# This output was generated with AUGUSTUS (version 3.4.0). # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de), # O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff. # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), # Using native and syntenically mapped cDNA alignments to improve de novo gene finding # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 # No extrinsic information on sequences given. # Sources of extrinsic information: M RM # Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ... # saccharomyces version. Using default transition matrix. # Looks like split/input_1/input_1.fa_chunk_0000009 is in fasta format. # We have hints for 0 sequences and for 0 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 3600692, name = Scaffold_3) ----- # # Predicted genes for sequence number 1 on both strands # start gene g1 Scaffold_3 AUGUSTUS gene 1113 1763 0.55 + . g1 Scaffold_3 AUGUSTUS transcript 1113 1763 0.55 + . g1.t1 Scaffold_3 AUGUSTUS start_codon 1113 1115 . + 0 transcript_id "g1.t1"; gene_id "g1"; Scaffold_3 AUGUSTUS CDS 1113 1763 0.55 + 0 transcript_id "g1.t1"; gene_id "g1"; Scaffold_3 AUGUSTUS stop_codon 1761 1763 . + 0 transcript_id "g1.t1"; gene_id "g1"; # protein sequence = [MNFELKDTFMVIRYWNYLNCRKHPKPFAPTGRYTEERKEIIDKNHPEGFLWERERDLMHEMMCKQEAGFAWEPSEAGT # FKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARS # FSGRSCGGTLDLYVGYDEQELDQLSREHDDVSKRRMDHIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1 ### # start gene g2 Scaffold_3 AUGUSTUS gene 4331 5382 0.62 - . g2 Scaffold_3 AUGUSTUS transcript 4331 5382 0.62 - . g2.t1 Scaffold_3 AUGUSTUS stop_codon 4331 4333 . - 0 transcript_id "g2.t1"; gene_id "g2"; Scaffold_3 AUGUSTUS CDS 4331 5002 0.69 - 0 transcript_id "g2.t1"; gene_id "g2"; Scaffold_3 AUGUSTUS CDS 5086 5382 0.62 - 0 transcript_id "g2.t1"; gene_id "g2"; Scaffold_3 AUGUSTUS start_codon 5380 5382 . - 0 transcript_id "g2.t1"; gene_id "g2"; # protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKA # LSMELHYTSGYHPEADGQTERFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPE # FPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSK # LDRRYKRCPLRYYIRWAGYEGTDDEFSGLLLMNYMLTNWYPHSTLDTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g2 ### # start gene g3 Scaffold_3 AUGUSTUS gene 8192 9875 0.44 - . g3 Scaffold_3 AUGUSTUS transcript 8192 9875 0.44 - . g3.t1 Scaffold_3 AUGUSTUS stop_codon 8192 8194 . - 0 transcript_id "g3.t1"; gene_id "g3"; Scaffold_3 AUGUSTUS CDS 8192 8520 0.9 - 2 transcript_id "g3.t1"; gene_id "g3"; Scaffold_3 AUGUSTUS CDS 9115 9542 0.58 - 1 transcript_id "g3.t1"; gene_id "g3"; Scaffold_3 AUGUSTUS CDS 9583 9875 0.76 - 0 transcript_id "g3.t1"; gene_id "g3"; Scaffold_3 AUGUSTUS start_codon 9873 9875 . - 0 transcript_id "g3.t1"; gene_id "g3"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRPPYGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNMTIWMTIPAVYRVVSLVTPVDLVVLVVPAVP # AVLVDLVDLVLPSPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDASGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQ # SGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g3 ### # start gene g4 Scaffold_3 AUGUSTUS gene 10581 10847 0.68 + . g4 Scaffold_3 AUGUSTUS transcript 10581 10847 0.68 + . g4.t1 Scaffold_3 AUGUSTUS start_codon 10581 10583 . + 0 transcript_id "g4.t1"; gene_id "g4"; Scaffold_3 AUGUSTUS CDS 10581 10847 0.68 + 0 transcript_id "g4.t1"; gene_id "g4"; Scaffold_3 AUGUSTUS stop_codon 10845 10847 . + 0 transcript_id "g4.t1"; gene_id "g4"; # protein sequence = [MPEEHIAQVVLEWPPCHDKTEVRAFLGTASQLRMFIATLLGKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINLIGMFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g4 ### # start gene g5 Scaffold_3 AUGUSTUS gene 11219 12725 0.13 + . g5 Scaffold_3 AUGUSTUS transcript 11219 12725 0.13 + . g5.t1 Scaffold_3 AUGUSTUS start_codon 11219 11221 . + 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_3 AUGUSTUS CDS 11219 11318 0.26 + 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_3 AUGUSTUS CDS 11380 11505 0.99 + 2 transcript_id "g5.t1"; gene_id "g5"; Scaffold_3 AUGUSTUS CDS 11630 11806 0.92 + 2 transcript_id "g5.t1"; gene_id "g5"; Scaffold_3 AUGUSTUS CDS 12202 12725 0.49 + 2 transcript_id "g5.t1"; gene_id "g5"; Scaffold_3 AUGUSTUS stop_codon 12723 12725 . + 0 transcript_id "g5.t1"; gene_id "g5"; # protein sequence = [MANKTSRSNPEDYVDENGGEPINLLWEMGKRKSPQEADDIELDVQEALDEERSYEIRRNHMLESKTQHVKSSVGIYES # LGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDSWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGG # DVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDATKLQSYEDLNEN # IDIQLKIGISNQVNWSRLGILELKRVWIENVSKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g5 ### # start gene g6 Scaffold_3 AUGUSTUS gene 12844 13035 0.7 + . g6 Scaffold_3 AUGUSTUS transcript 12844 13035 0.7 + . g6.t1 Scaffold_3 AUGUSTUS start_codon 12844 12846 . + 0 transcript_id "g6.t1"; gene_id "g6"; Scaffold_3 AUGUSTUS CDS 12844 13035 0.7 + 0 transcript_id "g6.t1"; gene_id "g6"; Scaffold_3 AUGUSTUS stop_codon 13033 13035 . + 0 transcript_id "g6.t1"; gene_id "g6"; # protein sequence = [MKIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g6 ### # start gene g7 Scaffold_3 AUGUSTUS gene 13320 13691 0.97 - . g7 Scaffold_3 AUGUSTUS transcript 13320 13691 0.97 - . g7.t1 Scaffold_3 AUGUSTUS stop_codon 13320 