 AUGUSTUS CDS 3987164 3987299 0.76 - 0 transcript_id "g818.t1"; gene_id "g818"; Scaffold_5 AUGUSTUS start_codon 3987297 3987299 . - 0 transcript_id "g818.t1"; gene_id "g818"; # protein sequence = [MQSYANDTYVIPTSVNQSFYIFIAVMLNDHGIYEQILEDEYFFHVYDPEFPTHKANFPRVLDDSTFNVLNSCIIFNQM # DIIQHVQQDNAFLRDIVKLYVDEDMLAGGGRKAQEQQQIGPQVNGHDPPSTSSPTNGAQPLANGYVPSSSPTPRPSTPSQAKQQPYSFAPPEEMSEAA # LELRRSVIFLIQQLCVMGKNVQLPARLALFRTLVDRGVLFAIQWALGLSEKQPVTKAMISAGGEVLAALLDHDLGGVRAHVLKQVVAIDKERAAGKRG # ADKAETIVELCCRNLSQSKDLAVQSQIGDALKVWLDVPLSTDNFSSGGSEATQVCISPTFLNCVCGIKSLYRQWHQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g818 ### # start gene g819 Scaffold_5 AUGUSTUS gene 3988116 3988523 0.6 - . g819 Scaffold_5 AUGUSTUS transcript 3988116 3988523 0.6 - . g819.t1 Scaffold_5 AUGUSTUS stop_codon 3988116 3988118 . - 0 transcript_id "g819.t1"; gene_id "g819"; Scaffold_5 AUGUSTUS CDS 3988116 3988523 0.6 - 0 transcript_id "g819.t1"; gene_id "g819"; Scaffold_5 AUGUSTUS start_codon 3988521 3988523 . - 0 transcript_id "g819.t1"; gene_id "g819"; # protein sequence = [MNGDGEPNVMDSTLPLIPSANTADVATGLSTQIDSTNDALSMNFSSQVHAENNEYATLTDGNGDLSISQSEHSNLIPL # KHDERLDLTVGQVEMMEPGGELNGDSAGAGAIADDDQEYLQNADPNEMKRVKVCIST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g819 ### # start gene g820 Scaffold_5 AUGUSTUS gene 3999995 4001428 0.88 - . g820 Scaffold_5 AUGUSTUS transcript 3999995 4001428 0.88 - . g820.t1 Scaffold_5 AUGUSTUS stop_codon 3999995 3999997 . - 0 transcript_id "g820.t1"; gene_id "g820"; Scaffold_5 AUGUSTUS CDS 3999995 4001428 0.88 - 0 transcript_id "g820.t1"; gene_id "g820"; Scaffold_5 AUGUSTUS start_codon 4001426 4001428 . - 0 transcript_id "g820.t1"; gene_id "g820"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g820 ### # start gene g821 Scaffold_5 AUGUSTUS gene 4001479 4002645 0.93 - . g821 Scaffold_5 AUGUSTUS transcript 4001479 4002645 0.93 - . g821.t1 Scaffold_5 AUGUSTUS stop_codon 4001479 4001481 . - 0 transcript_id "g821.t1"; gene_id "g821"; Scaffold_5 AUGUSTUS CDS 4001479 4002645 0.93 - 0 transcript_id "g821.t1"; gene_id "g821"; Scaffold_5 AUGUSTUS start_codon 4002643 4002645 . - 0 transcript_id "g821.t1"; gene_id "g821"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g821 ### # start gene g822 Scaffold_5 AUGUSTUS gene 4003535 4003924 0.66 - . g822 Scaffold_5 AUGUSTUS transcript 4003535 4003924 0.66 - . g822.t1 Scaffold_5 AUGUSTUS stop_codon 4003535 4003537 . - 0 transcript_id "g822.t1"; gene_id "g822"; Scaffold_5 AUGUSTUS CDS 4003535 4003924 0.66 - 0 transcript_id "g822.t1"; gene_id "g822"; Scaffold_5 AUGUSTUS start_codon 4003922 4003924 . - 0 transcript_id "g822.t1"; gene_id "g822"; # protein sequence = [MMKDSPDSDFKVSFYQPRDLITRRGVGSPKQIQAMKQQAATTVHAAVKEYLEQQFGTAKITFQDGEARAYPYAFADFP # LAFYATLLSKDRSLQFSGKLWKSGGSMLGSFTPSRAGSTYEVAKHMYCFNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g822 ### # start gene g823 Scaffold_5 AUGUSTUS gene 4009332 4009865 0.63 + . g823 Scaffold_5 AUGUSTUS transcript 4009332 4009865 0.63 + . g823.t1 Scaffold_5 AUGUSTUS start_codon 4009332 4009334 . + 0 transcript_id "g823.t1"; gene_id "g823"; Scaffold_5 AUGUSTUS CDS 4009332 4009865 0.63 + 0 transcript_id "g823.t1"; gene_id "g823"; Scaffold_5 AUGUSTUS stop_codon 4009863 4009865 . + 0 transcript_id "g823.t1"; gene_id "g823"; # protein sequence = [MKRKRMDKDTTSVVLSMSESVSQQGAVSRRHDKNSSGGGSPVSYTGPISASLPASSHIPLPIPSRIPPRTIAAAQNGS # DKGNHAEANHNQTDPASDIAFDFTTTNFDAPSAARALKRDRHTQILNLLAASLPSHRAAWAGKNYEAFVRGAYAKTNEDYDDDEFDDGGDDMKTEECK # V] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g823 ### # start gene g824 Scaffold_5 AUGUSTUS gene 4010036 4010404 0.49 + . g824 Scaffold_5 AUGUSTUS transcript 4010036 4010404 0.49 + . g824.t1 Scaffold_5 AUGUSTUS start_codon 4010036 4010038 . + 0 transcript_id "g824.t1"; gene_id "g824"; Scaffold_5 AUGUSTUS CDS 4010036 4010404 0.49 + 0 transcript_id "g824.t1"; gene_id "g824"; Scaffold_5 AUGUSTUS stop_codon 4010402 4010404 . + 0 transcript_id "g824.t1"; gene_id "g824"; # protein sequence = [MDNNRPLQADVMYKKRASAAALRRASYAERDIERGVDPGMFDYLLAVHHEEDEEDEDQLDGHQDSEHGENGESATNRA # NSEDANGSSRGPTGNRKGRDRAHKILEAQAKSGVPDDEMWRSLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g824 ### # start gene g825 Scaffold_5 AUGUSTUS gene 4015437 4016499 0.67 - . g825 Scaffold_5 AUGUSTUS transcript 4015437 4016499 0.67 - . g825.t1 Scaffold_5 AUGUSTUS stop_codon 4015437 4015439 . - 0 transcript_id "g825.t1"; gene_id "g825"; Scaffold_5 AUGUSTUS CDS 4015437 4016116 0.81 - 2 transcript_id "g825.t1"; gene_id "g825"; Scaffold_5 AUGUSTUS CDS 4016259 4016499 0.84 - 0 transcript_id "g825.t1"; gene_id "g825"; Scaffold_5 AUGUSTUS start_codon 4016497 4016499 . - 0 transcript_id "g825.t1"; gene_id "g825"; # protein sequence = [MNLSNREVRTKCSAEFLVGFESEFILLKSTNPVVSMNVHGWSASAGMLNGSIEAEIMEEIADSLQASGITVELFHPEA # APAKHGVHATFAPRPFMYSAGTSTHAHISVHDIANRPEFRKAPGELSLLEKAFLAGVLSHLPAIAAITLPIPASYKRAVDGAWSGGTYVSWGTENREA # PIRLTNVASPNSRRYECRFIDATANPHLALAAVLGSALAEMGAVSDGSGDVQLEVQDAGTKPAAVMTEEERKTHGITKRMPASSGEARSYLRGDGQLC # EVLGKELIEAFLSVNKVGDSSIFCMNLRLMFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g825 ### # start gene g826 Scaffold_5 AUGUSTUS gene 4019359 4019961 0.66 + . g826 Scaffold_5 AUGUSTUS transcript 4019359 4019961 0.66 + . g826.t1 Scaffold_5 AUGUSTUS start_codon 4019359 4019361 . + 0 transcript_id "g826.t1"; gene_id "g826"; Scaffold_5 AUGUSTUS CDS 4019359 4019961 0.66 + 0 transcript_id "g826.t1"; gene_id "g826"; Scaffold_5 AUGUSTUS stop_codon 4019959 4019961 . + 0 transcript_id "g826.t1"; gene_id "g826"; # protein sequence = [MRQQPHRPDSPSEQFAMYTELEPEQRSALNGYHRSSFTAIPNATRPSKHHATPSSTMPSTNPTIYRDAGAPVYQYEAY # GLSSPTQSHMQPSLVDRPKYAGSFGLAEPYVNYNKLSHPSQPHLLPSTVNPHPMPMSSQTPYGPHLATNNVSTGVNSGHGGGGNVPSGGNNMQEDIST # IFVVGFPDDMQVYLVCQIVENYSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g826 ### # start gene g827 Scaffold_5 AUGUSTUS gene 4019994 4022719 0.04 + . g827 Scaffold_5 AUGUSTUS transcript 4019994 4022719 0.04 + . g827.t1 Scaffold_5 AUGUSTUS start_codon 4019994 4019996 . + 0 transcript_id "g827.t1"; gene_id "g827"; Scaffold_5 AUGUSTUS CDS 4019994 4021160 0.33 + 0 transcript_id "g827.t1"; gene_id "g827"; Scaffold_5 AUGUSTUS CDS 4021213 4021568 0.09 + 0 transcript_id "g827.t1"; gene_id "g827"; Scaffold_5 AUGUSTUS CDS 4022158 4022719 0.39 + 1 transcript_id "g827.t1"; gene_id "g827"; Scaffold_5 AUGUSTUS stop_codon 4022717 4022719 . + 0 transcript_id "g827.t1"; gene_id "g827"; # protein sequence = [MFTFSSGFEAATLKIPNKEYTAYGVSGSTNNPGAAPPGLPGLTPSLASLVRAQAAINDPYNLVTMNQGGVVVDGGRDG # TMSSWPTASIDDSYYPPGLGIGNLGGMIPSVGGPGITLGPNPNPNASGTTSVGNGPVPPRKKIIGFAKFRTREEALEARDVLQSRRVDIEKGSILKAE # MAKKNLHTKRGVTANGGAGTNVGSVNGNPLGATLTSASHLGPAPPAAVNGISYPGHAPMSKYDLFSGSANLAEPGSGNISARDRELGALGAMGFTMAG # SSNNGHFSGTNNVTALSSLTTLWDEDNRERERMVYDAMGLGISSGDESSGPISAKEGGRRQMETWRDGRERDRDERQPLRLRSGSAFDAFHSIPASLP # QNSLVSPLLKRPSPFPFSSAGSNVPNSASSRFHTRLPMVRKAPMVVQGPPARLVLRLAQLILRGSARDINGHEDDDDVHTNPEMELEDSNTTVKEIDV # AQIARAVGSLAVTTNKHVSHAGSTGANTVNGAHSLGHTKNPLGIRTPTSANGPGPGFQQQHFQQQAHVGRDGDRERGDRYGYGGTQALSPTPHHHSVS # YRPSHTHEFMISPPPPRFAGNSSGANPLSNISFGNFSSTSFSGVNSQLVGSGSNSMFGATNSFQGGTGPGVGYHLLPSDSYGDAQGQGLNTSFSPFDG # SHLDHPQMPPMSSLPMQHGPNPSQNQNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g827 ### # start gene g828 Scaffold_5 AUGUSTUS gene 4023976 4026253 0.22 - . g828 Scaffold_5 AUGUSTUS transcript 4023976 4026253 0.22 - . g828.t1 Scaffold_5 AUGUSTUS stop_codon 4023976 4023978 . - 0 transcript_id "g828.t1"; gene_id "g828"; Scaffold_5 AUGUSTUS CDS 4023976 4024607 0.35 - 2 transcript_id "g828.t1"; gene_id "g828"; Scaffold_5 AUGUSTUS CDS 4024681 4026253 0.64 - 0 transcript_id "g828.t1"; gene_id "g828"; Scaffold_5 AUGUSTUS start_codon 4026251 4026253 . - 0 transcript_id "g828.t1"; gene_id "g828"; # protein sequence = [MVSKSVPKSERVEELERMADEVETRVRDLSSDLPPSSDQKQLDGWAEEPPLVPTITDKARLLLTKSRENDYFSIAPAP # NQSALNAHGSPKKDLTNGNLAAPSSSASSRPRSRSRTPPTPATPTLTAVVTPRKSLATGYINGYSTKAVKAVKGKIGNDQSLLGLGFGVEGRAESGLD # ALERKLLAEVGTRKIVDEKRPDVWSVLRSGKEKNLSPNDTSNPGPGFGRDSGVGAEKTEKPSPIEIPRRNSDRDPFNDSAISSLTLPDCGDIEPAVSN # SNAQPDVANAWKSTAAMDKVHGNSNLELDRDRDSDEKTHKGGLRSKNNKRKKHSSRGTLKDGQDGKEDDEGETREAKKKDSEKKGGKKKGKDRSSASK # GRVAAWLGGVGAEPPLDDVISASPSPQPSRIVELPSDIEVLDKPHADLQSESRDTDSSKEKEKEHRKDSDTAILPPSPDPRSSGFVPIGTLKRDIYQR # TLVPKDSPMASTSPSEDAKRITDIWNHRDTARHAGPSPKSNSSLNDLAKNPAKRARGGKGGRVTAVAAIWASGSVGASGKKPTATSPLSTPHPPGKSS # KAIGKVTSPFSVPKFPVSVSSSSSSASGDGISGQRTTPTRRNVGVGVGVKVASTPVPAVISSSYAKPALSTTASLSRPTTAASRASPVKVPPTISEFP # SEVRLESKSSDPTSNVKMTRTGLGLGAGKAANNLRAVTNSESKKTYTHGEHLAFGQARLRDLIKKYQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g828 ### # start gene g829 Scaffold_5 AUGUSTUS gene 4030333 4031571 0.65 + . g829 Scaffold_5 AUGUSTUS transcript 4030333 4031571 0.65 + . g829.t1 Scaffold_5 AUGUSTUS start_codon 4030333 4030335 . + 0 transcript_id "g829.t1"; gene_id "g829"; Scaffold_5 AUGUSTUS CDS 4030333 4031571 0.65 + 0 transcript_id "g829.t1"; gene_id "g829"; Scaffold_5 AUGUSTUS stop_codon 4031569 4031571 . + 0 transcript_id "g829.t1"; gene_id "g829"; # protein sequence = [MPKSWRDLLINVKGISSDDAFIHLRQVYDNKKEDEEDARQRSQVRALIAQEMASFHSANTASAPKKDHPTCTNPNCPP # RRRRTHTIEKCWAPGGGNEGGGPKKAETAVTQTANYASDGGNHTIMELFDLCTSLPTPISSIQLPNAHTCRNCMSVSRGYEANEEVTHNIDVLNSSVP # HQSSDVDECIACSAHNKNNLLYAASKPRVPQTFLDSAASDHFWVRRDDFIKYENLYGKAGKSAIARKAGEFEIHGKGTVEFETAVDGIRRRCRLNDVY # HTPSFHHNLISLRTLDAKGMKGEWGRGSLTVRTANGSIVMQGEGKGTMYEVQAYFPPSFANFARSLNKPVDIQTWHRRLGHPAIDRILLMHRHNLVDG # LQITSKKVAGKCEPCILGKSTHLSRSGRGGVTNGAGKRSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g829 ### # start gene g830 Scaffold_5 AUGUSTUS gene 4032054 4032665 0.64 - . g830 Scaffold_5 AUGUSTUS transcript 4032054 4032665 0.64 - . g830.t1 Scaffold_5 AUGUSTUS stop_codon 4032054 4032056 . - 0 transcript_id "g830.t1"; gene_id "g830"; Scaffold_5 AUGUSTUS CDS 4032054 4032665 0.64 - 0 transcript_id "g830.t1"; gene_id "g830"; Scaffold_5 AUGUSTUS start_codon 4032663 4032665 . - 0 transcript_id "g830.t1"; gene_id "g830"; # protein sequence = [MSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAED # INLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVK # WKGYDRAQLLGTRSQPQSSTKNCSGLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g830 ### # start gene g831 Scaffold_5 AUGUSTUS gene 4034301 4035416 0.9 - . g831 Scaffold_5 AUGUSTUS transcript 4034301 4035416 0.9 - . g831.t1 Scaffold_5 AUGUSTUS stop_codon 4034301 4034303 . - 0 transcript_id "g831.t1"; gene_id "g831"; Scaffold_5 AUGUSTUS CDS 4034301 4035416 0.9 - 0 transcript_id "g831.t1"; gene_id "g831"; Scaffold_5 AUGUSTUS start_codon 4035414 4035416 . - 0 transcript_id "g831.t1"; gene_id "g831"; # protein sequence = [MDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPELEPPAENP # HIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLP # AHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRL # QGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g831 ### # start gene g832 Scaffold_5 AUGUSTUS gene 4036243 4036950 0.88 - . g832 Scaffold_5 AUGUSTUS transcript 4036243 4036950 0.88 - . g832.t1 Scaffold_5 AUGUSTUS stop_codon 4036243 4036245 . - 0 transcript_id "g832.t1"; gene_id "g832"; Scaffold_5 AUGUSTUS CDS 4036243 4036950 0.88 - 0 transcript_id "g832.t1"; gene_id "g832"; Scaffold_5 AUGUSTUS start_codon 4036948 4036950 . - 0 transcript_id "g832.t1"; gene_id "g832"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g832 ### # start gene g833 Scaffold_5 AUGUSTUS gene 4038340 4038830 0.32 + . g833 Scaffold_5 AUGUSTUS transcript 4038340 4038830 0.32 + . g833.t1 Scaffold_5 AUGUSTUS start_codon 4038340 4038342 . + 0 transcript_id "g833.t1"; gene_id "g833"; Scaffold_5 AUGUSTUS CDS 4038340 4038401 0.68 + 0 transcript_id "g833.t1"; gene_id "g833"; Scaffold_5 AUGUSTUS CDS 4038479 4038830 0.42 + 1 transcript_id "g833.t1"; gene_id "g833"; Scaffold_5 AUGUSTUS stop_codon 4038828 4038830 . + 0 transcript_id "g833.t1"; gene_id "g833"; # protein sequence = [MGNSVLGLWRDDLLGISAEGGSAPAVPDEVDGEVFVDVDVGSAPDAVPGYPANKNQIDHSTASIPSISTTPSTPNYEG # LAELFANQALPQSLPVPTPDPDTGPRRSTRIRQPSTRQIQFEESAERERSAFEREPCVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g833 ### # start gene g834 Scaffold_5 AUGUSTUS gene 4039870 4040654 0.4 + . g834 Scaffold_5 AUGUSTUS transcript 4039870 4040654 0.4 + . g834.t1 Scaffold_5 AUGUSTUS start_codon 4039870 4039872 . + 0 transcript_id "g834.t1"; gene_id "g834"; Scaffold_5 AUGUSTUS CDS 4039870 4040051 0.4 + 0 transcript_id "g834.t1"; gene_id "g834"; Scaffold_5 AUGUSTUS CDS 4040171 4040654 0.9 + 1 transcript_id "g834.t1"; gene_id "g834"; Scaffold_5 AUGUSTUS stop_codon 4040652 4040654 . + 0 transcript_id "g834.t1"; gene_id "g834"; # protein sequence = [MSSAQDVRDAITELTKNQAKLQDVVSELVSGLSTTKSVGKPQNYNGKRGEDARRFLAAFELSSITGSGVPFPYDTWEE # FVTAFKTRFETTDASADAKQLLKRLYQNRTTVGTYASTFQQYADRTGYSDKDLRDRFYDHLADRVKDGLVFTTCPTGSLQELIEAAIDVDNRQITRAW # EQGKKLVDDGILTNFRPTTVATPFTAPTRDPNAMDIDATTTHSIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g834 ### # start gene g835 Scaffold_5 AUGUSTUS gene 4043987 4044827 0.56 + . g835 Scaffold_5 AUGUSTUS transcript 4043987 4044827 0.56 + . g835.t1 Scaffold_5 AUGUSTUS start_codon 4043987 4043989 . + 0 transcript_id "g835.t1"; gene_id "g835"; Scaffold_5 AUGUSTUS CDS 4043987 4044035 0.57 + 0 transcript_id "g835.t1"; gene_id "g835"; Scaffold_5 AUGUSTUS CDS 4044283 4044827 0.56 + 2 transcript_id "g835.t1"; gene_id "g835"; Scaffold_5 AUGUSTUS stop_codon 4044825 4044827 . + 0 transcript_id "g835.t1"; gene_id "g835"; # protein sequence = [MARLNELTKKSKDTSGYTIAEHPNQPSFEVGQPVWLSVNNLKIRRKSEKLGSRRLGPFEVIEKTGAHTYRLALPTWMK # IHDNINVKRLAPWKGNEVNGILPAPPEPEVIDGEEFYDVDRILDSRIHGRWKKLQYLVRWKGYDEGHDTWENEENVVGSSDEAINEFYAAHPNAPRKI # SATIFHSLPWQPMVNFTEVNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g835 ### # start gene g836 Scaffold_5 AUGUSTUS gene 4055154 4055504 0.48 + . g836 Scaffold_5 AUGUSTUS transcript 4055154 4055504 0.48 + . g836.t1 Scaffold_5 AUGUSTUS start_codon 4055154 4055156 . + 0 transcript_id "g836.t1"; gene_id "g836"; Scaffold_5 AUGUSTUS CDS 4055154 4055504 0.48 + 0 transcript_id "g836.t1"; gene_id "g836"; Scaffold_5 AUGUSTUS stop_codon 4055502 4055504 . + 0 transcript_id "g836.t1"; gene_id "g836"; # protein sequence = [MVENMKRVASSDQELTVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKGNEAQVSMIKGYREKIETELAKICEDI # LDVLDKHLIPSAASGESKVFYHKMYVVSVGVVFSVLYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g836 ### # start gene g837 Scaffold_5 AUGUSTUS gene 4056749 4057963 0.99 + . g837 Scaffold_5 AUGUSTUS transcript 4056749 4057963 0.99 + . g837.t1 Scaffold_5 AUGUSTUS start_codon 4056749 4056751 . + 0 transcript_id "g837.t1"; gene_id "g837"; Scaffold_5 AUGUSTUS CDS 4056749 4057963 0.99 + 0 transcript_id "g837.t1"; gene_id "g837"; Scaffold_5 AUGUSTUS stop_codon 4057961 4057963 . + 0 transcript_id "g837.t1"; gene_id "g837"; # protein sequence = [MVAKHESLGLFCGLASMLPFVRVRADSLDLADFNEDLSAFHGPTLKAQIEYCARAISYILSLYPPNTSIIIMGHSMGG # IVATSLLPSKDISSIITMSTPHTLPPARFDQRVDEIYARNREIMLHDSTPILSLCGGAMDMMIPSESCILPPLVEGLPVPYRRTVFSSALEGAWTGVG # HREMVWCHQVRWRVARAAMELSMAPSLAERGLILDKWFRDGHTLPPAENTEAFESFPLSEDQSRVLSSGERLVLAQPEGSQTYLFPISKQNTTDHRFV # LFVSQGSVPPVSPQKPNSLRISVARCFGLTASLDCKTLHPLVHKLIPNPIPGHTFPVPQQGTDESEGVVVFDADVIPERNSDAQWIAVNIERAAGEGW # LVGGFVSADQVFDDVSMTSNVFPSLHIEYIFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g837 ### # start gene g838 Scaffold_5 AUGUSTUS gene 4060464 4061114 0.96 + . g838 Scaffold_5 AUGUSTUS transcript 4060464 4061114 0.96 + . g838.t1 Scaffold_5 AUGUSTUS start_codon 4060464 4060466 . + 0 transcript_id "g838.t1"; gene_id "g838"; Scaffold_5 AUGUSTUS CDS 4060464 4061114 0.96 + 0 transcript_id "g838.t1"; gene_id "g838"; Scaffold_5 AUGUSTUS stop_codon 4061112 4061114 . + 0 transcript_id "g838.t1"; gene_id "g838"; # protein sequence = [MHSNSAANSPRGTPSRRGKSPKSSTTPSPAQSSSVSFHPEAANNSTSSFFSCINIPVEGAVPIGNVSSQEKLPTPDLE # TSPSSESKRAPRKSKTFALAALNSHVRDDLVDVDETTTLSALEEKYRQSAPIPVTPTLDLSTVKRTSPRHFSHPRTIQRPFGLQDCPEYFPSAEEFQD # PMAYIKSISAEAKEFGICKIVPPEGWKMPFVTDTEVRFFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g838 ### # start gene g839 Scaffold_5 AUGUSTUS gene 4064105 4066900 0.13 + . g839 Scaffold_5 AUGUSTUS transcript 4064105 4066900 0.13 + . g839.t1 Scaffold_5 AUGUSTUS start_codon 4064105 4064107 . + 0 transcript_id "g839.t1"; gene_id "g839"; Scaffold_5 AUGUSTUS CDS 4064105 4065623 0.18 + 0 transcript_id "g839.t1"; gene_id "g839"; Scaffold_5 AUGUSTUS CDS 4065736 4066078 0.41 + 2 transcript_id "g839.t1"; gene_id "g839"; Scaffold_5 AUGUSTUS CDS 4066240 4066900 0.98 + 1 transcript_id "g839.t1"; gene_id "g839"; Scaffold_5 AUGUSTUS stop_codon 4066898 4066900 . + 0 transcript_id "g839.t1"; gene_id "g839"; # protein sequence = [MQQCQKLVLDASSLNVLIDEVAEVEKIVDKEQLLAELEEKMVDGFTLTLEEVRQLLSRSRACQFPPDNKYIRLLEIRL # REGTSWEDRAQEVLQQPIKTLEDLDQFADLDPSVPIDPSVLDRLMSARDKARDFEKTAQGWLEPGTATKPRPSDVIKLAKRAEKEFSLPTLLEVKGMA # NIANELEDRAEQILKSSYVRSNEDVFRSVQDWKDYANQHLKIFSLPKFEKVHVQVAAHEKWVSDLPWYCRRHNGAYTHGKEVLDDVIECTRPDDDQPP # NDEYLTCICNVPVRPPPPGVPSDAVQCDHCFARFHEECAKNGGSCPFCDHSHWTGDIPKARSWHFCFLPNLLINAPEISKKYSEEWKQLEVIVHRVDR # LSAVIGQFLAYTSQPANQHPTYIHQVRHYMRKLYKLQFAVSPNPKVSFGLDLAGLHRILAGRPKKRRKPKFHFGQDSDSNWADGTRCICRGRTPYLLG # YPAVDCEQCDRRYHAGCVFYNVEQRATFGNRPRPYIFVAEDTAHADYYVDTKEMLDTFSKTIIYKAMGQPYTQTLFVELLKFTPGQPDTHAGGSAQPP # SSSGPRASSIEVPGQHLVPPPTHAPVALPPPVSVSALNAVTNVAVQNVPPPPCLTEPAAKRRIILPPVHHQNPLPPIQSHPPRASHPPQTRTPVLPPP # TPQNQSLSPSLARLMSPVDQSPRSQFSHAHSSNGMSTRLETRHDSPLMRPGGVDILNSPPMRGLDRDVPRSIRSNDPTTLPGPSTSRNRHTSPLIERD # MRGSPPLGALSIVNGRHKLLASPLIERDGTRGGPNGHDKVHRSPVVRNGYANPQTSLATGIDAPPIRKLMMSPGKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g839 ### # start gene g840 Scaffold_5 AUGUSTUS gene 4072431 4073929 0.55 + . g840 Scaffold_5 AUGUSTUS transcript 4072431 4073929 0.55 + . g840.t1 Scaffold_5 AUGUSTUS start_codon 4072431 4072433 . + 0 transcript_id "g840.t1"; gene_id "g840"; Scaffold_5 AUGUSTUS CDS 4072431 4072852 0.55 + 0 transcript_id "g840.t1"; gene_id "g840"; Scaffold_5 AUGUSTUS CDS 4072906 4073929 0.8 + 1 transcript_id "g840.t1"; gene_id "g840"; Scaffold_5 AUGUSTUS stop_codon 4073927 4073929 . + 0 transcript_id "g840.t1"; gene_id "g840"; # protein sequence = [MAAEDAGEPLDDGEMEFEDEEADEEVHAEPSPPINLSNNAPSASRNRKKYAKLTKRSRAKRAAEAVERVVTRGVKPFV # VELAKGALPLELEDFDSSSLPVSSSGWNANPRKRLSPGLQRVWKNLEALSSLSGLKLLRWDGESCIVLIDAHDRIIAVLGGIPHGSKGNEWQAVEAEA # TAAATLCRESSTFTEAQKHGRRGDFASRTVGYGYGNGRRKPQNYKVSGRANQNAMQELLQNKAIRRISGFQNGACYFLPFCRAPALTEPLALFNTFCH # KNYAEYRDTNDELQLKQPELRANFPNNAFAATTFNLGPLSFSPPHMDPDNRASSWCADTNMGPFDPDKGGHLVLWDLGLIIRFPPGSTILFPSALITH # STIPIQAHETRYTMVQYSSGGLFRWRNNGFQSDKSFLEHATAEECAEREASRVSRWRLGLQKFTRWGDVCRGDWRGTARTAAGLDEVSDLSDIEESPE # ILRPSKHARRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g840 ### # start gene g841 Scaffold_5 AUGUSTUS gene 4080866 4082947 0.93 + . g841 Scaffold_5 AUGUSTUS transcript 4080866 4082947 0.93 + . g841.t1 Scaffold_5 AUGUSTUS start_codon 4080866 4080868 . + 0 transcript_id "g841.t1"; gene_id "g841"; Scaffold_5 AUGUSTUS CDS 4080866 4080882 0.96 + 0 transcript_id "g841.t1"; gene_id "g841"; Scaffold_5 AUGUSTUS CDS 4081642 4082947 0.94 + 1 transcript_id "g841.t1"; gene_id "g841"; Scaffold_5 AUGUSTUS stop_codon 4082945 4082947 . + 0 transcript_id "g841.t1"; gene_id "g841"; # protein sequence = [MRLYILKTAYFEEFGESRSLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGTLIYRLLQMFPRQIGTIFRALKPKVEDEFKDLLGIKLESLIQGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g841 ### # start gene g842 Scaffold_5 AUGUSTUS gene 4083287 4083607 0.53 + . g842 Scaffold_5 AUGUSTUS transcript 4083287 4083607 0.53 + . g842.t1 Scaffold_5 AUGUSTUS start_codon 4083287 4083289 . + 0 transcript_id "g842.t1"; gene_id "g842"; Scaffold_5 AUGUSTUS CDS 4083287 4083607 0.53 + 0 transcript_id "g842.t1"; gene_id "g842"; Scaffold_5 AUGUSTUS stop_codon 4083605 4083607 . + 0 transcript_id "g842.t1"; gene_id "g842"; # protein sequence = [MPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEE # LSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g842 ### # start gene g843 Scaffold_5 AUGUSTUS gene 4083637 4084892 0.49 + . g843 Scaffold_5 AUGUSTUS transcript 4083637 4084892 0.49 + . g843.t1 Scaffold_5 AUGUSTUS start_codon 4083637 4083639 . + 0 transcript_id "g843.t1"; gene_id "g843"; Scaffold_5 AUGUSTUS CDS 4083637 4084360 0.5 + 0 transcript_id "g843.t1"; gene_id "g843"; Scaffold_5 AUGUSTUS CDS 4084411 4084892 0.49 + 2 transcript_id "g843.t1"; gene_id "g843"; Scaffold_5 AUGUSTUS stop_codon 4084890 4084892 . + 0 transcript_id "g843.t1"; gene_id "g843"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEIFGRIRRILQKDIVESFLRDLSIDDERRNIAIVANQSVAYE # DHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNK # APFQVLLGRPFDVLVESEIKTFGNGDSER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g843 ### # start gene g844 Scaffold_5 AUGUSTUS gene 4085609 4086703 1 + . g844 Scaffold_5 AUGUSTUS transcript 4085609 4086703 1 + . g844.t1 Scaffold_5 AUGUSTUS start_codon 4085609 4085611 . + 0 transcript_id "g844.t1"; gene_id "g844"; Scaffold_5 AUGUSTUS CDS 4085609 4086703 1 + 0 transcript_id "g844.t1"; gene_id "g844"; Scaffold_5 AUGUSTUS stop_codon 4086701 4086703 . + 0 transcript_id "g844.t1"; gene_id "g844"; # protein sequence = [MVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDE # TNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERD # LMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLE # PLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTIFYEMKYHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g844 ### # start gene g845 Scaffold_5 AUGUSTUS gene 4086949 4089333 0.83 + . g845 Scaffold_5 AUGUSTUS transcript 4086949 4089333 0.83 + . g845.t1 Scaffold_5 AUGUSTUS start_codon 4086949 4086951 . + 0 transcript_id "g845.t1"; gene_id "g845"; Scaffold_5 AUGUSTUS CDS 4086949 4089333 0.83 + 0 transcript_id "g845.t1"; gene_id "g845"; Scaffold_5 AUGUSTUS stop_codon 4089331 4089333 . + 0 transcript_id "g845.t1"; gene_id "g845"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIK # KFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQ # KVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKI # ERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVR # RRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIEL # PNNIHELIDLTAEQLDLMVEDEDEYWMTRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g845 ### # start gene g846 Scaffold_5 AUGUSTUS gene 4093189 4094135 0.35 - . g846 Scaffold_5 AUGUSTUS transcript 4093189 4094135 0.35 - . g846.t1 Scaffold_5 AUGUSTUS stop_codon 4093189 4093191 . - 0 transcript_id "g846.t1"; gene_id "g846"; Scaffold_5 AUGUSTUS CDS 4093189 4093862 0.86 - 2 transcript_id "g846.t1"; gene_id "g846"; Scaffold_5 AUGUSTUS CDS 4093922 4094135 0.4 - 0 transcript_id "g846.t1"; gene_id "g846"; Scaffold_5 AUGUSTUS start_codon 4094133 4094135 . - 0 transcript_id "g846.t1"; gene_id "g846"; # protein sequence = [MMRSVPSKDLDVFASLRGKVSPVVASKISTLSPPLEIKSSTSVPKAPVAPPRLIRRNRELESLKADASTFVISSPRST # RSRDSDNELLSGFPSAVSASRASSSTKVSTDRKEPKPKTTVKVVEDSKASKPTSSAMVYKRVRLPSRSRKIAPTTAKGKSRQVVVSDDDSASNEVESE # DEEEDEDEEEDSAPPPKRLKRHLLFPVRLYSSFCLILLIQFDCSFIPRRSVKRVTVPKRVSKLQQNPLLSVPSDSTFRPVLLADAQGRLRLPEQSTGS # FTPFPKFAHARVSHSDSIRFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g846 ### # start gene g847 Scaffold_5 AUGUSTUS gene 4097306 4098088 0.82 - . g847 Scaffold_5 AUGUSTUS transcript 4097306 4098088 0.82 - . g847.t1 Scaffold_5 AUGUSTUS stop_codon 4097306 4097308 . - 0 transcript_id "g847.t1"; gene_id "g847"; Scaffold_5 AUGUSTUS CDS 4097306 4098088 0.82 - 0 transcript_id "g847.t1"; gene_id "g847"; Scaffold_5 AUGUSTUS start_codon 4098086 4098088 . - 0 transcript_id "g847.t1"; gene_id "g847"; # protein sequence = [MPPKTRAQSRANSEENTFFTTSQSFAPFSKSISAIGQPRRHNRGFGPATVPTTSTLPEAMEEDQQLEYSTLYTGDGQP # VQVLTPRHGQPPVVAPARGRSTTRIESPILQAIAHRTGKQPQHCAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDNSGGLPCGEPG # DPSGPGRPGGPGGPGGPGGPGGPRSPISPDIPNKQRAMLELLSVTSLPRFCVKEKGRNLMGTPTNQSNTQYVSSLLSNLFNSKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g847 ### # start gene g848 Scaffold_5 AUGUSTUS gene 4100471 4101319 0.94 - . g848 Scaffold_5 AUGUSTUS transcript 4100471 4101319 0.94 - . g848.t1 Scaffold_5 AUGUSTUS stop_codon 4100471 4100473 . - 0 transcript_id "g848.t1"; gene_id "g848"; Scaffold_5 AUGUSTUS CDS 4100471 4101319 0.94 - 0 transcript_id "g848.t1"; gene_id "g848"; Scaffold_5 AUGUSTUS start_codon 4101317 4101319 . - 0 transcript_id "g848.t1"; gene_id "g848"; # protein sequence = [MLEFIRPVTTSEYLYFYLNERRLIAASITSQTETYNASSRHDVPMSGTDLYDQLDKYFADASRELLLGAPQEDSDLIH # YIIPCFNRYSLGAQSANRLLNYVNRHYVKRAVDEDKGWLTVSDVLEHVAKTAKATDTREQLGKKLREKRTDELRKWGDIDAGPEALVEAEGCAEAASP # VDRIVHISALAHRRFRVEFIEPLLAVPKLKKGTKVKKKIPKSNGAGPSPAPKGRLARALKNLLESSEIEVEEQAKLASELAKMLRKIGVRPDHPLRKK # LAKTSAPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g848 ### # start gene g849 Scaffold_5 AUGUSTUS gene 4105201 4105707 0.42 + . g849 Scaffold_5 AUGUSTUS transcript 4105201 4105707 0.42 + . g849.t1 Scaffold_5 AUGUSTUS start_codon 4105201 4105203 . + 0 transcript_id "g849.t1"; gene_id "g849"; Scaffold_5 AUGUSTUS CDS 4105201 4105707 0.42 + 0 transcript_id "g849.t1"; gene_id "g849"; Scaffold_5 AUGUSTUS stop_codon 4105705 4105707 . + 0 transcript_id "g849.t1"; gene_id "g849"; # protein sequence = [MTHASDSKIPPTNVVVKFAYRYGETGHRLLAEAGLAPRIYYCAFDETIGLWVIVMDYVEGVLCKGKLVGGEAKSLTRA # IKLLHDNDLVFGDLREPNIIISKPRESVCVVDFEWCGPCKDIKEGGNVVQRRARYPTNIALSAEYNWAPGVEADGVIAKEHDNHRLQMMV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g849 ### # start gene g850 Scaffold_5 AUGUSTUS gene 4106965 4108092 0.28 + . g850 Scaffold_5 AUGUSTUS transcript 4106965 4108092 0.28 + . g850.t1 Scaffold_5 AUGUSTUS start_codon 4106965 4106967 . + 0 transcript_id "g850.t1"; gene_id "g850"; Scaffold_5 AUGUSTUS CDS 4106965 4108092 0.28 + 0 transcript_id "g850.t1"; gene_id "g850"; Scaffold_5 AUGUSTUS stop_codon 4108090 4108092 . + 0 transcript_id "g850.t1"; gene_id "g850"; # protein sequence = [MDGSESFPSVSRLDLSLADPLSPSRKRQRTWDWNPPDHVPSFLPPFPSTSETSSTPHPPRIPPTELPPNPTEGAGINQ # PPSPPPITSTQPPQPPALTSTSAAASDYLVQVPYTQSTISNVSEWHLPSAPPDSTSSSRPEPRWATPAIEPSLIAAYHHILTHPPPPNATHIANPQRH # KVAMALLALTQSASRWELPDTLFSTLATNQPRVASIGPTYPVLIADHLPAEGVKKGEKEFKFPATAPRSVATTERISQSVIQQGSRIPELARHVLPVR # KHLTNPFEHESIDVPFLFQPTILSRTNRLTHPPPLTRNNKTLTYGAGIPAPWNVNTIPPTTLLLILRKTLKLTGKMCRLLSYPMLDSSLHGTTNTRTF # EHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g850 ### # start gene g851 Scaffold_5 AUGUSTUS gene 4108829 4110963 0.61 - . g851 Scaffold_5 AUGUSTUS transcript 4108829 4110963 0.61 - . g851.t1 Scaffold_5 AUGUSTUS stop_codon 4108829 4108831 . - 0 transcript_id "g851.t1"; gene_id "g851"; Scaffold_5 AUGUSTUS CDS 4108829 4109648 0.71 - 1 transcript_id "g851.t1"; gene_id "g851"; Scaffold_5 AUGUSTUS CDS 4109786 4110963 0.62 - 0 transcript_id "g851.t1"; gene_id "g851"; Scaffold_5 AUGUSTUS start_codon 4110961 4110963 . - 0 transcript_id "g851.t1"; gene_id "g851"; # protein sequence = [MASCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLA # VDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVR # NYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEE # RSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYH # RNTDQPDQPQLVVEKEKRMHIQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCP # EEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPF # DIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRLNENIDIQLKIGISNQVNWSRLGILELKRVWIERCIQDIEDLWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g851 ### # start gene g852 Scaffold_5 AUGUSTUS gene 4111629 4112550 0.92 - . g852 Scaffold_5 AUGUSTUS transcript 4111629 4112550 0.92 - . g852.t1 Scaffold_5 AUGUSTUS stop_codon 4111629 4111631 . - 0 transcript_id "g852.t1"; gene_id "g852"; Scaffold_5 AUGUSTUS CDS 4111629 4112472 0.99 - 1 transcript_id "g852.t1"; gene_id "g852"; Scaffold_5 AUGUSTUS CDS 4112528 4112550 0.92 - 0 transcript_id "g852.t1"; gene_id "g852"; Scaffold_5 AUGUSTUS start_codon 4112548 4112550 . - 0 transcript_id "g852.t1"; gene_id "g852"; # protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY # ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFR # IERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNI # PIPPGIFEDVCKIK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g852 ### # start gene g853 Scaffold_5 AUGUSTUS gene 4112880 4114313 0.95 - . g853 Scaffold_5 AUGUSTUS transcript 4112880 4114313 0.95 - . g853.t1 Scaffold_5 AUGUSTUS stop_codon 4112880 4112882 . - 0 transcript_id "g853.t1"; gene_id "g853"; Scaffold_5 AUGUSTUS CDS 4112880 4114313 0.95 - 0 transcript_id "g853.t1"; gene_id "g853"; Scaffold_5 AUGUSTUS start_codon 4114311 4114313 . - 0 transcript_id "g853.t1"; gene_id "g853"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENMIQ # REIFIPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g853 ### # start gene g854 Scaffold_5 AUGUSTUS gene 4114343 4114663 0.52 - . g854 Scaffold_5 AUGUSTUS transcript 4114343 4114663 0.52 - . g854.t1 Scaffold_5 AUGUSTUS stop_codon 4114343 4114345 . - 0 transcript_id "g854.t1"; gene_id "g854"; Scaffold_5 AUGUSTUS CDS 4114343 4114663 0.52 - 0 transcript_id "g854.t1"; gene_id "g854"; Scaffold_5 AUGUSTUS start_codon 4114661 4114663 . - 0 transcript_id "g854.t1"; gene_id "g854"; # protein sequence = [MPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEE # LSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g854 ### # start gene g855 Scaffold_5 AUGUSTUS gene 4115004 4117328 0.3 - . g855 Scaffold_5 AUGUSTUS transcript 4115004 4117328 0.3 - . g855.t1 Scaffold_5 AUGUSTUS stop_codon 4115004 4115006 . - 0 transcript_id "g855.t1"; gene_id "g855"; Scaffold_5 AUGUSTUS CDS 4115004 4116310 0.61 - 2 transcript_id "g855.t1"; gene_id "g855"; Scaffold_5 AUGUSTUS CDS 4117313 4117328 0.36 - 0 transcript_id "g855.t1"; gene_id "g855"; Scaffold_5 AUGUSTUS start_codon 4117326 4117328 . - 0 transcript_id "g855.t1"; gene_id "g855"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIQGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g855 ### # start gene g856 Scaffold_5 AUGUSTUS gene 4119054 4120768 0.42 + . g856 Scaffold_5 AUGUSTUS transcript 4119054 4120768 0.42 + . g856.t1 Scaffold_5 AUGUSTUS start_codon 4119054 4119056 . + 0 transcript_id "g856.t1"; gene_id "g856"; Scaffold_5 AUGUSTUS CDS 4119054 4119707 0.42 + 0 transcript_id "g856.t1"; gene_id "g856"; Scaffold_5 AUGUSTUS CDS 4120007 4120768 1 + 0 transcript_id "g856.t1"; gene_id "g856"; Scaffold_5 AUGUSTUS stop_codon 4120766 4120768 . + 0 transcript_id "g856.t1"; gene_id "g856"; # protein sequence = [MEPILLRAIHSEVVACAADRSSTAPIVPPLPPSIPAEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYP # LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDE # WKPPFGPDTAPTNGRLCRSALRTPLRLSSGLLMTSSLTCSMFRYCCADDSAYPKRRSLDLGQELSRAFENLKIAFTSAPILAHWEPNRPLIVETDASD # YAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSELHQFNMVIRF # RPGKLGEKPDSITRHWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLNLQKILPMNVG # A] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g856 ### # start gene g857 Scaffold_5 AUGUSTUS gene 4165411 4166892 0.45 - . g857 Scaffold_5 AUGUSTUS transcript 4165411 4166892 0.45 - . g857.t1 Scaffold_5 AUGUSTUS stop_codon 4165411 4165413 . - 0 transcript_id "g857.t1"; gene_id "g857"; Scaffold_5 AUGUSTUS CDS 4165411 4165957 0.69 - 1 transcript_id "g857.t1"; gene_id "g857"; Scaffold_5 AUGUSTUS CDS 4166383 4166513 0.84 - 0 transcript_id "g857.t1"; gene_id "g857"; Scaffold_5 AUGUSTUS CDS 4166629 4166892 0.59 - 0 transcript_id "g857.t1"; gene_id "g857"; Scaffold_5 AUGUSTUS start_codon 4166890 4166892 . - 0 transcript_id "g857.t1"; gene_id "g857"; # protein sequence = [MPMLLMLPHSLIGGLDKLITKKVIPSMDTLIPRCTHAYSVYTLADQLNFTVLPIFEQHIFSLTSSAVKIHNLHHGTQS # NEVTPVPVSFTHQSPHLCQAAIKVAFDIAIVAGIYQNVGYWSRTFPTTWRVVTXSSADYIYSSYSSTVVIWVVYQLAIRRESIPVLREELSRVLEIDV # LTNKPSLTFSSLRNAQYLDSFIREVMRTKGDTLTVFRMTTRDIKIDQYIIPRSQWCTQTLIALAESFLLDSFITPLATLSHESPKYYGEDAKVFIADR # WVGSDKSSTSIGPAYWPFGLGRYACPGRALAIAGSLLQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g857 ### # start gene g858 Scaffold_5 AUGUSTUS gene 4181025 4181711 0.5 - . g858 Scaffold_5 AUGUSTUS transcript 4181025 4181711 0.5 - . g858.t1 Scaffold_5 AUGUSTUS stop_codon 4181025 4181027 . - 0 transcript_id "g858.t1"; gene_id "g858"; Scaffold_5 AUGUSTUS CDS 4181025 4181711 0.5 - 0 transcript_id "g858.t1"; gene_id "g858"; Scaffold_5 AUGUSTUS start_codon 4181709 4181711 . - 0 transcript_id "g858.t1"; gene_id "g858"; # protein sequence = [MSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAED # INLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVK # WKGYDAGHNSGNPQPTSVEHQKLFGPFIKNTQQRQSLDHRGQCHKTRVEKLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g858 ### # start gene g859 Scaffold_5 AUGUSTUS gene 4192071 4193237 0.9 - . g859 Scaffold_5 AUGUSTUS transcript 4192071 4193237 0.9 - . g859.t1 Scaffold_5 AUGUSTUS stop_codon 4192071 4192073 . - 0 transcript_id "g859.t1"; gene_id "g859"; Scaffold_5 AUGUSTUS CDS 4192071 4193237 0.9 - 0 transcript_id "g859.t1"; gene_id "g859"; Scaffold_5 AUGUSTUS start_codon 4193235 4193237 . - 0 transcript_id "g859.t1"; gene_id "g859"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATASPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g859 ### # start gene g860 Scaffold_5 AUGUSTUS gene 4194700 4195182 0.79 + . g860 Scaffold_5 AUGUSTUS transcript 4194700 4195182 0.79 + . g860.t1 Scaffold_5 AUGUSTUS start_codon 4194700 4194702 . + 0 transcript_id "g860.t1"; gene_id "g860"; Scaffold_5 AUGUSTUS CDS 4194700 4194955 0.82 + 0 transcript_id "g860.t1"; gene_id "g860"; Scaffold_5 AUGUSTUS CDS 4195100 4195182 0.93 + 2 transcript_id "g860.t1"; gene_id "g860"; Scaffold_5 AUGUSTUS stop_codon 4195180 4195182 . + 0 transcript_id "g860.t1"; gene_id "g860"; # protein sequence = [MGISRFGGLNQSKLKLEHTDRYGGLELCAGTTTQHDLPLRPMTDPKFEEYPTAGYNISQSQGAEHNVPILTSAGPEWL # LAKRLQSGSPLLFYSPLYCLILYPAGTTHIAPTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g860 ### # start gene g861 Scaffold_5 AUGUSTUS gene 4199446 4200051 0.52 - . g861 Scaffold_5 AUGUSTUS transcript 4199446 4200051 0.52 - . g861.t1 Scaffold_5 AUGUSTUS stop_codon 4199446 4199448 . - 0 transcript_id "g861.t1"; gene_id "g861"; Scaffold_5 AUGUSTUS CDS 4199446 4200051 0.52 - 0 transcript_id "g861.t1"; gene_id "g861"; Scaffold_5 AUGUSTUS start_codon 4200049 4200051 . - 0 transcript_id "g861.t1"; gene_id "g861"; # protein sequence = [MLFGLTNASAAFQRFVTDIFSDMLDVCVIAYLDDILIYSDTPEEHREHIKEVLRRLRKHRLYANPDKCEFNMDTVEYL # GYILSPDGLTMSKEKVQTILEWPVPRKVKVIQSFLGFSNFYRCFIYNYSDIVVPMTRLTRKGAPWIWDNDCQEAFENLKIAFTSAPILAHWEPNCPII # VETDASDYTIAVILSIQLLTVKFIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g861 ### # start gene g862 Scaffold_5 AUGUSTUS gene 4210158 4211284 0.65 - . g862 Scaffold_5 AUGUSTUS transcript 4210158 4211284 0.65 - . g862.t1 Scaffold_5 AUGUSTUS stop_codon 4210158 4210160 . - 0 transcript_id "g862.t1"; gene_id "g862"; Scaffold_5 AUGUSTUS CDS 4210158 4210475 0.85 - 0 transcript_id "g862.t1"; gene_id "g862"; Scaffold_5 AUGUSTUS CDS 4210532 4210573 0.74 - 0 transcript_id "g862.t1"; gene_id "g862"; Scaffold_5 AUGUSTUS CDS 4210646 4211284 0.66 - 0 transcript_id "g862.t1"; gene_id "g862"; Scaffold_5 AUGUSTUS start_codon 4211282 4211284 . - 0 transcript_id "g862.t1"; gene_id "g862"; # protein sequence = [MLDEQDTVDADQQELQKFLALQQNEAVVTAKRKHDHSPMPVVGPSSKKIRSDAPKKRPHHKSLVVEANPEPPRRVQLV # VPPGRSVVASPRASPSLMEVPNRDLPMQGPSDLVWLAAVAEVHSGLVQQSTSSPSARTHIKGTDSDPLPSNMSPTPRSTLVPRAFTAHPYRAENQCLL # DQVRSLESQLADSQRENSSLTTALRDTSHALEARQREFRALDRSLSGLPGQTVLQHFQALVEELCVAKRDCDAAVWKLSPASCKSSELTTALMQQQGL # VDKTNALAMRQRHRLEELQEEVHCARNCAALIEQMIKEYPDEGFYEVVLPPFYNWREI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g862 ### # start gene g863 Scaffold_5 AUGUSTUS gene 4230726 4231796 0.81 + . g863 Scaffold_5 AUGUSTUS transcript 4230726 4231796 0.81 + . g863.t1 Scaffold_5 AUGUSTUS start_codon 4230726 4230728 . + 0 transcript_id "g863.t1"; gene_id "g863"; Scaffold_5 AUGUSTUS CDS 4230726 4231796 0.81 + 0 transcript_id "g863.t1"; gene_id "g863"; Scaffold_5 AUGUSTUS stop_codon 4231794 4231796 . + 0 transcript_id "g863.t1"; gene_id "g863"; # protein sequence = [MVDTAKAIGKPLYVAYMDWTHAFPLTNRPMMWMKLNKMGIRGPLIDWLRLMYQKLGNVVQVADSFSEAFTSNIGAWTG # DPGTPMLFNLAIADFRLSEHPGDVVLYDKVVNHTEQADDVLMTTMCPTSFQSKLNQFGEYSAQTGFIASVPKCVYAVYGKEETEGLPFTLYGKRLKKK # KEMKYMGIWHQTTGVDMYQQQYKESAEKAKKTAGAVLHAKVFVGKNIPIWDLWLLYMGRVDPYLKNGAEVIVDIYDVRRKQLESVQHYFIRRMLGLND # KSMVALLFSETGLWPIRYRRIILFLKNLKYLVQLKRDHLAWKACRQAYELAEQGKNSVFMEMVQVLDRLPHRVVWNIPNSRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g863 ### # start gene g864 Scaffold_5 AUGUSTUS gene 4233524 4234600 0.53 - . g864 Scaffold_5 AUGUSTUS transcript 4233524 4234600 0.53 - . g864.t1 Scaffold_5 AUGUSTUS stop_codon 4233524 4233526 . - 0 transcript_id "g864.t1"; gene_id "g864"; Scaffold_5 AUGUSTUS CDS 4233524 4234600 0.53 - 0 transcript_id "g864.t1"; gene_id "g864"; Scaffold_5 AUGUSTUS start_codon 4234598 4234600 . - 0 transcript_id "g864.t1"; gene_id "g864"; # protein sequence = [MSKIIGWIDNPEPNPGNIFLLTGAAGTEKSGVAHAISKHYHHLDHLGSSIFTCVPDETVEKNTIPFHLIFPTIARDIA # DLDPKFRHALYAAASSMAVRTSRSPMDQFTNFILTPSQYLAILGPIVVVLDGIDQMPESSTRGNFLSVLTQRAQDLPSNFRILVTSRPDSPIMHHLSS # VKALTVKIEDFDQQYTNYRLLQFARSQLHARGLNIKQEQQLHLRLVQKSEGSFQCMAKACSELCGMNVELDSQALSLHLPGREQHMPLVPPEDSLYQQ # EIDYLQRTGKTITEGIDFLKGNLRNSSISMTLKEIIDFRKLANEQFQGNSHENTLGIINTLFHNPSDDYFERFLCDKARSGELD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g864 ### # start gene g865 Scaffold_5 AUGUSTUS gene 4240581 4242195 0.24 + . g865 Scaffold_5 AUGUSTUS transcript 4240581 4242195 0.24 + . g865.t1 Scaffold_5 AUGUSTUS start_codon 4240581 4240583 . + 0 transcript_id "g865.t1"; gene_id "g865"; Scaffold_5 AUGUSTUS CDS 4240581 4241118 0.29 + 0 transcript_id "g865.t1"; gene_id "g865"; Scaffold_5 AUGUSTUS CDS 4241272 4241287 0.43 + 2 transcript_id "g865.t1"; gene_id "g865"; Scaffold_5 AUGUSTUS CDS 4241826 4242195 0.37 + 1 transcript_id "g865.t1"; gene_id "g865"; Scaffold_5 AUGUSTUS stop_codon 4242193 4242195 . + 0 transcript_id "g865.t1"; gene_id "g865"; # protein sequence = [MTCSRMHGVVIPRHFDYRVVKCKVSSVSVWNHLSVHRSLAMNVRQLEVLDERAVSGPGTAIGHGTLSSSLSNQSREMV # PGGISSTETDLEDTDDELAMHIKQEQYLLDALSKMAHLESFIWSCNHSPISIDTFWPILLKIHALKEVEINDNMVFAPMVVADEEDEDEDVPASDAQN # AVVIVRISWKLIDSVPKLTWLDLGIKGYGHGRSGGGGGSYVPTVNVNECLSSAPELTTFHGIKFFYEISLQAQASLASSYESLSNGSSSSPASSFASP # SFSSSSSSSIGSSTDRSRIRKNDETASLLVEMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g865 ### # start gene g866 Scaffold_5 AUGUSTUS gene 4246716 4247258 0.88 + . g866 Scaffold_5 AUGUSTUS transcript 4246716 4247258 0.88 + . g866.t1 Scaffold_5 AUGUSTUS start_codon 4246716 4246718 . + 0 transcript_id "g866.t1"; gene_id "g866"; Scaffold_5 AUGUSTUS CDS 4246716 4247258 0.88 + 0 transcript_id "g866.t1"; gene_id "g866"; Scaffold_5 AUGUSTUS stop_codon 4247256 4247258 . + 0 transcript_id "g866.t1"; gene_id "g866"; # protein sequence = [MRTLHGSYNPYTTHSYGGIFERGSREYTLDDFHSIQLDKMDRFVCLKESGIVIEEGDDESDEDDADGDEDEDEEEADD # DDEEYGSDDEGTIVGSVTTKDEQEELYYRLRDDDDDLESIATIEEEEEYFEDEDELTTTKKILIAKVGRTKYSPSAPWLIVISKTQGRTPFASYRVHG # RIKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g866 ### # start gene g867 Scaffold_5 AUGUSTUS gene 4258837 4259701 0.56 + . g867 Scaffold_5 AUGUSTUS transcript 4258837 4259701 0.56 + . g867.t1 Scaffold_5 AUGUSTUS start_codon 4258837 4258839 . + 0 transcript_id "g867.t1"; gene_id "g867"; Scaffold_5 AUGUSTUS CDS 4258837 4258875 0.57 + 0 transcript_id "g867.t1"; gene_id "g867"; Scaffold_5 AUGUSTUS CDS 4258946 4259701 0.56 + 0 transcript_id "g867.t1"; gene_id "g867"; Scaffold_5 AUGUSTUS stop_codon 4259699 4259701 . + 0 transcript_id "g867.t1"; gene_id "g867"; # protein sequence = [MFLLVRKPFHVYEDTEHLFHEFLRDPSHRQLIDQWIRLAYWAGPKSTFSRAFYSLWRTDPDRKKLYGCVDHLAEMETA # MTLRDMALVLDIGTNLLKLDDPREPRKELTNEKEKEVESCKFEYSESLESPEPFPSVQSLEAQWPPTCRSVALTLTGPRVTFRPLPEVVTPVSFKTMK # SPFAYLEWHKEIDKRLADGEASSAFRSPHSGDLREGHCNDSSVGEEMMKTTVVNRAEGIATEVCIPIAIASRSYSLVYPVAIRNAFYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g867 ### # start gene g868 Scaffold_5 AUGUSTUS gene 4260773 4261389 0.69 + . g868 Scaffold_5 AUGUSTUS transcript 4260773 4261389 0.69 + . g868.t1 Scaffold_5 AUGUSTUS start_codon 4260773 4260775 . + 0 transcript_id "g868.t1"; gene_id "g868"; Scaffold_5 AUGUSTUS CDS 4260773 4260940 0.74 + 0 transcript_id "g868.t1"; gene_id "g868"; Scaffold_5 AUGUSTUS CDS 4260997 4261389 0.76 + 0 transcript_id "g868.t1"; gene_id "g868"; Scaffold_5 AUGUSTUS stop_codon 4261387 4261389 . + 0 transcript_id "g868.t1"; gene_id "g868"; # protein sequence = [MSEGIAMAPAPVVAPIAPKEHEDGSRIEPPEDVTEEPAPITEQEVGEYREQDRYLPIANVSRIMKSSVPPTAKIAKDA # KECVQEYANSSSIFTSQVLYNFFPSLRCVSEFISFITSEAAEKCQLEKRKTIGGEDILYAMGSLGFDNYAECLKVHLAKLRAVSSHVSLTLIIFNSTI # FLSINMEMLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g868 ### # start gene g869 Scaffold_5 AUGUSTUS gene 4262109 4262987 0.48 + . g869 Scaffold_5 AUGUSTUS transcript 4262109 4262987 0.48 + . g869.t1 Scaffold_5 AUGUSTUS start_codon 4262109 4262111 . + 0 transcript_id "g869.t1"; gene_id "g869"; Scaffold_5 AUGUSTUS CDS 4262109 4262115 0.75 + 0 transcript_id "g869.t1"; gene_id "g869"; Scaffold_5 AUGUSTUS CDS 4262179 4262987 0.62 + 2 transcript_id "g869.t1"; gene_id "g869"; Scaffold_5 AUGUSTUS stop_codon 4262985 4262987 . + 0 transcript_id "g869.t1"; gene_id "g869"; # protein sequence = [MLSFATVIDAQSAIGATEVGTSTAFVTASAVSNSPQALPSSTITANPNVATFYLPSPTSQVGIPFTSIVSVSLVGSGV # SGGVTYTTYVEERVVEIPAATMTTLVDSTPVDTALASGSTTTITGLYSRSSGFASGTMVSNGQSWTFTAPDFGNFVENCTISPQTDAILQMSPLLECS # YNSTNGFGGSIGSGLAEYTLILDSSNAVPSSTGSLSHGSDSGSETSLGSDSGSSVTSTATGSASDKSANGSGKKWGSEISVAGAVVALWEISYLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g869 ### # start gene g870 Scaffold_5 AUGUSTUS gene 4276525 4277487 0.28 + . g870 Scaffold_5 AUGUSTUS transcript 4276525 4277487 0.28 + . g870.t1 Scaffold_5 AUGUSTUS start_codon 4276525 4276527 . + 0 transcript_id "g870.t1"; gene_id "g870"; Scaffold_5 AUGUSTUS CDS 4276525 4276979 0.28 + 0 transcript_id "g870.t1"; gene_id "g870"; Scaffold_5 AUGUSTUS CDS 4277064 4277487 0.95 + 1 transcript_id "g870.t1"; gene_id "g870"; Scaffold_5 AUGUSTUS stop_codon 4277485 4277487 . + 0 transcript_id "g870.t1"; gene_id "g870"; # protein sequence = [MQTPTSTRARAGGYSDFFSSGFRVIYAKRVKPRPRPASTYSLPSIPSDLIRSMSSTSRRRSTDSQNTGLPYPLPSPKR # KEDLHSNIVTPLPNEKRKKRSSFIEFSARLFDKMNPGVPEAVSFVEFDETRRCSRSHRAMAHLIIQSWEFRVLSYPDSNESDPFNSSPNSKSFFIDLS # DSSSSSSFTSSPKRSRHQSFMSFSGSSLSSLTSFTRRERPSSIHSLPTVDLLSSGPVRTRYSISRTPSYQHPSNSDKASFSFQEESTVPESPYENDDR # DLANIDWREFHIQFFDNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g870 ### # start gene g871 Scaffold_5 AUGUSTUS gene 4283216 4284935 0.49 - . g871 Scaffold_5 AUGUSTUS transcript 4283216 4284935 0.49 - . g871.t1 Scaffold_5 AUGUSTUS stop_codon 4283216 4283218 . - 0 transcript_id "g871.t1"; gene_id "g871"; Scaffold_5 AUGUSTUS CDS 4283216 4283761 0.91 - 0 transcript_id "g871.t1"; gene_id "g871"; Scaffold_5 AUGUSTUS CDS 4283838 4284935 0.49 - 0 transcript_id "g871.t1"; gene_id "g871"; Scaffold_5 AUGUSTUS start_codon 4284933 4284935 . - 0 transcript_id "g871.t1"; gene_id "g871"; # protein sequence = [MHRPTLTRLHFQALAQRPLQDVWSTRQRILCAMGRTPFIPFHARTQVLTLSLSRYPEPGSFVGWQDLFWKIQNATFIA # HGPLAFLPTWNLPVDNVDHQPLFLSSTGAQESFHLGVELRKRYEFTTGGGNFTAWCVQLCFLHTPFKSHIPRSAGEQRVVDTATYFLRGYLSDGNYIA # DPSLNRGHLIVLPDSLTAEQAINATNGTFADSLTPSASCPPYTVFSNNGSAAASTFRATYQNRTAARINSFLQGNLTFDATDIGVMQDLCGFGYEING # DRRFCDIFTGKFIVLSFLNVPSLIAYRSGEEWLDYEYADDLNYYYGSGPGNPLSAVTGYPWIKAISDLFEVGPNNTVSNGTLIPPPLIMGFSHDNNLP # PLVSALGLWNDTILSLAQRDTNPLRQFRSGHLVAFRGYLALERLTCSTPRPDLNNSGIFHQAGVLGGAVVNLNDTAVASPNISSTTTPQFYVRVRADN # APIPVPSCSSGPGQTCLLAQFIEKVNGPLANSAGDFMEVCGLANVTGSGVSGISGNGSSVRFLTTKGDGTEILAGLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g871 ### # start gene g872 Scaffold_5 AUGUSTUS gene 4305077 4305718 0.48 - . g872 Scaffold_5 AUGUSTUS transcript 4305077 4305718 0.48 - . g872.t1 Scaffold_5 AUGUSTUS stop_codon 4305077 4305079 . - 0 transcript_id "g872.t1"; gene_id "g872"; Scaffold_5 AUGUSTUS CDS 4305077 4305718 0.48 - 0 transcript_id "g872.t1"; gene_id "g872"; Scaffold_5 AUGUSTUS start_codon 4305716 4305718 . - 0 transcript_id "g872.t1"; gene_id "g872"; # protein sequence = [MISLPTWNSIMAWISNMNHIWLLQHIFLSTINEQLAFWAEGWNHHRVSQRHGPSRSPEDMFGFDMIVNGLRGESLEQV # AMTDEELEVFGVDWEGLKDEVILRSLRKNYRTEGAGSWLGQQGPPAELNQVVVDPPSGLFTSEQIAFMDQQLQGYARTPQEVDVVHLWTTALGLARSM # SSHDQHFSSSIYNLLFLSSKTTSSLHRLKVGSWRTDK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g872 ### # start gene g873 Scaffold_5 AUGUSTUS gene 4313356 4314790 0.58 + . g873 Scaffold_5 AUGUSTUS transcript 4313356 4314790 0.58 + . g873.t1 Scaffold_5 AUGUSTUS start_codon 4313356 4313358 . + 0 transcript_id "g873.t1"; gene_id "g873"; Scaffold_5 AUGUSTUS CDS 4313356 4313548 0.76 + 0 transcript_id "g873.t1"; gene_id "g873"; Scaffold_5 AUGUSTUS CDS 4313622 4314790 0.65 + 2 transcript_id "g873.t1"; gene_id "g873"; Scaffold_5 AUGUSTUS stop_codon 4314788 4314790 . + 0 transcript_id "g873.t1"; gene_id "g873"; # protein sequence = [MEQLQGGVPSNSITPHGSNCARLPWLRMHNPVIDWKELCLTFQDRNVRISAALASEIVQPGAEGAPQQPPEAPQPPPE # VPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPGPHKLVPSDKDLGPDDPILMGINEWLAFADESPEEEVEEILETGRSTMEKVTPNPAKDSEEAYQKW # KSRDTERSSSWPGAKQKVRWRKKRREHGPYPDLPTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDR # LLREGTPAYFLHISPTKEESPTEEMLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPH # RPYDIKIETEGMRDTSHRKLYNMSEKELKSLKEYIDEMLGKGFIRSSSPCGSSCLVCQEKGWYPATLRGDLSSSEQDYEEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g873 ### # start gene g874 Scaffold_5 AUGUSTUS gene 4316511 4317470 0.74 + . g874 Scaffold_5 AUGUSTUS transcript 4316511 4317470 0.74 + . g874.t1 Scaffold_5 AUGUSTUS start_codon 4316511 4316513 . + 0 transcript_id "g874.t1"; gene_id "g874"; Scaffold_5 AUGUSTUS CDS 4316511 4317470 0.74 + 0 transcript_id "g874.t1"; gene_id "g874"; Scaffold_5 AUGUSTUS stop_codon 4317468 4317470 . + 0 transcript_id "g874.t1"; gene_id "g874"; # protein sequence = [MPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNN # TPNTTPGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKAYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKW # TGPYTILSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEDILDSKPKKGRPEEVEYLVKWEGYNDEFNSWVGW # EGMVGSIELLRSWHKHHPRKRQPSRLQWASLEREAREDEEEGPER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g874 ### # start gene g875 Scaffold_5 AUGUSTUS gene 4323987 4324860 0.35 - . g875 Scaffold_5 AUGUSTUS transcript 4323987 4324860 0.35 - . g875.t1 Scaffold_5 AUGUSTUS stop_codon 4323987 4323989 . - 0 transcript_id "g875.t1"; gene_id "g875"; Scaffold_5 AUGUSTUS CDS 4323987 4324477 0.57 - 2 transcript_id "g875.t1"; gene_id "g875"; Scaffold_5 AUGUSTUS CDS 4324656 4324860 0.4 - 0 transcript_id "g875.t1"; gene_id "g875"; Scaffold_5 AUGUSTUS start_codon 4324858 4324860 . - 0 transcript_id "g875.t1"; gene_id "g875"; # protein sequence = [MLLDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLDSTSGSIVPTNKMTGRLYFRSPTQSRYKEQAD # RKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYN # VAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELYPHSTPIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g875 ### # start gene g876 Scaffold_5 AUGUSTUS gene 4328445 4329296 0.94 - . g876 Scaffold_5 AUGUSTUS transcript 4328445 4329296 0.94 - . g876.t1 Scaffold_5 AUGUSTUS stop_codon 4328445 4328447 . - 0 transcript_id "g876.t1"; gene_id "g876"; Scaffold_5 AUGUSTUS CDS 4328445 4329296 0.94 - 0 transcript_id "g876.t1"; gene_id "g876"; Scaffold_5 AUGUSTUS start_codon 4329294 4329296 . - 0 transcript_id "g876.t1"; gene_id "g876"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPTSIW # TLVITMIKTLLSTPTIRASIITTTIWMTIPAVYRVVNLVTPVDLVVLAVPGDPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGCP # SDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDLPKYFTNQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWMSSFTALVKELQDNFGVYDA # QGEAEGRPW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g876 ### # start gene g877 Scaffold_5 AUGUSTUS gene 4335141 4336762 0.96 - . g877 Scaffold_5 AUGUSTUS transcript 4335141 4336762 0.96 - . g877.t1 Scaffold_5 AUGUSTUS stop_codon 4335141 4335143 . - 0 transcript_id "g877.t1"; gene_id "g877"; Scaffold_5 AUGUSTUS CDS 4335141 4335728 0.99 - 0 transcript_id "g877.t1"; gene_id "g877"; Scaffold_5 AUGUSTUS CDS 4336123 4336488 0.99 - 0 transcript_id "g877.t1"; gene_id "g877"; Scaffold_5 AUGUSTUS CDS 4336545 4336689 0.99 - 1 transcript_id "g877.t1"; gene_id "g877"; Scaffold_5 AUGUSTUS CDS 4336746 4336762 0.99 - 0 transcript_id "g877.t1"; gene_id "g877"; Scaffold_5 AUGUSTUS start_codon 4336760 4336762 . - 0 transcript_id "g877.t1"; gene_id "g877"; # protein sequence = [MNPHNTVFDAKRLIGRKFDDAEVQADMKHFPFTVFSKEGKLYIEVEYRGEKKQFSPEEISSMVLLKMKETAEAFLGTT # ITNSVVTVPAYFNNSQRQTTKDARTKSGMNGLCIINEPIPAAIAYGLLDKKVSDECKVLIFDLGGGTFDVSLLTIKEGIFEVEATVGDTHVGGALPTF # DLLLLDVSPLSLGIETAGGVMTALIKRNTTVPTKKSETFSTYADNQSDVLIQVFKGERACTKDNNLLGKFEPSGIPPAPHGAPQIEVTFDIDANGISD # VSAADKSTGKSNHIIITNDKGRLRKEEIEGMVSETKKYKAENEAATARIAAKNGLESYLSNLRHPLTNEKLADKFSLEDKAKLTTYVDETIKWLDES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g877 ### # start gene g878 Scaffold_5 AUGUSTUS gene 4341488 4342654 0.89 + . g878 Scaffold_5 AUGUSTUS transcript 4341488 4342654 0.89 + . g878.t1 Scaffold_5 AUGUSTUS start_codon 4341488 4341490 . + 0 transcript_id "g878.t1"; gene_id "g878"; Scaffold_5 AUGUSTUS CDS 4341488 4342654 0.89 + 0 transcript_id "g878.t1"; gene_id "g878"; Scaffold_5 AUGUSTUS stop_codon 4342652 4342654 . + 0 transcript_id "g878.t1"; gene_id "g878"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g878 ### # start gene g879 Scaffold_5 AUGUSTUS gene 4343022 4346420 0.96 + . g879 Scaffold_5 