13322 . - 0 transcript_id "g7.t1"; gene_id "g7"; Scaffold_3 AUGUSTUS CDS 13320 13691 0.97 - 0 transcript_id "g7.t1"; gene_id "g7"; Scaffold_3 AUGUSTUS start_codon 13689 13691 . - 0 transcript_id "g7.t1"; gene_id "g7"; # protein sequence = [MLLLKSYSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASD # ASFATAQSIPTTGSEDTVVTPTEMLFQSLRPSNEPLLHSLVVLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g7 ### # start gene g8 Scaffold_3 AUGUSTUS gene 26835 27359 0.96 - . g8 Scaffold_3 AUGUSTUS transcript 26835 27359 0.96 - . g8.t1 Scaffold_3 AUGUSTUS stop_codon 26835 26837 . - 0 transcript_id "g8.t1"; gene_id "g8"; Scaffold_3 AUGUSTUS CDS 26835 27359 0.96 - 0 transcript_id "g8.t1"; gene_id "g8"; Scaffold_3 AUGUSTUS start_codon 27357 27359 . - 0 transcript_id "g8.t1"; gene_id "g8"; # protein sequence = [MAYSYPRCVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGY # HPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVSFERKSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g8 ### # start gene g9 Scaffold_3 AUGUSTUS gene 37359 37742 0.98 - . g9 Scaffold_3 AUGUSTUS transcript 37359 37742 0.98 - . g9.t1 Scaffold_3 AUGUSTUS stop_codon 37359 37361 . - 0 transcript_id "g9.t1"; gene_id "g9"; Scaffold_3 AUGUSTUS CDS 37359 37742 0.98 - 0 transcript_id "g9.t1"; gene_id "g9"; Scaffold_3 AUGUSTUS start_codon 37740 37742 . - 0 transcript_id "g9.t1"; gene_id "g9"; # protein sequence = [MDTQQQAFDTLRKAFISAPILALWTPDRPTRIEVDASGFATGSALMQKQDDGQWHPVAFKSASMQPAERNYEIYDWEM # LAIIEALKDYPSPLTSSLITLTLNFGAQLKTSPAAKPAGLYTFHGLTST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g9 ### # start gene g10 Scaffold_3 AUGUSTUS gene 38310 39038 0.99 - . g10 Scaffold_3 AUGUSTUS transcript 38310 39038 0.99 - . g10.t1 Scaffold_3 AUGUSTUS stop_codon 38310 38312 . - 0 transcript_id "g10.t1"; gene_id "g10"; Scaffold_3 AUGUSTUS CDS 38310 39038 0.99 - 0 transcript_id "g10.t1"; gene_id "g10"; Scaffold_3 AUGUSTUS start_codon 39036 39038 . - 0 transcript_id "g10.t1"; gene_id "g10"; # protein sequence = [MGERTTFSKAPWVTIEEVPDEEISYSHLAAANTESPIPELPNLEPPAESPHIEVPLEATLEESESAVVEEPPIHQIQA # NHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRAKPVKTFEEMVPEQYRDFKKVFSESASEQLPAHQPWDHAIDLIPGAPVTMRTKIYPMSL # NEQEELDRFLEENLRKGYICPLQITHLVPSLLCEEEGWKTPFRTGLPETERVYCEELLPLPLVADN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g10 ### # start gene g11 Scaffold_3 AUGUSTUS gene 39949 40563 0.86 - . g11 Scaffold_3 AUGUSTUS transcript 39949 40563 0.86 - . g11.t1 Scaffold_3 AUGUSTUS stop_codon 39949 39951 . - 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_3 AUGUSTUS CDS 39949 40563 0.86 - 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_3 AUGUSTUS start_codon 40561 40563 . - 0 transcript_id "g11.t1"; gene_id "g11"; # protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFNAENPP # FGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAI # SVDVYLHDPTMTGRNSGYPPTYRSYYPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g11 ### # start gene g12 Scaffold_3 AUGUSTUS gene 41771 43873 0.44 - . g12 Scaffold_3 AUGUSTUS transcript 41771 43873 0.44 - . g12.t1 Scaffold_3 AUGUSTUS stop_codon 41771 41773 . - 0 transcript_id "g12.t1"; gene_id "g12"; Scaffold_3 AUGUSTUS CDS 41771 43873 0.44 - 0 transcript_id "g12.t1"; gene_id "g12"; Scaffold_3 AUGUSTUS start_codon 43871 43873 . - 0 transcript_id "g12.t1"; gene_id "g12"; # protein sequence = [MNGKGPFVIKYAAPIIFLFSPSRRLXLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPA # TFQALMNAIFADLIAAGKVAVYLDDILIFSSDLQEHRRVVREVLIRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPAPTNLR # ELRGFLGFANFYRRFIRNFARIARPLNDLTRKDISFTWMDTQQQAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFR # SASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRINTQADALSRMAAHQVL # DNEDNRQQTVLKPNHFTKIAASILRNPLEDRIRKASQREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNDLRTEVLRQCHDHPT # AGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCETCARKKIQRHPRAVTQPLDVPLGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHALPCTSS # ITAEGVADIYYKEIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSR # THSALGMSPFELTYGYLPLFNIPVGQRSGIPAVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g12 ### # start gene g13 Scaffold_3 AUGUSTUS gene 45197 45649 0.43 - . g13 Scaffold_3 AUGUSTUS transcript 45197 45649 0.43 - . g13.t1 Scaffold_3 AUGUSTUS stop_codon 45197 45199 . - 0 transcript_id "g13.t1"; gene_id "g13"; Scaffold_3 AUGUSTUS CDS 45197 45649 0.43 - 0 transcript_id "g13.t1"; gene_id "g13"; Scaffold_3 AUGUSTUS start_codon 45647 45649 . - 0 transcript_id "g13.t1"; gene_id "g13"; # protein sequence = [MTGRNSGHTPTHAAHTTLADPPLWTLMQPTLAMGILGRHSLPACEDDASAVVPKVMSSKTAHTEKLPAVTVDAEDIWK # QSAKTSSWDSDETEADASNLDASRYPLRDPHHSPYSQMNPSRLLPRPQHLPLQPYLLLRAPLTRTFLTRLVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g13 ### # start gene g14 Scaffold_3 AUGUSTUS gene 45800 46306 0.98 - . g14 Scaffold_3 AUGUSTUS transcript 45800 46306 0.98 - . g14.t1 Scaffold_3 AUGUSTUS stop_codon 45800 45802 . - 0 transcript_id "g14.t1"; gene_id "g14"; Scaffold_3 AUGUSTUS CDS 45800 46306 0.98 - 0 transcript_id "g14.t1"; gene_id "g14"; Scaffold_3 AUGUSTUS start_codon 46304 46306 . - 0 transcript_id "g14.t1"; gene_id "g14"; # protein sequence = [MSTPIPPATPAPPASAEDLMTQLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS # QAKLIKSALGFFTESAGDWATPHLLHFNAEHPPFGGNWEEFLKEFVQRFESVDPGMEARSEIKNLKQSKGQTVAEFAQKFKDIGGSDWNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g14 ### # start gene g15 Scaffold_3 AUGUSTUS gene 51241 51741 0.37 + . g15 Scaffold_3 AUGUSTUS transcript 51241 51741 0.37 + . g15.t1 Scaffold_3 AUGUSTUS start_codon 51241 51243 . + 0 transcript_id "g15.t1"; gene_id "g15"; Scaffold_3 AUGUSTUS CDS 51241 51741 0.37 + 0 transcript_id "g15.t1"; gene_id "g15"; Scaffold_3 AUGUSTUS stop_codon 51739 51741 . + 0 transcript_id "g15.t1"; gene_id "g15"; # protein sequence = [MQPGQALRQMFSTILLFCNPQNPADLWNDFRVHICDDLHYRLRVLGRTNPTTEDIFDYGLYLLDRLLQESGHFLEDFA # GMPLPIQDWTAQVENTFIAEQLDYDCESERERGEQDVAIMNPEQRIAFEQVMESVEMENGKLFFLNGPGGTGKTFVYKALCHAILPVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g15 ### # start gene g16 Scaffold_3 AUGUSTUS gene 60827 61528 0.9 - . g16 Scaffold_3 AUGUSTUS transcript 60827 61528 0.9 - . g16.t1 Scaffold_3 AUGUSTUS stop_codon 60827 60829 . - 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_3 AUGUSTUS CDS 60827 61528 0.9 - 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_3 AUGUSTUS start_codon 61526 61528 . - 0 transcript_id "g16.t1"; gene_id "g16"; # protein sequence = [MDESLSELTQIHDIQTEMDNKEEWNSKTLEYRREREGTLRQLERHASSYTTLGRSTVELLKLFTAETKKPFMMPEIVD # KLAAMLDYNLEALVGPRMQNLKVRQPEKLRFDPKALLSDVLQIFLNLSDQPEFMKAIAGDGRSYSKGLFEQAERIMFRRSLKSGTDLEKWRLLITKVE # EAKETLEAEEDLGDIPDEFLGMNASCHYFCRANHHSRSAHVLHNERSGHTSHITYHH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g16 ### # start gene g17 Scaffold_3 AUGUSTUS gene 63557 64045 0.98 - . g17 Scaffold_3 AUGUSTUS transcript 63557 64045 0.98 - . g17.t1 Scaffold_3 AUGUSTUS stop_codon 63557 63559 . - 0 transcript_id "g17.t1"; gene_id "g17"; Scaffold_3 AUGUSTUS CDS 63557 64045 0.98 - 0 transcript_id "g17.t1"; gene_id "g17"; Scaffold_3 AUGUSTUS start_codon 64043 64045 . - 0 transcript_id "g17.t1"; gene_id "g17"; # protein sequence = [MSNLPDANIRRLLGPPELVAPLLSLSTLSTPLYSSNTASANTLSPTDVELFLQDLARRFEPDNEIDEVLGDVVRQLLF # HESLFRPEGLGGAVATWRGVVGGLEALVSVKSIAVMITRMPEWIPANATAANFEKLSLMGPLCRLGVFAREWVSLLSKIDYPLY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g17 ### # start gene g18 Scaffold_3 AUGUSTUS gene 66950 68584 0.93 - . g18 Scaffold_3 AUGUSTUS transcript 66950 68584 0.93 - . g18.t1 Scaffold_3 AUGUSTUS stop_codon 66950 66952 . - 0 transcript_id "g18.t1"; gene_id "g18"; Scaffold_3 AUGUSTUS CDS 66950 68584 0.93 - 0 transcript_id "g18.t1"; gene_id "g18"; Scaffold_3 AUGUSTUS start_codon 68582 68584 . - 0 transcript_id "g18.t1"; gene_id "g18"; # protein sequence = [MFPEFFFFCKNSTQYHTGIDFTVPAPLTILPPRPPIQPPPIPAPSHPTLVSEDFSKIAKAPTQVAIAAFYSSVEPYLR # VIKEEDVGFLSWEGDDIEPFVMPKLGRHYLEVWEEQDRLGLTTSSSALGTLQQVALNGGDIPPNPSAVAPNPSFDPSTLSESDTQLEHLGHGPLTERL # ISALLPMPDSHLTWKGVKAAEDAMEGRPGGSGAAASRKEKLSVSDLERRIGDTMRWYNLLPSGSNVQPLDYSNKTDDPIATALRINQAELRRVSAINR # LRKARYAEIARDRVAWAEYLELRESIDRNITNVYNKLQKMQKAQRDAPKLGRKKKFKSEESTPVKGVNGSNGNGSVNGDTPPLPLCPAALGLGPDEDN # QLVVSETLKQLVQTRRNWVKLGETLLDEKEGPLEVIELMEPGESSPEPNAEDLSSSPGVNDSSSSKWRVPVMERPRRGRLVGFPKESIFKGIEEEVEE # LMRDWERHNVEREQAEGQAKIPTTTNSRVGATTVPHSNDTSTSGSGLKIHLNGHVQATYGKGKGKARDDQMDVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g18 ### # start gene g19 Scaffold_3 AUGUSTUS gene 72351 75396 0.66 + . g19 Scaffold_3 AUGUSTUS transcript 72351 75396 0.66 + . g19.t1 Scaffold_3 AUGUSTUS start_codon 72351 72353 . + 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_3 AUGUSTUS CDS 72351 73822 0.96 + 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_3 AUGUSTUS CDS 74718 75396 0.84 + 1 transcript_id "g19.t1"; gene_id "g19"; Scaffold_3 AUGUSTUS stop_codon 75394 75396 . + 0 transcript_id "g19.t1"; gene_id "g19"; # protein sequence = [MKFFSGKGGDGCAAFHREKFLPFGPPSGGNGGRGGDVYILPTPELTTLTSVAKRVRGENGGNGQGTWQNGKNGAPLII # RVPLGTIVRELPRDDPRRAKDEWEAEAEALEGLDPADKQAKMRDKRWVHYPRHSESNVDRDVFKEAEQMLYKQERDRRYARRKREIEQPIYLDLDKDM # ELEEDPNLPLGLPRKDALGHLIASGGQGGLGNPHFLSQDNRSPKFATRGHEGERVTLSLELKLLADIGFVGIPNAGKSTLLRALTGGRAKTEVAGYAF # TTLNPVIGVVRVAADGSFEGGLSEGMVHDETLVEEAQNQAKMEEGAFADALTRNQQANSDAVARGFGAGYRFDIVEHFRFTIADNPGLITKASENVGL # GHSFLRSMERSLGLVYVVDFSSPAPWEEIAILRDELEQYLPGMSNKARMVIANKADLLAGDGDAASIEEAKLKLKRLEEFVEKEMLVVDDDGNRRSLS # VVPISAKYSQNLKKVVELMQSPPPRSTHSNADPLTSDGIQLDLPPSSAPLLSAANDPVSEEPDEIRAIWGTTVNINQTIQLFTDFLKNFKIKYRIAYN # RENRLPTSALATPEEGEVLLYEGYLRRMRQTGETNLNLDVRNLLAYPPTKKLHTQVIKYPQEVIPTFDQALKDVMIDLAEQDQAEGLEGMQDAAGDAE # ISDILSKVYKVRPLGVTPINMRELNPSGELHPVLLAIQVMAYLTSPLRYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g19 ### # start gene g20 Scaffold_3 AUGUSTUS gene 75569 76201 0.46 + . g20 Scaffold_3 AUGUSTUS transcript 75569 76201 0.46 + . g20.t1 Scaffold_3 AUGUSTUS start_codon 75569 75571 . + 0 transcript_id "g20.t1"; gene_id "g20"; Scaffold_3 AUGUSTUS CDS 75569 76201 0.46 + 0 transcript_id "g20.t1"; gene_id "g20"; Scaffold_3 AUGUSTUS stop_codon 76199 76201 . + 0 transcript_id "g20.t1"; gene_id "g20"; # protein sequence = [MSLIHNRSEFADRQVVRVQETPDAVPDGQTPHTVSLSVYDELVDVSKPGDRILVTGIFRSTPVRVNPRQRSLKSLFKT # FVDVVHIKLGTDKGLGFDRSTRPMGGDKIPGVGGVGDGLDGDNPDANPLDDVPSVEGGSSRRALHQDHLRELSQQPDIYERLARSLAPSIWEMDDVKK # GILLQLFGGTNKSIKGRRRRRAKISWRYQCSFGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g20 ### # start gene g21 Scaffold_3 AUGUSTUS gene 76514 77504 0.34 + . g21 Scaffold_3 AUGUSTUS transcript 76514 77504 0.34 + . g21.t1 Scaffold_3 AUGUSTUS start_codon 76514 76516 . + 