AUGUSTUS transcript 4343022 4346420 0.96 + . g879.t1 Scaffold_5 AUGUSTUS start_codon 4343022 4343024 . + 0 transcript_id "g879.t1"; gene_id "g879"; Scaffold_5 AUGUSTUS CDS 4343022 4346420 0.96 + 0 transcript_id "g879.t1"; gene_id "g879"; Scaffold_5 AUGUSTUS stop_codon 4346418 4346420 . + 0 transcript_id "g879.t1"; gene_id "g879"; # protein sequence = [MDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPELEPPAENP # HIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLP # AHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRL # QGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRL # EKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFD # TLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSN # LEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLK # TVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRA # VTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIK # SDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDA # GAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEI # PTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g879 ### # start gene g880 Scaffold_5 AUGUSTUS gene 4375471 4376443 0.21 - . g880 Scaffold_5 AUGUSTUS transcript 4375471 4376443 0.21 - . g880.t1 Scaffold_5 AUGUSTUS stop_codon 4375471 4375473 . - 0 transcript_id "g880.t1"; gene_id "g880"; Scaffold_5 AUGUSTUS CDS 4375471 4375914 0.74 - 0 transcript_id "g880.t1"; gene_id "g880"; Scaffold_5 AUGUSTUS CDS 4375967 4376443 0.33 - 0 transcript_id "g880.t1"; gene_id "g880"; Scaffold_5 AUGUSTUS start_codon 4376441 4376443 . - 0 transcript_id "g880.t1"; gene_id "g880"; # protein sequence = [MDISREAGKLWRALGPAGQEEYHARAQQEKEEHARKYPGYFYKPRTKQQIADAKAEKARGKPVANAKRSARHSDDDDY # EGSSFRSSFSPSSMGSSDFSGADSSPSPFYSGESWGSSSLDSGSREVSPYSNGAPPPFAGADTWILDPKFQASLAGYEVYNSPLESTPMAATFSQQQQ # QSLGTSVYSPTSDDELFKAAFDTLLSNEYFDPTTIASGSSAPEFNPFAFNSNQFDLSTNPMDFLSGSTDQNFPLINNVNTGGDADYTTDLLPELDPSL # VPGSYFQREELYQPQQSIDYQLECYRLPSFDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g880 ### # start gene g881 Scaffold_5 AUGUSTUS gene 4379431 4380327 0.98 + . g881 Scaffold_5 AUGUSTUS transcript 4379431 4380327 0.98 + . g881.t1 Scaffold_5 AUGUSTUS start_codon 4379431 4379433 . + 0 transcript_id "g881.t1"; gene_id "g881"; Scaffold_5 AUGUSTUS CDS 4379431 4380327 0.98 + 0 transcript_id "g881.t1"; gene_id "g881"; Scaffold_5 AUGUSTUS stop_codon 4380325 4380327 . + 0 transcript_id "g881.t1"; gene_id "g881"; # protein sequence = [MVSTIPNSTSSVYGGWTNAGAMNGSLAPGVASGVPTIVAASTPSPIITASSAPTTPVGAATALPQTGVAYTVPQAGVG # SAMPQPGIASTMPPTGVVPPIPQENTAYIMPQAGIASMPTAAPHTGVPAVVPQTGMAPTVPQATPGSALTSSSAFSGTRRRVRNIFGGSGAPGAGGMA # SAGNTAVQTQMGGMGMGMGAPGSMGGMGAGTMGSMGGMTGAGGFAPYPNTMYPSMGSGMAYPPAIAQPQMQYGGTGMMMPSAQSQQAPVVVYTKPRRH # HHHRSSKHGHGYGRRSRSVEIDRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g881 ### # start gene g882 Scaffold_5 AUGUSTUS gene 4391362 4392012 0.82 - . g882 Scaffold_5 AUGUSTUS transcript 4391362 4392012 0.82 - . g882.t1 Scaffold_5 AUGUSTUS stop_codon 4391362 4391364 . - 0 transcript_id "g882.t1"; gene_id "g882"; Scaffold_5 AUGUSTUS CDS 4391362 4392012 0.82 - 0 transcript_id "g882.t1"; gene_id "g882"; Scaffold_5 AUGUSTUS start_codon 4392010 4392012 . - 0 transcript_id "g882.t1"; gene_id "g882"; # protein sequence = [MLLDPFSVKCTKEVFEALHSHQKLLGELAIAPEDFSAETVPCLSWKPDPKIQINPTVYNGGLLDTDLAAIHNWIFVKL # PQPAEMERLDMLHYTTAHARTLLLAYRHREEFLNNAPDNLADVDQYIVHQAWNRLVAWTGLSVDGKSKRSKGADVNYEAVSLLDKIMFDESSRAGVAG # NHQWGLDVGPHEMGWNPQFTGPNVTVGKRREGNDDEEVLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g882 ### # start gene g883 Scaffold_5 AUGUSTUS gene 4392407 4393618 0.53 - . g883 Scaffold_5 AUGUSTUS transcript 4392407 4393618 0.53 - . g883.t1 Scaffold_5 AUGUSTUS stop_codon 4392407 4392409 . - 0 transcript_id "g883.t1"; gene_id "g883"; Scaffold_5 AUGUSTUS CDS 4392407 4393618 0.53 - 0 transcript_id "g883.t1"; gene_id "g883"; Scaffold_5 AUGUSTUS start_codon 4393616 4393618 . - 0 transcript_id "g883.t1"; gene_id "g883"; # protein sequence = [MEHCRVQMQRKGLGWSPLASQWDQHQGSIQKWFSSLTQVQPLSDVYSTSGCWRRVYEDGALVKVCSGQSQQSQYIIDI # PVILIIQPDVSAGKHWDYPLRLLPGSLAEARKGVVYDLVGRIFQSHNHFMAHTSVPTTSRGMSVFAYDSLKHQGYSQRLHGKASNLIAGISPPCPLGF # QTHAAVYKLKGGLAGQNIFRTRQKSAIRNILNISLDSDPPTLHSPNWIECSVDDRSHWKTREYQLSQPNLPNSIMENASLPPPEDILPEGADFQYGDP # TELPFIPSPTSTSMVLDPTVNPCTPEPQAPALFIPDSPISSIASSSPLPSSPHYITADVELRQMDIESPFNKTLSNVAYAASIPILPVLQCDSMTNLL # RSSSVMSVMYSKNMTTSVNSDIHCPICVNKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g883 ### # start gene g884 Scaffold_5 AUGUSTUS gene 4393779 4394771 0.62 - . g884 Scaffold_5 AUGUSTUS transcript 4393779 4394771 0.62 - . g884.t1 Scaffold_5 AUGUSTUS stop_codon 4393779 4393781 . - 0 transcript_id "g884.t1"; gene_id "g884"; Scaffold_5 AUGUSTUS CDS 4393779 4394551 1 - 2 transcript_id "g884.t1"; gene_id "g884"; Scaffold_5 AUGUSTUS CDS 4394606 4394771 0.62 - 0 transcript_id "g884.t1"; gene_id "g884"; Scaffold_5 AUGUSTUS start_codon 4394769 4394771 . - 0 transcript_id "g884.t1"; gene_id "g884"; # protein sequence = [MAADLAAKLPATTNAEEAMHATIYRAVGINHPLLKGLDGLLAVEKLFRIESQNALLHVKSHYGKSGRELRKELYQQHG # TTHPSRKHPRGAAKERRRGRREGNPPFWQLKKSSSSLKRHRLVRASTKRPISHSGSDSSSSEHLPPYPHHSHVIPSSDDSDNEPAKTANELHKAQQKI # QLMSPTKLNARPSQPDFGPIKSTTTSELPSAKWDRNSCWLDSSMEVLFCAMAFHNTFKEFENLVLTEKTKATPAPIYYLYLAFKFRLDQGLNKFLAPS # HGEASEITEVRNSFRQTLHTIKAVNGKVGEFQMAFVSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g884 ### # start gene g885 Scaffold_5 AUGUSTUS gene 4395130 4397592 0.62 - . g885 Scaffold_5 AUGUSTUS transcript 4395130 4397592 0.62 - . g885.t1 Scaffold_5 AUGUSTUS stop_codon 4395130 4395132 . - 0 transcript_id "g885.t1"; gene_id "g885"; Scaffold_5 AUGUSTUS CDS 4395130 4396437 0.79 - 0 transcript_id "g885.t1"; gene_id "g885"; Scaffold_5 AUGUSTUS CDS 4397342 4397503 0.62 - 0 transcript_id "g885.t1"; gene_id "g885"; Scaffold_5 AUGUSTUS CDS 4397566 4397592 0.81 - 0 transcript_id "g885.t1"; gene_id "g885"; Scaffold_5 AUGUSTUS start_codon 4397590 4397592 . - 0 transcript_id "g885.t1"; gene_id "g885"; # protein sequence = [MAIAALGKLYIMIMILFHLLKTHWDELVTAGFLFNAPTRLNLDSPWVKVTRTPISPVRALFDMTQPTGNLVKSQPNIH # PSQPASDSLHPNSKNWTSIPLIDLSNPAALTTFIPLDPQPLSVCELDQGVIATLLGNLQGGEWDPWPNGRFRLDLTHTEYMATKRLAVQWATKSNTTR # SRNSSVGSSTIAGGKILNKKCLGVLICTVEGCQFIGRPQVESAGLQKQLSARCHCGGQLKHDHCSSRSYLITWGQQDGDISTTQYRYINGTAHTHSRL # PGVVRTTAAEDQRFRTVYENRPNATSTQLMVGAPAPQGFGPSAADLGQKFSQRAYTSYRLNQEKKKDGNGPTSAFGNLQNLQKWKGKHSTVLCKDYVS # SDIVCISLQTEWMQQQTLPDMSDVGDPLHGLLSDAAHKYWEDPNGRLIVTSIYSPLIEKWVPVLFTYANGATIAHYEYHFLILIEGIAATALQKNIPI # TDSLFASVSAIFFSNDISFTKDINTIAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g885 ### # start gene g886 Scaffold_5 AUGUSTUS gene 4403341 4404018 0.54 - . g886 Scaffold_5 AUGUSTUS transcript 4403341 4404018 0.54 - . g886.t1 Scaffold_5 AUGUSTUS stop_codon 4403341 4403343 . - 0 transcript_id "g886.t1"; gene_id "g886"; Scaffold_5 AUGUSTUS CDS 4403341 4404018 0.54 - 0 transcript_id "g886.t1"; gene_id "g886"; Scaffold_5 AUGUSTUS start_codon 4404016 4404018 . - 0 transcript_id "g886.t1"; gene_id "g886"; # protein sequence = [MMNALIEDIPNSETLDELVAILSELSSREGEIEQSLRERIFVPDHQNALRKLSEIYFNDMNYTIPTDDLYPLHPAISK # TIASNLGVPFLSSLQLDEQDDLDVDDEDMSESLILRIKNVLVAYDKRYAFNEFLANAVDADASRFKVLLDAKRFNGDPIALPNSMLCPEMAACQEGPA # LVLHNDAKFSEADFKGIKCIGEGGKQDRNGTIGKFGLGALSFYHFSEVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g886 ### # start gene g887 Scaffold_5 AUGUSTUS gene 4404076 4406531 0.83 - . g887 Scaffold_5 AUGUSTUS transcript 4404076 4406531 0.83 - . g887.t1 Scaffold_5 AUGUSTUS stop_codon 4404076 4404078 . - 0 transcript_id "g887.t1"; gene_id "g887"; Scaffold_5 AUGUSTUS CDS 4404076 4406028 0.89 - 0 transcript_id "g887.t1"; gene_id "g887"; Scaffold_5 AUGUSTUS CDS 4406079 4406531 0.83 - 0 transcript_id "g887.t1"; gene_id "g887"; Scaffold_5 AUGUSTUS start_codon 4406529 4406531 . - 0 transcript_id "g887.t1"; gene_id "g887"; # protein sequence = [MLCRLLVTWNRVFFEELIPKAWASLLIPKLVQNNDVENIWDAWPPKPEDILITPVKSMLDFVTKKALASRDKLFPAYI # SGKRIFIRSSDPALVASVSNVGQKVRDAVSRTGIAVIVLPLYIFSAIQSYVGSQDHMYEFHLFNPKNLHRFLQQEPNTILGTDSDKDRILDYLIATSP # DYIIGLPLVPTVHGDRISLSQPTGQSKRYILGSATEVELFRTCETSMIDLSSLPENAQRWLQQSDIGTKLNVARLGPDNLKVYLMKLLGIHSAKARIM # PSSVRLSPSWFRSFWDWIDGLLNAKDFLETAACFHLLLLLDGSLCPVSEKAFIVSDDQTEVFRVLKVAGIPFLDPHIVSTMALSCHGFTMSIDNIREL # IGFINPSDIQGHIDCLILQRHLIGLIQRSTPVLTPAERMVFRSLPIFPRRLPQISAPITELDSVTGQLKLVAVPDDFPLPILQHVTFIDMSKASNVLG # LLIEPDAPILDEVAIMALSIQHLSEQPEAFQDLLMAKIIPRLLELTQETREGLRHQRFVPAVGSPGRVSPADIIDPKSLLSGLYQDEQGRFPMPPYSD # HIPLSIMRTAGLYSTKLSSVMLEERIQYISSGGSDPSRIAKAKILLGLLSDSGQWNPSFVKTVVTDDETAWIPNTVNTLVSRQRCRDVNSGEHHFLFD # FVLDSVACRVSKDVRSALGWESELCFDILYQQFQTTLERSNVSDRYDRLTHLIKYIAKQHLDGTFTMGNICALQTLVEGRRWIPLSDNSLGLTHHALL # TSNLKIGNMFQSIQSTILRSDNRSCIDFWRAMGCTER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g887 ### # start gene g888 Scaffold_5 AUGUSTUS gene 4414805 4415801 0.67 + . g888 Scaffold_5 AUGUSTUS transcript 4414805 4415801 0.67 + . g888.t1 Scaffold_5 AUGUSTUS start_codon 4414805 4414807 . + 0 transcript_id "g888.t1"; gene_id "g888"; Scaffold_5 AUGUSTUS CDS 4414805 4415356 0.67 + 0 transcript_id "g888.t1"; gene_id "g888"; Scaffold_5 AUGUSTUS CDS 4415442 4415801 0.93 + 0 transcript_id "g888.t1"; gene_id "g888"; Scaffold_5 AUGUSTUS stop_codon 4415799 4415801 . + 0 transcript_id "g888.t1"; gene_id "g888"; # protein sequence = [MKKSETFGAPSSDIAAEAGIQYNAASHGSSGPIHWSYPGETFNIVGNWTPTLVTLGIPSNPDSASGDNSGAYITTSSI # NPSNWTRSYSRSGYIDPLPPRSNLDILPSATVTNIVWGSGTSGNLTATGVQWASSSTAAKQTVNANKEVILAAGTIGSAQVLQLSGVGPSKYLQAAGV # DVQLDLPGSGSLIYSTTAETAGDLHADGVATAEFLSYINSATAYVNLTTLLGSDSASALISSAQAEVDSSASSLLPLGDSTVAAGYKAIYDTITNQFY # SSNSGQIELLLSITSTSVLIQAAIQHPLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g888 ### # start gene g889 Scaffold_5 AUGUSTUS gene 4433841 4435003 0.76 + . g889 Scaffold_5 AUGUSTUS transcript 4433841 4435003 0.76 + . g889.t1 Scaffold_5 AUGUSTUS start_codon 4433841 4433843 . + 0 transcript_id "g889.t1"; gene_id "g889"; Scaffold_5 AUGUSTUS CDS 4433841 4434018 0.77 + 0 transcript_id "g889.t1"; gene_id "g889"; Scaffold_5 AUGUSTUS CDS 4434096 4435003 0.99 + 2 transcript_id "g889.t1"; gene_id "g889"; Scaffold_5 AUGUSTUS stop_codon 4435001 4435003 . + 0 transcript_id "g889.t1"; gene_id "g889"; # protein sequence = [MSLHFSIEPLPPPRPTSFEIMKELHDSRFKEFPVKRDAEPAEVIYAQFAPPTPPKTSPRFNAQDAEITVVSSDNVLFR # LHKMNVQVTSGGLLQSQSKGPGIQDDFLTLTEPADVLEILFEFLYPDYETDLERLEFNALLSVAEAAEKYGVFYAMSHCTFCLRCVYPKVIFSSLDLM # TSTCIRKHTLFHSAELIRFAVKYRKEKMLAELTPALLDMELEEVITILPPTAFGEFVRDPISAHRVVTRFDDFCQCIFRDRWIKVLLKCFALIIESSA # DHDQNQNYPCFKEPQTQITRRLKSFLDDAIAKPSSLFPDQLDRSFLQLEAILMGNGCAWCKDAFITFKDCVLDEVKELPRTFAVELY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g889 ### # start gene g890 Scaffold_5 AUGUSTUS gene 4447708 4448270 0.41 + . g890 Scaffold_5 AUGUSTUS transcript 4447708 4448270 0.41 + . g890.t1 Scaffold_5 AUGUSTUS start_codon 4447708 4447710 . + 0 transcript_id "g890.t1"; gene_id "g890"; Scaffold_5 AUGUSTUS CDS 4447708 4447882 0.41 + 0 transcript_id "g890.t1"; gene_id "g890"; Scaffold_5 AUGUSTUS CDS 4447960 4448270 1 + 2 transcript_id "g890.t1"; gene_id "g890"; Scaffold_5 AUGUSTUS stop_codon 4448268 4448270 . + 0 transcript_id "g890.t1"; gene_id "g890"; # protein sequence = [MKHSTTTTGELLSEQDKRNLAATDEKAAGCSTLPRLTPGISEHTHIVSTSPHNDRQQRLIHETTETTETTETTETTET # TETTETTETNETTETNETNETNETNETNETNETNETNETNETNETNETNETNETNVTYLPDTSSLFAPESYLLGTSSLFAPES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g890 ### # start gene g891 Scaffold_5 AUGUSTUS gene 4453838 4454776 0.64 - . g891 Scaffold_5 AUGUSTUS transcript 4453838 4454776 0.64 - . g891.t1 Scaffold_5 AUGUSTUS stop_codon 4453838 4453840 . - 0 transcript_id "g891.t1"; gene_id "g891"; Scaffold_5 AUGUSTUS CDS 4453838 4454776 0.64 - 0 transcript_id "g891.t1"; gene_id "g891"; Scaffold_5 AUGUSTUS start_codon 4454774 4454776 . - 0 transcript_id "g891.t1"; gene_id "g891"; # protein sequence = [MWLTVASLKEWQLVGLVSFQNGYASLKSHTDQVLENFAGKKTLSGLDPYYSIIDFQSKANFGGFKEMDFDWADPSPLV # ITDPEFLPLTFTQNAYLTLPHVDGMGAHMRFGHIWGAKLWILWPLTAENYSHVNSQWFVPGSAKTPGIHWCFEKLGPPEVVLMEAPVTFHLPPCTIHA # CLSLTQSAHVGQYFLCSDGFEDAKIINRTIMEAWKRVEMHWKNQMDSRNAPEKLDAQGSGDEASMRQRKLRESHENAWNIQSAESFLEWKKVIDIDIG # GWKRVAHTNDDHQKEKEILRWAKELGRFCRQVEIPFEW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g891 ### # start gene g892 Scaffold_5 AUGUSTUS gene 4457319 4458913 0.56 - . g892 Scaffold_5 AUGUSTUS transcript 4457319 4458913 0.56 - . g892.t1 Scaffold_5 AUGUSTUS stop_codon 4457319 4457321 . - 0 transcript_id "g892.t1"; gene_id "g892"; Scaffold_5 AUGUSTUS CDS 4457319 4458471 0.74 - 1 transcript_id "g892.t1"; gene_id "g892"; Scaffold_5 AUGUSTUS CDS 4458531 4458913 0.58 - 0 transcript_id "g892.t1"; gene_id "g892"; Scaffold_5 AUGUSTUS start_codon 4458911 4458913 . - 0 transcript_id "g892.t1"; gene_id "g892"; # protein sequence = [MGSSKYQRDIVSHIMDVAGCRIEPGSRAQGEYEAAYFQLYTTDKAITYNPEGRHHGKAISTNLAMGPTQPPAFISGLF # ELFTDAMTRNSSNARIEVRVPIRHATRVLLTIDVDLVRRNLLAFPRSTWWKFRAQRVEAISRVLLRQQQGDPQLRIKPAALQLTAACVWLLNGLHSRP # DDGSAARNLMTTVLPLTDSLDPDPNTVLFLSTEEDFAELPYNPFGVIFLRCISLKVPVPRMRHNPDVFLLPNSFQYLFNATEEEIRYKYHSIGVVPRH # TEAQRRIITNKTRRTKRFIRVDERLPDSQFNLGLRGYVLPPPPADDGSDKECENQEEGNIDAKLTSIWYQFLLDMADRSPAPKKSSSASYLKLSSAQR # QHAGEELYMNLKLSDVWTAVRWKLGTPSEFQTAFGNLFPEKDHETQPKVQNYTQCRYYMEWKTLCASGDAETITAARKELWRKVLRLQWIPQAASDKC # GTRSSQKGRMPQSGFHLIPRAQHRVYCVDGSPHGDCREHDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g892 ### # start gene g893 Scaffold_5 AUGUSTUS gene 4458964 4459938 0.83 - . g893 Scaffold_5 AUGUSTUS transcript 4458964 4459938 0.83 - . g893.t1 Scaffold_5 AUGUSTUS stop_codon 4458964 4458966 . - 0 transcript_id "g893.t1"; gene_id "g893"; Scaffold_5 AUGUSTUS CDS 4458964 4459938 0.83 - 0 transcript_id "g893.t1"; gene_id "g893"; Scaffold_5 AUGUSTUS start_codon 4459936 4459938 . - 0 transcript_id "g893.t1"; gene_id "g893"; # protein sequence = [MDGLYSSLPPKAYSLRNFVRAGSALDSPDVDGDAYLLFLLTGQHVLEDHQAVVDARRNTLNDDHSIGASRDYDSLIGI # ADEILVDAAISVYPAPNPAEVLSTSIHVKIRLPSGDVSTNAFKYNSQFTFCSQNHKLVPIHRIPNFQFAVWGNRCQIHIFFPGIASRGPEDLARQLSK # EEKTTFYEIGLRPAIAALLPEDISDWPPTYDGELFRARKQSGHMSYQTKIIPALEVHNVVDRIRKNLEDANIDWAESFFFTHTVRGFKHGTQHEMNED # EAQLALDVLLSHADLSRMQLRGENGGLMWVSNSVATFRAAFSGRQHRIIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g893 ### # start gene g894 Scaffold_5 AUGUSTUS gene 4462673 4463183 0.62 + . g894 Scaffold_5 AUGUSTUS transcript 4462673 4463183 0.62 + . g894.t1 Scaffold_5 AUGUSTUS start_codon 4462673 4462675 . + 0 transcript_id "g894.t1"; gene_id "g894"; Scaffold_5 AUGUSTUS CDS 4462673 4462753 0.64 + 0 transcript_id "g894.t1"; gene_id "g894"; Scaffold_5 AUGUSTUS CDS 4462851 4463183 0.96 + 0 transcript_id "g894.t1"; gene_id "g894"; Scaffold_5 AUGUSTUS stop_codon 4463181 4463183 . + 0 transcript_id "g894.t1"; gene_id "g894"; # protein sequence = [MKLTKCETWASSTSQECERSNLGLLSFDLSSLARLIGIPHFMTKDSAEEAKEDAAAIRKAKKADDEGLTLQQVQIRAV # RRIQAQFLGHVLRRTIDSQNWSGERLLALPPFKTIVGVLTLSDREMEILVQRQQDAQAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g894 ### # start gene g895 Scaffold_5 AUGUSTUS gene 4464092 4465382 0.52 + . g895 Scaffold_5 AUGUSTUS transcript 4464092 4465382 0.52 + . g895.t1 Scaffold_5 AUGUSTUS start_codon 4464092 4464094 . + 0 transcript_id "g895.t1"; gene_id "g895"; Scaffold_5 AUGUSTUS CDS 4464092 4464277 0.76 + 0 transcript_id "g895.t1"; gene_id "g895"; Scaffold_5 AUGUSTUS CDS 4464557 4464746 0.66 + 0 transcript_id "g895.t1"; gene_id "g895"; Scaffold_5 AUGUSTUS CDS 4464850 4465382 0.98 + 2 transcript_id "g895.t1"; gene_id "g895"; Scaffold_5 AUGUSTUS stop_codon 4465380 4465382 . + 0 transcript_id "g895.t1"; gene_id "g895"; # protein sequence = [MTLPVTLNLVSRLDLTDSLSGKLIIVDESEDSAIVAEEVEGSKTRRQAKGSKAKAKAKHAPQDEAIHSSGAQVDDTDA # SAAQSFIDETDSGWNSRVETDDADGDGFRDGELNECSTVFVEARSNIYLEYHDDDENFFAAAVATDSSGYDLPASNRKKSKRRKRATPQVVGAASRSV # EENLSTTAVSPVPSTNYSSRTTLLGEIAARTGSMPSTPPLKRKKAESHSDLDGIEISEVSPVLSKRHRRAETESPSRIPTKAKSRFIDLNALNASTRD # PQSHSSSKPDAQVVPLPHSSKVELRIPD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g895 ### # start gene g896 Scaffold_5 AUGUSTUS gene 4465727 4466311 0.93 + . g896 Scaffold_5 AUGUSTUS transcript 4465727 4466311 0.93 + . g896.t1 Scaffold_5 AUGUSTUS start_codon 4465727 4465729 . + 0 transcript_id "g896.t1"; gene_id "g896"; Scaffold_5 AUGUSTUS CDS 4465727 4466311 0.93 + 0 transcript_id "g896.t1"; gene_id "g896"; Scaffold_5 AUGUSTUS stop_codon 4466309 4466311 . + 0 transcript_id "g896.t1"; gene_id "g896"; # protein sequence = [MHESNAEAFSDKTSAPSPARTAVPTSSRAHSFAPSSSRNDMHESNAEAFSDKTSAPSPARTAVPTSSRAHSFAPSSSR # SDMRESSLKPSSSKIATSSSVRTAVVTSTRGRSFAPSSSRTPMHDSNAEASSSKIAASSSVRTAGGSSSRNNSFAALNRNIFTTSPKSRATSKSRCGH # YWRMDIIDVAFSRRTPAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g896 ### # start gene g897 Scaffold_5 AUGUSTUS gene 4476746 4478863 0.7 - . g897 Scaffold_5 AUGUSTUS transcript 4476746 4478863 0.7 - . g897.t1 Scaffold_5 AUGUSTUS stop_codon 4476746 4476748 . - 0 transcript_id "g897.t1"; gene_id "g897"; Scaffold_5 AUGUSTUS CDS 4476746 4478863 0.7 - 0 transcript_id "g897.t1"; gene_id "g897"; Scaffold_5 AUGUSTUS start_codon 4478861 4478863 . - 0 transcript_id "g897.t1"; gene_id "g897"; # protein sequence = [MFHSPRNSRLLIEAWKDFEYRIKWRIFFTFKDGRQDADNYDPDYEVPRERTSKVPQLPQYIEYGLNIGQVYITKMMAL # MPKDQEGSAFKSLAPDPKRIRQYLIDNDYVVTNTDKNLGIAVSQRTWIEEKSLALLNNPSDYERLTPAECKRILDKQCTQMELLCTLVDEAEPALEKQ # LKRFFRHKVTSPSGSHHIPTFYCIPKIHKEPVKGRPIIPCHSAIQNPAAKYVSKKLKPLIEAAPSIIHGSKDLAIKLSKFKRDPRRRLFIVTGDVVAF # YPNIPLQRCFDVVDELFCEFYHIEVDDLGVPISDEWKHKVLLLERAMMYGCSDLVTQFFDSTIKDFIYFKQKRGLAMGVACSPDLANLFGFWFESRKQ # IWKRPEFGFYGRYIDDCLALVYAHSADEALALCENNINFDGCTIEWNVSEHFQHFLDMTLYLDEKGDLQHMPFRKAMSHQERIPWISHHPLDVKRGSF # IGEMSRLATLSSTQSHYLVAIKDLASLYVKRGYPSKAVYHWLNNNKKERWDNRLSLNNQHDGLSATEDVLVLKSTFNSAWDYFSASELGKRITRYWKE # WLIHAEKGDYSSKYPKYRFGEDSLKDTVGSLRSVIDSGAPAGVLTAPVTVPDIRLTGLADARWLVSRKRTRNLFDLANLWKKEVFQRMDVDTATNIAQ # GIPSDNYLDDVEMEDIQTKGDRPVPGDLEYIHYGHAMES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g897 ### # start gene g898 Scaffold_5 AUGUSTUS gene 4522375 4523622 0.65 - . g898 Scaffold_5 AUGUSTUS transcript 4522375 4523622 0.65 - . g898.t1 Scaffold_5 AUGUSTUS stop_codon 4522375 4522377 . - 0 transcript_id "g898.t1"; gene_id "g898"; Scaffold_5 AUGUSTUS CDS 4522375 4523288 0.97 - 2 transcript_id "g898.t1"; gene_id "g898"; Scaffold_5 AUGUSTUS CDS 4523343 4523622 0.65 - 0 transcript_id "g898.t1"; gene_id "g898"; Scaffold_5 AUGUSTUS start_codon 4523620 4523622 . - 0 transcript_id "g898.t1"; gene_id "g898"; # protein sequence = [MQDLQSSHSPIASAPQPPPHFPSPGEAFPPLPHPTPAAPATLHIDNLTTSALTQGLAGDSGDMKDLNEGRDIGIEVEG # VQEIDATGDTAELDKDGNSTDDEQSSNEGDDPSDDEDQQVCDEEMDVDQAPSSLSPPEIHSSLLRFNILVEPVYRLVVCTECAIPVRLEHMYTHQKTK # HFKGLNLPPELNLPSRANLESLLVTLGAGQPLEVPAGPIPRIRGVQIVQGLKCTTSGCSGKVFGSIEGRSRNLRVHQLQVHPQVALADRRSVQVSCHP # LSANRRDRQFVEVSPSSTSTSASFRLVEKAAETCNLLEHSQVFSLASNEREKNAVFAQSRWDELLDGVNLTLLIATISNSKRDAFGSFQRLKRIAREY # YKGVADRLMTLPVLTRRYLLSSSTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g898 ### # start gene g899 Scaffold_5 AUGUSTUS gene 4526275 4529237 0.51 + . g899 Scaffold_5 AUGUSTUS transcript 4526275 4529237 0.51 + . g899.t1 Scaffold_5 AUGUSTUS start_codon 4526275 4526277 . + 0 transcript_id "g899.t1"; gene_id "g899"; Scaffold_5 AUGUSTUS CDS 4526275 4527408 0.54 + 0 transcript_id "g899.t1"; gene_id "g899"; Scaffold_5 AUGUSTUS CDS 4527486 4529237 0.55 + 0 transcript_id "g899.t1"; gene_id "g899"; Scaffold_5 AUGUSTUS stop_codon 4529235 4529237 . + 0 transcript_id "g899.t1"; gene_id "g899"; # protein sequence = [MKRAVFEDVQISNDRGQPSGQTELRFVRWEESPELEPQYRDLLSNCVQYAFRIIQLVEAMFAKQEGKRKEKRELKAAA # DVEMADLTQPGPSLQSTIDKAVAAQVRAALKGKKRDSSSTSTVRFDSMNTDFSAHRFFKEENIGTSREEKRSQIVRRSSSRSDSLRLPQSAASASRQK # VHQKGNARWKDRGEKTGSDEQGIFIEQGQRKEVVSLSSTPHFDWSKYDSYPDELLTMPYPDAIRTILLQVPSDILDAAAYRSSVHIGPGVFLPLEYQM # DLSVGQNYMFHSPRNSRLLIEAWKDFEYRIKWRIFFTFKDGRQDADNYDPDYEVPRERTSKVPQLPQYIEYGLNIGQVYITKMMALMPKDQEGSALSR # WLPIPNRTWIEEKSLALLNNPSDYERLTPAECKRILDKQCTQMELLCTLVDEAEPALEKQLKRFFRHKVTSPSGSHHIPTFYCIPKIHKEPVKGRPII # PCHSAIQNPAAKYVSKKLKPLIEAAPSIIHGSKDLAIKLSKFKRDPRRRLFIVTGDVVAFYPNIPLQRCFDVVDELFCEFYHIEVDDLGVPISDEWKH # KVLLLERAMMYGCSDLVTQFFDSTIKDFIYFKQKRGLAMGVACSPDLANLFGFWFESRKQIWKRPEFGFYGRYIDDCLALVYAHSADEALALCENNIN # FDGCTIEWNVSEHFQHFLDMTLYLDEKGDLQHMPFRKAMSHQERIPWISHHPLDVKRGSFIGEMSRLATLSSTQSHYLVAIKDLASLYVKRGYPSKAV # YHWLNNNKKERWDNRLSLNNQHDGLSATEDVLVLKSTFNSAWDYFSASELGKRITRYWKEWLIHAEKGDYSSKYPKYRFGEDSLKDTVGSLRSVIDSG # APAGVLTAPVTVPDIRLTGLADARWLVSRKRTRNLFDLANLWKKEVFQRMDVDTATNIAQGIPSDNYLDDVEMEDIQTKGDRPVPGDLEYIHYGHAME # S] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g899 ### # start gene g900 Scaffold_5 AUGUSTUS gene 4534331 4534937 0.24 - . g900 Scaffold_5 AUGUSTUS transcript 4534331 4534937 0.24 - . g900.t1 Scaffold_5 AUGUSTUS stop_codon 4534331 4534333 . - 0 transcript_id "g900.t1"; gene_id "g900"; Scaffold_5 AUGUSTUS CDS 4534331 4534716 0.45 - 2 transcript_id "g900.t1"; gene_id "g900"; Scaffold_5 AUGUSTUS CDS 4534934 4534937 0.4 - 0 transcript_id "g900.t1"; gene_id "g900"; Scaffold_5 AUGUSTUS start_codon 4534935 4534937 . - 0 transcript_id "g900.t1"; gene_id "g900"; # protein sequence = [MRQVQPQRTNFPVNGRGKPGKHPPPEFEFGDADDGPNVDPDADLGDDEYEEEDEDGEDYEEEDEEDEEEDPDPDPDDE # ELSPNPNLPAHPGVDDVGIGRGRGTPRRPGTTPQLGVRGGAGGREGERSWC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g900 ### # start gene g901 Scaffold_5 AUGUSTUS gene 4551417 4552370 0.15 + . g901 Scaffold_5 AUGUSTUS transcript 4551417 4552370 0.15 + . g901.t1 Scaffold_5 AUGUSTUS start_codon 4551417 4551419 . + 0 transcript_id "g901.t1"; gene_id "g901"; Scaffold_5 AUGUSTUS CDS 4551417 4551521 0.2 + 0 transcript_id "g901.t1"; gene_id "g901"; Scaffold_5 AUGUSTUS CDS 4551834 4552370 0.63 + 0 transcript_id "g901.t1"; gene_id "g901"; Scaffold_5 AUGUSTUS stop_codon 4552368 4552370 . + 0 transcript_id "g901.t1"; gene_id "g901"; # protein sequence = [MSRKGSKGSKTEVASYEVGDIVLGKVRGYPPWPGRGYKIARDPTEWAQDLAEKAAAKAEEEEARGDIDEEDELVDDGE # RPAGSKKRKAPHASASTATKKRKRNSEPGTTTKKGAGKGRKSKAAIESEDEEGAQEAQAASKSAPTASPPPLKRTKTTTSGKEENPDDGQLLCLPFTT # SSHSIASLLLTVVQPNFPRILKLQKCANGDISYKKSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g901 ### # start gene g902 Scaffold_5 AUGUSTUS gene 4561308 4562083 0.59 + . g902 Scaffold_5 AUGUSTUS transcript 4561308 4562083 0.59 + . g902.t1 Scaffold_5 AUGUSTUS start_codon 4561308 4561310 . + 0 transcript_id "g902.t1"; gene_id "g902"; Scaffold_5 AUGUSTUS CDS 4561308 4561433 0.59 + 0 transcript_id "g902.t1"; gene_id "g902"; Scaffold_5 AUGUSTUS CDS 4561505 4562083 0.98 + 0 transcript_id "g902.t1"; gene_id "g902"; Scaffold_5 AUGUSTUS stop_codon 4562081 4562083 . + 0 transcript_id "g902.t1"; gene_id "g902"; # protein sequence = [MQTSESINFLAAFGGYGFTSRQWGLALDTIFAINAVLANGTISLTPIQALKGAAPSFAITTSIEINTYAAPSYAIVME # YTWSNMDYETAGQSMYSFQNFSLSGPASPFAGELVISAGSEEGQVTFGFTGAWYGEEGSAIPTIQPWLDTMPTPTQTSLIGDGSYIDTVSQLSGTSLN # TSQATDSTDTFYAKSIMTPENDPMTLESCTAFMQYLATQGFHSNTVSHSHSFSKFYLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g902 ### # start gene g903 Scaffold_5 AUGUSTUS gene 4571414 4572448 0.31 - . g903 Scaffold_5 AUGUSTUS transcript 4571414 4572448 0.31 - . g903.t1 Scaffold_5 AUGUSTUS stop_codon 4571414 4571416 . - 0 transcript_id "g903.t1"; gene_id "g903"; Scaffold_5 AUGUSTUS CDS 4571414 4571801 0.83 - 1 transcript_id "g903.t1"; gene_id "g903"; Scaffold_5 AUGUSTUS CDS 4571925 4572448 0.32 - 0 transcript_id "g903.t1"; gene_id "g903"; Scaffold_5 AUGUSTUS start_codon 4572446 4572448 . - 0 transcript_id "g903.t1"; gene_id "g903"; # protein sequence = [MARVCTPLSLVKVMIVSYYICVYYGILQCSHLLPRVNKVRYQDQADIEDAAGILRFDYTSSIIQQQQPPLIDTTLVTP # SPNAHHSNFSTDYSIAARNQPDIQYLPQTSVNTRASHFSPGPGGEALDFRYNSSERRSSGRQSHDPMVRRVMDGDQPLTPVSPVELSESSTAFAGNRR # SRKIRCDSARPVCTNCHRRKNVCEYDAAPKRRGPDKRPGTRRRSCKKRPADGSTPPPSKRKKIETDEVTSTNQISPSTKSKTAMTEKKRSLSTDKHGQ # VPIESTYEDTPPGLRISTDNTVIKVIMAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g903 ### # start gene g904 Scaffold_5 AUGUSTUS gene 4582538 4582939 0.99 - . g904 Scaffold_5 AUGUSTUS transcript 4582538 4582939 0.99 - . g904.t1 Scaffold_5 AUGUSTUS stop_codon 4582538 4582540 . - 0 transcript_id "g904.t1"; gene_id "g904"; Scaffold_5 AUGUSTUS CDS 4582538 4582939 0.99 - 0 transcript_id "g904.t1"; gene_id "g904"; Scaffold_5 AUGUSTUS start_codon 4582937 4582939 . - 0 transcript_id "g904.t1"; gene_id "g904"; # protein sequence = [MQSFIDPYIPGVTPVSSPSIKLPPTVDGKFYTKLSNLFDEEMISSYAWIPSVFKVSPDGTDVHIDGYINGLGTREEHP # GLFRVIEKMFLLALPHFEKTVEKAEEYEPKMSPSGRYTSLYPRTSVSSSKADFTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g904 ### # start gene g905 Scaffold_5 AUGUSTUS gene 4588967 4589596 1 + . g905 Scaffold_5 AUGUSTUS transcript 4588967 4589596 1 + . g905.t1 Scaffold_5 AUGUSTUS start_codon 4588967 4588969 . + 0 transcript_id "g905.t1"; gene_id "g905"; Scaffold_5 AUGUSTUS CDS 4588967 4589596 1 + 0 transcript_id "g905.t1"; gene_id "g905"; Scaffold_5 AUGUSTUS stop_codon 4589594 4589596 . + 0 transcript_id "g905.t1"; gene_id "g905"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY # PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g905 ### # start gene g906 Scaffold_5 AUGUSTUS gene 4590559 4592883 0.29 + . g906 Scaffold_5 AUGUSTUS transcript 4590559 4592883 0.29 + . g906.t1 Scaffold_5 AUGUSTUS start_codon 4590559 4590561 . + 0 transcript_id "g906.t1"; gene_id "g906"; Scaffold_5 AUGUSTUS CDS 4590559 4591974 0.45 + 0 transcript_id "g906.t1"; gene_id "g906"; Scaffold_5 AUGUSTUS CDS 4592215 4592883 0.69 + 0 transcript_id "g906.t1"; gene_id "g906"; Scaffold_5 AUGUSTUS stop_codon 4592881 4592883 . + 0 transcript_id "g906.t1"; gene_id "g906"; # protein sequence = [MVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPP # RVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGA # PFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTAGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSW # QATEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLS # QGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREETEESSPLELLTYLQHAMTRTNPGTTIQDKVGTVRQLLDLPTR # DEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEEIANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFT # KLDGAVRAQAESLRNLHGEKVLQGWLSRFPGLELAPEAPYKSPLRREREPADVWTSNPKPAATGRFPNRSNWKEGRQRASAAWGEGESYDSENREEDE # DCCHCRDGGEWTEAVLRAGVTDTGEMDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g906 ### # start gene g907 Scaffold_5 AUGUSTUS gene 4593452 4595006 0.24 + . g907 Scaffold_5 AUGUSTUS transcript 4593452 4595006 0.24 + . g907.t1 Scaffold_5 AUGUSTUS start_codon 4593452 4593454 . + 0 transcript_id "g907.t1"; gene_id "g907"; Scaffold_5 AUGUSTUS CDS 4593452 4594514 0.48 + 0 transcript_id "g907.t1"; gene_id "g907"; Scaffold_5 AUGUSTUS CDS 4594588 4595006 0.33 + 2 transcript_id "g907.t1"; gene_id "g907"; Scaffold_5 AUGUSTUS stop_codon 4595004 4595006 . + 0 transcript_id "g907.t1"; gene_id "g907"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEKYTQELSNHLLKLQRPPEAPQPLQKFLNNSEAPLRAPRTRVKLEEVKDEEYEASQPGPH # KLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDLPL # RHRKPEHTQDSFKVWSDSQGFNKTQQLPEKAAHSGYPCGGTKIGPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPRRRKWDPSSEQGGVVKELDKE # ESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKD # GTLRLCVTIEPEQITRRIGTLYP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g907 ### # start gene g908 Scaffold_5 AUGUSTUS gene 4602160 4602975 0.58 + . g908 Scaffold_5 AUGUSTUS transcript 4602160 4602975 0.58 + . g908.t1 Scaffold_5 AUGUSTUS start_codon 4602160 4602162 . + 0 transcript_id "g908.t1"; gene_id "g908"; Scaffold_5 AUGUSTUS CDS 4602160 4602975 0.58 + 0 transcript_id "g908.t1"; gene_id "g908"; Scaffold_5 AUGUSTUS stop_codon 4602973 4602975 . + 0 transcript_id "g908.t1"; gene_id "g908"; # protein sequence = [MAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIRVANEAYARYANQRRQEAL # DWKEGDHVWLNMENVRTRRPMKKLDHKWTGPYSILSKIGTHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQNSPPPPIFIKGESEHFVESILDSK # PIKGKPEEVEYLVKWEGYDEGFNSWVGWRGMTGSLELLKQWHKRHTRKRQPKWSHWKLLEKQAEDDEEEATEPTRGTGSGEGEQGGKGGRTRPTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g908 ### # start gene g909 Scaffold_5 AUGUSTUS gene 4609936 4610271 0.36 - . g909 Scaffold_5 AUGUSTUS transcript 4609936 4610271 0.36 - . g909.t1 Scaffold_5 AUGUSTUS stop_codon 4609936 4609938 . - 0 transcript_id "g909.t1"; gene_id "g909"; Scaffold_5 AUGUSTUS CDS 4609936 4610271 0.36 - 0 transcript_id "g909.t1"; gene_id "g909"; Scaffold_5 AUGUSTUS start_codon 4610269 4610271 . - 0 transcript_id "g909.t1"; gene_id "g909"; # protein sequence = [MLNQIPIEIWLRIYRFGGFSLKALAQVSTMLQAPAYGCLRSQSQQFQDVQSLTNTGEAWADAGGRVYPLIKNGTPGHG # RSKERRQQCKLAGGAQYFEVVEVLALCHMHGEY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g909 ### # start gene g910 Scaffold_5 AUGUSTUS gene 4614313 4615131 0.65 - . g910 Scaffold_5 AUGUSTUS transcript 4614313 4615131 0.65 - . g910.t1 Scaffold_5 AUGUSTUS stop_codon 4614313 4614315 . - 0 transcript_id "g910.t1"; gene_id "g910"; Scaffold_5 AUGUSTUS CDS 4614313 4615131 0.65 - 0 transcript_id "g910.t1"; gene_id "g910"; Scaffold_5 AUGUSTUS start_codon 4615129 4615131 . - 0 transcript_id "g910.t1"; gene_id "g910"; # protein sequence = [MTAPAAFQCFVNDIFSDMLDVCVIVYLDDILIYSDTPEEYREHIKEVLWWLRKHRLYANPDKCKFNMDTIEYLGYILS # PDRLTMSKEKVQTILEWPVPRKVKEIQCFLGFANFYCHFIYNYSDIVVPMTRLTQKGAPWIWDNDCQEAFENLKTAFTSAPILAHWEPNRPIIVETDA # SDYAIAAILSIQTVDGEIHPLAFLSRTFHAAELNYNTHNKELLAIFEAFKAWHHYLEGSGDSVDIVTDHKNLKYFLLPRFSPAIRSVGQNNCTNST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g910 ### # start gene g911 Scaffold_5 AUGUSTUS gene 4615892 4616437 0.86 + . g911 Scaffold_5 AUGUSTUS transcript 4615892 4616437 0.86 + . g911.t1 Scaffold_5 AUGUSTUS start_codon 4615892 4615894 . + 0 transcript_id "g911.t1"; gene_id "g911"; Scaffold_5 AUGUSTUS CDS 4615892 4616437 0.86 + 0 transcript_id "g911.t1"; gene_id "g911"; Scaffold_5 AUGUSTUS stop_codon 4616435 4616437 . + 0 transcript_id "g911.t1"; gene_id "g911"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEAHRFMAQFQNWASEQPDLAKSQVK # LIKSTLGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDWTEMSDIDLRERFFTA # LLPEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g911 ### # start gene g912 Scaffold_5 AUGUSTUS gene 4617686 4619697 0.92 + . g912 Scaffold_5 AUGUSTUS transcript 4617686 4619697 0.92 + . g912.t1 Scaffold_5 AUGUSTUS start_codon 4617686 4617688 . + 0 transcript_id "g912.t1"; gene_id "g912"; Scaffold_5 AUGUSTUS CDS 4617686 4617702 0.99 + 0 transcript_id "g912.t1"; gene_id "g912"; Scaffold_5 AUGUSTUS CDS 4618464 4619697 0.92 + 1 transcript_id "g912.t1"; gene_id "g912"; Scaffold_5 AUGUSTUS stop_codon 4619695 4619697 . + 0 transcript_id "g912.t1"; gene_id "g912"; # protein sequence = [MRLYILKTAYFEEFGESRSLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g912 ### # start gene g913 Scaffold_5 AUGUSTUS gene 4619785 4621195 0.28 + . g913 Scaffold_5 AUGUSTUS transcript 4619785 4621195 0.28 + . g913.t1 Scaffold_5 AUGUSTUS start_codon 4619785 4619787 . + 0 transcript_id "g913.t1"; gene_id "g913"; Scaffold_5 AUGUSTUS CDS 4619785 4620392 0.33 + 0 transcript_id "g913.t1"; gene_id "g913"; Scaffold_5 AUGUSTUS CDS 4620541 4621195 0.81 + 1 transcript_id "g913.t1"; gene_id "g913"; Scaffold_5 AUGUSTUS stop_codon 4621193 4621195 . + 0 transcript_id "g913.t1"; gene_id "g913"; # protein sequence = [MVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNG # TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSDRLGNLKHTEKMMSVLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIEDVNESDDEDAIKLIPSSRPTN # QINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRP # RTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEIFGRIRRICLKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g913 ### # start gene g914 Scaffold_5 AUGUSTUS gene 4621515 4622230 0.79 + . g914 Scaffold_5 AUGUSTUS transcript 4621515 4622230 0.79 + . g914.t1 Scaffold_5 AUGUSTUS start_codon 4621515 4621517 . + 0 transcript_id "g914.t1"; gene_id "g914"; Scaffold_5 AUGUSTUS CDS 4621515 4621884 0.8 + 0 transcript_id "g914.t1"; gene_id "g914"; Scaffold_5 AUGUSTUS CDS 4621959 4622230 0.85 + 2 transcript_id "g914.t1"; gene_id "g914"; Scaffold_5 AUGUSTUS stop_codon 4622228 4622230 . + 0 transcript_id "g914.t1"; gene_id "g914"; # protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVG # TYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQV # FCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGDQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g914 ### # start gene g915 Scaffold_5 AUGUSTUS gene 4622377 4622769 0.88 + . g915 Scaffold_5 AUGUSTUS transcript 4622377 4622769 0.88 + . g915.t1 Scaffold_5 AUGUSTUS start_codon 4622377 4622379 . + 0 transcript_id "g915.t1"; gene_id "g915"; Scaffold_5 AUGUSTUS CDS 4622377 4622769 0.88 + 0 transcript_id "g915.t1"; gene_id "g915"; Scaffold_5 AUGUSTUS stop_codon 4622767 4622769 . + 0 transcript_id "g915.t1"; gene_id "g915"; # protein sequence = [MIIGINLKTLKELGREWFDMKYSKEELNHFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEER # IKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g915 ### # start gene g916 Scaffold_5 AUGUSTUS gene 4622964 4624920 0.32 + . g916 Scaffold_5 AUGUSTUS transcript 4622964 4624920 0.32 + . g916.t1 Scaffold_5 AUGUSTUS start_codon 4622964 4622966 . + 0 transcript_id "g916.t1"; gene_id "g916"; Scaffold_5 AUGUSTUS CDS 4622964 4623626 0.32 + 0 transcript_id "g916.t1"; gene_id "g916"; Scaffold_5 AUGUSTUS CDS 4623739 4624920 0.88 + 0 transcript_id "g916.t1"; gene_id "g916"; Scaffold_5 AUGUSTUS stop_codon 4624918 4624920 . + 0 transcript_id "g916.t1"; gene_id "g916"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY # ILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFDIDVPMKAVCPKNHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAA # PLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLA # LEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIM # GDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLD # ELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKVSSGRPRKVVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g916 ### # start gene g917 Scaffold_5 AUGUSTUS gene 4625199 4625873 0.51 + . g917 Scaffold_5 AUGUSTUS transcript 4625199 4625873 0.51 + . g917.t1 Scaffold_5 AUGUSTUS start_codon 4625199 4625201 . + 0 transcript_id "g917.t1"; gene_id "g917"; Scaffold_5 AUGUSTUS CDS 4625199 4625873 0.51 + 0 transcript_id "g917.t1"; gene_id "g917"; Scaffold_5 AUGUSTUS stop_codon 4625871 4625873 . + 0 transcript_id "g917.t1"; gene_id "g917"; # protein sequence = [MSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIR # ISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQA # LSKHNSFIEKVRRRVDANKVAELRRFRTKNIDIQLKDWDFKTRSIGPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g917 ### # start gene g918 Scaffold_5 AUGUSTUS gene 4625932 4626237 0.47 + . g918 Scaffold_5 AUGUSTUS transcript 4625932 4626237 0.47 + . g918.t1 Scaffold_5 AUGUSTUS start_codon 4625932 4625934 . + 0 transcript_id "g918.t1"; gene_id "g918"; Scaffold_5 AUGUSTUS CDS 4625932 4626237 0.47 + 0 transcript_id "g918.t1"; gene_id "g918"; Scaffold_5 AUGUSTUS stop_codon 4626235 4626237 . + 0 transcript_id "g918.t1"; gene_id "g918"; # protein sequence = [MVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIF # DAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g918 ### # start gene g919 Scaffold_5 AUGUSTUS gene 4628052 4631768 0.94 + . g919 Scaffold_5 AUGUSTUS transcript 4628052 4631768 0.94 + . g919.t1 Scaffold_5 AUGUSTUS start_codon 4628052 4628054 . + 0 transcript_id "g919.t1"; gene_id "g919"; Scaffold_5 AUGUSTUS CDS 4628052 4631768 0.94 + 0 transcript_id "g919.t1"; gene_id "g919"; Scaffold_5 AUGUSTUS stop_codon 4631766 4631768 . + 0 transcript_id "g919.t1"; gene_id "g919"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEESESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g919 ### # start gene g920 Scaffold_5 AUGUSTUS gene 4640455 4640883 0.99 - . g920 Scaffold_5 AUGUSTUS transcript 4640455 4640883 0.99 - . g920.t1 Scaffold_5 AUGUSTUS stop_codon 4640455 4640457 . - 0 transcript_id "g920.t1"; gene_id "g920"; Scaffold_5 AUGUSTUS CDS 4640455 4640883 0.99 - 0 transcript_id "g920.t1"; gene_id "g920"; Scaffold_5 AUGUSTUS start_codon 4640881 4640883 . - 0 transcript_id "g920.t1"; gene_id "g920"; # protein sequence = [MDSQTFLASNTVSQYHKKAKHRLREEKDRMKEEEDHITEEEDRMREEEDRMREEEDHLRNEEDRLRNEEDCLRNEEDR # LRNEEDRLRNEEDRLRNEEDRLRNEEDRLRNGEDRIERYLHTKTRTKLISEYEHVLILKHSELM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g920 ### # start gene g921 Scaffold_5 AUGUSTUS gene 4665231 4665929 0.56 - . g921 Scaffold_5 AUGUSTUS transcript 4665231 4665929 0.56 - . g921.t1 Scaffold_5 AUGUSTUS stop_codon 4665231 4665233 . - 0 transcript_id "g921.t1"; gene_id "g921"; Scaffold_5 AUGUSTUS CDS 4665231 4665340 0.96 - 2 transcript_id "g921.t1"; gene_id "g921"; Scaffold_5 AUGUSTUS CDS 4665455 4665929 0.56 - 0 transcript_id "g921.t1"; gene_id "g921"; Scaffold_5 AUGUSTUS start_codon 4665927 4665929 . - 0 transcript_id "g921.t1"; gene_id "g921"; # protein sequence = [MSTSRTTTTTIQLTASTSSCPADPPSPGAPINDEEDLIMREALARVKRVKAQKAVEETERKKQVAARHRAAQDACDQV # VQAREQEDEVAKQRRKLVEAATARSQGGTSMGDVSTSPRRPVVEITRVKGKGKGKAKTQVRPLLLPLNFLLTYFFPAHWTDKILDKIATPKRPYSTVG # EDPNNGDNGNDDDNDDED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g921 ### # start gene g922 Scaffold_5 AUGUSTUS gene 4670322 4671113 0.19 + . g922 Scaffold_5 AUGUSTUS transcript 4670322 4671113 0.19 + . g922.t1 Scaffold_5 AUGUSTUS start_codon 4670322 4670324 . + 0 transcript_id "g922.t1"; gene_id "g922"; Scaffold_5 AUGUSTUS CDS 4670322 4670414 0.25 + 0 transcript_id "g922.t1"; gene_id "g922"; Scaffold_5 AUGUSTUS CDS 4670492 4670824 0.73 + 0 transcript_id "g922.t1"; gene_id "g922"; Scaffold_5 AUGUSTUS CDS 4670877 4671113 0.7 + 0 transcript_id "g922.t1"; gene_id "g922"; Scaffold_5 AUGUSTUS stop_codon 4671111 4671113 . + 0 transcript_id "g922.t1"; gene_id "g922"; # protein sequence = [MDLQSEGVCVAVELSYVVLKDVLDEDSGRPVSSDLRSFISLDFNNRQTLYDQVEGLIAENTQLLTPLDMVMHFFNDVF # FNCPLPEASTTSMQRVASLSDHGGLWLVDSAREVVSVAVVAQISPHADDLKCGEYLDMNVYNQEINLDSLRRASARLFFNQVFISPDFSDRIANIYAA # HSSRFEKLLNVLQEATVQYLDSVKVVDGKSMCESSDYYFDDCFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g922 ### # start gene g923 Scaffold_5 AUGUSTUS gene 4671817 4672173 0.58 + . g923 Scaffold_5 AUGUSTUS transcript 4671817 4672173 0.58 + . g923.t1 Scaffold_5 AUGUSTUS start_codon 4671817 4671819 . + 0 transcript_id "g923.t1"; gene_id "g923"; Scaffold_5 AUGUSTUS CDS 4671817 4672173 0.58 + 0 transcript_id "g923.t1"; gene_id "g923"; Scaffold_5 AUGUSTUS stop_codon 4672171 4672173 . + 0 transcript_id "g923.t1"; gene_id "g923"; # protein sequence = [MRLLFHTEAIRRADDIDRLAEESRLAEEAREMARREEVLRLEQTMAKAKSLANAKKKRLEELRVKTTKDSSTTPTKRS # AVALPSGGLRKSKRLESKKGLADVEVEEGEINEDMFIELS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g923 ### # start gene g924 Scaffold_5 AUGUSTUS gene 4675262 4675909 0.87 - . g924 Scaffold_5 AUGUSTUS transcript 4675262 4675909 0.87 - . g924.t1 Scaffold_5 AUGUSTUS stop_codon 4675262 4675264 . - 0 transcript_id "g924.t1"; gene_id "g924"; Scaffold_5 AUGUSTUS CDS 4675262 4675909 0.87 - 0 transcript_id "g924.t1"; gene_id "g924"; Scaffold_5 AUGUSTUS start_codon 4675907 4675909 . - 0 transcript_id "g924.t1"; gene_id "g924"; # protein sequence = [MESNKQLQSDAWFLFENGMIIAMAQAGEIDAAHVHRQRILEQGGAPSADAYGGLILNVKDTTDDTSNAMTLFNEFQLF # HVVPNHYLYDNIISKLAKARKAETALDLFTRMKSSGIAPSSITYGAVIGACARVDDAASAEALYVEMMSVPNFKPRIPPFNTMMQLYTTTKPNRDRTV # FFYHEILKYSVHPTSCTYKVSRCHFISTELINLSSSDSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g924 ### # start gene g925 Scaffold_5 AUGUSTUS gene 4676061 4676573 0.79 - . g925 Scaffold_5 AUGUSTUS transcript 4676061 4676573 0.79 - . g925.t1 Scaffold_5 AUGUSTUS stop_codon 4676061 4676063 . - 0 transcript_id "g925.t1"; gene_id "g925"; Scaffold_5 AUGUSTUS CDS 4676061 4676573 0.79 - 0 transcript_id "g925.t1"; gene_id "g925"; Scaffold_5 AUGUSTUS start_codon 4676571 4676573 . - 0 transcript_id "g925.t1"; gene_id "g925"; # protein sequence = [MELSHKQPKALCAAGATLEMVEPHHRPNFAGLMPLLENLVQQNYNISQPLGEHDVRQHVFSALMYDRSAYQVKSLIGE # LGLESVFKILLDTTEPAAATPSPSIASSPISDNGLSEAEPDTPPTNPSISSDDLSRPTPQNLLYGLKNGGIPKQLIIDREVTGDRQSSTGES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g925 ### # start gene g926 Scaffold_5 AUGUSTUS gene 4677085 4678369 0.25 - . g926 Scaffold_5 AUGUSTUS transcript 4677085 4678369 0.25 - . g926.t1 Scaffold_5 AUGUSTUS stop_codon 4677085 4677087 . - 0 transcript_id "g926.t1"; gene_id "g926"; Scaffold_5 AUGUSTUS CDS 4677085 4677839 0.66 - 2 transcript_id "g926.t1"; gene_id "g926"; Scaffold_5 AUGUSTUS CDS 4677919 4678369 0.26 - 0 transcript_id "g926.t1"; gene_id "g926"; Scaffold_5 AUGUSTUS start_codon 4678367 4678369 . - 0 transcript_id "g926.t1"; gene_id "g926"; # protein sequence = [MLFNQALTTDHIVPDLVDSAPSIPPLARRNSTVSVTRPDTPPIDTLPPPLPVLQTLPPFVNQTDNLRNTHTSQSSNHY # RAFVDARSSGDHEVALLAVNNFSANLAAKLVHVYEFNAALVALYHTRPRGSPLADIQDLYNTMISLGVHPNVQTQESEDRQSLCRIFSLVIRSQIIRT # VPHKEHLQIQLFSSLLSCCAHRGVVDIAIMVWKIVEQHSLQPSAVLYKSMMQTFARVGKLSAAEDVSADFREQSAAGSIAWGSSGSQPSSRAAVRIWN # VMMEAYFKCGKPDMAIELLQEMLKPRQSDTRPELPSPAPSTYTTIIAGFCNSGMTVVLYGSLLLLTSNIGDYQSARTWFNTLVTQPSSPGFSFDPSPL # PSRPDALAYRVVLETLSQKTDALPAMNAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g926 ### # start gene g927 Scaffold_5 AUGUSTUS gene 4681583 4681930 0.51 - . g927 Scaffold_5 AUGUSTUS transcript 4681583 4681930 0.51 - . g927.t1 Scaffold_5 AUGUSTUS stop_codon 4681583 4681585 . - 0 transcript_id "g927.t1"; gene_id "g927"; Scaffold_5 AUGUSTUS CDS 4681583 4681930 0.51 - 0 transcript_id "g927.t1"; gene_id "g927"; Scaffold_5 AUGUSTUS start_codon 4681928 4681930 . - 0 transcript_id "g927.t1"; gene_id "g927"; # protein sequence = [MYSNPPTTTSQLLSTFEDFGLKSRIYRAPYDSNGKDASPRPRDYAGLVYNLKRGEGIAILDDSVSEFGSQETSNDEFY # NLLQGDPSVAGWRYAGAPPSVKEIRTRLRSYEGRLKQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g927 ### # start gene g928 Scaffold_5 AUGUSTUS gene 4689005 4690171 0.24 - . g928 Scaffold_5 AUGUSTUS transcript 4689005 4690171 0.24 - . g928.t1 Scaffold_5 AUGUSTUS stop_codon 4689005 4689007 . - 0 transcript_id "g928.t1"; gene_id "g928"; Scaffold_5 AUGUSTUS CDS 4689005 4689842 0.94 - 1 transcript_id "g928.t1"; gene_id "g928"; Scaffold_5 AUGUSTUS CDS 4689883 4689997 0.82 - 2 transcript_id "g928.t1"; gene_id "g928"; Scaffold_5 AUGUSTUS CDS 4690114 4690171 0.24 - 0 transcript_id "g928.t1"; gene_id "g928"; Scaffold_5 AUGUSTUS start_codon 4690169 4690171 . - 0 transcript_id "g928.t1"; gene_id "g928"; # protein sequence = [MDLSEDQYNWLMIWYKIATRTIRRNSDDCRLFAKCKVQLSILIFINNFVAITIGFYVSAEQDYESGAEQDYESSAEQD # YESSAEQDYEFVAEQDHEYIAEQESRSEEEYESSAEHEYRTSPEQIYRSIPEQVYRLGEAQVDDVSAGHVYGLHESSEEQVYGMSAGQVYHSYDSSEK # QVREISAKHVYSSYDSSTEQVCGTNTEQFYRSSADHDYEPNAVQHYRSSAERVHATNPEQNYNLNTTSEEWQPMFEYYSRGKFGPTNKGKIDPIVSVH # ASDDGGVGQIVSSVYSRDHDDSIYETLDSMSSRNSSQVSSTNNSRTLVQMPSTGCSPFRKRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g928 ### # start gene g929 Scaffold_5 AUGUSTUS gene 4693297 4694191 0.32 + . g929 Scaffold_5 AUGUSTUS transcript 4693297 4694191 0.32 + . g929.t1 Scaffold_5 AUGUSTUS start_codon 4693297 4693299 . + 0 transcript_id "g929.t1"; gene_id "g929"; Scaffold_5 AUGUSTUS CDS 4693297 4693337 0.94 + 0 transcript_id "g929.t1"; gene_id "g929"; Scaffold_5 AUGUSTUS CDS 4693479 4693520 0.32 + 1 transcript_id "g929.t1"; gene_id "g929"; Scaffold_5 AUGUSTUS CDS 4693618 4694191 0.94 + 1 transcript_id "g929.t1"; gene_id "g929"; Scaffold_5 AUGUSTUS stop_codon 4694189 4694191 . + 0 transcript_id "g929.t1"; gene_id "g929"; # protein sequence = [MVRVRFGVRGYLIKIAWPFRNQLTPFFGSGQNYDINYLHVTPTNYLHHDLQSSETRDHDTNATRKITQNSSTLHSLLP # YLSSSSSSSYHIPLGSVLGGDPYPTSTGLYSNVNGTELFLTLDTDSHCLNQINQSYSQWPPHWDSTFYSASSFSSTENFLAASIPNLEINLFDSDSSI # SNQTFVPVLPPISILEDLRQFNADNAPDILRRLSNDKNDKNE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g929 ### # start gene g930 Scaffold_5 AUGUSTUS gene 4697363 4697956 0.92 + . g930 Scaffold_5 AUGUSTUS transcript 4697363 4697956 0.92 + . g930.t1 Scaffold_5 AUGUSTUS start_codon 4697363 4697365 . + 0 transcript_id "g930.t1"; gene_id "g930"; Scaffold_5 AUGUSTUS CDS 4697363 4697956 0.92 + 0 transcript_id "g930.t1"; gene_id "g930"; Scaffold_5 AUGUSTUS stop_codon 4697954 4697956 . + 0 transcript_id "g930.t1"; gene_id "g930"; # protein sequence = [MAQFQNWAQNNLISPKASKTIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEI # KNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPA # DPHAMDIDATHTVMGILGKHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g930 ### # start gene g931 Scaffold_5 AUGUSTUS gene 4709078 4710723 0.12 + . g931 Scaffold_5 AUGUSTUS transcript 4709078 4710723 0.12 + . g931.t1 Scaffold_5 AUGUSTUS start_codon 4709078 4709080 . + 0 transcript_id "g931.t1"; gene_id "g931"; Scaffold_5 AUGUSTUS CDS 4709078 4709568 0.56 + 0 transcript_id "g931.t1"; gene_id "g931"; Scaffold_5 AUGUSTUS CDS 4709638 4710262 0.27 + 1 transcript_id "g931.t1"; gene_id "g931"; Scaffold_5 AUGUSTUS CDS 4710376 4710723 0.6 + 0 transcript_id "g931.t1"; gene_id "g931"; Scaffold_5 AUGUSTUS stop_codon 4710721 4710723 . + 0 transcript_id "g931.t1"; gene_id "g931"; # protein sequence = [MKPFRVGDLACMHGAKDTGSTNKCKKKLVPFVLTAGIGPVRSKKLKHTDKPAPPSSMGPKVHHRTTSSSRLGPNSRTT # SATRLGANLQLTQKDPQFNTNKQPQPAQSKKNALGTHDVGCCVSRKALCTQCPLESWKNFHFSKSKQFSPDSLERPTSTFSTSPKTPSDEADDDEWVS # SESGAATPNYVEGSDSGAESELVTPAEMAKLLERPTSTKSNATKEMVEEQDRGRADGGVTPIPRVDIARPPQTLDPQLPRGKLPAEPELDSLRPAPPP # PPAASQNYDRRASLPPMVTMINSVEPSPIDTPAVAPRPSHKRRPSTRPPSTHSISSRHEPLRPHPLIRGQSFGFPNNKLAPLAMTSDVASAQLSSTPP # LPSRRTSISSARSVATLPAHSLREPPRQGKDRNRTISTISISSSSAAISSLAHIPATRPPSPQRLSVVFPPPSHPQFHTAGVHSLLPPPYLTNHLTTL # AHRTPLPRAMTVLDMPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g931 ### # start gene g932 Scaffold_5 AUGUSTUS gene 4714786 4715070 0.74 - . g932 Scaffold_5 AUGUSTUS transcript 4714786 4715070 0.74 - . g932.t1 Scaffold_5 AUGUSTUS stop_codon 4714786 4714788 . - 0 transcript_id "g932.t1"; gene_id "g932"; Scaffold_5 AUGUSTUS CDS 4714786 4715070 0.74 - 0 transcript_id "g932.t1"; gene_id "g932"; Scaffold_5 AUGUSTUS start_codon 4715068 4715070 . - 0 transcript_id "g932.t1"; gene_id "g932"; # protein sequence = [MVVVDKRQDKTAYAPGANRAEVQAQLEQTRFSSGGNLESVALPVPAQVEVDLTSKRIHKTDGDHRGVWCITETPGPDA # LLETLLARVWGVQGCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g932 ### # start gene g933 Scaffold_5 AUGUSTUS gene 4720428 4721701 0.69 + . g933 Scaffold_5 AUGUSTUS transcript 4720428 4721701 0.69 + . g933.t1 Scaffold_5 AUGUSTUS start_codon 4720428 4720430 . + 0 transcript_id "g933.t1"; gene_id "g933"; Scaffold_5 AUGUSTUS CDS 4720428 4720483 0.81 + 0 transcript_id "g933.t1"; gene_id "g933"; Scaffold_5 AUGUSTUS CDS 4720569 4720729 0.71 + 1 transcript_id "g933.t1"; gene_id "g933"; Scaffold_5 AUGUSTUS CDS 4720866 4721701 0.78 + 2 transcript_id "g933.t1"; gene_id "g933"; Scaffold_5 AUGUSTUS stop_codon 4721699 4721701 . + 0 transcript_id "g933.t1"; gene_id "g933"; # protein sequence = [MPRVHPKSNGEEEVESVSAPLERDIYVLLANDALQLVVTSRATPECIQERRTTSVLFPAATRDVRDRTTYNNNNNASP # PASQQDYSLASEQPPLSPPPLVPVSIPAPSLSPPPLQSVRATGTDVRYSPPPDSPPLAHATMTVAYHAHQRASPASSATSSPESTSFPSTNMISPPPL # TPVHSVHPSTSTQSNTYGFRTNGAYQDHSGTSTAYSYGQSESPTSENYQATSEGYTSNQYPLPRIETLAPKDELSASPSVAISNTSLTGVNSRHSISH # ISHSHPAYPRMMSSSMNSRPSTGPPSPASSHSTSHSVVSHSGPPTPNGYTTYDPESGQSSPNCLASSVESSWRPDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g933 ### # start gene g934 Scaffold_5 AUGUSTUS gene 4723269 4723976 0.84 - . g934 Scaffold_5 AUGUSTUS transcript 4723269 4723976 0.84 - . g934.t1 Scaffold_5 AUGUSTUS stop_codon 4723269 4723271 . - 0 transcript_id "g934.t1"; gene_id "g934"; Scaffold_5 AUGUSTUS CDS 4723269 4723976 0.84 - 0 transcript_id "g934.t1"; gene_id "g934"; Scaffold_5 AUGUSTUS start_codon 4723974 4723976 . - 0 transcript_id "g934.t1"; gene_id "g934"; # protein sequence = [MFSLPPSQRPTSFSFSSPRPTSSHSKAPSGSDQRLASEQQKEVVSTFESSSFPVVSFSRQPSARLSNQRSNVPIRKSK # KDDAKIGDNPLPQLLSELNKLRKESSLVHEKQQAILDELRRMGTEDRILEPMFAVIGIRNEADHGINVDPEGMLFVLLKAPGLNQLSSAAKIRLRAIE # QEITIERKRRNKAMDELRTIEWEGRDPFVVPALLHAFISLSKLTTDTNQKLKNDYVQAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g934 ### # start gene g935 Scaffold_5 AUGUSTUS gene 4733158 4734161 0.77 - . g935 Scaffold_5 AUGUSTUS transcript 4733158 4734161 0.77 - . g935.t1 Scaffold_5 AUGUSTUS stop_codon 4733158 4733160 . - 0 transcript_id "g935.t1"; gene_id "g935"; Scaffold_5 AUGUSTUS CDS 4733158 4733286 0.83 - 0 transcript_id "g935.t1"; gene_id "g935"; Scaffold_5 AUGUSTUS CDS 4733340 4733665 0.84 - 2 transcript_id "g935.t1"; gene_id "g935"; Scaffold_5 AUGUSTUS CDS 4733711 4734161 0.89 - 0 transcript_id "g935.t1"; gene_id "g935"; Scaffold_5 AUGUSTUS start_codon 4734159 4734161 . - 0 transcript_id "g935.t1"; gene_id "g935"; # protein sequence = [MASTPPPQHEFEIPPMPHLPTPSGSRHRGSFGSSFSFGPTAFIDSYLEANSSTYSNNHSIALDPNRSILHASPLRSSP # RRTRKPKDSINRPHPLANDTTGIFQHSDDDADDEEEYEWGMVDRMRLWRHDALMQHLYETAAFWGDKIVSWTNDPNDAFWLAQTYFMQHQYSRAERLL # TRPFPTLAPKHPSTPLNLTNGDVSTAVAKGKGKERDTLPLAIPIPRLPLDPAGMFEGTQDPHEIISRLVDMSVACRYLAAQCQVRQGNWSDATEMLGE # ANPFRDLEQDRAAVPDIDGGIKVTLVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g935 ### # start gene g936 Scaffold_5 AUGUSTUS gene 4741795 4742407 0.75 + . g936 Scaffold_5 AUGUSTUS transcript 4741795 4742407 0.75 + . g936.t1 Scaffold_5 AUGUSTUS start_codon 4741795 4741797 . + 0 transcript_id "g936.t1"; gene_id "g936"; Scaffold_5 AUGUSTUS CDS 4741795 4741822 0.91 + 0 transcript_id "g936.t1"; gene_id "g936"; Scaffold_5 AUGUSTUS CDS 4741974 4742407 0.76 + 2 transcript_id "g936.t1"; gene_id "g936"; Scaffold_5 AUGUSTUS stop_codon 4742405 4742407 . + 0 transcript_id "g936.t1"; gene_id "g936"; # protein sequence = [MVRPCEGIGSEDEISDGGQDTTEAGPSSVEGSAPTQVTDVDMEDGYDSDDSEEENVDGKLIKIINPTQPEQRAIFQNI # SNIRALRLFNDVDIRPAPPVPSGHKRFSPPHPLVDYAGWQEIYTGVTLWVYDSTSNIDQSARLISAEGDIYGTAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g936 ### # start gene g937 Scaffold_5 AUGUSTUS gene 4746494 4747033 0.3 - . g937 Scaffold_5 AUGUSTUS transcript 4746494 4747033 0.3 - . g937.t1 Scaffold_5 AUGUSTUS stop_codon 4746494 4746496 . - 0 transcript_id "g937.t1"; gene_id "g937"; Scaffold_5 AUGUSTUS CDS 4746494 4747033 0.3 - 0 transcript_id "g937.t1"; gene_id "g937"; Scaffold_5 AUGUSTUS start_codon 4747031 4747033 . - 0 transcript_id "g937.t1"; gene_id "g937"; # protein sequence = [MTDYDPIRTCCSEADICKRCWGFIAIAVEVLDTAIRDQFGYTKLLWVYSGRRGIHLWISDKEAFELNDDQRKAMVEYL # TVIKNGKEPGKRVNVRFGMKDLPPTLKYVVASAVVIVRLKLLHSERPARLLIKLLMILSFKTKTVLALRKDTKLFSPLYLMPSWLRDFVKNGHKSRIV # RRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g937 ### # start gene g938 Scaffold_5 AUGUSTUS gene 4749571 4750407 0.65 - . g938 Scaffold_5 AUGUSTUS transcript 4749571 4750407 0.65 - . g938.t1 Scaffold_5 AUGUSTUS stop_codon 4749571 4749573 . - 0 transcript_id "g938.t1"; gene_id "g938"; Scaffold_5 AUGUSTUS CDS 4749571 4750407 0.65 - 0 transcript_id "g938.t1"; gene_id "g938"; Scaffold_5 AUGUSTUS start_codon 4750405 4750407 . - 0 transcript_id "g938.t1"; gene_id "g938"; # protein sequence = [MPVETKMGVFDPFQHYPDIPASSLPSDIPPEYRKKILSILPELPGVKSVRNLSNAHRDANGNIHIDAPVVNRPWEWTE # NLGDYVGDYSQGRDVRNSGSLNLLNFGARLTGEGRIPEAYQKDARIEENLRTFEDGFSSESIFQRDWRETRVRPSVEELLGAEGLRTRLDENLPMSFV # AHRRKGSPAMSNSGASRSSGMSMRHSPGHGGLNRRSSSTISDIIDVDAIPSIIGSSSRGKRKAAVESDDEVVFVEGPIAAPTKGGKKAKPTKTQTKKS # TKRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g938 ### # start gene g939 Scaffold_5 AUGUSTUS gene 4756427 4756816 0.47 - . g939 Scaffold_5 AUGUSTUS transcript 4756427 4756816 0.47 - . g939.t1 Scaffold_5 AUGUSTUS stop_codon 4756427 4756429 . - 0 transcript_id "g939.t1"; gene_id "g939"; Scaffold_5 AUGUSTUS CDS 4756427 4756816 0.47 - 0 transcript_id "g939.t1"; gene_id "g939"; Scaffold_5 AUGUSTUS start_codon 4756814 4756816 . - 0 transcript_id "g939.t1"; gene_id "g939"; # protein sequence = [MASSTGTGIDRPTSAPPPAEDSRIGNLKPSPLLTSMSAANSTATSPALPIRSNFQSSSKLKGMQLGASKVPSSIAAAL # AEQLAEEVAAEDGVDVSNPWGDDDLMDVNADEGDWSKYQQERISFANNEFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g939 ### # start gene g940 Scaffold_5 AUGUSTUS gene 4763920 4765064 0.59 - . g940 Scaffold_5 AUGUSTUS transcript 4763920 4765064 0.59 - . g940.t1 Scaffold_5 AUGUSTUS stop_codon 4763920 4763922 . - 0 transcript_id "g940.t1"; gene_id "g940"; Scaffold_5 AUGUSTUS CDS 4763920 4764895 0.96 - 1 transcript_id "g940.t1"; gene_id "g940"; Scaffold_5 AUGUSTUS CDS 4764991 4765064 0.59 - 0 transcript_id "g940.t1"; gene_id "g940"; Scaffold_5 AUGUSTUS start_codon 4765062 4765064 . - 0 transcript_id "g940.t1"; gene_id "g940"; # protein sequence = [MFQNTELINRVLTLQFIQDPLTHALRPHGSSRWELPILFNFVLWGDVVKGCYRRSAGGAVSVEEDEEALEKMYKSDSL # AEDTSSHDRDPGRANNDNAQGKKRKAKRVVSPRKKREREGCIESSTSSLGEEFDFDEVEEERYSDDPEVVGTSRRRMATSSPTKFKIGNAHLTIPTPV # TPSASTRARKPQTTLFSSSPTPRKQVRAIRSPKDYQESSEGELFDFDDVERLSSTDDDEAPKRKVGRPKKVLNVDGAVSGPSSRPTGATKRRGRPRKD # SLNVALSSTSSKTPTKKLSNSSKRMFMSRPLGKLAAAPLEPPRSNVLPLYLSDSDDDVLVHTMSSLSVSSPSSSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g940 ### # start gene g941 Scaffold_5 AUGUSTUS gene 4775676 4776698 0.29 + . g941 Scaffold_5 AUGUSTUS transcript 4775676 4776698 0.29 + . g941.t1 Scaffold_5 AUGUSTUS start_codon 4775676 4775678 . + 0 transcript_id "g941.t1"; gene_id "g941"; Scaffold_5 AUGUSTUS CDS 4775676 4775748 0.57 + 0 transcript_id "g941.t1"; gene_id "g941"; Scaffold_5 AUGUSTUS CDS 4775952 4776382 0.35 + 2 transcript_id "g941.t1"; gene_id "g941"; Scaffold_5 AUGUSTUS CDS 4776450 4776698 1 + 0 transcript_id "g941.t1"; gene_id "g941"; Scaffold_5 AUGUSTUS stop_codon 4776696 4776698 . + 0 transcript_id "g941.t1"; gene_id "g941"; # protein sequence = [MAGPEIKRKTNLQIEADEDLDDLDAPISIPGTGALQKEVGITERSEDTDDADYIPEGPEDEAALSDAFTKELVKNMQD # LMRELADEKIPKSNENEETEEGEAERLMKAAWEAMLIEGMNGITEPPPLPSTSKLTAASTSASGGAAASGAGSDFQSKIKQTMEKLKESENSSSSTST # GKPESLQGLLNSLKDLGLDDLGADGDGVEDEAELASFLESMMGQLMSKDVLYEPVKELNEKAGICYLLLLIHIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g941 ### # start gene g942 Scaffold_5 AUGUSTUS gene 4779085 4779483 0.2 + . g942 Scaffold_5 AUGUSTUS transcript 4779085 4779483 0.2 + . g942.t1 Scaffold_5 AUGUSTUS start_codon 4779085 4779087 . + 0 transcript_id "g942.t1"; gene_id "g942"; Scaffold_5 AUGUSTUS CDS 4779085 4779483 0.2 + 0 transcript_id "g942.t1"; gene_id "g942"; Scaffold_5 AUGUSTUS stop_codon 4779481 4779483 . + 0 transcript_id "g942.t1"; gene_id "g942"; # protein sequence = [MPSPPMLSFTPIVSISISSKIRFPDKSLFIVIGRELEFFSQAGFDMDKIYLKRNAPVAQLYEDAIRNEGAILSSSGAL # INFSGKKTGRSPKDKRIVYEDTSKDDIWWGSVNIKLDERMSCDPIGLSCLCANF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g942 ### # start gene g943 Scaffold_5 AUGUSTUS gene 4791565 4792335 0.84 + . g943 Scaffold_5 AUGUSTUS transcript 4791565 4792335 0.84 + . g943.t1 Scaffold_5 AUGUSTUS start_codon 4791565 4791567 . + 0 transcript_id "g943.t1"; gene_id "g943"; Scaffold_5 AUGUSTUS CDS 4791565 4792335 0.84 + 0 transcript_id "g943.t1"; gene_id "g943"; Scaffold_5 AUGUSTUS stop_codon 4792333 4792335 . + 0 transcript_id "g943.t1"; gene_id "g943"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPAYPLILPLLTPTLWTLMQPTPVMGILGKHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g943 ### # start gene g944 Scaffold_5 AUGUSTUS gene 4793557 4796463 0.9 + . g944 Scaffold_5 AUGUSTUS transcript 4793557 4796463 0.9 + . g944.t1 Scaffold_5 AUGUSTUS start_codon 4793557 4793559 . + 0 transcript_id "g944.t1"; gene_id "g944"; Scaffold_5 AUGUSTUS CDS 4793557 4796463 0.9 + 0 transcript_id "g944.t1"; gene_id "g944"; Scaffold_5 AUGUSTUS stop_codon 4796461 4796463 . + 0 transcript_id "g944.t1"; gene_id "g944"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGF # LGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ # PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDN # RQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPG # LHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEG # VADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSAL # GMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYR # ILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSR # APKMFGLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g944 ### # start gene g945 Scaffold_5 AUGUSTUS gene 4815707 4816237 0.58 + . g945 Scaffold_5 AUGUSTUS transcript 4815707 4816237 0.58 + . g945.t1 Scaffold_5 AUGUSTUS start_codon 4815707 4815709 . + 0 transcript_id "g945.t1"; gene_id "g945"; Scaffold_5 AUGUSTUS CDS 4815707 4815727 0.58 + 0 transcript_id "g945.t1"; gene_id "g945"; Scaffold_5 AUGUSTUS CDS 4815875 4816237 0.82 + 0 transcript_id "g945.t1"; gene_id "g945"; Scaffold_5 AUGUSTUS stop_codon 4816235 4816237 . + 0 transcript_id "g945.t1"; gene_id "g945"; # protein sequence = [MSDGAPAFESPAVENDVAGAKVKGPQTEQTQEVVVKPSEETSWASMVATPQDLMFKKGGDVPPNSAAAAAPSDPAAPT # SVPTAPSGLVGPAAGMAAGLAAGMMNPFNMAMLNNIGFSTERRSLPFNW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g945 ### # start gene g946 Scaffold_5 AUGUSTUS gene 4822266 4822952 0.69 - . g946 Scaffold_5 AUGUSTUS transcript 4822266 4822952 0.69 - . g946.t1 Scaffold_5 AUGUSTUS stop_codon 4822266 4822268 . - 0 transcript_id "g946.t1"; gene_id "g946"; Scaffold_5 AUGUSTUS CDS 4822266 4822952 0.69 - 0 transcript_id "g946.t1"; gene_id "g946"; Scaffold_5 AUGUSTUS start_codon 4822950 4822952 . - 0 transcript_id "g946.t1"; gene_id "g946"; # protein sequence = [MSATELSAFDDMFTMIFDAVSEQKSSEMRSSGTQGKTSDPGGLNDLFGKLRKHSKRMRWTTEEEELLDRKKEAMDLCD # TDQELLEWAIREVFDESQKFEAASREALQKVTSSPNKTSAAENLPILQSPIYPHIIAHLMRTFRDKYHDPHLALSIFDHARNLSIPSYVFGCTTPAYN # ELIETKWTHFHDLKGVHDALQEMVINGVDVNDNTRKIVDGVRRQVGERNLLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g946 ### # start gene g947 Scaffold_5 AUGUSTUS gene 4840563 4841232 0.54 + . g947 Scaffold_5 AUGUSTUS transcript 4840563 4841232 0.54 + . g947.t1 Scaffold_5 AUGUSTUS start_codon 4840563 4840565 . + 0 transcript_id "g947.t1"; gene_id "g947"; Scaffold_5 AUGUSTUS CDS 4840563 4840611 0.57 + 0 transcript_id "g947.t1"; gene_id "g947"; Scaffold_5 AUGUSTUS CDS 4840718 4841232 0.89 + 2 transcript_id "g947.t1"; gene_id "g947"; Scaffold_5 AUGUSTUS stop_codon 4841230 4841232 . + 0 transcript_id "g947.t1"; gene_id "g947"; # protein sequence = [MTQMAGSLQSQTLVSFHSESLASLQPLHALIFLFKWVSTSSDSMSGNYDPEFPGFFAHQVVNNACATLAVLNALGNIP # ALKSGSQLTQLLEFTNGMDPQTRGLVITSSDWLREAHNSLSPPSAISLDGLGLPKQTEDAYHFVVYLPFMGFLYELDGLKPHAVSHGSYNETGEGWLS # RARSVVSRFPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g947 ### # start gene g948 Scaffold_5 AUGUSTUS gene 4847918 4849376 0.4 + . g948 Scaffold_5 AUGUSTUS transcript 4847918 4849376 0.4 + . g948.t1 Scaffold_5 AUGUSTUS start_codon 4847918 4847920 . + 0 transcript_id "g948.t1"; gene_id "g948"; Scaffold_5 AUGUSTUS CDS 4847918 4848107 0.53 + 0 transcript_id "g948.t1"; gene_id "g948"; Scaffold_5 AUGUSTUS CDS 4848170 4848417 0.77 + 2 transcript_id "g948.t1"; gene_id "g948"; Scaffold_5 AUGUSTUS CDS 4848729 4849376 0.7 + 0 transcript_id "g948.t1"; gene_id "g948"; Scaffold_5 AUGUSTUS stop_codon 4849374 4849376 . + 0 transcript_id "g948.t1"; gene_id "g948"; # protein sequence = [MERLEDLAVSQPERVKIIKKARVTKLIKDENAQVIGVEYTFNGKTETAYGPVILATGGMLLTLHHCTGDGHKMAMTAG # AKGIDMEKVQVHPTGLVDPNDPEAKVKFLAAEALRGVGGLLLDNTGARFVDELQHRDYVTGKMWENGKFFSGEWTYDDTFHVSMMTPVLHYTMGGLEI # DDASRVIDTNGKPIPGLFACGEVAGGVHGANRLGGSSLLGCVVFGRVAGDSAAAYTLQATSAAIAKAGGRLGAIAGQVSGAPSASSSSSSAPAPEAKG # EQSSTGGKVYTMDEVAKHKDKKDVWVVVNGEVLDVTEVRLVILFDRFPANINVGSSFLTIPEVRKRSCFMLGEMLRKSSTCYTIPRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g948 ### # start gene g949 Scaffold_5 AUGUSTUS gene 4849734 4850458 0.7 + . g949 Scaffold_5 AUGUSTUS transcript 4849734 4850458 0.7 + . g949.t1 Scaffold_5 AUGUSTUS start_codon 4849734 4849736 . + 0 transcript_id "g949.t1"; gene_id "g949"; Scaffold_5 AUGUSTUS CDS 4849734 4849757 0.7 + 0 transcript_id "g949.t1"; gene_id "g949"; Scaffold_5 AUGUSTUS CDS 4849850 4850458 0.99 + 0 transcript_id "g949.t1"; gene_id "g949"; Scaffold_5 AUGUSTUS stop_codon 4850456 4850458 . + 0 transcript_id "g949.t1"; gene_id "g949"; # protein sequence = [MFRSQAIRAKQIRTYTTEVPKSKSNNGLLIATVVAAVGAGGYWYYSNNPDEAARLEAKAKKDEEVAVQKAREAGAAGK # ARVDDAYKLGQLKIGEAKASADKTVGQAETRAKQAANDAQAKFDEYKSSASRSLSNAKDSTENLYNEAKASVDQKYGDAKGSVEEKKEQAKAGWFSWL # GWGKALQRILRRQVPRKSQMQQEMYRRRQASVHD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g949 ### # start gene g950 Scaffold_5 AUGUSTUS gene 4853225 4854190 0.33 + . g950 Scaffold_5 AUGUSTUS transcript 4853225 4854190 0.33 + . g950.t1 Scaffold_5 AUGUSTUS start_codon 4853225 4853227 . + 0 transcript_id "g950.t1"; gene_id "g950"; Scaffold_5 AUGUSTUS CDS 4853225 4853353 0.45 + 0 transcript_id "g950.t1"; gene_id "g950"; Scaffold_5 AUGUSTUS CDS 4853414 4854190 0.64 + 0 transcript_id "g950.t1"; gene_id "g950"; Scaffold_5 AUGUSTUS stop_codon 4854188 4854190 . + 0 transcript_id "g950.t1"; gene_id "g950"; # protein sequence = [MPKPAIQPEASSDSEPDIPIMKMVKKTRRVEQESSSPDSSEAEPPLVKGKRKRPNVKAVGLTCFVVILRAYIQVEQRS # TAEETEPPRYMNPGPSNLSLQTETKLVNKNKPSLPRLRTARPASGPSNTTHSTSLPTLAKLKTPTPSLPKPTTEGSASAGGSAFMKTPTQGALKTDAL # PEKDIGGSRPHLPRKSTSTLNGISFKKNRGGPMKESQTIIADRASPKNVPTYSHRAEPSSPAVVSATPTPRHFSRPKMASEDQVPSSQKTLNNPTNPQ # VEPFVPLASTSEAQPSDDWGWILLPLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g950 ### # start gene g951 Scaffold_5 AUGUSTUS gene 4854259 4854853 0.45 + . g951 Scaffold_5 AUGUSTUS transcript 4854259 4854853 0.45 + . g951.t1 Scaffold_5 AUGUSTUS start_codon 4854259 4854261 . + 0 transcript_id "g951.t1"; gene_id "g951"; Scaffold_5 AUGUSTUS CDS 4854259 4854430 0.45 + 0 transcript_id "g951.t1"; gene_id "g951"; Scaffold_5 AUGUSTUS CDS 4854540 4854853 0.54 + 2 transcript_id "g951.t1"; gene_id "g951"; Scaffold_5 AUGUSTUS stop_codon 4854851 4854853 . + 0 transcript_id "g951.t1"; gene_id "g951"; # protein sequence = [MVIFRRSSMLNDEAESFLSSVMPMTKYVSSKIYLSFHEHDEFSGLLVWNMSCQNPSHDEIDEAQTMSMESLLLASDPS # AGQISLTQGVIPLKVSMSYNDSKLVMKSRSFYRFEDLNAILAACSPVKEWGWLCAAKEEEARKFRQIADLLSHKKWVMILLLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g951 ### # start gene g952 Scaffold_5 AUGUSTUS gene 4855219 4856493 0.45 + . g952 Scaffold_5 AUGUSTUS transcript 4855219 4856493 0.45 + . g952.t1 Scaffold_5 AUGUSTUS start_codon 4855219 4855221 . + 0 transcript_id "g952.t1"; gene_id "g952"; Scaffold_5 AUGUSTUS CDS 4855219 4855546 0.45 + 0 transcript_id "g952.t1"; gene_id "g952"; Scaffold_5 AUGUSTUS CDS 4855619 4856493 1 + 2 transcript_id "g952.t1"; gene_id "g952"; Scaffold_5 AUGUSTUS stop_codon 4856491 4856493 . + 0 transcript_id "g952.t1"; gene_id "g952"; # protein sequence = [MLELPELLHSYLVSGGERPFALWPPVDSEVFGLSPVSEIEREMLSTLLNEYPATVNQGTVGTEWDSSLRVIFAHVNSL # VPSSGWRDIRDIPGLSEYRMMNDVRFFVYGSMSIATINAEGLGGLVTFTPNALLSDPLGVHERILQIEEHDFWACYILPAVIGMAVSIAYRDREHVIQ # KRIACKANKHVPHCTGSQSIDVDIDIGIDEPISCTCDGLGYEWLLDAIDEELISIVGAPPLQTHLGGQGAVTRRGASRDNRLRNTEDWNLLSENHSTS # SSFLTYLDTPSSSLPLSFIAQDQLGCPPSSIPVQYDDSFVPWIFQLFDSDVRDRSETLAFCVREFMQLCGNLPQEEWEDAIKREIIEHLGRLQISRGF # REELRRFVIVTGSEDKGLQTDQSGVSIE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g952 ### # start gene g953 Scaffold_5 AUGUSTUS gene 4858741 4859639 0.42 + . g953 Scaffold_5 AUGUSTUS transcript 4858741 4859639 0.42 + . g953.t1 Scaffold_5 AUGUSTUS start_codon 4858741 4858743 . + 0 transcript_id "g953.t1"; gene_id "g953"; Scaffold_5 AUGUSTUS CDS 4858741 4858759 0.43 + 0 transcript_id "g953.t1"; gene_id "g953"; Scaffold_5 AUGUSTUS CDS 4859263 4859639 0.81 + 2 transcript_id "g953.t1"; gene_id "g953"; Scaffold_5 AUGUSTUS stop_codon 4859637 4859639 . + 0 transcript_id "g953.t1"; gene_id "g953"; # protein sequence = [MFVRDTSLAYYDTLLFAYADERAVLKAIQLAVILPHASALTLFFLLTNTMTRRSVTSEDEDPLTLAIAPPPNETPTQR # DQRLAEEKKAKEISDSIDEEINVQRLAEKKENPVKVLLLGMLSDVISYLSGLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g953 ### # start gene g954 Scaffold_5 AUGUSTUS gene 4859843 4860388 0.67 + . g954 Scaffold_5 AUGUSTUS transcript 4859843 4860388 0.67 + . g954.t1 Scaffold_5 AUGUSTUS start_codon 4859843 4859845 . + 0 transcript_id "g954.t1"; gene_id "g954"; Scaffold_5 AUGUSTUS CDS 4859843 4860388 0.67 + 0 transcript_id "g954.t1"; gene_id "g954"; Scaffold_5 AUGUSTUS stop_codon 4860386 4860388 . + 0 transcript_id "g954.t1"; gene_id "g954"; # protein sequence = [MRAVIQLNVARSIRIIIDAMTRAQQASSPNSPLAPDSLDDISILDSENELPTLTAEHLKLKMRLSPLLQVEESLWRRL # SPSSAFESETSHLASITNVPHSTRPKEVYVQSSMAWKSTFSRLLSTSTRSSVDSDPGIDFDDPKDPGVILNNCAEDMIKLWHDPTIRNLLNVLRIRLE # DTPGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g954 ### # start gene g955 Scaffold_5 AUGUSTUS gene 4866459 4867133 0.95 + . g955 Scaffold_5 AUGUSTUS transcript 4866459 4867133 0.95 + . g955.t1 Scaffold_5 AUGUSTUS start_codon 4866459 4866461 . + 0 transcript_id "g955.t1"; gene_id "g955"; Scaffold_5 AUGUSTUS CDS 4866459 4867133 0.95 + 0 transcript_id "g955.t1"; gene_id "g955"; Scaffold_5 AUGUSTUS stop_codon 4867131 4867133 . + 0 transcript_id "g955.t1"; gene_id "g955"; # protein sequence = [MGTTAPARPGFMTPAVPSSPQMRAKSPFLSPAIPNSIPTLSAPVHHPSPLGDNAISNSSYFSAARDIPGFYVVIPAGG # AGTRLWPLSREGHPKFLLDLTLKGRSLIQATWDRLLPLTSASRTTIVAGPSHVSSIREQLPDLLSENLFCEPTAKDSMAAIGLAAAILAHRDPDAVIG # SFAADHMISGDDAFLAAVAEAVEVARNDYLVTIGIAPSHPSTGFGYIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g955 ### # start gene g956 Scaffold_5 AUGUSTUS gene 4870036 4870869 0.97 - . g956 Scaffold_5 AUGUSTUS transcript 4870036 4870869 0.97 - . g956.t1 Scaffold_5 AUGUSTUS stop_codon 4870036 4870038 . - 0 transcript_id "g956.t1"; gene_id "g956"; Scaffold_5 AUGUSTUS CDS 4870036 4870869 0.97 - 0 transcript_id "g956.t1"; gene_id "g956"; Scaffold_5 AUGUSTUS start_codon 4870867 4870869 . - 0 transcript_id "g956.t1"; gene_id "g956"; # protein sequence = [MESRKIQEVKDKREREEDTSREAEEEKKKKRRLAEPLVPVVKNPLVPFQASFHDALYEIAHVSPIPLPFFSNDALQFI # SARAHSLPHKKFKSNDPRKSGYFIDIEALKKMLRIKYADDDQLEGLDYILFVECVNNYMRFETSRDPAGPAGTRAQFIIQHFSFFLNKRHTAKLYAFW # KPAELRIRNEQYLEFTGFIQSVYDSEWTKVESQVEFEDTMAKARGGSLWYSYPFQSNTTSDISPPYQGSPIGDMPPLSENTITPDHTSVTNTQVVNQD # IAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g956 ### # start gene g957 Scaffold_5 AUGUSTUS gene 4871989 4872300 0.79 + . g957 Scaffold_5 AUGUSTUS transcript 4871989 4872300 0.79 + . g957.t1 Scaffold_5 AUGUSTUS start_codon 4871989 4871991 . + 0 transcript_id "g957.t1"; gene_id "g957"; Scaffold_5 AUGUSTUS CDS 4871989 4872300 0.79 + 0 transcript_id "g957.t1"; gene_id "g957"; Scaffold_5 AUGUSTUS stop_codon 4872298 4872300 . + 0 transcript_id "g957.t1"; gene_id "g957"; # protein sequence = [MRKTRLYPHSSPAQKISSSENFQLYCDEKFQTRTGKEELESQLCGMSEEDISALVEQIGQRKVEKLARIEKFKNIYRR # RPAEEEEDSDEDTDKEDELKRCTVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g957 ### # start gene g958 Scaffold_5 AUGUSTUS gene 4877222 4878610 0.96 - . g958 Scaffold_5 AUGUSTUS transcript 4877222 4878610 0.96 - . g958.t1 Scaffold_5 AUGUSTUS stop_codon 4877222 4877224 . - 0 transcript_id "g958.t1"; gene_id "g958"; Scaffold_5 AUGUSTUS CDS 4877222 4878610 0.96 - 0 transcript_id "g958.t1"; gene_id "g958"; Scaffold_5 AUGUSTUS start_codon 4878608 4878610 . - 0 transcript_id "g958.t1"; gene_id "g958"; # protein sequence = [MSDPVGQVRVCYTPLASAIVDTPEASLIACTGGKTSPFTQAIYKDFGDGKLHSPRLATATLEAIDSIQARNIFPQDLP # AYQRASVTARTNGVVSPFWRDWPLAEPCEFLTPEPLHHWHKMFWDHDAKWAIQAVGASHIDFRFSIHQPIVGYRSFKEGISSLKQVTGRAQRDVQRCL # IPLISGAVIPKFVAALRALTDFRYAGQAPRFNQASTLRVQTALNEFHENKDIIQDLKARVNPKGVPIVHWEIPKLEFMQSVAPSISASGPIMQWTADT # TEHAHITLVKDPARSGNNHDFEVQICRHLDRQSRVRRFDLVTAMVDAGVDFRLDDIEGDEGRGDIGHDREERDERDEEDKEVDAKISSSEELMTRLHP # VSQKLFGSFRPKQNFFLKARLLKQDASALLPLRIFTDNISGEISAFKVNRDPDLKTLTIEQVSNLYSLPDFSGACLDFLERIQAKTQTLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g958 ### # start gene g959 Scaffold_5 AUGUSTUS gene 4882768 4883816 0.37 - . g959 Scaffold_5 AUGUSTUS transcript 4882768 4883816 0.37 - . g959.t1 Scaffold_5 AUGUSTUS stop_codon 4882768 4882770 . - 0 transcript_id "g959.t1"; gene_id "g959"; Scaffold_5 AUGUSTUS CDS 4882768 4883649 0.96 - 0 transcript_id "g959.t1"; gene_id "g959"; Scaffold_5 AUGUSTUS CDS 4883727 4883816 0.37 - 0 transcript_id "g959.t1"; gene_id "g959"; Scaffold_5 AUGUSTUS start_codon 4883814 4883816 . - 0 transcript_id "g959.t1"; gene_id "g959"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLEWPRYRVPMTRLTRKGAPWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPL # IVETDASDYAIAAILSIQNADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFL # HQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLQATFLEGPVLRASIIMDIEALHQAIILALPADPSSVVGLEL # AKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLCYFHDHPLSGYFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g959 ### # start gene g960 Scaffold_5 AUGUSTUS gene 4885803 4886192 0.74 + . g960 Scaffold_5 AUGUSTUS transcript 4885803 4886192 0.74 + . g960.t1 Scaffold_5 AUGUSTUS start_codon 4885803 4885805 . + 0 transcript_id "g960.t1"; gene_id "g960"; Scaffold_5 AUGUSTUS CDS 4885803 4886192 0.74 + 0 transcript_id "g960.t1"; gene_id "g960"; Scaffold_5 AUGUSTUS stop_codon 4886190 4886192 . + 0 transcript_id "g960.t1"; gene_id "g960"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPLSSGTWDGDHHNGGLPPWVTPNLPVVPWEVSHTPLPGEREDLPLDRYRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g960 ### # start gene g961 Scaffold_5 AUGUSTUS gene 4889513 4891190 0.58 + . g961 Scaffold_5 AUGUSTUS transcript 4889513 4891190 0.58 + . g961.t1 Scaffold_5 AUGUSTUS start_codon 4889513 4889515 . + 0 transcript_id "g961.t1"; gene_id "g961"; Scaffold_5 AUGUSTUS CDS 4889513 4889805 0.73 + 0 transcript_id "g961.t1"; gene_id "g961"; Scaffold_5 AUGUSTUS CDS 4890381 4890777 0.8 + 1 transcript_id "g961.t1"; gene_id "g961"; Scaffold_5 AUGUSTUS CDS 4890861 4891190 0.92 + 0 transcript_id "g961.t1"; gene_id "g961"; Scaffold_5 AUGUSTUS stop_codon 4891188 4891190 . + 0 transcript_id "g961.t1"; gene_id "g961"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYVKKFFVLTIVIGNARKLESVRLPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNH # LGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g961 ### # start gene g962 Scaffold_5 AUGUSTUS gene 4893994 4895053 0.7 + . g962 Scaffold_5 AUGUSTUS transcript 4893994 4895053 0.7 + . g962.t1 Scaffold_5 AUGUSTUS start_codon 4893994 4893996 . + 0 transcript_id "g962.t1"; gene_id "g962"; Scaffold_5 AUGUSTUS CDS 4893994 4894617 0.7 + 0 transcript_id "g962.t1"; gene_id "g962"; Scaffold_5 AUGUSTUS CDS 4894673 4895053 0.84 + 0 transcript_id "g962.t1"; gene_id "g962"; Scaffold_5 AUGUSTUS stop_codon 4895051 4895053 . + 0 transcript_id "g962.t1"; gene_id "g962"; # protein sequence = [MDFIEQLPLSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVFTSSLSMVFLIMLLPIVVPNLFRRSSGSRLKR # SPWNFTIPLISPEADGQTERVNQTLEQYIGSIAPTNRMTVASTSDRRGSPITTLPMLPLVLLHSSLTKGYHQISPFAEVDMKSDLARDFVVNLDELHV # FLREEILLAQSRYKEQADRKRISHPEFPIGSEKNILVLSRSSVDLVLVLRAQAPRLSSPNSPGFPCLTAGAGYAKPFPNRTQSPPPPIEVDGEEEYNV # AEILDSKLDRRYKRCPLRYYIRWAGYKGTDDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g962 ### # start gene g963 Scaffold_5 AUGUSTUS gene 4898797 4899495 0.7 + . g963 Scaffold_5 AUGUSTUS transcript 4898797 4899495 0.7 + . g963.t1 Scaffold_5 AUGUSTUS start_codon 4898797 4898799 . + 0 transcript_id "g963.t1"; gene_id "g963"; Scaffold_5 AUGUSTUS CDS 4898797 4899495 0.7 + 0 transcript_id "g963.t1"; gene_id "g963"; Scaffold_5 AUGUSTUS stop_codon 4899493 4899495 . + 0 transcript_id "g963.t1"; gene_id "g963"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQIYTDQISFVDGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGKGVNDEEIHEGIPQPPPEAPQPPPEVPQQPHEAPQPPPEVPQQSPEAPLRAPRMGVKLEEVKDEE # YKASQPGPHKLFPSDKDLGPDDPILMGINEWLALRTKARKKRWRRSSRLDDPPWRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g963 ### # start gene g964 Scaffold_5 AUGUSTUS gene 4899825 4900388 0.56 + . g964 Scaffold_5 AUGUSTUS transcript 4899825 4900388 0.56 + . g964.t1 Scaffold_5 AUGUSTUS start_codon 4899825 4899827 . + 0 transcript_id "g964.t1"; gene_id "g964"; Scaffold_5 AUGUSTUS CDS 4899825 4900388 0.56 + 0 transcript_id "g964.t1"; gene_id "g964"; Scaffold_5 AUGUSTUS stop_codon 4900386 4900388 . + 0 transcript_id "g964.t1"; gene_id "g964"; # protein sequence = [MDRLLREGTPAYFLHISPTKEESPTEEMLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKS # IPVQYQDYLDVFSPGEARMLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELTSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALN # KITKKNRYPLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g964 ### # start gene g965 Scaffold_5 AUGUSTUS gene 4902091 4902783 0.63 + . g965 Scaffold_5 AUGUSTUS transcript 4902091 4902783 0.63 + . g965.t1 Scaffold_5 AUGUSTUS start_codon 4902091 4902093 . + 0 transcript_id "g965.t1"; gene_id "g965"; Scaffold_5 AUGUSTUS CDS 4902091 4902783 0.63 + 0 transcript_id "g965.t1"; gene_id "g965"; Scaffold_5 AUGUSTUS stop_codon 4902781 4902783 . + 0 transcript_id "g965.t1"; gene_id "g965"; # protein sequence = [MPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNN # TPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQEQIGVANKAYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKW # TGPYTILSKVGSHAYRLDLPGDLHKIHNVFHVDRLKHHFHDKFRRQNSPLPQSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g965 ### # start gene g966 Scaffold_5 AUGUSTUS gene 4904519 4905685 0.88 + . g966 Scaffold_5 AUGUSTUS transcript 4904519 4905685 0.88 + . g966.t1 Scaffold_5 AUGUSTUS start_codon 4904519 4904521 . + 0 transcript_id "g966.t1"; gene_id "g966"; Scaffold_5 AUGUSTUS CDS 4904519 4905685 0.88 + 0 transcript_id "g966.t1"; gene_id "g966"; Scaffold_5 AUGUSTUS stop_codon 4905683 4905685 . + 0 transcript_id "g966.t1"; gene_id "g966"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g966 ### # start gene g967 Scaffold_5 AUGUSTUS gene 4905736 4906812 0.94 + . g967 Scaffold_5 AUGUSTUS transcript 4905736 4906812 0.94 + . g967.t1 Scaffold_5 AUGUSTUS start_codon 4905736 4905738 . + 0 transcript_id "g967.t1"; gene_id "g967"; Scaffold_5 AUGUSTUS CDS 4905736 4906812 0.94 + 0 transcript_id "g967.t1"; gene_id "g967"; Scaffold_5 AUGUSTUS stop_codon 4906810 4906812 . + 0 transcript_id "g967.t1"; gene_id "g967"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVRRRMGNSVSYKTTGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g967 ### # start gene g968 Scaffold_5 AUGUSTUS gene 4914113 4915102 0.58 - . g968 Scaffold_5 AUGUSTUS transcript 4914113 4915102 0.58 - . g968.t1 Scaffold_5 AUGUSTUS stop_codon 4914113 4914115 . - 0 transcript_id "g968.t1"; gene_id "g968"; Scaffold_5 AUGUSTUS CDS 4914113 4914923 0.68 - 1 transcript_id "g968.t1"; gene_id "g968"; Scaffold_5 AUGUSTUS CDS 4915077 4915102 0.58 - 0 transcript_id "g968.t1"; gene_id "g968"; Scaffold_5 AUGUSTUS start_codon 4915100 4915102 . - 0 transcript_id "g968.t1"; gene_id "g968"; # protein sequence = [MRGLERKDIGSAKEWFVPDILDPDLDSLPAWTSSFTALVKELQDNFGVYDAQGEAEDALGNLKMKETENIRKYNIRFN # TLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLAAYCLEVLRIDNRYWKREETKKREAGKPFIARNPKKGSSDFKTGSTNQHNNSQPSGSSAP # FTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEE # DSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g968 ### # start gene g969 Scaffold_5 AUGUSTUS gene 4915423 4916187 0.76 - . g969 Scaffold_5 AUGUSTUS transcript 4915423 4916187 0.76 - . g969.t1 Scaffold_5 AUGUSTUS stop_codon 4915423 4915425 . - 0 transcript_id "g969.t1"; gene_id "g969"; Scaffold_5 AUGUSTUS CDS 4915423 4916187 0.76 - 0 transcript_id "g969.t1"; gene_id "g969"; Scaffold_5 AUGUSTUS start_codon 4916185 4916187 . - 0 transcript_id "g969.t1"; gene_id "g969"; # protein sequence = [MEEEQQFEYSTLFTSDGQPVQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDL # DTGDHGDQDPPVDPDDPGTDNNHDDLDDDSGSLLRGEPGDPSGPGGPGGPGGPGGPRSSNSPDIPNEQRAMLDLFSGFKVSMETLGTVLAALGRPSDS # SESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRLLRSCTPCNRAKATRCLSAEDEWDSSEVINNTAVTPLVPGERE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g969 ### # start gene g970 Scaffold_5 AUGUSTUS gene 4918846 4919826 0.24 + . g970 Scaffold_5 AUGUSTUS transcript 4918846 4919826 0.24 + . g970.t1 Scaffold_5 AUGUSTUS start_codon 4918846 4918848 . + 0 transcript_id "g970.t1"; gene_id "g970"; Scaffold_5 AUGUSTUS CDS 4918846 4918907 0.5 + 0 transcript_id "g970.t1"; gene_id "g970"; Scaffold_5 AUGUSTUS CDS 4918999 4919307 0.26 + 1 transcript_id "g970.t1"; gene_id "g970"; Scaffold_5 AUGUSTUS CDS 4919589 4919826 0.3 + 1 transcript_id "g970.t1"; gene_id "g970"; Scaffold_5 AUGUSTUS stop_codon 4919824 4919826 . + 0 transcript_id "g970.t1"; gene_id "g970"; # protein sequence = [MGRGSTASSGGSHYYGSQPGPGYENSYGQGGRSDKVDDGGYIAGHNMSFGRSLSGVQGYGEGYREDIEGDILVDMEVD # TEVNMEVDMEVDTEDYGVDNGGGYRHGLRRWIRISAGWFHLFSCRCPQEEKAKSSKASNPAILKIHSKSHVLTTEEDFINEELAEFEHDRYADDEDDE # NADAEDEDADNNGEDVTLTSREYKRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g970 ### # start gene g971 Scaffold_5 AUGUSTUS gene 4924092 4925324 0.49 - . g971 Scaffold_5 AUGUSTUS transcript 4924092 4925324 0.49 - . g971.t1 Scaffold_5 AUGUSTUS stop_codon 4924092 4924094 . - 0 transcript_id "g971.t1"; gene_id "g971"; Scaffold_5 AUGUSTUS CDS 4924092 4925324 0.49 - 0 transcript_id "g971.t1"; gene_id "g971"; Scaffold_5 AUGUSTUS start_codon 4925322 4925324 . - 0 transcript_id "g971.t1"; gene_id "g971"; # protein sequence = [MDISSDPGVFTSSPGTEWNFDRSRYPVKYYFTNFRRARQISPPVISTPAPSPSSPFTKDVQSCGKWLEAVVNDIHPVY # ESLLPLTQAMVSGTFTADGARKLFEARARSLSLSRDKSLWDDEVPSVRWKPMVQPGKEFGEKSYVKRSKTIHVAQSRPGMGVSHTRVTEASSTTKATT # LSTMDPPPPAHISRSKSNPIPIPQENSRTDVFGDLSFVKSVDPGVTTPVSLLNTFFPDEPVALRSAKSKESDSDIGSTTTTTKVNSPAPSRPLSFLNP # NPHAHAKVPPSPVFTIPSLVTFPSWSALPSLPELSSQQQPDQHYQHHQHQPPTSLLRRKTLALGTGLFSRKALQYAPSLGGPGSSSSVAAVVDEESDV # GLSSMSTLTPTLPTPLMKIGRSISMPVSGSGTWTNSQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g971 ### # start gene g972 Scaffold_5 AUGUSTUS gene 4925967 4926419 1 - . g972 Scaffold_5 AUGUSTUS transcript 4925967 4926419 1 - . g972.t1 Scaffold_5 AUGUSTUS stop_codon 4925967 4925969 . - 0 transcript_id "g972.t1"; gene_id "g972"; Scaffold_5 AUGUSTUS CDS 4925967 4926419 1 - 0 transcript_id "g972.t1"; gene_id "g972"; Scaffold_5 AUGUSTUS start_codon 4926417 4926419 . - 0 transcript_id "g972.t1"; gene_id "g972"; # protein sequence = [MFPISAPPGLDVSSNSILGCQITLSPDRMVLGHRRNPSTGSLYSDDSDDTDDTIDISDLDDDDGVGLIGFPLQRMAQY # STSPSGNSRREDEESESEYEDDDELTALYNACMAARLETNQNADDGRSDSSGTSSIGWDDVYVVNPCLYHSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g972 ### # start gene g973 Scaffold_5 AUGUSTUS gene 4929741 4930601 0.65 + . g973 Scaffold_5 AUGUSTUS transcript 4929741 4930601 0.65 + . g973.t1 Scaffold_5 AUGUSTUS start_codon 4929741 4929743 . + 0 transcript_id "g973.t1"; gene_id "g973"; Scaffold_5 AUGUSTUS CDS 4929741 4929776 0.65 + 0 transcript_id "g973.t1"; gene_id "g973"; Scaffold_5 AUGUSTUS CDS 4930269 4930601 0.88 + 0 transcript_id "g973.t1"; gene_id "g973"; Scaffold_5 AUGUSTUS stop_codon 4930599 4930601 . + 0 transcript_id "g973.t1"; gene_id "g973"; # protein sequence = [MTQFNFFKFIHFSIDANCDNLFIGEQLCIPGTTPPPPCAENYTVKAGDVCINIANQFNITVAQLEAANTEIDPLCDNL # QIGEVDQSRYSTNRDFANDSHLGSMHSLGLSIDVTWNFPECTPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g973 ### # start gene g974 Scaffold_5 AUGUSTUS gene 4932014 4933354 0.99 - . g974 Scaffold_5 AUGUSTUS transcript 4932014 4933354 0.99 - . g974.t1 Scaffold_5 AUGUSTUS stop_codon 4932014 4932016 . - 0 transcript_id "g974.t1"; gene_id "g974"; Scaffold_5 AUGUSTUS CDS 4932014 4933354 0.99 - 0 transcript_id "g974.t1"; gene_id "g974"; Scaffold_5 AUGUSTUS start_codon 4933352 4933354 . - 0 transcript_id "g974.t1"; gene_id "g974"; # protein sequence = [MSAQKVSFTIRRPSPTSRAASSGPESDSGSSFKVPALPRHLTNDSSVPGSPLARSGTSSPYYDDSDSDQDDEVQDELV # TGFDKFGVQRCVFRQASCIQSSQLTKVLRQNHRRLHERKKPQGPLVIPALKNRDWREAARRRRTLNQYVPESARAQTVGSDGSVGGLGTRDSINSGPV # VSGLQYTKKEMDSEKREQDVVMVEVAGEDIPKAEEEEDSEDKAALRALLAGADGEDSGPRIDIIPTPISEKDAYKQDVEELPESASLADYERVPVSQF # GAAMLRGMGWKEGTAASRKGNGIVQPYIPESRPALLGIGAKEMEVFDDGSKKRGGNRRPEKRYIPVVKKDKDGNIVSEGEARRRDSERERRRDRSRSP # QRESRVSSRRSSSERRSYDDRRREYSRKDEDERNNRRDKFRDRDTDKESSRRERIDRDRDRHQDRSRDTERQRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g974 ### # start gene g975 Scaffold_5 AUGUSTUS gene 4940182 4941018 0.62 + . g975 Scaffold_5 AUGUSTUS transcript 4940182 4941018 0.62 + . g975.t1 Scaffold_5 AUGUSTUS start_codon 4940182 4940184 . + 0 transcript_id "g975.t1"; gene_id "g975"; Scaffold_5 AUGUSTUS CDS 4940182 4941018 0.62 + 0 transcript_id "g975.t1"; gene_id "g975"; Scaffold_5 AUGUSTUS stop_codon 4941016 4941018 . + 0 transcript_id "g975.t1"; gene_id "g975"; # protein sequence = [MPLWLPKSYQDLNDLPSENIVYQPKLGGSKVVRTAPGVVIKYRGDLAEEVNCLNFARDHLSIRVPRVLHHPGDVRQST # LWDPRTEELPQVWYICMEEIQGVQLKEVIDSFTPLQLEHVASQIKAILADMHSVPAPHIGSVSGGPFQNSYFFPYAVKPQNAWTKVSDFIDHYHQLLM # TFGTEEYAKELLANFPQDCPVNFTHGDLVPRNILVEGSTITGIVDWSMAGFYPEFWEYSRMYDDSEQSKGWSQVLSMIFPGPRLDNQIATFHRLMGTL # LYNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g975 ### # start gene g976 Scaffold_5 AUGUSTUS gene 4951293 4952153 0.79 + . g976 Scaffold_5 AUGUSTUS transcript 4951293 4952153 0.79 + . g976.t1 Scaffold_5 AUGUSTUS start_codon 4951293 4951295 . + 0 transcript_id "g976.t1"; gene_id "g976"; Scaffold_5 AUGUSTUS CDS 4951293 4952153 0.79 + 0 transcript_id "g976.t1"; gene_id "g976"; Scaffold_5 AUGUSTUS stop_codon 4952151 4952153 . + 0 transcript_id "g976.t1"; gene_id "g976"; # protein sequence = [MRKNRDSSAPIVGTTGSTPLHFAAANGNKNVIITLLMRGAHADRRDKHGITPAMLAEQYGWLECADVLNNWVKDKDRD # LRERVQPDEGISMALSVAQAPSGSEDDIKPNTRKHIQVKRSIDTALNILKAGSTSTPSSKLALSSTSSFTNNARTTSPISPTIARRDFSPSPSEDGRF # SPSPSPINQESRRPSLPHIFQTPSSSSQRSQKPATLTKPRNSRRPRSAGTDAEQDPDPDGSGTGFGRGSTGKKTRDQIFLVESFQERQRIRRRSARED # CLVSELCVYSIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g976 ### # start gene g977 Scaffold_5 AUGUSTUS gene 4952915 4954410 0.35 + . g977 Scaffold_5 AUGUSTUS transcript 4952915 4954410 0.35 + . g977.t1 Scaffold_5 AUGUSTUS start_codon 4952915 4952917 . + 0 transcript_id "g977.t1"; gene_id "g977"; Scaffold_5 AUGUSTUS CDS 4952915 4953326 0.57 + 0 transcript_id "g977.t1"; gene_id "g977"; Scaffold_5 AUGUSTUS CDS 4953392 4954410 0.65 + 2 transcript_id "g977.t1"; gene_id "g977"; Scaffold_5 AUGUSTUS stop_codon 4954408 4954410 . + 0 transcript_id "g977.t1"; gene_id "g977"; # protein sequence = [MALEKEKEQPWKARVPDSAPANIGDFDFTVTEENEYGHPIQPSIAARLGIQTRNRGSSFTSSESSLSPALSAGDEPTS # TVALHADFPFSLDAPPPIDEVDGVAPPQVQLSPPPVDSRMRGDSVSSTSTADSGLNPSLKGGSYLNLSSADSRPRSNNEKINVPEVSYDDYLEAGPAQ # GVAVIGINERRGNTALENIDVNIVSSHAQAEALVQRTQQDILSAHADGHSSSTDSMPLSARLAALGESLELERRLREKKQAEEVKAQVTAELLEDSTS # STARTEILRQCSLDQLSGSVSSSQQIRRPHANSEASRIATVNGRLCFLPMGKTKMMLNFLLLDIDSARIDRTKLTHHPSLSASVVEASVSSPTFDSDV # DSPSIQSKFFDRRANHSRTPDLENDLSRISSLEGFDVDTELGPSLFRVSTAPNSSFSTRDKRERELASNTKLTRMGFSPSENARAPSKRFGGLKSLMQ # SLKGSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g977 ### # start gene g978 Scaffold_5 AUGUSTUS gene 4955807 4957770 0.14 + . g978 Scaffold_5 AUGUSTUS transcript 4955807 4957770 0.14 + . g978.t1 Scaffold_5 AUGUSTUS start_codon 4955807 4955809 . + 0 transcript_id "g978.t1"; gene_id "g978"; Scaffold_5 AUGUSTUS CDS 4955807 4956424 0.59 + 0 transcript_id "g978.t1"; gene_id "g978"; Scaffold_5 AUGUSTUS CDS 4956713 4956911 0.45 + 0 transcript_id "g978.t1"; gene_id "g978"; Scaffold_5 AUGUSTUS CDS 4956968 4957770 0.32 + 2 transcript_id "g978.t1"; gene_id "g978"; Scaffold_5 AUGUSTUS stop_codon 4957768 4957770 . + 0 transcript_id "g978.t1"; gene_id "g978"; # protein sequence = [MSANSDSTATAAQSTMATSGMIIPNTSTMEEEYIEVPYGRDARESGSSTNDERDRSRDRGQTPGFSPGFTDDEPDSAS # NYASPLSPNSPAVGLSGLSARLKTDDEEDGPSTRSGDDFYDKPLSYGRNSANSDRSINAYSNRMGGRASVVEENEKMRRDYEFRIATMQTQISNLQRD # LGDSQQTQFKLSESEMRVRQLEEELASVLRADAEVVEQLRSDMQGLLVEVSDLSRRNDELMTAKDSDLVVIRDLDNQLKEYKRKYEQAKTELRSVKAT # SQLFLQAPKIDKLEDQLPVSADGGILDIHVTAFLSAVDGLLTAGRSNAPTRVLSPMKYVVNAVTNIIDDVRAYERRPSRADVDVDTLHMLRERADATL # SNLVTASKTHATSSGMSPVSLLDAAASHVAATITDIGKLIYIRKATKAEQEQFASSTYSPGPSATNGFTPSLRSVNEKDHQRKGSSASSAFGSSSRYD # NPSMYPSGRSSDEHARRTPSDNSSSEKTNSPPPIFDHPPNTASTASDGDGTEDNWAEVKVNIPSIDRFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g978 ### # start gene g979 Scaffold_5 AUGUSTUS gene 4960933 4961214 0.77 - . g979 Scaffold_5 AUGUSTUS transcript 4960933 4961214 0.77 - . g979.t1 Scaffold_5 AUGUSTUS stop_codon 4960933 4960935 . - 0 transcript_id "g979.t1"; gene_id "g979"; Scaffold_5 AUGUSTUS CDS 4960933 4961214 0.77 - 0 transcript_id "g979.t1"; gene_id "g979"; Scaffold_5 AUGUSTUS start_codon 4961212 4961214 . - 0 transcript_id "g979.t1"; gene_id "g979"; # protein sequence = [MGLTATDDCHQKVDKVEILEATNIETRIADATCVKITQNSFKAKALSNKLNSVSRNIEERSTSQQENKPGRMGVANGC # ILLVLRMVDQHAVDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g979 ### # start gene g980 Scaffold_5 AUGUSTUS gene 4965390 4966337 0.8 - . g980 Scaffold_5 AUGUSTUS transcript 4965390 4966337 0.8 - . g980.t1 Scaffold_5 AUGUSTUS stop_codon 4965390 4965392 . - 0 transcript_id "g980.t1"; gene_id "g980"; Scaffold_5 AUGUSTUS CDS 4965390 4966337 0.8 - 0 transcript_id "g980.t1"; gene_id "g980"; Scaffold_5 AUGUSTUS start_codon 4966335 4966337 . - 0 transcript_id "g980.t1"; gene_id "g980"; # protein sequence = [MAFAKSVATEPLTSDDWEIIVCRSMISVEFRLICCPGNPCISRRIYSSLSSPRSESRPGDQCVGAGQDTRPTQDRHVY # RALFVPTLNLITVVVSLAPQAKNDALLLSTNTEVSISPKLHANRRVHAKEPTVNGTADAVVPKSIPQPFQILRVLPNHVLSKPLTAYSGSEVIGYVSS # STLAQLLPASRNVAKQHTCYKVSLKRLEPPINPVSTLQTPETVPETVLNPSEKIHNVENSDNAERSYVCGRVELIGGHIVFPSLPAGIEHWDLIKFVP # RIVEYPLFQTQELLRIVADSSAGTLTISGDNNTETLTPHPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g980 ### # start gene g981 Scaffold_5 AUGUSTUS gene 4967580 4969700 0.39 - . g981 Scaffold_5 AUGUSTUS transcript 4967580 4969700 0.39 - . g981.t1 Scaffold_5 AUGUSTUS stop_codon 4967580 4967582 . - 0 transcript_id "g981.t1"; gene_id "g981"; Scaffold_5 AUGUSTUS CDS 4967580 4967886 0.99 - 1 transcript_id "g981.t1"; gene_id "g981"; Scaffold_5 AUGUSTUS CDS 4968047 4968469 0.39 - 1 transcript_id "g981.t1"; gene_id "g981"; Scaffold_5 AUGUSTUS CDS 4968547 4969700 0.71 - 0 transcript_id "g981.t1"; gene_id "g981"; Scaffold_5 AUGUSTUS start_codon 4969698 4969700 . - 0 transcript_id "g981.t1"; gene_id "g981"; # protein sequence = [MCLIGSWTSEPEDCFPFELAESDEEEEEHAEQPSLSDPPSDPDPSTGANVEEEHEDTESDESDESEDPSSVHGENEME # LNLPVYMPTPSSLAEALTPLDPSESPQNFTTGVFALPVPLPPKKPETPQDLPPFITRSPSFEEKTPFAPPPLSIPPPPLATIVPAQSRLYEADQLSET # FQQEILPDYQADKVRELSQNDDPPAFSSSASTAVLRAEIQRQADIRLRTPYSRLLNYASRKLGSIGHGTPIDPNRRRNLIAWLEDRKVVNNAHAISEK # VFVQHGPERLPPVGSSAWYAMRFPSTLSSQPVLKSTAVKPDAFITSTGPTASSPQALLAGTQQQQLEAQPSFETNWPPLTVQPGDLETFRNHNWMDAK # AYFRGIIFRYHANRGCGTDQAQYQYSPANHGATPNTNGNLNQGAAPNVAPSRFSPKIAMDENLSDEDAEGDIDPDVVQSVSEFTSSPSNDPASSGGNL # MTTGVHENRSYSPSTAGMDSFSGLPPDGHSNGVSDLTPADLALGFITVGWASIAVRVGFGMGMGINRFDMMGVGVGLGMIGFPVVETDSWFLPASSPP # STSLPTSSANGEHHDHGVGGMGSFGNNSIYNDPLPDHARERFGSPGSPENAYPLGFAMG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g981 ### # start gene g982 Scaffold_5 AUGUSTUS gene 4970312 4970854 0.4 - . g982 Scaffold_5 AUGUSTUS transcript 4970312 4970854 0.4 - . g982.t1 Scaffold_5 AUGUSTUS stop_codon 4970312 4970314 . - 0 transcript_id "g982.t1"; gene_id "g982"; Scaffold_5 AUGUSTUS CDS 4970312 4970854 0.4 - 0 transcript_id "g982.t1"; gene_id "g982"; Scaffold_5 AUGUSTUS start_codon 4970852 4970854 . - 0 transcript_id "g982.t1"; gene_id "g982"; # protein sequence = [MGKSNQVANDDLPEPMRSKLTSPLQKTAELPVFVSADDEATQSVMKSQSRSPLRRLRSLAQTTAKASLTKRKRASSTG # VPTGKKKPKIVEIEGDILDEEESDASTPSEDVEAVTTVPSEPTIPIAATLPYPMSLPNPIPTLSVTPPTPPNSPPPVSTSDPSRTIIVLFLLSKVQKK # PVKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g982 ### # start gene g983 Scaffold_5 AUGUSTUS gene 4971028 4971585 0.26 - . g983 Scaffold_5 AUGUSTUS transcript 4971028 4971585 0.26 - . g983.t1 Scaffold_5 AUGUSTUS stop_codon 4971028 4971030 . - 0 transcript_id "g983.t1"; gene_id "g983"; Scaffold_5 AUGUSTUS CDS 4971028 4971585 0.26 - 0 transcript_id "g983.t1"; gene_id "g983"; Scaffold_5 AUGUSTUS start_codon 4971583 4971585 . - 0 transcript_id "g983.t1"; gene_id "g983"; # protein sequence = [MAASDIDKSLRRSNRRPSTSTTLLAKDTEGGSLRRSARVGRLPARYSHSATAGTTPSHFPLSASNKRKRTSSTSKERS # TGRASKRSHIIQADTPTANNSPPADRNNTSSASARSQRYQRRHPSVFNGGVSETENSQAIASTSYLPPLVVNNPIDSTQRRTRRKENFLGERIITVRI # SYASSPSNC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g983 ### # start gene g984 Scaffold_5 AUGUSTUS gene 4975858 4976568 0.23 + . g984 Scaffold_5 AUGUSTUS transcript 4975858 4976568 0.23 + . g984.t1 Scaffold_5 AUGUSTUS start_codon 4975858 4975860 . + 0 transcript_id "g984.t1"; gene_id "g984"; Scaffold_5 AUGUSTUS CDS 4975858 4976568 0.23 + 0 transcript_id "g984.t1"; gene_id "g984"; Scaffold_5 AUGUSTUS stop_codon 4976566 4976568 . + 0 transcript_id "g984.t1"; gene_id "g984"; # protein sequence = [MFQKSTHQFKTPQVKLKNFPKPGVTEVDAKIVCDASGFSRKLTSKFGNKELLDGWNCDAYWAYFKEKEGGKAENRLDH # WDYPATKHMCFPEGWGWFIKLISWHHAPLANLMDLVAYIINKAKSGVPAHAIPPTKILSEMFNCPFEFITSIGWAVRNDHEFPDNLEEYGDGEGERKF # NYFKVRYPTLNKLMNGVYELLPKYYGKQTYFVRKSMTYRSPVVAGEGWFAIGNSAGFRTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g984 ### # start gene g985 Scaffold_5 AUGUSTUS gene 4978456 4979626 0.83 - . g985 Scaffold_5 AUGUSTUS transcript 4978456 4979626 0.83 - . g985.t1 Scaffold_5 AUGUSTUS stop_codon 4978456 4978458 . - 0 transcript_id "g985.t1"; gene_id "g985"; Scaffold_5 AUGUSTUS CDS 4978456 4978866 0.89 - 0 transcript_id "g985.t1"; gene_id "g985"; Scaffold_5 AUGUSTUS CDS 4978978 4979111 0.87 - 2 transcript_id "g985.t1"; gene_id "g985"; Scaffold_5 AUGUSTUS CDS 4979623 4979626 0.83 - 0 transcript_id "g985.t1"; gene_id "g985"; Scaffold_5 AUGUSTUS start_codon 4979624 4979626 . - 0 transcript_id "g985.t1"; gene_id "g985"; # protein sequence = [MRGSGEQCASAWVGIDGDTCETAILQTGVDFCVSGSAVSFDAWSVICPKCLKKPADSFDFSGFSVSAGDSVTVTATVI # STTEGTLTIENNSKGTSASKTVTSTARLCETNAEWIVEDFEECEGNDCELVPFANFGTVEFTGASATTSSGTVTPAGATIFDIEQNSVLTSVSQSGST # VTVEFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g985 ### # start gene g986 Scaffold_5 AUGUSTUS gene 4983277 4983729 0.94 + . g986 Scaffold_5 AUGUSTUS transcript 4983277 4983729 0.94 + . g986.t1 Scaffold_5 AUGUSTUS start_codon 4983277 4983279 . + 0 transcript_id "g986.t1"; gene_id "g986"; Scaffold_5 AUGUSTUS CDS 4983277 4983550 0.94 + 0 transcript_id "g986.t1"; gene_id "g986"; Scaffold_5 AUGUSTUS CDS 4983602 4983729 1 + 2 transcript_id "g986.t1"; gene_id "g986"; Scaffold_5 AUGUSTUS stop_codon 4983727 4983729 . + 0 transcript_id "g986.t1"; gene_id "g986"; # protein sequence = [MKTSHLSEVFGCFEGNVVCGDDPRSGMRSKPDPDIFLVAAKETLGRDVGPLKGEDEKGVEVTDAQRIERGKGLVLEDG # LPGMQAGKRAGMAVVWVPDANLLDVNYSGNEKADQILKSLEDFVPEEWGLPPYDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g986 ### # start gene g987 Scaffold_5 AUGUSTUS gene 4988222 4988980 0.44 + . g987 Scaffold_5 AUGUSTUS transcript 4988222 4988980 0.44 + . g987.t1 Scaffold_5 AUGUSTUS start_codon 4988222 4988224 . + 0 transcript_id "g987.t1"; gene_id "g987"; Scaffold_5 AUGUSTUS CDS 4988222 4988980 0.44 + 0 transcript_id "g987.t1"; gene_id "g987"; Scaffold_5 AUGUSTUS stop_codon 4988978 4988980 . + 0 transcript_id "g987.t1"; gene_id "g987"; # protein sequence = [MFRSAFFLDFIDLTIPSQNHSVVPESDSDWPSFSTIIQFRDGVRSRLENLYAELDSGERVLTRRIARMLVMCIEHEGW # HVETLLYMLIQRSPGALPSNLPTTLLPPGFALPPWDSLAAQWDTTWASFDILESDSDVKSKTILLGPATVVLGHNDSEGDDPHFEGGNTEEVINHEYG # WDNESPSRSLAVGKFKAELRPVSNGEFAQYWRRGKGKVPAPKSWIITDDETTGKSEFKCAPSTAPSLSESHIHGPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g987 ### # start gene g988 Scaffold_5 AUGUSTUS gene 4992279 4993277 0.96 + . g988 Scaffold_5 AUGUSTUS transcript 4992279 4993277 0.96 + . g988.t1 Scaffold_5 AUGUSTUS start_codon 4992279 4992281 . + 0 transcript_id "g988.t1"; gene_id "g988"; Scaffold_5 AUGUSTUS CDS 4992279 4993277 0.96 + 0 transcript_id "g988.t1"; gene_id "g988"; Scaffold_5 AUGUSTUS stop_codon 4993275 4993277 . + 0 transcript_id "g988.t1"; gene_id "g988"; # protein sequence = [MILCRLAKRSREEDNGRPQANGTTSSRDHPKFVSSNSTEFFSDTLCPDANLDSLRVDTLCPLIRRKKILFAGPDTTFY # LHANLLQAFELHENRSHSCLGTEFCTFHQICRVPRSSNSAEPFFPPGGFKKYPSNRELDASQSGILKYILSNSLYVGSDMQDPRYTDPLAQVDQDTGV # RQKERYWLGQARKADVLVLNRGPLPAPAWTYDGTLQGNWSFVQKPLRIMRGREIERDGRVGENTLESRNLYGEGILDIALRVTVAKFLPEIVETLKAL # SKEAQQHRQVVLWHGSWIMEPACAGKDARGLSTLDSKMDSWTLFYNAQGKMIVYHGRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g988 ### # start gene g989 Scaffold_5 AUGUSTUS gene 4997429 4998637 0.43 - . g989 Scaffold_5 AUGUSTUS transcript 4997429 4998637 0.43 - . g989.t1 Scaffold_5 AUGUSTUS stop_codon 4997429 4997431 . - 0 transcript_id "g989.t1"; gene_id "g989"; Scaffold_5 AUGUSTUS CDS 4997429 4997861 0.73 - 1 transcript_id "g989.t1"; gene_id "g989"; Scaffold_5 AUGUSTUS CDS 4998169 4998333 0.7 - 1 transcript_id "g989.t1"; gene_id "g989"; Scaffold_5 AUGUSTUS CDS 4998429 4998637 0.61 - 0 transcript_id "g989.t1"; gene_id "g989"; Scaffold_5 AUGUSTUS start_codon 4998635 4998637 . - 0 transcript_id "g989.t1"; gene_id "g989"; # protein sequence = [MLLSAVFLALFAPSVWAQSSVIDAYVASESPIAKASMLANIGPSGSKSSGAFSGIVIASPSTENPDYLYTFTLGFDTT # LRAEIDNYVGAQAIVQQIPNPSGDITTGGLGEPKFYVNETAFTGPWGYDLWEEIYSSSFFSTAVQHRALRQGTTLARAIGQTSLASSYGNQADFLLCF # LQSYWNPTGYMTANTGGGRSGIDANSVLASIHTFDAAAGCDAITFQPCSDVALLNLFTYVNAFRNTYEINSGISTNEAVLTGRYPEDVYMGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g989 ### # start gene g990 Scaffold_5 AUGUSTUS gene 5005165 5007414 0.75 + . g990 Scaffold_5 AUGUSTUS transcript 5005165 5007414 0.75 + . g990.t1 Scaffold_5 AUGUSTUS start_codon 5005165 5005167 . + 0 transcript_id "g990.t1"; gene_id "g990"; Scaffold_5 AUGUSTUS CDS 5005165 5007414 0.75 + 0 transcript_id "g990.t1"; gene_id "g990"; Scaffold_5 AUGUSTUS stop_codon 5007412 5007414 . + 0 transcript_id "g990.t1"; gene_id "g990"; # protein sequence = [MERLNSKPAPTLKTEADRILEASGDLCLIQPAGPSLALPKPFAYRYSSSQTSHSTSASNVLPIQNTHAPLNSQSAQAS # SSSVQEISSQNLSSELLSILEAAKNNPQVNREALLRVISFIDSATKTNTELTIADALRKLAPSQAPVTLPQAPQTPPRTPPAPTAPTSPDDTIVILDK # ENVNPSAFRRRAERGAEEGKSLATLSIDIPPLPQQQVLLASGVNQYLRPTTTFTNEAIPSVPSTRKRTLSEALDDTHSFKRNQERNGTFSSPPRSNRT # IMSPGFSKDQPIVIPDSPSMPKPGGQRTQSRARLKMPYVVPDWARTQTALQPRLSEEALSMMKEMEQRKQEEKLAKRMKWSQQRKSGLMHRTMSTPAV # FSSGADEPVASGSGLSSFSKKGPIVGPSLHPVPDLLPPVIAAAGTSISFPSSPQRTPSPSPMQPAPPQTPPRRRFASSSSSPEEEEFSLFTPRRMATP # QKGPSVFESLTITQSPSIRPIHRREATPPPSSEPVAAEDDTASCQGDDSDDENFLTQELNSAMEETEISAILPVKRSDKEMTDSRDDVDAHIQDEDEE # DEEGADKPFWPGLPPSSPPPQSSPMLQPTDDLEDDFELPTVSSDFDIEDFPPKTEQIIDSENVENTFSDVDHEVNHFDDTALAAILEMLTNSNNVNSG # SPFIADNSDDIFKDLGAVVDETGQSQHVDTAHRDSLLGFPSDITLDNPGFWSAVGPLLDQIPNTDTVIEGSDPIKNLLSGCVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g990 ### # start gene g991 Scaffold_5 AUGUSTUS gene 5014751 5016043 0.94 + . g991 Scaffold_5 AUGUSTUS transcript 5014751 5016043 0.94 + . g991.t1 Scaffold_5 AUGUSTUS start_codon 5014751 5014753 . + 0 transcript_id "g991.t1"; gene_id "g991"; Scaffold_5 AUGUSTUS CDS 5014751 5015364 0.94 + 0 transcript_id "g991.t1"; gene_id "g991"; Scaffold_5 AUGUSTUS CDS 5015419 5016043 0.94 + 1 transcript_id "g991.t1"; gene_id "g991"; Scaffold_5 AUGUSTUS stop_codon 5016041 5016043 . + 0 transcript_id "g991.t1"; gene_id "g991"; # protein sequence = [MVSTLWLSNEFKSIRAFAFTFTSDASKFGANYLAKFGWDSSKGLGVEGQGRTSHIKVSQKLDMLGIGAAQSKDPNGIA # WKQSKDFESLLRRLNESNAASSDSGAQVIDGNTENIREEEGINGDDDLEKDGKKENREDRKKRKKEEKEAKKERKEQKKRKRAESVGEEVEQPKPKKK # AKSDTKVKEEPPKVEKAEEPKRIIPRHRAHRARAIAAKNISSKSAVHISEILGIASSSSSSFATPITAAPPSGTLTPLDQDVLGLVKLTTSTKSVSEY # FKERLLVKTSGNSSPLSSTVTPESNARAVDESESEDAPRAGLGSSRNLTRDTGDLDDTPRGGLGSSRTSTTFTSAASTFQSGMSKFESMFMSASVIAK # EETIVQVDVKSVDNISRDTNTRRRSQEKAERSSEEREGKQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g991 ### # start gene g992 Scaffold_5 AUGUSTUS gene 5019352 5019906 0.6 + . g992 Scaffold_5 AUGUSTUS transcript 5019352 5019906 0.6 + . g992.t1 Scaffold_5 AUGUSTUS start_codon 5019352 5019354 . + 0 transcript_id "g992.t1"; gene_id "g992"; Scaffold_5 AUGUSTUS CDS 5019352 5019906 0.6 + 0 transcript_id "g992.t1"; gene_id "g992"; Scaffold_5 AUGUSTUS stop_codon 5019904 5019906 . + 0 transcript_id "g992.t1"; gene_id "g992"; # protein sequence = [MWQSILYPPIFAKVIDVSLIWMFNWHNRNITPSQKIAAYAHLYSFASTKSVVHWFQIMRNGAFLMYDDEVMSPVVRTS # VSSYRPARFPTKNIATPIVLLYGDRDSLVDIDAMMSQLPEHTEARRLHSYEHIDILWGKDVDRDVIPEVLDALKRYCEDKDKLSGIVNGVKRTGDGTE # TDGLSDSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g992 ### # start gene g993 Scaffold_5 AUGUSTUS gene 5023931 5025196 0.87 - . g993 Scaffold_5 AUGUSTUS transcript 5023931 5025196 0.87 - . g993.t1 Scaffold_5 AUGUSTUS stop_codon 5023931 5023933 . - 0 transcript_id "g993.t1"; gene_id "g993"; Scaffold_5 AUGUSTUS CDS 5023931 5025196 0.87 - 0 transcript_id "g993.t1"; gene_id "g993"; Scaffold_5 AUGUSTUS start_codon 5025194 5025196 . - 0 transcript_id "g993.t1"; gene_id "g993"; # protein sequence = [MSTSGILYNELEFATSLGFASIGANNGHNGTSGYAFLNNTDALADYTYRSLHTGVVAGKELTKKFYGFPFHKSYFLGC # SSGGRQGLKEAQDFPEDFDGIVAGAPALALPNIMSWGGALYKATGDPESESFLSPELWAVVYDEVLRQCDALDGASDGLLEDPSTCQFTPETLICSKG # QTSRCLTGLQAQTVRSIYSPLYGSDGQLLYPRMQPGINTKKQVPFYFQGIPWDLTEVISRTSYLSPLTCFVQDWFRYVVYNDTTWDGRNFSLADAMNA # ASQNPFNIQTWEGDLSAFAENGGKILTYHGLQDFVCSPEISQLYYAHVSRTMSLPPHELDSFYRLFYVSGMDHCRDGDGASAIGQDIGSSAGRDPNEN # ALMAMVRWVEEGIPPDVLRGAKLSADGSQVEYWRAHCKWPKKIDTLAMA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g993 ### # start gene g994 Scaffold_5 AUGUSTUS gene 5028499 5030076 0.56 - . g994 Scaffold_5 AUGUSTUS transcript 5028499 5030076 0.56 - . g994.t1 Scaffold_5 AUGUSTUS stop_codon 5028499 5028501 . - 0 transcript_id "g994.t1"; gene_id "g994"; Scaffold_5 AUGUSTUS CDS 5028499 5028723 1 - 0 transcript_id "g994.t1"; gene_id "g994"; Scaffold_5 AUGUSTUS CDS 5028801 5029116 0.92 - 1 transcript_id "g994.t1"; gene_id "g994"; Scaffold_5 AUGUSTUS CDS 5029209 5029479 0.71 - 2 transcript_id "g994.t1"; gene_id "g994"; Scaffold_5 AUGUSTUS CDS 5029529 5029679 0.82 - 0 transcript_id "g994.t1"; gene_id "g994"; Scaffold_5 AUGUSTUS CDS 5029732 5030076 0.83 - 0 transcript_id "g994.t1"; gene_id "g994"; Scaffold_5 AUGUSTUS start_codon 5030074 5030076 . - 0 transcript_id "g994.t1"; gene_id "g994"; # protein sequence = [MVTRNYEQLGLKFKLFSAEVLFNKGLSQIYLGSVDAGLADMQEARKDKATDEHNVIDDAIADRGEGYTVFSIVGFLFV # LMLYITSLTTLQPVGVLYRPSEKKLKNAVSKNYMGKAVLIAAADSRDAFTGFTGSTNLKQGISPSGVFVETAPDLTRSATVPAPSLPKLDTEVGRAPA # LGRANTTLNVPSNARERITGSDSSPEPTASVTRSNTTISPIKPSVNATMGMGMGGPVRGLSVRKTPAGNTAPPPPPLKGPYGNDGPPPPLPLASAGAA # ANGPPDRIAAWARSNANPNNLPPIARSGSRSAPASNYAPSSFGGGSVRRRVTRRNTARTANSRIQSSYEEEEEGYASGDYDDGPFELLHYKDDVRGMA # LTPDTSFEDFMDKITSKFGKGFGGLGLKFKDEDGGKVTLQDESDYDLAIETARESSKGKQKGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g994 ### # start gene g995 Scaffold_5 AUGUSTUS gene 5033906 5034388 0.37 - . g995 Scaffold_5 AUGUSTUS transcript 5033906 5034388 0.37 - . g995.t1 Scaffold_5 AUGUSTUS stop_codon 5033906 5033908 . - 0 transcript_id "g995.t1"; gene_id "g995"; Scaffold_5 AUGUSTUS CDS 5033906 5034388 0.37 - 0 transcript_id "g995.t1"; gene_id "g995"; Scaffold_5 AUGUSTUS start_codon 5034386 5034388 . - 0 transcript_id "g995.t1"; gene_id "g995"; # protein sequence = [MCSIAGTAYADVVDENRRGDGEDGKGNEDVWRTFAEMKAMLEDNANANPFVDPSASGSLTSDADREKEVIREFLTLLA # VCHTVIPEEKDGKLQYQASSPDEAALVAGAELLGYQFHVRVLRQSTCYRRSYVCPKIRKPKSVLCQCFRRVTGIPDSQCLRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g995 ### # start gene g996 Scaffold_5 AUGUSTUS gene 5039381 5040358 0.53 + . g996 Scaffold_5 AUGUSTUS transcript 5039381 5040358 0.53 + . g996.t1 Scaffold_5 AUGUSTUS start_codon 5039381 5039383 . + 0 transcript_id "g996.t1"; gene_id "g996"; Scaffold_5 AUGUSTUS CDS 5039381 5040358 0.53 + 0 transcript_id "g996.t1"; gene_id "g996"; Scaffold_5 AUGUSTUS stop_codon 5040356 5040358 . + 0 transcript_id "g996.t1"; gene_id "g996"; # protein sequence = [MQKATAHLRKSRHAVWEIPPISLPSIKNPRTPYCSPEDPRIFHMFWSGDFTDKPYLALLSFLYTQNIGLHDTQSSKDV # CSPKLWLWINPGFMLTLKNPALSREKFEKIIQNQWAAPFLHPRFKGIIEFKFWNTTEQLDGVSELRDVWRFAPTLFNSGGHHIPGMPKTWGVQDEGTT # SVVEGHPNATSVPVSYSEPEKVAVVLSDMARFLLCHRFGGVYLDADTLFLRDWEELWGWKGAFAYRWSWHDNYNTAALKMSKGSALGSFILRTAFKND # FDFHPMTITNYLKDAHMEDLLFRLPDAMFDSAWLNMEGYQRERPPQPYFSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g996 ### # start gene g997 Scaffold_5 AUGUSTUS gene 5046327 5048243 0.2 - . g997 Scaffold_5 AUGUSTUS transcript 5046327 5048243 0.2 - . g997.t1 Scaffold_5 AUGUSTUS stop_codon 5046327 5046329 . - 0 transcript_id "g997.t1"; gene_id "g997"; Scaffold_5 AUGUSTUS CDS 5046327 5048243 0.2 - 0 transcript_id "g997.t1"; gene_id "g997"; Scaffold_5 AUGUSTUS start_codon 5048241 5048243 . - 0 transcript_id "g997.t1"; gene_id "g997"; # protein sequence = [MNVPKLARFPVLSMAKAKSAHTLDVFPWQSHVVGKMLNRYLAMGGWLDRSMALSEYYDIPLGHIEGDQPLQLSDITFA # RRLVQQDMVLWWSSSELPDLGGMETDKRPTDDLPKTEFTMPGAYSHVCLEIAVRNLAINSVVHSLVINELEGSGGSTAFDSVSRTLDEYAQGDGQKDI # SLGESNVPVQTFSILKAMVKAWLTDRLQGELEGVECPSVLTVDHFWRWISSSASNMYDPSLHRFVHGLMRKTFVQLLAEFKRLGSHVIYADFSKILLA # TSKPPGTAHAYATYINTAVTSHELFQHIYLRNDCFYDYLLFMDQANWGGIVCENPLALEPPEELSVMMKLNIAEFLPQPAQKEITSIIQYFVVSLFKI # RQKTNETARVPLRPLQNGDPPGATQHDFQMKDEVENVRQFIAGKLTRRMLRTVGNIQEQYREAMMNEETAVEWQFPVLPGSHLHMSNPPLEFIKFACA # IFQLAKEYHVEIGLVKRNALDLIGVKEFASEAIFRNPCEPLKLFNVPCKHCDALKDFDFCRDPELLPAQGETGPPKWVCFNCKGEYDRTLIEFSLIRV # VWAMERNFAGQDLKCSKCKQIQGDYVSRWCHCSGSYQLTIGKAEVKRKLKTVVNVAIVHNMNRLKVKIIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g997 ### # start gene g998 Scaffold_5 AUGUSTUS gene 5048743 5051145 0.18 - . g998 Scaffold_5 AUGUSTUS transcript 5048743 5051145 0.18 - . g998.t1 Scaffold_5 AUGUSTUS stop_codon 5048743 5048745 . - 0 transcript_id "g998.t1"; gene_id "g998"; Scaffold_5 AUGUSTUS CDS 5048743 5051145 0.18 - 0 transcript_id "g998.t1"; gene_id "g998"; Scaffold_5 AUGUSTUS start_codon 5051143 5051145 . - 0 transcript_id "g998.t1"; gene_id "g998"; # protein sequence = [MRDNPKRIDNPLIYHLDVAAMYPNIMLSNRLQPDSMVDESICAVCDYNRPGKTCDRRLEWAWRGEFFPSHRDEYNMIR # HALNQEIFPSKRPNGPQRRYADLSPAEQTALLHKRLGDYSRKVYKKTKDTKVENRESIVCQRENPFYVDTVRRFRDRRYEYKGLHKTWKKNLDTVINE # GRSLAEVDEAKKMIVLYDSLQLAHKCILNSFYGYVMRKGARWHSMEMAGITCLTGATIIQMARALVEQIGRPLELDTDGIWCMLPGVFPENFKFKLDN # GKSIGFSYPCTMLNHLVHAKFTNHQYHDLDLETGEYKIHSENSIFFELDGPYKAMILPSSKEEDKLLKKRYAVFNDDGSLAELKGFEVKRRGELQLIK # HFQSQIFEKFLLGSTTEECYKAVAQVADQWLDVLFSKAAALTDEELVELIAENRSMSKTLAEYGGQKSTSISTARRLAEFLGDQMVKDKGLACKFIIS # AKPIGAPVTDRAVPVAIFSAEESIKRVYLRKWLKDSSLIDFDLRSILDWNYYIERLGSVIQKLITIPAAMQKVSNPVPRIHHPDWLHRRVAGTIDKMK # QNKLTDFFRLATDVEAQEEESQLMDIEDWGGEGPSTQILLAPSEPHIVRQNIPEPGVAEEDKALPDPMISYSAWLKAMRPRWKRRRQGPDPRSVVVPS # MFSNVKVRADRRWDIVQIRPTGTLGRYMLWLSVDSELIPLPLRIARQFYVHLRTPKEEIFRTDFYSYEKVSRNLPRDLPCINLYKITVREDLYREISE # HFIDLTNDPNVDGVFELQVSASKDPPYCALTISRFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g998 ### # start gene g999 Scaffold_5 AUGUSTUS gene 5052101 5052865 0.66 - . g999 Scaffold_5 AUGUSTUS transcript 5052101 5052865 0.66 - . g999.t1 Scaffold_5 AUGUSTUS stop_codon 5052101 5052103 . - 0 transcript_id "g999.t1"; gene_id "g999"; Scaffold_5 AUGUSTUS CDS 5052101 5052865 0.66 - 0 transcript_id "g999.t1"; gene_id "g999"; Scaffold_5 AUGUSTUS start_codon 5052863 5052865 . - 0 transcript_id "g999.t1"; gene_id "g999"; # protein sequence = [MENSVEEWLKKKYEGLICRIVRDRKEDLKLPNHLMGHRRLYLQLCFRNVSDLLNVRRELLPLALANGAKRDAVDAYAE # VVNATSTGLANMDIAFEEEGWGNAGFSRNATFREDAREAIIDIREYDVPYYLRVAIDNDIRVGLWYAVSFTAGQPDFRHIAERVKRADPVVMAYDIET # TKAPLKFPDQATDQVMMISYMVDGQGYLITNREIVSEDIEDFEYTPMEGYEGPFIIFNEPNEVRTHFYFLDHLCSWRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g999 ### # start gene g1000 Scaffold_5 AUGUSTUS gene 5054274 5054861 0.9 + . g1000 Scaffold_5 AUGUSTUS transcript 5054274 5054861 0.9 + . g1000.t1 Scaffold_5 AUGUSTUS start_codon 5054274 5054276 . + 0 transcript_id "g1000.t1"; gene_id "g1000"; Scaffold_5 AUGUSTUS CDS 5054274 5054861 0.9 + 0 transcript_id "g1000.t1"; gene_id "g1000"; Scaffold_5 AUGUSTUS stop_codon 5054859 5054861 . + 0 transcript_id "g1000.t1"; gene_id "g1000"; # protein sequence = [MRLQHSIEPPAPGRGGTRKRKRDETSPPPTNGAALASGSGFRTFKVEQPWSNSETMDEADLDYENYTRAEAAHRRPPV # DEEEESALDVLPAHLKSQFDSSSRRVMGRSPEMVMYILTKAKHKYALQRQEALLAELTLASAELNRVRGEKDAMMDRVLHATFGCVVYLLRYGLLLTP # SPAALRPKFSQNPYRNLQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1000 ### # start gene g1001 Scaffold_5 AUGUSTUS gene 5057642 5058672 0.45 + . g1001 Scaffold_5 AUGUSTUS transcript 5057642 5058672 0.45 + . g1001.t1 Scaffold_5 AUGUSTUS start_codon 5057642 5057644 . + 0 transcript_id "g1001.t1"; gene_id "g1001"; Scaffold_5 AUGUSTUS CDS 5057642 5057940 0.58 + 0 transcript_id "g1001.t1"; gene_id "g1001"; Scaffold_5 AUGUSTUS CDS 5057997 5058672 0.5 + 1 transcript_id "g1001.t1"; gene_id "g1001"; Scaffold_5 AUGUSTUS stop_codon 5058670 5058672 . + 0 transcript_id "g1001.t1"; gene_id "g1001"; # protein sequence = [MDFSSPTPSLTPSIGSPPPFIPVQPDHFYRLDDSSGLPSSPRSLYGTTWYEPEDDRLASRGIPVFKPTMEEFRDFEAY # MNMVECWGKYSGIVKVIPPKECDALPSVKEQLSSVQIKTPIEQLMLGQTGLFRQQNMEKRKTMSVREWAEFCSQPEYRAPSVDEVGIHARTTVKAKTR # RTRKSKVTAKDEAGDLDLANQVLIKEEPVDSLTHDHILLSHSATPAGDDIKPKVKNNRRQQEKLTEVEKLERDASFLENFDPALDWLPFSMSPEDYTP # EFCAKLERHYWRNLGLGKAPWYGADTQGMLHRSSRLTTPLTTDLRLSFHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1001 ### # start gene g1002 Scaffold_5 AUGUSTUS gene 5060659 5061468 0.98 + . g1002 Scaffold_5 AUGUSTUS transcript 5060659 5061468 0.98 + . g1002.t1 Scaffold_5 AUGUSTUS start_codon 5060659 5060661 . + 0 transcript_id "g1002.t1"; gene_id "g1002"; Scaffold_5 AUGUSTUS CDS 5060659 5061468 0.98 + 0 transcript_id "g1002.t1"; gene_id "g1002"; Scaffold_5 AUGUSTUS stop_codon 5061466 5061468 . + 0 transcript_id "g1002.t1"; gene_id "g1002"; # protein sequence = [MGASLTPYSTSSTPQVTASQLPPVEATTTSPSYSTTSQYPYAAYNLYDYGKYLPQPSHASHGAPNMGASSTNHVSGPS # FTASYTHLAQSHYLQSAWQQQYQQLNLAQKYRPPAFYIAPQLSTQSGSPSLALNHTPSTSISPIAASTPTPIPTPISTPSYNSGSSSVNLMPTCIHPT # PIRTTGSISNTIQTSTPTLPSPIMQDPPSVTLPHAQSPSIAYTLSQSHMTHDTSTQAPVFDFDALKSLRPEQLAQLVRDNAQFRDIFQSAFQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1002 ### # start gene g1003 Scaffold_5 AUGUSTUS gene 5066070 5068187 0.91 - . g1003 Scaffold_5 AUGUSTUS transcript 5066070 5068187 0.91 - . g1003.t1 Scaffold_5 AUGUSTUS stop_codon 5066070 5066072 . - 0 transcript_id "g1003.t1"; gene_id "g1003"; Scaffold_5 AUGUSTUS CDS 5066070 5068187 0.91 - 0 transcript_id "g1003.t1"; gene_id "g1003"; Scaffold_5 AUGUSTUS start_codon 5068185 5068187 . - 0 transcript_id "g1003.t1"; gene_id "g1003"; # protein sequence = [MHGKVSRIRHDDRGCFRGVSQSIQSIRYHSLSAALTSLPSHLVVTAASEESGVIMGIRHRQFTLESVQYHPESILSEG # GDDLLRNFLALRGGFWEENPEARVLDTTLPPFHLDLPVTNKGTTSKSKVPSILNKIYTQRLADVSEAQKTPGTTLADLQTLLSLNIAPPLIPLLPRLK # QNTEDRPSLVAEIKRASPSKGPISVATSPAAQALTYALAGANTISVLTEPKWFLGSLQDMLHARMSVANLPNRPAILRKDFILSRYQVLESRIWGADS # ILLIVSMLSETLLRDLYQYSLELGMEPLIEVNNAKEMELALSLPAKVIGVNNRNLHDFQVDMTTTSRLSEMVKGKDVFLCALSGIVSADDVKKYASEG # VSAVLVGESLMRAKDPADYIRKLLSLPEPELAPREWRSEAPLVKICGVRNTEEALFIAEAGADMLGLMFVKKSSRYIDFDTGKSISEAIHTSKPTPSP # SNSLDDSSLNVPWFTSQVNRLSSIISRPLVVGVFQDASLSTILHAVSYCNLDMVQLHGSEPTEWARHIPVPVIRAFHVGKDSGIDGITRGGNHHFILL # DSMRDDGSGVSGGTGKVVDWNLAKRVIDAGEIIPDGATYNIAAAELAPEVVPTGSVETTTSESNGNIAEEPSPVRTNGDLNGHTTGHANGYAKRACKT # CTLSSSPTTPSKYLFPLFLLRIDTGEHRRGRIASSPVGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1003 ### # start gene g1004 Scaffold_5 AUGUSTUS gene 5083005 5084276 0.39 - . g1004 Scaffold_5 AUGUSTUS transcript 5083005 5084276 0.39 - . g1004.t1 Scaffold_5 AUGUSTUS stop_codon 5083005 5083007 . - 0 transcript_id "g1004.t1"; gene_id "g1004"; Scaffold_5 AUGUSTUS CDS 5083005 5084276 0.39 - 0 transcript_id "g1004.t1"; gene_id "g1004"; Scaffold_5 AUGUSTUS start_codon 5084274 5084276 . - 0 transcript_id "g1004.t1"; gene_id "g1004"; # protein sequence = [MGFKDEERREMIRYLMNRAHPDDGGWGMYVLLVIMLNSLTKHSSFSHVEGHSTVFGTALNYAALRILGVSADHPVCIR # ARGTLHKLGGACAIPSWGKFWLSILNVYDWAGNNPVPPELFVLPTQLPFHPHRWWIHTRNVYIPMSYLYGVRFSAPENDLILSLREELYPQNFYSIDW # PAQRNNVSEADLYAPHSKIFDGINIALSSYEMCSFPPLRKLALQKVYDLIVMEDENTAYQTLGPVSKMFNLIARVHNEGRESEAFKLHAEKRADFMWL # GAEGMMMCGTNGSQLWDLAFISQAVVETGLADLEENQGELIKALDWLEKGQMLDNPKHFEKAFRHRTKGAWGFSTREQGYTVSDCTGEGLKSAIYLQR # LEYVLCHVLLPNCFSTVLVSFLNSYPRNECAGPLTQCFPFKIPMADLLRMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1004 ### # start gene g1005 Scaffold_5 AUGUSTUS gene 5098495 5099175 0.72 - . g1005 Scaffold_5 AUGUSTUS transcript 5098495 5099175 0.72 - . g1005.t1 Scaffold_5 AUGUSTUS stop_codon 5098495 5098497 . - 0 transcript_id "g1005.t1"; gene_id "g1005"; Scaffold_5 AUGUSTUS CDS 5098495 5099175 0.72 - 0 transcript_id "g1005.t1"; gene_id "g1005"; Scaffold_5 AUGUSTUS start_codon 5099173 5099175 . - 0 transcript_id "g1005.t1"; gene_id "g1005"; # protein sequence = [MPEPSVGPTAVTGTSTPGGTSRMTAPLLPMPEPSSSSAYNSHVHQTPAGGNSRMTAPAISMPEPSVGSSSVEPFMPGS # FTPGGVSSGSRVTPAAVSMPEPTLPQYGPSGGSQGHPTPGGGDTGSRTTPGVVSMPEPTVPQFGSATPRNAGNVSMPEPSVPQFGVNGSSPAAASVSR # ITVPAVSMPEPTIPQVVPQANSTTTPVEGSSRMTAPAMSMPEPSVPMRKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1005 ### # start gene g1006 Scaffold_5 AUGUSTUS gene 5100127 5102780 0.21 - . g1006 Scaffold_5 AUGUSTUS transcript 5100127 5102780 0.21 - . g1006.t1 Scaffold_5 AUGUSTUS stop_codon 5100127 5100129 . - 0 transcript_id "g1006.t1"; gene_id "g1006"; Scaffold_5 AUGUSTUS CDS 5100127 5100922 0.97 - 1 transcript_id "g1006.t1"; gene_id "g1006"; Scaffold_5 AUGUSTUS CDS 5101559 5101693 0.24 - 1 transcript_id "g1006.t1"; gene_id "g1006"; Scaffold_5 AUGUSTUS CDS 5101867 5102780 0.92 - 0 transcript_id "g1006.t1"; gene_id "g1006"; Scaffold_5 AUGUSTUS start_codon 5102778 5102780 . - 0 transcript_id "g1006.t1"; gene_id "g1006"; # protein sequence = [MEREGRILKAKEDGRKEGFGEGLKRGRLVIAAAISAGDPYESRGLVGDGAAYIEEYDDESDNHRVQRQQRRRGKSRSR # VSRSKRSESTRERVNSSSTRPRASEPATPFSEPPPPPPSEPSRVPPPSESESQTIIIRRARSIQTDPSLFQSERTRSRTTSSTASPLSRHSLNQQQQQ # ILRAPSPPPQIFVQESPPPPLPPVISPPEQEEQSIKSEPFSPQIPQTPQQFPRPQVEISPIPIPPPISQVPFAPGIFPPSSFQQQPQFQYAPSEPVPQ # PPPVQPVYFPMPAPPAPAIRVVVTPAEKNAMEGTAFGGEEDFGDTRDTQGMTPDRSRNVEQWRMSLGGVSLSFELWSWCCASTGFVNGGVTGGIPVGF # YAHGNSSSHRDARRQDTQYPLYGAPGAIRGRGYDDNYSRSSSSGSSRSSSTTGSSSGTELGRPSKYARSKRSDARSDVSSRTRDRGLTSTFPPTMMSE # GGYGYGTNSSGESARIHREPLCMQLIWSRNQGGHTLGGIYAMPGISGNPNAQHSKRSLPQYGTVPAAAVGVAFNGASSRMAASNVPMPEPSVPQYGVT # PMPEPSVPQYQYDAAAARYSSPAGGTSNTKEWSLGSHTCLNPQYPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1006 ### # start gene g1007 Scaffold_5 AUGUSTUS gene 5105411 5107579 0.44 + . g1007 Scaffold_5 AUGUSTUS transcript 5105411 5107579 0.44 + . g1007.t1 Scaffold_5 AUGUSTUS start_codon 5105411 5105413 . + 0 transcript_id "g1007.t1"; gene_id "g1007"; Scaffold_5 AUGUSTUS CDS 5105411 5105509 0.48 + 0 transcript_id "g1007.t1"; gene_id "g1007"; Scaffold_5 AUGUSTUS CDS 5105642 5107579 1 + 0 transcript_id "g1007.t1"; gene_id "g1007"; Scaffold_5 AUGUSTUS stop_codon 5107577 5107579 . + 0 transcript_id "g1007.t1"; gene_id "g1007"; # protein sequence = [MQNIGYSQHKIHKEKEASEKGQIDDVDYHKIRCNDFHQDSPPPEDPPPPPPPPPPPPPPPPPPPPPPPMAPVEALPQI # ALNPYNSDIQIAQQYINALRAIELEQSGLSAAALDTLTHPIENPIEFGDSEEEKDVLFSLDLFIGLTRASEREYTSSRSAIQRRYPLSSLLSYAQVKL # QIASLTGIHPIIHDMCPQTCLAYTGPFQDHESCPRCSTTRYDPITNEPRQQFYTLPIGPYIQMLYRDSKTAELLGYFGERLQSILDQVQRGEPIEEFD # DICCGKDVIEALSCGKISLNDIFLMVSMDGAQLYRMKTSDSWLYIWILVGFSPDRRYKKKYIVPGGVIPGPNAPKITQSFLFPGLAHVAAVNKSGGLR # IWNAYSNVIRSSKLFIIMALADSLGLVYFSGGVGHSGKNGCRVWCGQSGRHKDGESMYYPVIFKPNAYIMPGCDFDDVDPAVVLAMDPQRYQQDLQLV # MASRTAADYSENRRETGIKVPSIFLGLHPHTYLGLPNMFPGDIMHLILNLADILIPLWRGSLHCDQSDDVSTWVWAVLKNKDTWDKHGADVANCTPYL # PGSFDRPPRNPAEKINSGYKAWEFLLYLFGLGPGLLYNVLPSNFGSLTASFVLGSVICINTRLLAINSKPCIFSLSNSVSSTNGYMYSAKSLEFILSD # KVFTTYAMLLPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1007 ### # start gene g1008 Scaffold_5 AUGUSTUS gene 5109501 5109977 0.81 - . g1008 Scaffold_5 AUGUSTUS transcript 5109501 5109977 0.81 - . g1008.t1 Scaffold_5 AUGUSTUS stop_codon 5109501 5109503 . - 0 transcript_id "g1008.t1"; gene_id "g1008"; Scaffold_5 AUGUSTUS CDS 5109501 5109977 0.81 - 0 transcript_id "g1008.t1"; gene_id "g1008"; Scaffold_5 AUGUSTUS start_codon 5109975 5109977 . - 0 transcript_id "g1008.t1"; gene_id "g1008"; # protein sequence = [MGIDEIVAVGGGEMEESSNVACGGESDDEAAFGVERVASSDDEGASGGEGGPRRDGEASCKDESIARGDDGALGEGVT # VARSDSEDVDGGVLAADEAMIGRASAVAIGGRDEEALDTASGADTTEEGAISDDVSITCRVEIEIVSTGERIRHCTRNLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1008 ### # start gene g1009 Scaffold_5 AUGUSTUS gene 5111777 5112112 0.8 + . g1009 Scaffold_5 AUGUSTUS transcript 5111777 5112112 0.8 + . g1009.t1 Scaffold_5 AUGUSTUS start_codon 5111777 5111779 . + 0 transcript_id "g1009.t1"; gene_id "g1009"; Scaffold_5 AUGUSTUS CDS 5111777 5112112 0.8 + 0 transcript_id "g1009.t1"; gene_id "g1009"; Scaffold_5 AUGUSTUS stop_codon 5112110 5112112 . + 0 transcript_id "g1009.t1"; gene_id "g1009"; # protein sequence = [MGIDEIVAVGGGEMEESSNVACGGESDDEAAFGVERVASSDDEGASGGEGGPRRDGEASCKDESIARGDDGALGEGVT # VARSDSEDVDGGVLAADEAMIGKSFCSCNWWKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1009 ### # start gene g1010 Scaffold_5 AUGUSTUS gene 5113863 5115302 0.44 - . g1010 Scaffold_5 AUGUSTUS transcript 5113863 5115302 0.44 - . g1010.t1 Scaffold_5 AUGUSTUS stop_codon 5113863 5113865 . - 0 transcript_id "g1010.t1"; gene_id "g1010"; Scaffold_5 AUGUSTUS CDS 5113863 5115302 0.44 - 0 transcript_id "g1010.t1"; gene_id "g1010"; Scaffold_5 AUGUSTUS start_codon 5115300 5115302 . - 0 transcript_id "g1010.t1"; gene_id "g1010"; # protein sequence = [MDGAQLYRMKTSDSWLYIWILVGFSPDRRYKKKYIVPGGVIPGPNAPKITQSFLFPGLAHVAAVNKSGGLRIWNAYSN # VIRSSKLFIIMALADSLGLVYFSGGVGHSGKNGCRVWCGQSGRHKDGESMYYPVIFKPNAYIMPGCDFDDVDPAVVLAMDPQRYQQDLQLVMASRTAA # DYSENRRETGIKVPSIFLGLHPHTYLGLPNMFPGDIMHLILNLADILIPLWRGSLHCDQSDDVSTWVWAVLKNKDTWDKHGADVANCTPYLPGSFDRP # PRNPAEKINSGYKAWEFLLYLFGLGPGLLYNVLPLEFWKSYCKLCAGIRYMYQYKITRNQLKTMHILLIQFSVEYERLYVQRKISRIHFVRQSIHYLR # HAAPEIERVGPGITYSQWTMERSIGNLTEEIGQHSNPYKNLSMRCLRRSQINSLMAAVPALDSDREKENKIPRGGLDLGNKFILLCKKDRRLHELELH # EFSTSIICS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1010 ### # start gene g1011 Scaffold_5 AUGUSTUS gene 5115359 5116332 0.91 - . g1011 Scaffold_5 AUGUSTUS transcript 5115359 5116332 0.91 - . g1011.t1 Scaffold_5 AUGUSTUS stop_codon 5115359 5115361 . - 0 transcript_id "g1011.t1"; gene_id "g1011"; Scaffold_5 AUGUSTUS CDS 5115359 5116099 0.97 - 0 transcript_id "g1011.t1"; gene_id "g1011"; Scaffold_5 AUGUSTUS CDS 5116225 5116332 0.98 - 0 transcript_id "g1011.t1"; gene_id "g1011"; Scaffold_5 AUGUSTUS start_codon 5116330 5116332 . - 0 transcript_id "g1011.t1"; gene_id "g1011"; # protein sequence = [MQNIGYSQHKIHKEKEASEKGQIDDVDYHKIRCVEYNDFHQDSPPPEDPPPPPPPPPPPPPPPPPPPPPMAPVEALPQ # IALNPYNSDIQIAQQYINALRAIELEQSGLSAAALDTLTHPIENPIEFGDSEEEKDVLFSLDLFIGLTRASEREYTSSRSAIQRRYPLSSLLSYAQVK # LQIASLTGIHPIIHDMCPQTCLAYTGPFQDHESCPRCSTTRYDPITNEPRQQFYTLPIGPYIQMLYRDSKTAELLGYFGERLQSILDQVQRGEPIEEF # DDICCGRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1011 ### # start gene g1012 Scaffold_5 AUGUSTUS gene 5120924 5121785 0.22 + . g1012 Scaffold_5 AUGUSTUS transcript 5120924 5121785 0.22 + . g1012.t1 Scaffold_5 AUGUSTUS start_codon 5120924 5120926 . + 0 transcript_id "g1012.t1"; gene_id "g1012"; Scaffold_5 AUGUSTUS CDS 5120924 5121172 0.25 + 0 transcript_id "g1012.t1"; gene_id "g1012"; Scaffold_5 AUGUSTUS CDS 5121273 5121785 0.53 + 0 transcript_id "g1012.t1"; gene_id "g1012"; Scaffold_5 AUGUSTUS stop_codon 5121783 5121785 . + 0 transcript_id "g1012.t1"; gene_id "g1012"; # protein sequence = [MSATSTLSQSTTLNHSMTGSLPGVDFLGLQGDLSRLTNTLRAVIEVGDPCWRGDECELSSGVRTGLEQVASHFGRHSE # LSESRLEYSWVSLIVFVQSQRDLYIAVRDLFIRHDRLSLDQVERLKKRVETTSLKLDGIKAAQKDGWQDDADKLVAAIEKDQATIAAQLSRRVFIRAW # SVWSPNSPCHSMLKKMMPSLTLPYSLWHELRVILHNRENTLLTVMTQSFGREEQEYAEAILNNWSSLTEAVEGMPFE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1012 ### # start gene g1013 Scaffold_5 AUGUSTUS gene 5133839 5135605 0.78 + . g1013 Scaffold_5 AUGUSTUS transcript 5133839 5135605 0.78 + . g1013.t1 Scaffold_5 AUGUSTUS start_codon 5133839 5133841 . + 0 transcript_id "g1013.t1"; gene_id "g1013"; Scaffold_5 AUGUSTUS CDS 5133839 5135605 0.78 + 0 transcript_id "g1013.t1"; gene_id "g1013"; Scaffold_5 AUGUSTUS stop_codon 5135603 5135605 . + 0 transcript_id "g1013.t1"; gene_id "g1013"; # protein sequence = [MVANQIVSIHQLHLTALLTFYPELAALTGVGDHTSSVLYPGRDTPTNRRRQQPPKPFDPNEDDPLDHTGSVKSDPSRE # HSQYIVAPSIQVRPEFSSLTRTHDVNQPLTCIVVIELPGKRVHAPVPGPAPQDYSASRRAEASSHSRQDTSHASPQPRRQQQMSESYSQDMHYNNSSG # HGHESLSSGSHKHNEQSAIIQEEDSPFNAITEDLRNRIIDWKGHPLSDLGPLQMYDLLSVRRDSLVREFYVYLFKEALICVVEEKKRSLGRLLSSGLA # DTASATSSTAQSKGVLRLKGRIYVRHIKQVTASSAAGEMSLTIDMEDELASFILIYKDRGSLEAWRNTIQALVNMFQSQNPSYQQPPQEEARVLEMEE # FGGNSKAMRMLSGSTSTTVSSGVDSLLQNGSSRSTMSSSTSHGSVLQQSQRPQMQQKLTTLGEADEMSQYDSPTGLVTPYTSSGPSNSLTPLPHPAMD # LIMVISLPPPNSSPSTAQLKLRVIKATLDFIIASLAAKDRLSLVTFEVGPGGRVRKTPFLSVSKGQSKTRLEKFVEDISTRPTSDPDGMGTGRVDEFL # VRVSKDEKTDVVTAVNHGKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1013 ### # start gene g1014 Scaffold_5 AUGUSTUS gene 5135756 5136424 0.67 + . g1014 Scaffold_5 AUGUSTUS transcript 5135756 5136424 0.67 + . g1014.t1 Scaffold_5 AUGUSTUS start_codon 5135756 5135758 . + 0 transcript_id "g1014.t1"; gene_id "g1014"; Scaffold_5 AUGUSTUS CDS 5135756 5136424 0.67 + 0 transcript_id "g1014.t1"; gene_id "g1014"; Scaffold_5 AUGUSTUS stop_codon 5136422 5136424 . + 0 transcript_id "g1014.t1"; gene_id "g1014"; # protein sequence = [MVLVSDASDSTRRAQMDLVLARAEAANVPIHSFGYGRSHDPASLWLMSNHTSGTYTFVKDWYDLRDSIAGCVGGMMSI # GLLNMKLHMKIVDGNRFRIRKVSGGPSSILASDGQNVDVDVGELRYGERKEMLIELELDNTDLQQRLARANGQGNRLDMRNMNATDRFVQSMGLDSLA # IDDVDLADGMMDRMIDEVPVVEVDGSFFDPAAAKTSLALHILCCLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1014 ### # start gene g1015 Scaffold_5 AUGUSTUS gene 5141417 5141961 0.7 + . g1015 Scaffold_5 AUGUSTUS transcript 5141417 5141961 0.7 + . g1015.t1 Scaffold_5 AUGUSTUS start_codon 5141417 5141419 . + 0 transcript_id "g1015.t1"; gene_id "g1015"; Scaffold_5 AUGUSTUS CDS 5141417 5141599 0.7 + 0 transcript_id "g1015.t1"; gene_id "g1015"; Scaffold_5 AUGUSTUS CDS 5141650 5141961 0.99 + 0 transcript_id "g1015.t1"; gene_id "g1015"; Scaffold_5 AUGUSTUS stop_codon 5141959 5141961 . + 0 transcript_id "g1015.t1"; gene_id "g1015"; # protein sequence = [MTTGPEIIEAVKSTPSTSSRVSSQKVDVVVCGAGTGGTISGISRAMKKTHNKDCIVVGVDPDGSILAVPSSLNTKTEG # DAYVVEGIGYDFIPDVLSRDPTDIDEWIKTNDTEAFDAVQALMRNEGLLVGGSSGSALSGTLKWLETRKDIAETLGLNVVVILPDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1015 ### # start gene g1016 Scaffold_5 AUGUSTUS gene 5143001 5145173 0.7 + . g1016 Scaffold_5 AUGUSTUS transcript 5143001 5145173 0.7 + . g1016.t1 Scaffold_5 AUGUSTUS start_codon 5143001 5143003 . + 0 transcript_id "g1016.t1"; gene_id "g1016"; Scaffold_5 AUGUSTUS CDS 5143001 5143960 0.7 + 0 transcript_id "g1016.t1"; gene_id "g1016"; Scaffold_5 AUGUSTUS CDS 5144016 5145173 0.98 + 0 transcript_id "g1016.t1"; gene_id "g1016"; Scaffold_5 AUGUSTUS stop_codon 5145171 5145173 . + 0 transcript_id "g1016.t1"; gene_id "g1016"; # protein sequence = [MKVRETLIPSVALDFIKAYECVASHPPHLARLEEDEIEWEEIVELSLNVVLRKPLRTPLAKDIPSQDPPSPSHTDNSE # MFVEDSLAYNEDEDMDALPGSKRRRGASQPGPAASKHPRYTTSKPVSAEQVACMSLLSVLFKSSSAPLLKSSIVRPVLRSLEGFFEIYSSETSLHHDF # LAATLSTLKHVSLNHKDDVVRFAANSWDRLLDLWGTKNKALKEGLVSILRMLFPFLTADPNIGESPTKPWIENLTKLWHLMCGQGDKRWNLDPLSLCA # VRLEVSTQDDYQKAFRAKTFRASAQLDPFQALTWAMLELQADCLAKLYQHFESNPVSSTQPQSTQSSKRPRLLENPVTSLLKSVQQPPMRIYNLQILL # FFIDRHWNTPHESMQSDIIRTLLDHVTNDDGTVQSWAFVCLAALASADCDNAASLLSSQTLSASAVPPTTIQTRYMTSVSTRGASTWDSVWTHAIRRT # NSPQVCRAACHTASILLVYANTGSARQSLVRSSLTSHRVLSEIETLAKDLDVQGPVAPFDSVCTFLSLCLKVANQDVRLYRMQLEEKVLTWLIDSWRP # AHMEDPEAPLYLVSDVLTLLEAICSSSQRSSLVCRVNLPQCLIVETLIAEEQTRVIRDYLLDAKLPSVKFDGSRPESSASPNESSDLGNATFMAPIPS # ETDLVQPRSRERKISCVLPKMPRISSITMAGRFRQYHSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1016 ### # start gene g1017 Scaffold_5 AUGUSTUS gene 5145661 5146452 0.73 + . g1017 Scaffold_5 AUGUSTUS transcript 5145661 5146452 0.73 + . g1017.t1 Scaffold_5 AUGUSTUS start_codon 5145661 5145663 . + 0 transcript_id "g1017.t1"; gene_id "g1017"; Scaffold_5 AUGUSTUS CDS 5145661 5146452 0.73 + 0 transcript_id "g1017.t1"; gene_id "g1017"; Scaffold_5 AUGUSTUS stop_codon 5146450 5146452 . + 0 transcript_id "g1017.t1"; gene_id "g1017"; # protein sequence = [MGQPSKLPADAMVVDDSFSTAGRSPSQSLGATLGTAAQISATRQVAGISILFLSVGPLLQQSAGEPTRDKELTELMLE # GAELDLDRFLLACPVYFNCIRNQTLNLSLNHLAQFITVLADHLVRYPNVKSEEFNLQMISFLDATLSLWISLANVNQNAADNFRELFDHYSKHLLRGR # LKHWKIRDSVARLYDRYLTLDPSQNAWMDQDEQTTSPMYILPMLIEDIDIRVRFRAVVINARLFEISKNPMALYDTIRQKYTTELEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1017 ### # start gene g1018 Scaffold_5 AUGUSTUS gene 5148162 5151429 0.16 + . g1018 Scaffold_5 AUGUSTUS transcript 5148162 5151429 0.16 + . g1018.t1 Scaffold_5 AUGUSTUS start_codon 5148162 5148164 . + 0 transcript_id "g1018.t1"; gene_id "g1018"; Scaffold_5 AUGUSTUS CDS 5148162 5149453 0.44 + 0 transcript_id "g1018.t1"; gene_id "g1018"; Scaffold_5 AUGUSTUS CDS 5149507 5149876 0.96 + 1 transcript_id "g1018.t1"; gene_id "g1018"; Scaffold_5 AUGUSTUS CDS 5150015 5150445 0.35 + 0 transcript_id "g1018.t1"; gene_id "g1018"; Scaffold_5 AUGUSTUS CDS 5150541 5151429 0.93 + 1 transcript_id "g1018.t1"; gene_id "g1018"; Scaffold_5 AUGUSTUS stop_codon 5151427 5151429 . + 0 transcript_id "g1018.t1"; gene_id "g1018"; # protein sequence = [MLDNHDDDGSRYAAYQTLRALMLTLPLDLFEVLSQFWPAEYRIEVCYLREFRLIATKRQIPELSSTLSAAKFIETAQD # FSAWISAFAILLADVLSASNPFYAQLCSILASHIPFTTTVLPLLVQTLLQSPDGNSHSLTLSRYFEQVLSSSKTAVLCRRSIIDIVLHLRHIDHDGRD # ALAYNQWLNVSFLSLAQNAITCGAYTTALLFLELDAEYRDRSGDDDVSRDTEQIMYEIYSNIDEPDGFYAIRTQDHHQFLMRRFHHEKEWGKAFRFHG # AALETDTQNATEIEGLLQSFHSYGFNHIATQTLLNSDQENPNIAYRLGWRAETWDLPESNDGYHPGASLYLALRAVHRERDQGVTDAVIRHVLFKEMD # HLRTLGSENIAQIREAIQSLMCLSQAIQWRSSSIQDLIVGKCTDVSKWSTFTTVESGFHFDDIESIMATRISLVKSARRKEQRHQIGTMHSPFSQTLL # DVEKICLLGLSQAARETRQNQIALNSVLRAKNLEDIPSFVITEEFASVLWAHKEEKHAVEYLKDLRRVGENSDPIWQARVTARLNAHDSEGRASVCHQ # FAKFAEAQYKAALDSPDLIRLNVYKERKEKELRHYEQLKHEQKGRIVDKNLANTIAAVQKVLAQDNKATSDFISSRDAYLKQAIEMYSRCLEASDKYD # ADVPIRFCSLWLSNFDYDPIQEKLHKALQRVPIDKTDSSSQKTLQPTMLQMCTEHPFHSLYQLYCLQPPKTQTKIDRRSSGRVSSGRTTELPPTGRSL # AAKIIFDKLLNDPKIRTRTAAVQELCDASLKFANFPVSQSKEKKVPDDQPIRTLHLSRGTVPVITAYTPIDPTMRYDPGNCVCVDKYAGEFDTAGGIN # LPKIIFCHGTDGKKYKQLVRTLTTIFLPSIFHHSFQFKGDQKDDLRQDAVMEQVFDLVNVVLNRDVETKRRNLYIRGYKVIPLASQAGILEFVGNTTT # LKSWLDRAHVRSVVLSVHGSQYSLDTPGTGLMT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1018 ### # start gene g1019 Scaffold_5 AUGUSTUS gene 5152037 5152417 0.68 + . g1019 Scaffold_5 AUGUSTUS transcript 5152037 5152417 0.68 + . g1019.t1 Scaffold_5 AUGUSTUS start_codon 5152037 5152039 . + 0 transcript_id "g1019.t1"; gene_id "g1019"; Scaffold_5 AUGUSTUS CDS 5152037 5152417 0.68 + 0 transcript_id "g1019.t1"; gene_id "g1019"; Scaffold_5 AUGUSTUS stop_codon 5152415 5152417 . + 0 transcript_id "g1019.t1"; gene_id "g1019"; # protein sequence = [MSDYKMKKQAEIDDSATTTTMIMKNPENERILTERLGIGINLDSTRAQEDADRALMGVSGKLSRNLSVAAAVRTLVAE # ATDTYNLGTIFYGASYLLRPKDIADIYYFVRLGTLLLTDLFSSFNFLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1019 ### # start gene g1020 Scaffold_5 AUGUSTUS gene 5152788 5153129 0.41 - . g1020 Scaffold_5 AUGUSTUS transcript 5152788 5153129 0.41 - . g1020.t1 Scaffold_5 AUGUSTUS stop_codon 5152788 5152790 . - 0 transcript_id "g1020.t1"; gene_id "g1020"; Scaffold_5 AUGUSTUS CDS 5152788 5153129 0.41 - 0 transcript_id "g1020.t1"; gene_id "g1020"; Scaffold_5 AUGUSTUS start_codon 5153127 5153129 . - 0 transcript_id "g1020.t1"; gene_id "g1020"; # protein sequence = [MERLNGQMFMGRPLKVRPGVPRSTRQNNDEENAVQDTPLQGVNRRPRRSPADFANNLAASLVFEGWERDAEVHWKGYA # DQGRRLYVGGLPQMTTHRAVNDAVRDIFKGYELYV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1020 ### # start gene g1021 Scaffold_5 AUGUSTUS gene 5160435 5161595 0.47 - . g1021 Scaffold_5 AUGUSTUS transcript 5160435 5161595 0.47 - . g1021.t1 Scaffold_5 AUGUSTUS stop_codon 5160435 5160437 . - 0 transcript_id "g1021.t1"; gene_id "g1021"; Scaffold_5 AUGUSTUS CDS 5160435 5161595 0.47 - 0 transcript_id "g1021.t1"; gene_id "g1021"; Scaffold_5 AUGUSTUS start_codon 5161593 5161595 . - 0 transcript_id "g1021.t1"; gene_id "g1021"; # protein sequence = [MTTLHKLLQAHILDFATAQRSSQNHVIFRTLCNWGYQRAPRGLEPILNLRLRAICPIWSYLQLSFVWKSSVLCFCRSF # ATTTYYNFEGRRVFEHFLQFHEINTTRYNPNNDRTKFIRVHSIDVFAGSSIDSWILQLQRLPEHPLKLPEYILRKIFQFACAPPTPPLPEVVYPEEDD # LAGASTADTWMEWLSKPGNSIVHLYLRRSSSNIEPDTRESEAQDPEPNLPRELWLRIFGYACDNPFPSVNSSVGEVASQCIITPRGHTAYILTFVCRL # WRELAENEPRLWTHITLSVDTPTSGTPSRVLKIMAELTRLYLRRSRPDSETRVAPPLSIVMQTPHTGPCELNWNCFIPASCVQTFARDDDVYHNASLS # CLYDRKAPFYGVYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1021 ### # start gene g1022 Scaffold_5 AUGUSTUS gene 5161728 5163293 0.62 - . g1022 Scaffold_5 AUGUSTUS transcript 5161728 5163293 0.62 - . g1022.t1 Scaffold_5 AUGUSTUS stop_codon 5161728 5161730 . - 0 transcript_id "g1022.t1"; gene_id "g1022"; Scaffold_5 AUGUSTUS CDS 5161728 5163293 0.62 - 0 transcript_id "g1022.t1"; gene_id "g1022"; Scaffold_5 AUGUSTUS start_codon 5163291 5163293 . - 0 transcript_id "g1022.t1"; gene_id "g1022"; # protein sequence = [MAPLTIEVTSNYWLTPRVVDAVSEGLKHLPRINELHLSASRDNMDKLLSGINSPAPFLRTLYLDIGRSDYYYHSRAEP # YILPEDFLGGDASRLSHIELTRCHLRWDSSLLRNISFLKVHNPGPPAPTLDQFIGALSGMPQLEILDLENTLPGTSDTEHTEKPGVSLPRLRKLRTVG # SLQECAIFLEHVVVPSNATIHIMAKCSDIPDEGSPTIQLIHDVCQRLPVARETATTSSATNSPLIKSLLVQSMGIGSGLIVEAWNSVAKSRPTTNALT # PSREISLNPLATAPSIGWLKLEFTWQSAVIRQIHNDVVVAICRPLPLAQLRHLHIRNGYQDSVNSPTFARTFGTLPKVNSLTVEGTSTYEFVDALNYH # TGSQSATGYNGLASSSSSNPNPGRPTLAFPALRTLKLLEADFDRDHEAENTLLEPLMDCLMHRYEHKSEIHKLILERCSHLNSEDVAELQGIVADVDW # DHIECGYSDTEDEDMDDEFDDEMDDVFGGEAYFGYGASYISSDEDMMFMGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1022 ### # start gene g1023 Scaffold_5 AUGUSTUS gene 5163953 5164880 0.25 + . g1023 Scaffold_5 AUGUSTUS transcript 5163953 5164880 0.25 + . g1023.t1 Scaffold_5 AUGUSTUS start_codon 5163953 5163955 . + 0 transcript_id "g1023.t1"; gene_id "g1023"; Scaffold_5 AUGUSTUS CDS 5163953 5163998 0.36 + 0 transcript_id "g1023.t1"; gene_id "g1023"; Scaffold_5 AUGUSTUS CDS 5164052 5164440 0.72 + 2 transcript_id "g1023.t1"; gene_id "g1023"; Scaffold_5 AUGUSTUS CDS 5164542 5164880 0.58 + 0 transcript_id "g1023.t1"; gene_id "g1023"; Scaffold_5 AUGUSTUS stop_codon 5164878 5164880 . + 0 transcript_id "g1023.t1"; gene_id "g1023"; # protein sequence = [MDSSELYHVKQQFVLGAYKTLVDLTLPDPISPDFLPILIYQARSHIALNNPKAALQLVPADSENVALKAVATLAKFVA # AEGTADKEALLEELRDLSVEIEGDDVEGTDRDKATVRVLAGTAFARAGELEEALETLGADTEDPEAFKEYERSKRWAEDDLLLQLIESLIGLATGKDG # YHNPYTFYTEQLGNPSLSSPHVLTARGVTRILRNEFPEAQSDLQESLEQYKDDAEALAASAVASGLSSTKKGETDANELWA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1023 ### # start gene g1024 Scaffold_5 AUGUSTUS gene 5171699 5172172 0.7 + . g1024 Scaffold_5 AUGUSTUS transcript 5171699 5172172 0.7 + . g1024.t1 Scaffold_5 AUGUSTUS start_codon 5171699 5171701 . + 0 transcript_id "g1024.t1"; gene_id "g1024"; Scaffold_5 AUGUSTUS CDS 5171699 5172172 0.7 + 0 transcript_id "g1024.t1"; gene_id "g1024"; Scaffold_5 AUGUSTUS stop_codon 5172170 5172172 . + 0 transcript_id "g1024.t1"; gene_id "g1024"; # protein sequence = [MIFIAVKTAPYELTTVFIQLSKREPGDYLNPYVKNLQTRGAGLFGAKNTDGDGEMIELQPLRTCKLEIRSLSYFDKKT # VDISFVEDLVLKAAQERNLFEGAHVEFVPEWKYSSEQCPSEPIVLNVNPVDVKQGVKCASDCRWNWVGQILVIITWSMP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1024 ### # start gene g1025 Scaffold_5 AUGUSTUS gene 5189386 5190952 0.29 - . g1025 Scaffold_5 AUGUSTUS transcript 5189386 5190952 0.29 - . g1025.t1 Scaffold_5 AUGUSTUS stop_codon 5189386 5189388 . - 0 transcript_id "g1025.t1"; gene_id "g1025"; Scaffold_5 AUGUSTUS CDS 5189386 5189621 1 - 2 transcript_id "g1025.t1"; gene_id "g1025"; Scaffold_5 AUGUSTUS CDS 5190156 5190162 0.99 - 0 transcript_id "g1025.t1"; gene_id "g1025"; Scaffold_5 AUGUSTUS CDS 5190249 5190446 1 - 0 transcript_id "g1025.t1"; gene_id "g1025"; Scaffold_5 AUGUSTUS CDS 5190531 5190688 0.98 - 2 transcript_id "g1025.t1"; gene_id "g1025"; Scaffold_5 AUGUSTUS CDS 5190754 5190952 0.4 - 0 transcript_id "g1025.t1"; gene_id "g1025"; Scaffold_5 AUGUSTUS start_codon 5190950 5190952 . - 0 transcript_id "g1025.t1"; gene_id "g1025"; # protein sequence = [MRLFAQLVLQLYECKCADDFATADVAAGTGGMDASIGWETDRPENVGSAFNDSLSFFAPFVNRHVSMADLIALSVVTS # VGVCSSPNIHIPLRGGRVDASEGGTFGVPEPETDISDHAQPGLTACGHTLGNVHHAGFPQVGECALLHFNLVCFRAYWALVGPEAVTPNNTGGGVHFD # STVDVFDVLRGDSPGSIETAAPPLLCVTTTTYHASEHKGTGIFGDTFFHVFNTTIDPTLGISSFDVNVEDSTAKAVALLDTPSRTEYLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1025 ### # start gene g1026 Scaffold_5 AUGUSTUS gene 5194284 5194775 0.66 - . g1026 Scaffold_5 AUGUSTUS transcript 5194284 5194775 0.66 - . g1026.t1 Scaffold_5 AUGUSTUS stop_codon 5194284 5194286 . - 0 transcript_id "g1026.t1"; gene_id "g1026"; Scaffold_5 AUGUSTUS CDS 5194284 5194775 0.66 - 0 transcript_id "g1026.t1"; gene_id "g1026"; Scaffold_5 AUGUSTUS start_codon 5194773 5194775 . - 0 transcript_id "g1026.t1"; gene_id "g1026"; # protein sequence = [MMDVDEQEAVQLQPSQPPPPPQQARNSRISSAVVFVDDNHPFDLDSYISNYTGRAAIDRLTHIVSVCPSVAVDAFTLA # VRLIQKARDPGLFQTLCHAYEQVSAYSDVKLPSISELPAIQTKWTDDTLKKNQSEKMKLEAELKNYSNNMIKESIRVSRLVSSFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1026 ### # start gene g1027 Scaffold_5 AUGUSTUS gene 5205831 5206565 0.41 + . g1027 Scaffold_5 AUGUSTUS transcript 5205831 5206565 0.41 + . g1027.t1 Scaffold_5 AUGUSTUS start_codon 5205831 5205833 . + 0 transcript_id "g1027.t1"; gene_id "g1027"; Scaffold_5 AUGUSTUS CDS 5205831 5206565 0.41 + 0 transcript_id "g1027.t1"; gene_id "g1027"; Scaffold_5 AUGUSTUS stop_codon 5206563 5206565 . + 0 transcript_id "g1027.t1"; gene_id "g1027"; # protein sequence = [MNDPSSITKYYIDPILANPSGHDLLSDILIAYFQSQTCTAWAVLTGSSYDAVPQRHSESGTADNAHGLFGGMGPRKGV # VPEPGMGKGKEDVDVDGNRIKLELPDTSKAHVPLLHVPPGRMNTKPNDARPYEEIAPYCVSANDLVNPLPLSLFSGSGWFSYHPTGASAAGGAALETK # AHYWYSSLPTSKIRIPILVGAGDIGVYYILEPRKDVREGSSIQCWVDDNFAGAKTLENAADVGEPQPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1027 ### # start gene g1028 Scaffold_5 AUGUSTUS gene 5207113 5207928 0.99 + . g1028 Scaffold_5 AUGUSTUS transcript 5207113 5207928 0.99 + . g1028.t1 Scaffold_5 AUGUSTUS start_codon 5207113 5207115 . + 0 transcript_id "g1028.t1"; gene_id "g1028"; Scaffold_5 AUGUSTUS CDS 5207113 5207928 0.99 + 0 transcript_id "g1028.t1"; gene_id "g1028"; Scaffold_5 AUGUSTUS stop_codon 5207926 5207928 . + 0 transcript_id "g1028.t1"; gene_id "g1028"; # protein sequence = [MSSVSSSTSTSPSSGPSKEKLDSEGSVKDISSNSFPKDTEENSTTAQEITEKPSEKDAESIEFNASGSAIPGSAASST # PWQAIYSPQYNAYYFFNAETNETTWENPLVTAPDSTTPNPALENPTNSSSPAVAPVEEAFDGAALSSYNALQAAAIAQGIDPSLAHLDPSLAGPIPGS # SSGAYGAAAKFNARTGQFTRLDGRDPSHLSEYERAKRMSEFYFDVNAWEKQRAHEQEAEAEAGGNEKKRKRPSKKDLVCNLYMILSLYFLNQFST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1028 ### # start gene g1029 Scaffold_5 AUGUSTUS gene 5209654 5210133 0.99 - . g1029 Scaffold_5 AUGUSTUS transcript 5209654 5210133 0.99 - . g1029.t1 Scaffold_5 AUGUSTUS stop_codon 5209654 5209656 . - 0 transcript_id "g1029.t1"; gene_id "g1029"; Scaffold_5 AUGUSTUS CDS 5209654 5210133 0.99 - 0 transcript_id "g1029.t1"; gene_id "g1029"; Scaffold_5 AUGUSTUS start_codon 5210131 5210133 . - 0 transcript_id "g1029.t1"; gene_id "g1029"; # protein sequence = [MSLVPVLSEEEFGVIVSEEEEETVSVDMLDTAGSVEEDTTEGLYVGDEVKEIVAVVSATEVGEGCEIVGDPDKAFPVV # VEFIDVDVSVCVDVDVIDERLPVEELPDSEVVAGVVVGDREFDVTFSEEEEDVVSAGSVGRDAPVRVDAVSVTEVVEGKYI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1029 ### # start gene g1030 Scaffold_5 AUGUSTUS gene 5210160 5210429 0.92 - . g1030 Scaffold_5 AUGUSTUS transcript 5210160 5210429 0.92 - . g1030.t1 Scaffold_5 AUGUSTUS stop_codon 5210160 5210162 . - 0 transcript_id "g1030.t1"; gene_id "g1030"; Scaffold_5 AUGUSTUS CDS 5210160 5210429 0.92 - 0 transcript_id "g1030.t1"; gene_id "g1030"; Scaffold_5 AUGUSTUS start_codon 5210427 5210429 . - 0 transcript_id "g1030.t1"; gene_id "g1030"; # protein sequence = [MEVPSVDIVSEIAEKVVLKFEEVDCDIVDMEEIADGDEVEREVVEKVGIVPPLDDDSKDIVLDISEIVSVDVESKLVL # EVMETEDSDGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1030 ### # start gene g1031 Scaffold_5 AUGUSTUS gene 5210893 5212035 0.96 + . g1031 Scaffold_5 AUGUSTUS transcript 5210893 5212035 0.96 + . g1031.t1 Scaffold_5 AUGUSTUS start_codon 5210893 5210895 . + 0 transcript_id "g1031.t1"; gene_id "g1031"; Scaffold_5 AUGUSTUS CDS 5210893 5212035 0.96 + 0 transcript_id "g1031.t1"; gene_id "g1031"; Scaffold_5 AUGUSTUS stop_codon 5212033 5212035 . + 0 transcript_id "g1031.t1"; gene_id "g1031"; # protein sequence = [MYNRILRKKAAIIGVIVAGVLIVVGGILVLFYAIRNRRRRVLRRTRSPDTNHTERSGRVLIQGRSPSLTSRPLTAQEW # QPPLVSEVVEDEREDEDEQFYNGQYQGPVTLPVVQREDYGSIMAAVHSYAAVGNDDPSRSSSVLPRHQADDEKEQIASPVKHLISFEEAESNTTRAVS # QASEAYHGWVQADISTPDPFADPESESHFSLISPDTLSKYRPLSQFGASSSLIFSPLSSPKLFDPGVNSGEPNRLRGGGNSTPGSAGIAVDPEPFFDP # YTSHTPITNFDLPSRPSSLLNPPIRPKFTGTLTNLAFSSGPPVLPPITPVASPGESIDSYHPDGLLDPALLESRSSESTGRPGGGASSESLVDYVDYT # RPISSVRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1031 ### # start gene g1032 Scaffold_5 AUGUSTUS gene 5220646 5220921 0.76 - . g1032 Scaffold_5 AUGUSTUS transcript 5220646 5220921 0.76 - . g1032.t1 Scaffold_5 AUGUSTUS stop_codon 5220646 5220648 . - 0 transcript_id "g1032.t1"; gene_id "g1032"; Scaffold_5 AUGUSTUS CDS 5220646 5220921 0.76 - 0 transcript_id "g1032.t1"; gene_id "g1032"; Scaffold_5 AUGUSTUS start_codon 5220919 5220921 . - 0 transcript_id "g1032.t1"; gene_id "g1032"; # protein sequence = [MEGIAQFTYFIHDTGMSGRGLRIRIHAHKFAFVPSKQSGVNSNLPKPEPKESTGQKVKWADKLTSKKTFDPDDPLEPK # GAGAWGKKLAHNE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1032 ### # start gene g1033 Scaffold_5 AUGUSTUS gene 5222610 5223104 0.69 - . g1033 Scaffold_5 AUGUSTUS transcript 5222610 5223104 0.69 - . g1033.t1 Scaffold_5 AUGUSTUS stop_codon 5222610 5222612 . - 0 transcript_id "g1033.t1"; gene_id "g1033"; Scaffold_5 AUGUSTUS CDS 5222610 5223104 0.69 - 0 transcript_id "g1033.t1"; gene_id "g1033"; Scaffold_5 AUGUSTUS start_codon 5223102 5223104 . - 0 transcript_id "g1033.t1"; gene_id "g1033"; # protein sequence = [MLTRSSVPVNSCTVARLADGPLDGRAVLLANDTAWETVDADVEVVLVLLVEEKGIDAVELEGEEETDEVYEPIGSVVL # DTPEEVYVVGVINVTLEVDVKEGVGGERLPGSGEALDIGIIGSGRVLDAEDLCISFLPERGCAPGKTSSTNIEHSTVLHFLHIELG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1033 ### # start gene g1034 Scaffold_5 AUGUSTUS gene 5225641 5225904 0.53 - . g1034 Scaffold_5 AUGUSTUS transcript 5225641 5225904 0.53 - . g1034.t1 Scaffold_5 AUGUSTUS stop_codon 5225641 5225643 . - 0 transcript_id "g1034.t1"; gene_id "g1034"; Scaffold_5 AUGUSTUS CDS 5225641 5225904 0.53 - 0 transcript_id "g1034.t1"; gene_id "g1034"; Scaffold_5 AUGUSTUS start_codon 5225902 5225904 . - 0 transcript_id "g1034.t1"; gene_id "g1034"; # protein sequence = [MSSTPEHLVETLELHVRRDLSDEDVLKLTRWAWEKCVGALTGGVGRSIDLTEDVGGDVKNGYGNGGPKVGVRGEMVKA # DVTVGVVRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1034 ### # start gene g1035 Scaffold_5 AUGUSTUS gene 5227412 5228410 1 - . g1035 Scaffold_5 AUGUSTUS transcript 5227412 5228410 1 - . g1035.t1 Scaffold_5 AUGUSTUS stop_codon 5227412 5227414 . - 0 transcript_id "g1035.t1"; gene_id "g1035"; Scaffold_5 AUGUSTUS CDS 5227412 5228410 1 - 0 transcript_id "g1035.t1"; gene_id "g1035"; Scaffold_5 AUGUSTUS start_codon 5228408 5228410 . - 0 transcript_id "g1035.t1"; gene_id "g1035"; # protein sequence = [MSALSVSSSLPENRNTLSPSSSLGDATGQEVAKPGQGQESQNNYDSKQHNRRHSRLHSRNLSIFFPRPGSLPANSISE # DGAQELEFPSSYSDVDVEALPMPSAGSSVSFPSSGRRTTTSLQNGINGQLTPLGANFTFGGRPGRPPALSGPTTVPTPPLMSNGPSSASSTSSRRGHH # HKHSLSHNFFSFLEPGAGGLPRAGAGVGVEQEQELYTQPTPTPMSPWNPISPFPKSAGMAPGSAGRAHDHSHSQSLNYSHFPPTPTLPTGPTASSSSL # PISAPILMLISNHLTPPSPHPRWHFHSPSSNSSLGLPLGVWTADWVPGYHGVGVLGCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1035 ### # start gene g1036 Scaffold_5 AUGUSTUS gene 5231621 5232031 0.35 - . g1036 Scaffold_5 AUGUSTUS transcript 5231621 5232031 0.35 - . g1036.t1 Scaffold_5 AUGUSTUS stop_codon 5231621 5231623 . - 0 transcript_id "g1036.t1"; gene_id "g1036"; Scaffold_5 AUGUSTUS CDS 5231621 5232031 0.35 - 0 transcript_id "g1036.t1"; gene_id "g1036"; Scaffold_5 AUGUSTUS start_codon 5232029 5232031 . - 0 transcript_id "g1036.t1"; gene_id "g1036"; # protein sequence = [MIKMYKAEVLGKLPVMQHFLFGSIIPYEGPPPPMDEDFVVDAHIGHTHPHPSLGNVGSSHTNEASGVSPRDIAGGWGD # CCGIPVPSAFGAARAEQQGNTHHSNMLPMDRFGGGGGGGGPGASIGLIGKGIRPVPFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1036 ### # start gene g1037 Scaffold_5 AUGUSTUS gene 5232570 5232986 0.41 - . g1037 Scaffold_5 AUGUSTUS transcript 5232570 5232986 0.41 - . g1037.t1 Scaffold_5 AUGUSTUS stop_codon 5232570 5232572 . - 0 transcript_id "g1037.t1"; gene_id "g1037"; Scaffold_5 AUGUSTUS CDS 5232570 5232986 0.41 - 0 transcript_id "g1037.t1"; gene_id "g1037"; Scaffold_5 AUGUSTUS start_codon 5232984 5232986 . - 0 transcript_id "g1037.t1"; gene_id "g1037"; # protein sequence = [MVPSSPPPRKCILTPAQLAWFQTSDTHKLIVEYIEMLNESVVGAKLSDEVVESEAVKAILAILDQVESIARDTPPVDN # SSSRFGNPAFRTFYDKLQRSRPPYTLKSHLSHLKPSQKYLFTLSNRGVTAPGLITEVEWR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1037 ### # start gene g1038 Scaffold_5 AUGUSTUS gene 5233393 5234469 0.48 + . g1038 Scaffold_5 AUGUSTUS transcript 5233393 5234469 0.48 + . g1038.t1 Scaffold_5 AUGUSTUS start_codon 5233393 5233395 . + 0 transcript_id "g1038.t1"; gene_id "g1038"; Scaffold_5 AUGUSTUS CDS 5233393 5234469 0.48 + 0 transcript_id "g1038.t1"; gene_id "g1038"; Scaffold_5 AUGUSTUS stop_codon 5234467 5234469 . + 0 transcript_id "g1038.t1"; gene_id "g1038"; # protein sequence = [MQLDPANQKTIIDIQNETSNMKGKRKAVEIDPSDADEDDGDDEVAMDVDVRLEEGIDIDSPPTPPALVPMSTPTSITA # LRAKLHAKMASLRRGGGGASGANKVELGAGLETGSRDDLLEERRQQRAAMRERRRKETKEKIKRDNTNSNNKDASAKLTKVRWISLSRTFTYYTTLQT # QLLVNDPTAAIIASQNPNSKLTHVSFSGLSSKPHPSSSSNPTQALSQLVSHNQKLASLPSSKQKAIEEKERFEKASARLEGVKVLDDEARLRKAIKRK # EKEKGKSKKEWGDRKEKVEMAIKAKQKKRGDNIAMRNERRSEKRKGIKAKKGGAHISKGSKGGKARPGFEGKAFGKSGGKGKGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1038 ### # start gene g1039 Scaffold_5 AUGUSTUS gene 5236437 5237462 0.82 - . g1039 Scaffold_5 AUGUSTUS transcript 5236437 5237462 0.82 - . g1039.t1 Scaffold_5 AUGUSTUS stop_codon 5236437 5236439 . - 0 transcript_id "g1039.t1"; gene_id "g1039"; Scaffold_5 AUGUSTUS CDS 5236437 5237462 0.82 - 0 transcript_id "g1039.t1"; gene_id "g1039"; Scaffold_5 AUGUSTUS start_codon 5237460 5237462 . - 0 transcript_id "g1039.t1"; gene_id "g1039"; # protein sequence = [MARRVTGQEFVTAFVAGVEAELKLGLAVWPEHYDVGWHDTSTTGSIGAAVAVSKILGLDIPTTQQAIGIACTQVIGMQ # EFFGSDTKSFHIGRAAQGGMIGALLAQSGFTSSLQGLEAQFGWVHVVSTRENVTAEFDQLGEVWEILSNTFKPYPCGIVMHPSIQGAIEVQSAALGQG # LRIQDITSVEARVNPETLVLTGQTDPETGLEGKFSVYHGIAVGLLFGQATPSQFTDSVVTNATVVALRKLVNVTTDSTINEDEAYVSAVFQDGTNVTQ # HIVHVIGSIDNPLNETQLKDKFMGQASLVLGEERAGKAYDAFMGIGNVSDVGLVVKMFSGVNGTNKM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1039 ### # start gene g1040 Scaffold_5 AUGUSTUS gene 5252068 5253702 0.49 + . g1040 Scaffold_5 AUGUSTUS transcript 5252068 5253702 0.49 + . g1040.t1 Scaffold_5 AUGUSTUS start_codon 5252068 5252070 . + 0 transcript_id "g1040.t1"; gene_id "g1040"; Scaffold_5 AUGUSTUS CDS 5252068 5253702 0.49 + 0 transcript_id "g1040.t1"; gene_id "g1040"; Scaffold_5 AUGUSTUS stop_codon 5253700 5253702 . + 0 transcript_id "g1040.t1"; gene_id "g1040"; # protein sequence = [MPGSKVWTNSPLVHEAREGVMEFLLSNHPLDCPICDQGGECDLQDQSMRYGSDRTRFHEIAGKRAVENKDLGPLVKTS # MNRCIQCTRCVRFANEVAGVEELGTTGRGNDLQIGMYVEKTMDSELSGNVVDLCPVGALTSKPYAFTARPWELKNTESVDVLDALGSNIRIDSRGVQV # MRIQPKTNDDVNEEWISDKTRYSYDGLRFQRLTSPLVKQGDRFVGATWEEALTAIANGLAASGAKDNEIQAVAGHLADTESLVALKDLINRLGSDNLA # LDQAGGYSAPVHGIDVRSNYLFNSTIPGVEEADVILLVGTNPRHEAAVLNSRIRKSWLHTGLEVGLIGEQVDTTYGYDYLGADAKALSDFIAGKGEFA # KKFKAAKKPLIIVGSALAEHADGATAFNELSRFVELNKETLVTPEWNGFSVLQRIASRPAAYDIGFVPSPTASKTKAKFIYLLNADEIDPSRIPRDAF # VVYQGHHGDIGAQLADVCLPGAAYTEKSSTWINTEGRTQLGRAAVPPPGASREDWKIIRLVNLTEHLVNFLSIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1040 ### # start gene g1041 Scaffold_5 AUGUSTUS gene 5254380 5255150 0.38 + . g1041 Scaffold_5 AUGUSTUS transcript 5254380 5255150 0.38 + . g1041.t1 Scaffold_5 AUGUSTUS start_codon 5254380 5254382 . + 0 transcript_id "g1041.t1"; gene_id "g1041"; Scaffold_5 AUGUSTUS CDS 5254380 5255150 0.38 + 0 transcript_id "g1041.t1"; gene_id "g1041"; Scaffold_5 AUGUSTUS stop_codon 5255148 5255150 . + 0 transcript_id "g1041.t1"; gene_id "g1041"; # protein sequence = [MVSKSPNFDACIYTNSLRLDWYDNEHAPLRITVPGFLTAARYKALDTPPKAFPKWLALYDLTSREVMQSHEYKDLRLK # ASDNERRVIGNLETLNRRVYELVNSSESISEGSETLKGSTANANGSESDKAVKFLYVVHMQVVKNGQDESRYKTQEDHLVQWYTSTRIPQLALAPGYI # RSRIFRLTEHAELAGRAAKKVQLQSPPTLLAIHEWRVDGAEVINSEFKMCMTDTEPWKMEGEEAVAVMEDRMFELYKVFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1041 ### # start gene g1042 Scaffold_5 AUGUSTUS gene 5259735 5261015 0.88 - . g1042 Scaffold_5 AUGUSTUS transcript 5259735 5261015 0.88 - . g1042.t1 Scaffold_5 AUGUSTUS stop_codon 5259735 5259737 . - 0 transcript_id "g1042.t1"; gene_id "g1042"; Scaffold_5 AUGUSTUS CDS 5259735 5260128 0.97 - 1 transcript_id "g1042.t1"; gene_id "g1042"; Scaffold_5 AUGUSTUS CDS 5260193 5260557 0.89 - 0 transcript_id "g1042.t1"; gene_id "g1042"; Scaffold_5 AUGUSTUS CDS 5260716 5261015 0.89 - 0 transcript_id "g1042.t1"; gene_id "g1042"; Scaffold_5 AUGUSTUS start_codon 5261013 5261015 . - 0 transcript_id "g1042.t1"; gene_id "g1042"; # protein sequence = [MASIQTNVLPKSYTLPSVANASIAGPSSSRLLPVGPAYISHLRLTIHHDHSFEAHDAHLEKERQRLEEIQNSAANGDD # DLGVGDEPESEELLALDPKEWKSRYLVFIADRKKVLKHHPDKKASSTAPQSTSSLLTGVNLNTNDDAFFKCIAKAHEVLTNPEKRRQYDSVDHELMDA # QEDDPIPSTFAKANKSLSDAEFFKIFTPIFERESRFSKKTACADARWRSFEWLDKEINEGSDNRDDKRYTEKKNKSERARRKKEDIARLRLLVDLTLR # LAADFSSPSTSSNAVRDFAILFSFDPRIKRIKQQEKEAREAKKAAKSAPASGAATPQKSKAQEEEERERRKRRKRFAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1042 ### # start gene g1043 Scaffold_5 AUGUSTUS gene 5263073 5263474 0.84 + . g1043 Scaffold_5 AUGUSTUS transcript 5263073 5263474 0.84 + . g1043.t1 Scaffold_5 AUGUSTUS start_codon 5263073 5263075 . + 0 transcript_id "g1043.t1"; gene_id "g1043"; Scaffold_5 AUGUSTUS CDS 5263073 5263474 0.84 + 0 transcript_id "g1043.t1"; gene_id "g1043"; Scaffold_5 AUGUSTUS stop_codon 5263472 5263474 . + 0 transcript_id "g1043.t1"; gene_id "g1043"; # protein sequence = [MASRYSSASVASASAVAMHSHTHHVPSSNPGSSRKAWIDPASLPNQGDISSVSGNAPDYVKQLNYNTYYSYGVGGEDS # FGHKVGKEVKFVDVNINRKLDRQERLEATTVAEVVVNKCLFDLSFYSYSLGSTFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1043 ### # start gene g1044 Scaffold_5 AUGUSTUS gene 5272079 5273300 0.54 + . g1044 Scaffold_5 AUGUSTUS transcript 5272079 5273300 0.54 + . g1044.t1 Scaffold_5 AUGUSTUS start_codon 5272079 5272081 . + 0 transcript_id "g1044.t1"; gene_id "g1044"; Scaffold_5 AUGUSTUS CDS 5272079 5272276 0.55 + 0 transcript_id "g1044.t1"; gene_id "g1044"; Scaffold_5 AUGUSTUS CDS 5272569 5273300 0.96 + 0 transcript_id "g1044.t1"; gene_id "g1044"; Scaffold_5 AUGUSTUS stop_codon 5273298 5273300 . + 0 transcript_id "g1044.t1"; gene_id "g1044"; # protein sequence = [MNRQSTIQHQRLEAVTDLSQLTGISDDVIVACIRERFMADNIYTNVGTSALVALNPHKYVSSNADNPGPAAEFVLESF # GNARTLFNPNASRFGKYTELQFSERGRLTGVKTLEYYLERNRVAGAPSGERNFHIFYYLVAGATPEERQHLHLIDKTAYRYLGQRNVTARSNGAQDDD # AVRFEQLKVALKTIGLSKRHVAQTCQLLAAILHLGNLEFVIDRSRNEDAAVVRNTDVCAIVADFLGVPPGELEQSLSYRSKMVKKEMCTIFLDPDGAS # DNRDDLAKALYSPSSSPGSMNTSINACARTIFLLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1044 ### # start gene g1045 Scaffold_5 AUGUSTUS gene 5273330 5276416 0.11 + . g1045 Scaffold_5 AUGUSTUS transcript 5273330 5276416 0.11 + . g1045.t1 Scaffold_5 AUGUSTUS start_codon 5273330 5273332 . + 0 transcript_id "g1045.t1"; gene_id "g1045"; Scaffold_5 AUGUSTUS CDS 5273330 5274364 0.93 + 0 transcript_id "g1045.t1"; gene_id "g1045"; Scaffold_5 AUGUSTUS CDS 5274430 5274933 0.13 + 0 transcript_id "g1045.t1"; gene_id "g1045"; Scaffold_5 AUGUSTUS CDS 5275451 5276416 0.22 + 0 transcript_id "g1045.t1"; gene_id "g1045"; Scaffold_5 AUGUSTUS stop_codon 5276414 5276416 . + 0 transcript_id "g1045.t1"; gene_id "g1045"; # protein sequence = [MTSRPNSLDQFCINFANEKLQHWTQKRLFESHVNEYAAEGISRFVPSIAYFDNTECIRLLQNKPGGLVHIMDDQARRQ # PKKTNHTMVEAFQKRWGNHSSFKTGNIDRSGFPTFTVSHYNGAVTYSSENFIERNQDELNSDFVNLLRGIEGMEGTGSINPFVKGLFSGKQIATTAHP # RNEDTIVAAQQNVKPMRAPSTRRKGTIKRMSTVKEGVEATDDDDGVGNTSGFGGSSNGTACVAGEFRVALDTLFETLDDTQSWHVFCINPNDSQLPNQ # LEGRSVKGQVRSLGLTEIAKRCVNVFEVNMMPEEFCDRYKEGLQEAGVVGGDERDKVEYAKSALGLNENDIVFLSQAAFHLLEDQLRSRDVEEQKRNR # LRDAEAEGGLEPRGAGDPYAPYSYPNADGEAAWSAGHNENYGSSNQHLPLVANASPFQRADLYDDGDDRSLHSEDFDARSKFTSQRDDSVSNFGSESY # APSRNMFQNADKAALANKEALPGEIQEGETTEVIKESSARRRWYHDFRINTNDSRPDWYFESMVTMRYTSRVGFLGYTKDEIKDMSTSGKSVGIYDGM # IYDVTSYVSSQPSLIAPPGFQAPADTDKNFMDPSVIDIFKFNNGGDITKSLNALVPNTISSQVLERQKVCLRNLFLIGKVDNRNSPQCLFSKYILLAL # SLFMVSVIGFKFLASINFSAARAPEDHDKFVICQVPCYTEGDSSLRRTIDTLAQMKYDDKRKLLVVICDGMIVGSGNDRPTPRIVLDILGADPNLDPE # PLSFLSLGEGAKQHNMGKIYSGLYECAGHVVPYMVIVKVGKPNERSRPGNRGKRDSQLILMHFLNKVGRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1045 ### # start gene g1046 Scaffold_5 AUGUSTUS gene 5288449 5289468 0.96 + . g1046 Scaffold_5 AUGUSTUS transcript 5288449 5289468 0.96 + . g1046.t1 Scaffold_5 AUGUSTUS start_codon 5288449 5288451 . + 0 transcript_id "g1046.t1"; gene_id "g1046"; Scaffold_5 AUGUSTUS CDS 5288449 5289468 0.96 + 0 transcript_id "g1046.t1"; gene_id "g1046"; Scaffold_5 AUGUSTUS stop_codon 5289466 5289468 . + 0 transcript_id "g1046.t1"; gene_id "g1046"; # protein sequence = [MKEEEQGEKEEQDTISIGSQIPPSPELPKLPKNTTLLTAHSIIPMRPLGPPQKEDWAAFADTPQGEEWDRFHPAVAKI # RNRLLAEAEAESYRRGSESRFRSLSGSTSGSDSDSCFGRLLTGSADSVSDPIHTSAAPTSEAEQVLAIPHTSAENTMDLLDTLNTVDTPALDPPPVEL # RDDDDGGGVKSVPQGTATLGSAESWESDPGGSGGSIVTTITIAGGENGGNTEDAVSQKSSESFTSMELKLLNNSSTMLNTNADANGDTSTDRKPSSRK # SGRRARKLAPDLEREREGKSFSLLSSLRELLRKEEEKGVKNRVGKMTVKWMDPPIQSSQIPRTRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1046 ### # start gene g1047 Scaffold_5 AUGUSTUS gene 5291177 5291464 0.57 + . g1047 Scaffold_5 AUGUSTUS transcript 5291177 5291464 0.57 + . g1047.t1 Scaffold_5 AUGUSTUS start_codon 5291177 5291179 . + 0 transcript_id "g1047.t1"; gene_id "g1047"; Scaffold_5 AUGUSTUS CDS 5291177 5291464 0.57 + 0 transcript_id "g1047.t1"; gene_id "g1047"; Scaffold_5 AUGUSTUS stop_codon 5291462 5291464 . + 0 transcript_id "g1047.t1"; gene_id "g1047"; # protein sequence = [MDGIEQSYREMVEEERDTVEERMVEEEWEEIREQEDMRVKADERESWMMGGYEQESGMELGMDLGEEAEAEQMESDRE # LKQVKSYEEDEKINDYP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1047 ### # start gene g1048 Scaffold_5 AUGUSTUS gene 5294619 5295445 0.46 - . g1048 Scaffold_5 AUGUSTUS transcript 5294619 5295445 0.46 - . g1048.t1 Scaffold_5 AUGUSTUS stop_codon 5294619 5294621 . - 0 transcript_id "g1048.t1"; gene_id "g1048"; Scaffold_5 AUGUSTUS CDS 5294619 5294970 0.59 - 1 transcript_id "g1048.t1"; gene_id "g1048"; Scaffold_5 AUGUSTUS CDS 5295075 5295445 0.46 - 0 transcript_id "g1048.t1"; gene_id "g1048"; Scaffold_5 AUGUSTUS start_codon 5295443 5295445 . - 0 transcript_id "g1048.t1"; gene_id "g1048"; # protein sequence = [MELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPE # VDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPDRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEE # EYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1048 ### # start gene g1049 Scaffold_5 AUGUSTUS gene 5295882 5296898 0.44 - . g1049 Scaffold_5 AUGUSTUS transcript 5295882 5296898 0.44 - . g1049.t1 Scaffold_5 AUGUSTUS stop_codon 5295882 5295884 . - 0 transcript_id "g1049.t1"; gene_id "g1049"; Scaffold_5 AUGUSTUS CDS 5295882 5296580 0.8 - 0 transcript_id "g1049.t1"; gene_id "g1049"; Scaffold_5 AUGUSTUS CDS 5296724 5296733 0.92 - 1 transcript_id "g1049.t1"; gene_id "g1049"; Scaffold_5 AUGUSTUS CDS 5296816 5296898 0.5 - 0 transcript_id "g1049.t1"; gene_id "g1049"; Scaffold_5 AUGUSTUS start_codon 5296896 5296898 . - 0 transcript_id "g1049.t1"; gene_id "g1049"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLDDIVTDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLA # IFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTN # EQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVLITAIFAFKSSLFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1049 ### # start gene g1050 Scaffold_5 AUGUSTUS gene 5302335 5302697 0.47 + . g1050 Scaffold_5 AUGUSTUS transcript 5302335 5302697 0.47 + . g1050.t1 Scaffold_5 AUGUSTUS start_codon 5302335 5302337 . + 0 transcript_id "g1050.t1"; gene_id "g1050"; Scaffold_5 AUGUSTUS CDS 5302335 5302697 0.47 + 0 transcript_id "g1050.t1"; gene_id "g1050"; Scaffold_5 AUGUSTUS stop_codon 5302695 5302697 . + 0 transcript_id "g1050.t1"; gene_id "g1050"; # protein sequence = [MRSATGCVVLGLFSSEIFEAEQSVLGFGNSWKDAKIYKDLKASAAHNHLEAINEVVKRLRNLDRVTFQEIDSHDGTTN # VWDDLYLAMTNPALYKQKVEDLSGDKKGLIWNVEKLLAKSRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1050 ### # start gene g1051 Scaffold_5 AUGUSTUS gene 5305031 5305372 0.49 + . g1051 Scaffold_5 AUGUSTUS transcript 5305031 5305372 0.49 + . g1051.t1 Scaffold_5 AUGUSTUS start_codon 5305031 5305033 . + 0 transcript_id "g1051.t1"; gene_id "g1051"; Scaffold_5 AUGUSTUS CDS 5305031 5305372 0.49 + 0 transcript_id "g1051.t1"; gene_id "g1051"; Scaffold_5 AUGUSTUS stop_codon 5305370 5305372 . + 0 transcript_id "g1051.t1"; gene_id "g1051"; # protein sequence = [MSSSRTTTIGSIPVTGRQPTPPVAPTRPSTPDPSDEERELELQLERTWEKNRRQKEEKKKAKEEAKRKAEEERERQEA # AARAANARRGGGGGREEEENSGSGSGAEPSGTLTW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1051 ### # start gene g1052 Scaffold_5 AUGUSTUS gene 5312882 5313232 0.95 + . g1052 Scaffold_5 AUGUSTUS transcript 5312882 5313232 0.95 + . g1052.t1 Scaffold_5 AUGUSTUS start_codon 5312882 5312884 . + 0 transcript_id "g1052.t1"; gene_id "g1052"; Scaffold_5 AUGUSTUS CDS 5312882 5313232 0.95 + 0 transcript_id "g1052.t1"; gene_id "g1052"; Scaffold_5 AUGUSTUS stop_codon 5313230 5313232 . + 0 transcript_id "g1052.t1"; gene_id "g1052"; # protein sequence = [MSTPVPPAPNTSADDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPLSEEIGIRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1052 ### # command line: # augustus --species=saccharomyces split/input_1/input_1.fa_chunk_0000010