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_3 AUGUSTUS CDS 76514 76768 0.34 + 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_3 AUGUSTUS CDS 76929 77504 0.71 + 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_3 AUGUSTUS stop_codon 77502 77504 . + 0 transcript_id "g21.t1"; gene_id "g21"; # protein sequence = [MLPGVFYTKSWFVHVILAFPSCSLPAQEQQTVSVAKAGIITTLNARTSILAAANPVGSKYDVDLPITRNIDLPPTLIS # RFDLLYLPIHELAAYIDYARSRIHPIITESAGKELVAAYVEMRNMGTDPRTSEKRITATTRQLESMIRLSEGHARMRFSEFVEDHDVEEAVRLMREAI # RTSAMDPRTGKIDMGMLNTGTGQGQLKLREDMRRELLKIINATGGTRGVKWTDVVKSLSAQSSIKIDPAEFTEVVKGLENEGLVKIVGERDKRMIRKM # DG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g21 ### # start gene g22 Scaffold_3 AUGUSTUS gene 78513 78818 0.97 - . g22 Scaffold_3 AUGUSTUS transcript 78513 78818 0.97 - . g22.t1 Scaffold_3 AUGUSTUS stop_codon 78513 78515 . - 0 transcript_id "g22.t1"; gene_id "g22"; Scaffold_3 AUGUSTUS CDS 78513 78818 0.97 - 0 transcript_id "g22.t1"; gene_id "g22"; Scaffold_3 AUGUSTUS start_codon 78816 78818 . - 0 transcript_id "g22.t1"; gene_id "g22"; # protein sequence = [MIHRENDITDVLYETFTRTEDRFGEIVTIDLKPNGADIPVTEENKKEYVDAVVEYRISKRVKDQFNAFMEGLLELIPL # DLISVFDEREMELLIGGISEIDM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g22 ### # start gene g23 Scaffold_3 AUGUSTUS gene 79490 80365 0.73 - . g23 Scaffold_3 AUGUSTUS transcript 79490 80365 0.73 - . g23.t1 Scaffold_3 AUGUSTUS stop_codon 79490 79492 . - 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_3 AUGUSTUS CDS 79490 80365 0.73 - 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_3 AUGUSTUS start_codon 80363 80365 . - 0 transcript_id "g23.t1"; gene_id "g23"; # protein sequence = [MSSNNLPVYGKLLFGFTLTSRPPPPTPRLADTSSFPMPAADTAHLSPNHPSGSATLDRIRSSSVIARTYDNEFPRTQH # LASSQSLRPSSSNANLSSSMSQRFPQPEVAGRPVSTAGVTNPTPARVVEDSEGNPLPDGWERRVDPQGRTYYVDHNTRSTTWYRPTSSQQNRTSQVPQ # QAPTRNPSATSSAPSTTQSTSPPSEYNDVHLPLGWEERRTPEGRPYFVDHTTRTTTWVDPRRTLNQSTVAPATNVNSNLGPLPSGWEMRLTSTGRVYF # VDHNTRCDFYVYLLHFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g23 ### # start gene g24 Scaffold_3 AUGUSTUS gene 81791 83299 0.77 + . g24 Scaffold_3 AUGUSTUS transcript 81791 83299 0.77 + . g24.t1 Scaffold_3 AUGUSTUS start_codon 81791 81793 . + 0 transcript_id "g24.t1"; gene_id "g24"; Scaffold_3 AUGUSTUS CDS 81791 83299 0.77 + 0 transcript_id "g24.t1"; gene_id "g24"; Scaffold_3 AUGUSTUS stop_codon 83297 83299 . + 0 transcript_id "g24.t1"; gene_id "g24"; # protein sequence = [MYVSSNPVSSVERRDTKPKEKSTAGPVAALPTPPSSLPARRHRSASISSDDTSKATFLPQFDHTSGTSSRLKYNLRAG # HPSLFRSIKLLRALRSTADVPGVRSLAQVLLSSIINVVHLMQVPQDVKDDQKYLENIQAVSFMVQQFQQGVERLEHVDASRGAAAVSRVVDIAELTID # ALERLLGLTERLVKPLPEIPADAVEEVKAPGLPPTPHLRAPKGSTSDRSFARMSLAQITTEVLDHPTEDSPKSSSSSRTSAILTILHKARDKSVLGSL # FKSKSDAASSGDEYPQYAPRNSALYYPVDPLNPDVDVELPPMSEDAMNITLSHDSAHMIKMSLVAVIRLLTSKDAIQDPYLIHWFFTTFRYVLLPSDV # LDLLISRFNEPMPDEPMDQKQMRVWCNNHAKIVRPRVVSVLIRWLTQFWEPPYDDSCVLNDMQDFVLKQVSASLLPDRLGIAFAQAVKVVRVDGVTRT # TWLQKRQQSISYRRLSNPRPTLSSNNVQRSFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g24 ### # start gene g25 Scaffold_3 AUGUSTUS gene 88132 89139 0.4 - . g25 Scaffold_3 AUGUSTUS transcript 88132 89139 0.4 - . g25.t1 Scaffold_3 AUGUSTUS stop_codon 88132 88134 . - 0 transcript_id "g25.t1"; gene_id "g25"; Scaffold_3 AUGUSTUS CDS 88132 89139 0.4 - 0 transcript_id "g25.t1"; gene_id "g25"; Scaffold_3 AUGUSTUS start_codon 89137 89139 . - 0 transcript_id "g25.t1"; gene_id "g25"; # protein sequence = [MSMRSTAVGSPTELPPTIAALSSTAHENSGPVTPHPPPISWDDQSTLDLPYDNPYYTRAISNVLWLPRNPCGTLDLDD # TVDLKVAISVDPTTGKIGTWSVSGETRSPSDAVESISDSFRLSPAPFSDGGASMLSGNSGVNTGAFPSTSEPEIDGTENIELPEILAKRALQKDNVEP # AVRPRRPSLFQQRQNERSSSLSLGLHRRPSTRHRQTSESRSISDIAIAAQTKPQKQKSIMSMFDDRSISHEIDPAARPDAHAQAELVMAHPAPSHMSI # DHPPPTLKRAVTISANFAIYHEIIAEEQQALGQRLVEEQAEADRNKSTKSWLTQWMFKKAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g25 ### # start gene g26 Scaffold_3 AUGUSTUS gene 91238 92422 0.51 - . g26 Scaffold_3 AUGUSTUS transcript 91238 92422 0.51 - . g26.t1 Scaffold_3 AUGUSTUS stop_codon 91238 91240 . - 0 transcript_id "g26.t1"; gene_id "g26"; Scaffold_3 AUGUSTUS CDS 91238 92422 0.51 - 0 transcript_id "g26.t1"; gene_id "g26"; Scaffold_3 AUGUSTUS start_codon 92420 92422 . - 0 transcript_id "g26.t1"; gene_id "g26"; # protein sequence = [MTRASISSLVDTTTGLSLLWIHICLMFWIALSWMATLFWIMHGAFRMRSDNIAATARRKALRDSDGHEYHPHPHPPYT # FAESPSLDTNTPVEGLRFRTIMVSNVPPQLRNESELKEYFEYYMSRKLEKPALGVNSTTQPGMFNKVFSFLFNRVKKLPVHLPQEGKENTGHTEDTAN # PDDKPVIERVVIARKMTELASLLERREEILRLLETAHIKLANTTLNAVKHAMERKANATSFTRSSSRAGLIAKQRAQQTNLEAGDASQDGTMTEEQRI # ERLIKALGPYVDEFGIKSYPYLRKSFKARYSFKKVRTDRSLDSDSESTEPPTSPIYPPSTVASHPPRRQKTVWDVLLSLPRSSIDAYQPLVRLSHLFR # GKTVPSIDYYTAKLNLLTALDH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g26 ### # start gene g27 Scaffold_3 AUGUSTUS gene 96160 97944 0.19 - . g27 Scaffold_3 AUGUSTUS transcript 96160 97944 0.19 - . g27.t1 Scaffold_3 AUGUSTUS stop_codon 96160 96162 . - 0 transcript_id "g27.t1"; gene_id "g27"; Scaffold_3 AUGUSTUS CDS 96160 96574 0.59 - 1 transcript_id "g27.t1"; gene_id "g27"; Scaffold_3 AUGUSTUS CDS 96639 96984 0.19 - 2 transcript_id "g27.t1"; gene_id "g27"; Scaffold_3 AUGUSTUS CDS 97425 97459 0.54 - 1 transcript_id "g27.t1"; gene_id "g27"; Scaffold_3 AUGUSTUS CDS 97691 97944 0.62 - 0 transcript_id "g27.t1"; gene_id "g27"; Scaffold_3 AUGUSTUS start_codon 97942 97944 . - 0 transcript_id "g27.t1"; gene_id "g27"; # protein sequence = [MHDLQRIQLHATQHLGELIRNSPAANSWTLRLLLTQLYDPSVEVRKLAVDYLEEACEAKDILEMVVEMRPVMDHLGEM # GNSLLLKFLVQMRKRNTLSDRTCFFVLGLISTTSQGAEILDDYNWEATLTPMGMPTGLCIPVDVGEFLSVSTFMSAISVILVETNFPFQLPSWKQHVP # DVTSTQLIPPTSEPELEALTAIQKLANTVIANAASRMKSRPEYRSVFTSPAMLYRVFHTISTSRYRLPVRRYIMDLFNIELDEEVVAAMVEASKKFKA # NSLHPPPKTDLNRRLSMFGNLGRRSSVSDDEDDDEMNEDSSPVLPKREEPAFALRPVHRIAGFAVESIAMGREPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g27 ### # start gene g28 Scaffold_3 AUGUSTUS gene 109877 110898 0.35 - . g28 Scaffold_3 AUGUSTUS transcript 109877 110898 0.35 - . g28.t1 Scaffold_3 AUGUSTUS stop_codon 109877 109879 . - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_3 AUGUSTUS CDS 109877 110470 0.69 - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_3 AUGUSTUS CDS 110598 110705 0.68 - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_3 AUGUSTUS CDS 110761 110898 0.37 - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_3 AUGUSTUS start_codon 110896 110898 . - 0 transcript_id "g28.t1"; gene_id "g28"; # protein sequence = [MVGERGFLLSGGQKQRIAIARAIVSDPRVLLLDEATSALDTQSEGVDALDKAAAGKFIIFADQFLFLDINASRSYNYH # DCASKLREAAEVTEAAENDENAEDTPENMEKAALEEIPLGRKNTGRSLASEIIEQKQKNISNEKTEYSIVYLFRRMGWINRASWKKYLFGGFCAILTG # LVFPAYGIVYGVLTNKPFYFLLMTLPITAQGINGFAETGHAERVAGDRNALWFFLIAIISSLTIGVQNYNFSASAANLTAKLRSLSFRAILRQDSQFI # ASPLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g28 ### # start gene g29 Scaffold_3 AUGUSTUS gene 118470 118700 0.53 - . g29 Scaffold_3 AUGUSTUS transcript 118470 118700 0.53 - . g29.t1 Scaffold_3 AUGUSTUS stop_codon 118470 118472 . - 0 transcript_id "g29.t1"; gene_id "g29"; Scaffold_3 AUGUSTUS CDS 118470 118700 0.53 - 0 transcript_id "g29.t1"; gene_id "g29"; Scaffold_3 AUGUSTUS start_codon 118698 118700 . - 0 transcript_id "g29.t1"; gene_id "g29"; # protein sequence = [MDAHIGDLHSLIVDREIEIIQALLEEILVHDAAMSHACDVCAELDCLLAFADVSRAYDYQRPVMVEDNIIDIVQGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g29 ### # start gene g30 Scaffold_3 AUGUSTUS gene 121552 122403 0.24 - . g30 Scaffold_3 AUGUSTUS transcript 121552 122403 0.24 - . g30.t1 Scaffold_3 AUGUSTUS stop_codon 121552 121554 . - 0 transcript_id "g30.t1"; gene_id "g30"; Scaffold_3 AUGUSTUS CDS 121552 121905 1 - 0 transcript_id "g30.t1"; gene_id "g30"; Scaffold_3 AUGUSTUS CDS 122059 122403 0.24 - 0 transcript_id "g30.t1"; gene_id "g30"; Scaffold_3 AUGUSTUS start_codon 122401 122403 . - 0 transcript_id "g30.t1"; gene_id "g30"; # protein sequence = [MFTMPFWVPNQKGLDGLLSVLNAYNSSPDSESVPPPSDEISVFTAATDAFTRANLNTSITESLVKMAPMVRAALDKGL # RVRGYVSVAIACPYTGQVDYKKVREVSRELLEMGCYEFHDTFGTAVANVFTALEHGVRTIDSSVGGLGGCPYSPGATGNVATEDVLYALQGSKYGITG # TEYGKGTIDLDQITEIGWWISEKLGRESVSRAGRALRAKKIRDAEMAKDGEVRAKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g30 ### # start gene g31 Scaffold_3 AUGUSTUS gene 131047 131700 0.38 - . g31 Scaffold_3 AUGUSTUS transcript 131047 131700 0.38 - . g31.t1 Scaffold_3 AUGUSTUS stop_codon 131047 131049 . - 0 transcript_id "g31.t1"; gene_id "g31"; Scaffold_3 AUGUSTUS CDS 131047 131700 0.38 - 0 transcript_id "g31.t1"; gene_id "g31"; Scaffold_3 AUGUSTUS start_codon 131698 131700 . - 0 transcript_id "g31.t1"; gene_id "g31"; # protein sequence = [MSRPVARNSANQFDDVPSPHTRSHNKLRHSNISAGRSRLSQRVMVNDDDPISTTTHGTNGFADMSLDIGFPDDLSISH # RSFTELDRDAMEDDEMDGVVDELPIPSPKRKKGNPPLSDDPPAQSPKRKRGQAIERTTSPEEPPPRTQTPDAEDEIQQQLEDLTNGNESIGEQEEVQE # DEEEEAVASKKSRMDKGKRSRRRRDKQGRRKLIAKVCRLHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g31 ### # start gene g32 Scaffold_3 AUGUSTUS gene 134707 135297 0.71 - . g32 Scaffold_3 AUGUSTUS transcript 134707 135297 0.71 - . g32.t1 Scaffold_3 AUGUSTUS stop_codon 134707 134709 . - 0 transcript_id "g32.t1"; gene_id "g32"; Scaffold_3 AUGUSTUS CDS 134707 135297 0.71 - 0 transcript_id "g32.t1"; gene_id "g32"; Scaffold_3 AUGUSTUS start_codon 135295 135297 . - 0 transcript_id "g32.t1"; gene_id "g32"; # protein sequence = [MEVAYAASLCREKSLIEDNLKLVERLRDLHSFDVPDSDTEAKEDLRPLSRSTAEPELKRSASSAPPQLIDAEDGEVSM # DLATPLQPTTFIATPEKTRRSNTSGTPSTPRPLIPLSPAPVSSSLFGQEQSPSSPRQGQSSIPFEDIKSVGPLSQPSAEDVGNEITSELASGEQQVVQ # SAGAVNETELVLDSGTNLND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g32 ### # start gene g33 Scaffold_3 AUGUSTUS gene 136794 137349 0.47 + . g33 Scaffold_3 AUGUSTUS transcript 136794 137349 0.47 + . g33.t1 Scaffold_3 AUGUSTUS start_codon 136794 136796 . + 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_3 AUGUSTUS CDS 136794 136817 0.49 + 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_3 AUGUSTUS CDS 136897 137349 0.5 + 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_3 AUGUSTUS stop_codon 137347 137349 . + 0 transcript_id "g33.t1"; gene_id "g33"; # protein sequence = [MEVENKERFRMQDENQADEALDIHVNQRQEHSELLESIFCVRDEQSDDVSLSDWSTDEKDRFFAALCSHSALRPDLIA # ESIGTKNVAQVCVYLFALEDAVGNCDTGPLRSDLEIAMEVTDEWVEAEEEQAAFLRDIELAWGRTWDRRTMIHQSQRMQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g33 ### # start gene g34 Scaffold_3 AUGUSTUS gene 138153 138605 0.98 + . g34 Scaffold_3 AUGUSTUS transcript 138153 138605 0.98 + . g34.t1 Scaffold_3 AUGUSTUS start_codon 138153 138155 . + 0 transcript_id "g34.t1"; gene_id "g34"; Scaffold_3 AUGUSTUS CDS 138153 138605 0.98 + 0 transcript_id "g34.t1"; gene_id "g34"; Scaffold_3 AUGUSTUS stop_codon 138603 138605 . + 0 transcript_id "g34.t1"; gene_id "g34"; # protein sequence = [MLGYPTTKAQAFEHLCGEDACSDDGDNSADQEGNVQVDGDNQADHEGNDQLESEEGVEESDDSLGNGSPLSLLASSPL # LSHFELNPPFIRFPTSTSVDSESLIPLETDEELLNEELAEEEILDQRDQALEKIHQDELWAAHKDNIAAFQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g34 ### # start gene g35 Scaffold_3 AUGUSTUS gene 145615 146483 0.58 + . g35 Scaffold_3 AUGUSTUS transcript 145615 146483 0.58 + . g35.t1 Scaffold_3 AUGUSTUS start_codon 145615 145617 . + 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_3 AUGUSTUS CDS 145615 146037 0.68 + 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_3 AUGUSTUS CDS 146181 146483 0.59 + 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_3 AUGUSTUS stop_codon 146481 146483 . + 0 transcript_id "g35.t1"; gene_id "g35"; # protein sequence = [MGPAPRERYNAKARQATAGGSKKKGKVGKRNLHINDKTPDSDPNALFHTPKTNEEKELDRKEKLKQEVCLSSSQIGSG # ELTAMPACRSIGIEMDEQEKEKTRKVYRALYLILFWNIRLIVHIQDKKLKKEERVHLFEKLSYEDKEIRRAIEGRSGKRKRHDGFYDVVEAEADDEEG # EEEEGDFMTETGLLEEQIEPSPKLPAPQPTVGSALARNSDGTVIAPKVRPRSKNRKVRIANFGII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g35 ### # start gene g36 Scaffold_3 AUGUSTUS gene 146524 147288 0.91 + . g36 Scaffold_3 AUGUSTUS transcript 146524 147288 0.91 + . g36.t1 Scaffold_3 AUGUSTUS start_codon 146524 146526 . + 0 transcript_id "g36.t1"; gene_id "g36"; Scaffold_3 AUGUSTUS CDS 146524 147288 0.91 + 0 transcript_id "g36.t1"; gene_id "g36"; Scaffold_3 AUGUSTUS stop_codon 147286 147288 . + 0 transcript_id "g36.t1"; gene_id "g36"; # protein sequence = [MKAKATTEVESDTSFDSSDSAYDSPDDEEWTGIEKQENNADEEEEDNEDREEDGEEESEEEDSDQNEGDDSDQYEGDD # RSSPTKLRKSLGFKDWAIKQLNVAKGYDLSPPTPRDSSLPLSDAASKPPPAKKRKRNPSDQPEMRGPLGEDLILPSNSFAQQLFSRTPSGKVDKDGSV # SKRKFISVLRPDDVQESRLLLPVVAEEQPIMEAVLLNPVVVVCGETGSGKTTQLPQFLYEAGFGSPGSGTLRLLTAKM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g36 ### # start gene g37 Scaffold_3 AUGUSTUS gene 151554 153294 0.39 - . g37 Scaffold_3 AUGUSTUS transcript 151554 153294 0.39 - . g37.t1 Scaffold_3 AUGUSTUS stop_codon 151554 151556 . - 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_3 AUGUSTUS CDS 151554 152027 0.56 - 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_3 AUGUSTUS CDS 152115 152152 0.56 - 2 transcript_id "g37.t1"; gene_id "g37"; Scaffold_3 AUGUSTUS CDS 152266 152755 0.77 - 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_3 AUGUSTUS CDS 152857 153294 0.69 - 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_3 AUGUSTUS start_codon 153292 153294 . - 0 transcript_id "g37.t1"; gene_id "g37"; # protein sequence = [MISARQEFQTVKNLRQVKIQELQKLRDSGARFDSLEVEVKQLTIKTTALRQRLDNLRDKHTSESRKMDTARRRARDEV # LREADVICSTLSGTGHENLEQYEYEMVIIDEAAQAIELSSLIPLKYKCNRCVMVGDPQQLPPTVISMQRPEAVHLLSIQYRMHPDISRLPSKIFYENR # LQDGPNMDTKTAQPWHTHSKFGTYRFFNVKGGLEESSGRSTKNRAEAQVAVALFNRLRKDFPSVDFSFRVGIVSMYSAQIRELKIAFEQRFGREVLTQ # VDFRTVDGFQGQEKDVIILSCVRAGPGVVSIGHVKATLERSNETWRGIVDVSYFTAPSTMTTGTPLTETSPRKLKSKQIKPPLPVPQHPDLSTPKELK # AAALTNPPKPSSSEPLPLDDAAPIPLDKQKGKRKLEETADPKPDSSHIRSVPPAPSASNAHPLPHHPPRKRPKQGPALFIPKNKNKVRLAVFHYVVYI # HSLSIVQRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g37 ### # start gene g38 Scaffold_3 AUGUSTUS gene 153907 156281 0.6 - . g38 Scaffold_3 AUGUSTUS transcript 153907 156281 0.6 - . g38.t1 Scaffold_3 AUGUSTUS stop_codon 153907 153909 . - 0 transcript_id "g38.t1"; gene_id "g38"; Scaffold_3 AUGUSTUS CDS 153907 155045 0.73 - 2 transcript_id "g38.t1"; gene_id "g38"; Scaffold_3 AUGUSTUS CDS 155192 156281 0.6 - 0 transcript_id "g38.t1"; gene_id "g38"; Scaffold_3 AUGUSTUS start_codon 156279 156281 . - 0 transcript_id "g38.t1"; gene_id "g38"; # protein sequence = [MNSAVANVLDIHAEAFVTVAFATSHQKAEWQIAREATRGLIHTSLMQDIHNIHDAISRCTIVLALSLKKTQENGSKPH # VHDNGHNSMAPLVIREQIWKKIYVHLQPTDTDGLAFLLAVLASAAHLDTVLKNSFGPALAFPGFSALLDSVNQSLEVIRSGFPELASAYEMSIAATQV # LHHPDVAKDIVKLMLSPVPDLHGGAMGIVTQANDAGSDGRRECFQWLFENFTEESFMGSFELLKVFNDYAPRVPEACSLSKSLVRCFTDIIGVLCSSH # RGLLHRSEYLRPDGPARRIPELWTLMCKTITVIFKRTPSWSQYYRTEVMTEWMRDALIFARDILGERAVFESAAEAADAVVTKSSEISKLLLKLSKQI # TDVRNRDSSSLSCRLDPAKLAPLEAILASFDDGDDVEIVEVSKAMPPPKVPAKPIRKAKAEVDIGLNPTSAVSRSLPASTPKTKSARFSAADQERLDA # ANSMPKFRKPTATSVPNVAPPSTKPPAAGGSSREKGESGSSSSSDESEEEEEESQRSLMAGLVKLQQSPKVRKQVQRRQVKMLDLPHLKQNAQEARLL # KRDEARQKALRFKPDISGLHRTLLSWDYQHEGESPPRTRLQLRSVPDTFSDFNHYRAVFEPLLLMECWAQLLQSKDESSESYDCRITSRLYNGQWSDL # EVIFLSDLRKEWFLTENDVVLLRHPEGKSTVLAKAISFRRPGKDPAEAGLRCYFPPDARDPGIQIQSSWLISKVFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g38 ### # start gene g39 Scaffold_3 AUGUSTUS gene 156706 157344 0.43 - . g39 Scaffold_3 AUGUSTUS transcript 156706 157344 0.43 - . g39.t1 Scaffold_3 AUGUSTUS stop_codon 156706 156708 . - 0 transcript_id "g39.t1"; gene_id "g39"; Scaffold_3 AUGUSTUS CDS 156706 157344 0.43 - 0 transcript_id "g39.t1"; gene_id "g39"; Scaffold_3 AUGUSTUS start_codon 157342 157344 . - 0 transcript_id "g39.t1"; gene_id "g39"; # protein sequence = [MHVLNFRFRYFGAFPEHVMSAFWDSFNNWELEHTLAQISDASAWIDIPTSTLYRMICNFQIFQDSRIQTFLEQHSPSR # SPSDWPAEPIPPAMLVLMMHENATLRDWSVKQASRCTNIPISQDDAPPILYDQALEIIMLPFISTAQARSDSISIRLVTETVTLWSSFHSVLRLLHPK # HLKFFSSKGVDVRHVVTGHLHDHGPGQRLSLFAALF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g39 ### # start gene g40 Scaffold_3 AUGUSTUS gene 163975 164295 0.95 + . g40 Scaffold_3 AUGUSTUS transcript 163975 164295 0.95 + . g40.t1 Scaffold_3 AUGUSTUS start_codon 163975 163977 . + 0 transcript_id "g40.t1"; gene_id "g40"; Scaffold_3 AUGUSTUS CDS 163975 164295 0.95 + 0 transcript_id "g40.t1"; gene_id "g40"; Scaffold_3 AUGUSTUS stop_codon 164293 164295 . + 0 transcript_id "g40.t1"; gene_id "g40"; # protein sequence = [MSISSGPSSLTLEPPSGANPLWKLAEKNGFSEEEAGEEEEEEEIDQLASEEDQEEEDITQEPASGSAPRHYRRAPGTT # LLPGVKIENILQADGKSMKTYFIGKYHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g40 ### # start gene g41 Scaffold_3 AUGUSTUS gene 175411 175815 0.94 + . g41 Scaffold_3 AUGUSTUS transcript 175411 175815 0.94 + . g41.t1 Scaffold_3 AUGUSTUS start_codon 175411 175413 . + 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_3 AUGUSTUS CDS 175411 175815 0.94 + 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_3 AUGUSTUS stop_codon 175813 175815 . + 0 transcript_id "g41.t1"; gene_id "g41"; # protein sequence = [MYSDFVAWAKQRLAEGGLTSVDMAEVKRRRERVREEALIEFGRQDEVEAYVKEFEGRKKLKSSFNGTVVNAWTHSKGN # WRKVKTIMTIVREQHGGEEGLLQILMTEGEEGLKERVMNALDDFNRSVAQSSVEVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g41 ### # start gene g42 Scaffold_3 AUGUSTUS gene 180896 181598 0.42 + . g42 Scaffold_3 AUGUSTUS transcript 180896 181598 0.42 + . g42.t1 Scaffold_3 AUGUSTUS start_codon 180896 180898 . + 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_3 AUGUSTUS CDS 180896 181073 0.44 + 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_3 AUGUSTUS CDS 181182 181222 0.45 + 2 transcript_id "g42.t1"; gene_id "g42"; Scaffold_3 AUGUSTUS CDS 181275 181598 0.64 + 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_3 AUGUSTUS stop_codon 181596 181598 . + 0 transcript_id "g42.t1"; gene_id "g42"; # protein sequence = [MSFEDSVSRLGSAIKDLVASAAKDDPSLAGKSEKDQAEVVQWIEKVGQGDIVKADNFKVPADVALYGALHPIISKLQP # PEYHSHPSITRYFDHIQSIPPVRKAADASSNYTLVSFDLVHTPKIDHTPEPPKKKEKKDKAAPVDSASPPAPAAAATSTVEAPIDEGKFRRKKRRKRR # KNLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g42 ### # start gene g43 Scaffold_3 AUGUSTUS gene 186666 187190 0.35 + . g43 Scaffold_3 AUGUSTUS transcript 186666 187190 0.35 + . g43.t1 Scaffold_3 AUGUSTUS start_codon 186666 186668 . + 0 transcript_id "g43.t1"; gene_id "g43"; Scaffold_3 AUGUSTUS CDS 186666 187190 0.35 + 0 transcript_id "g43.t1"; gene_id "g43"; Scaffold_3 AUGUSTUS stop_codon 187188 187190 . + 0 transcript_id "g43.t1"; gene_id "g43"; # protein sequence = [MLADVVSAGQKICEIYGITPQDLQYKWEAATYDHTNNFASVREAARFTSDSLAGVREQIKRELEQGSGSAKKKTPARS # LASGVASINRNKMPFALGRNIHAAQRVLEPQIKAEPDTFNSTELSVSLKGSGVVGPSMVKFRGPKSDMESKKKRACMLVKNATTSSADDIYRPIHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g43 ### # start gene g44 Scaffold_3 AUGUSTUS gene 195737 196895 0.38 + . g44 Scaffold_3 AUGUSTUS transcript 195737 196895 0.38 + . g44.t1 Scaffold_3 AUGUSTUS start_codon 195737 195739 . + 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_3 AUGUSTUS CDS 195737 196151 0.97 + 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_3 AUGUSTUS CDS 196203 196306 0.74 + 2 transcript_id "g44.t1"; gene_id "g44"; Scaffold_3 AUGUSTUS CDS 196383 196423 0.52 + 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_3 AUGUSTUS CDS 196490 196895 0.82 + 1 transcript_id "g44.t1"; gene_id "g44"; Scaffold_3 AUGUSTUS stop_codon 196893 196895 . + 0 transcript_id "g44.t1"; gene_id "g44"; # protein sequence = [MPATSTDIRSRDTSLIVERPERLIAAKIGLAAAVTRIQEVVGKSTGDPNDLVAALDKLTLGSRSSDITAPINVVHSSA # TLDILNHPAVRFTHGFPDPNTAKDSNEYLRNLKKWSEDSIEKISKGDSEIPQELAQGDLYLCPESLNAIQGALGTVCESIDTVVDPSPSSSKRAFLEQ # PMPISNTEFIAAHSSQGNGTQSLAWAINEETQRQKLEAEARIEAGNSFPATIPGLQVYYSSIHDILSYPCEDGTPSMVQAASVSISGAHGQWIENVHL # KDHAKEGDFWGLYEEHYKKIIHKAEEFVQSTATKNNEDVLVFIRYGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g44 ### # start gene g45 Scaffold_3 AUGUSTUS gene 196972 197715 0.83 + . g45 Scaffold_3 AUGUSTUS transcript 196972 197715 0.83 + . g45.t1 Scaffold_3 AUGUSTUS start_codon 196972 196974 . + 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_3 AUGUSTUS CDS 196972 197715 0.83 + 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_3 AUGUSTUS stop_codon 197713 197715 . + 0 transcript_id "g45.t1"; gene_id "g45"; # protein sequence = [MSRHGRKVPTNFYAQFTRDARAFAEKHAKGRIVSVLEGGYSDRALISGTFAQFCALGLSEERTWNETWWNKDNLDALQ # NATKPKKPRGHVSGPLSAPKTDLEPEPWLKQAVSIFQHLEPIPFKTPRKGKAILVEPSSRTLRQRKVGNASSSSPASAKSKPEKSEATGKGMPRGKIN # SSLSKSKGKKTKPGVVTESTRSEGQAEDTDSSTESSSTLSSMSDSDVDLPISAPSKKLPRVILKLGPPPNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g45 ### # start gene g46 Scaffold_3 AUGUSTUS gene 198507 199079 0.32 - . g46 Scaffold_3 AUGUSTUS transcript 198507 199079 0.32 - . g46.t1 Scaffold_3 AUGUSTUS stop_codon 198507 198509 . - 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_3 AUGUSTUS CDS 198507 199079 0.32 - 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_3 AUGUSTUS start_codon 199077 199079 . - 0 transcript_id "g46.t1"; gene_id "g46"; # protein sequence = [MWSQLCRDCLLLLGNDYQLLLRRGAPAPPPPAASPLPKPEPPLPATPTPLLKKDIFRKEKSSPIRAVLDSFASDGPLA # QAVDEGTESIHVPRLLKLVEDAVLPQLEKSKGEVVKSVIGATEIMPKITGGLNAVAEGIVDRHAPNFVRKNREALARWWTEDRLSKTVEGCIPFRELD # VLAVEGIFHTHEPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g46 ### # start gene g47 Scaffold_3 AUGUSTUS gene 201619 202521 0.99 - . g47 Scaffold_3 AUGUSTUS transcript 201619 202521 0.99 - . g47.t1 Scaffold_3 AUGUSTUS stop_codon 201619 201621 . - 0 transcript_id "g47.t1"; gene_id "g47"; Scaffold_3 AUGUSTUS CDS 201619 202521 0.99 - 0 transcript_id "g47.t1"; gene_id "g47"; Scaffold_3 AUGUSTUS start_codon 202519 202521 . - 0 transcript_id "g47.t1"; gene_id "g47"; # protein sequence = [MSTFRVNRKLLNHKFEGYKFDFVDQNQVVVRHPLQHSASQATASTQSWLSFHEVQSKITHNHLALNNEGTSAVYVDED # YNIVLIDITPVSEYISIRRRTFEILTFQVGNSLPSFRVVYELPKPISSSVAELHSEYPSASYLSSDFLLVGDGYGYMYLLRTSLGAFNLAGIYQLVVD # GSIQPFLIKSLDWVSPDSAVALLSSSHRGLKSDASTKKSTPVDFDIWAAEVNISLKELPAVAQTMSVLWNRRGDEVPILSKYDASRKAFMLIGGSPYR # DLKVVTSPPYEPSPDEIAQSLERVKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g47 ### # start gene g48 Scaffold_3 AUGUSTUS gene 202777 203124 0.9 + . g48 Scaffold_3 AUGUSTUS transcript 202777 203124 0.9 + . g48.t1 Scaffold_3 AUGUSTUS start_codon 202777 202779 . + 0 transcript_id "g48.t1"; gene_id "g48"; Scaffold_3 AUGUSTUS CDS 202777 203124 0.9 + 0 transcript_id "g48.t1"; gene_id "g48"; Scaffold_3 AUGUSTUS stop_codon 203122 203124 . + 0 transcript_id "g48.t1"; gene_id "g48"; # protein sequence = [MPIPIRTSMTSSGNTSRRSSTETRTTRNSRSSSSRDHYKTSSSSRELALLLAVERNKSDSLKLSLDEAQKELAAQRRR # IEEAEMNLLEFTSKFMRANKDRLEALHNAAVATEERE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g48 ### # start gene g49 Scaffold_3 AUGUSTUS gene 203152 204129 0.76 + . g49 Scaffold_3 AUGUSTUS transcript 203152 204129 0.76 + . g49.t1 Scaffold_3 AUGUSTUS start_codon 203152 203154 . + 0 transcript_id "g49.t1"; gene_id "g49"; Scaffold_3 AUGUSTUS CDS 203152 204129 0.76 + 0 transcript_id "g49.t1"; gene_id "g49"; Scaffold_3 AUGUSTUS stop_codon 204127 204129 . + 0 transcript_id "g49.t1"; gene_id "g49"; # protein sequence = [MVLMGACDRLYRLQLLAAQNDIDRARNIVKTIDERRVQAEKDAAKYKRTARELREEQLVMAAREEGRRIGFREGLQRA # RAEVGFLDIGEDGYVTPPSRTRLDSVSDEDRSTFYSDELGEEPDPMPRPMPSEPPSIRNESPQPQPQPSPHPQDIPIPVAPPRPPSSATGQIHPIPIH # NMPMSPRHPPVNIPPDGMIPLDNASGNGIQLPPPHELSPMPPIMELSPAPPPPQELDEEPRIVPPPGSHRTPMYATRSDYRPSHSYRGQSSPESSSTA # MSQFDMLTEPQDIMANLSPMSAIPEVASGFTSPNPPSMHGGDLHRSGSMVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g49 ### # start gene g50 Scaffold_3 AUGUSTUS gene 204881 205623 0.56 + . g50 Scaffold_3 AUGUSTUS transcript 204881 205623 0.56 + . g50.t1 Scaffold_3 AUGUSTUS start_codon 204881 204883 . + 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_3 AUGUSTUS CDS 204881 204976 0.56 + 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_3 AUGUSTUS CDS 205039 205623 0.99 + 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_3 AUGUSTUS stop_codon 205621 205623 . + 0 transcript_id "g50.t1"; gene_id "g50"; # protein sequence = [MYTTLAPPELQVEASSPQSSSSGDYSVAILSPTPPGSAHNDNEEGVRRAPLNEFLSAKDAERPMPMPGSPRAQSPSPR # LHPMSIAQSDDPSPLPTAPFGSPNIGTPIALGGGGIFIPSGFTPRQTPRPGLTSSPDPNASSTSPETGLEAQYSYNSLGMSTNPHRPVIPDPSLLGPA # DSDTDSEDRVSSGMNSEANTLTTPPTVARGLPSQRGRGSRGQATSKKKRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g50 ### # start gene g51 Scaffold_3 AUGUSTUS gene 205971 206741 0.52 - . g51 Scaffold_3 AUGUSTUS transcript 205971 206741 0.52 - . g51.t1 Scaffold_3 AUGUSTUS stop_codon 205971 205973 . - 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_3 AUGUSTUS CDS 205971 206741 0.52 - 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_3 AUGUSTUS start_codon 206739 206741 . - 0 transcript_id "g51.t1"; gene_id "g51"; # protein sequence = [MMCEHCLAPDTSAGAGIGCDNMTVLIVALLHGRTKQEWYAWIKNRVDNKYGFDTPSVLPQLYAQSRLTAFKARREALQ # AREASLLEYEEQPSFLSPGLSFTRVLGSTGGISFNRESGILSSATSLMFTGDDSDDEDDGEDSTSSFFTETLGLGATLHDEDDDGLDATQNLKAKLEE # FEKDIRQDGSDDSPDSDSTTEGDTSHPKLQGEAPPPPAPQANGGPVTPAPQLKSEPGGDKASPVVAAEGLMDTSEDPLKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g51 ### # start gene g52 Scaffold_3 AUGUSTUS gene 210779 211824 0.85 - . g52 Scaffold_3 AUGUSTUS transcript 210779 211824 0.85 - . g52.t1 Scaffold_3 AUGUSTUS stop_codon 210779 210781 . - 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_3 AUGUSTUS CDS 210779 211112 0.85 - 1 transcript_id "g52.t1"; gene_id "g52"; Scaffold_3 AUGUSTUS CDS 211169 211824 0.85 - 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_3 AUGUSTUS start_codon 211822 211824 . - 0 transcript_id "g52.t1"; gene_id "g52"; # protein sequence = [MQTALSKELTTNLLKPAESGTVAAKIQSRLLSSKVLSTEVAAAVEDLRSVIIIPTDSQEGDISANLDESASERPTKMK # KIAGNSEDSDVEMELGKADEAADDIEEEDEGDTDGWQSGTVGDDEKEPEDDWESGSVVGDLDEYMDEDLPSDSQEELKAASNKSGPMAKTNFKVLTGE # STFLPTLSAGFVRGSDSDWSDKEEDAADFGQKKNRRGQRARRAIWEKKYGKNANHKKKEAALNENERGRKRWPNGDSSSNRPSNKAGTSRKPHQSEVP # TRPRQQDFGWEQREVILLHQDHESRPLHPSWEAKKKLKERQSAAAIPSGRKIKFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g52 ### # start gene g53 Scaffold_3 AUGUSTUS gene 221397 222281 0.76 + . g53 Scaffold_3 AUGUSTUS transcript 221397 222281 0.76 + . g53.t1 Scaffold_3 AUGUSTUS start_codon 221397 221399 . + 0 transcript_id "g53.t1"; gene_id "g53"; Scaffold_3 AUGUSTUS CDS 221397 222281 0.76 + 0 transcript_id "g53.t1"; gene_id "g53"; Scaffold_3 AUGUSTUS stop_codon 222279 222281 . + 0 transcript_id "g53.t1"; gene_id "g53"; # protein sequence = [MLFLEVPNCVSDNFSCYVHSLQQSLSGHDLMFDNGLQFRPTYSRRKRQLSEAYWTAVIREVESGCTCFSVDKSGAPMM # TPACVCNQIPIPPLHPIIGYCPALQVMTVRSPSRIRPLLSEFLEVLLLVIQPLQSVSGMYVNPDSFKAQMEEHSTQANYIRSIIDPALIEQELRHNLF # DLSSLLRAIGVLLKGHCAPMRDSAVEDMVRAAETCKPGGPGTKAEGVNALRTCLEILELMKLVNESLQKHFVLHKLMLMLSFVAIFIRISPTTNSKAY # ALASPEPRPYTSFKISKQNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g53 ### # start gene g54 Scaffold_3 AUGUSTUS gene 228742 230085 0.56 - . g54 Scaffold_3 AUGUSTUS transcript 228742 230085 0.56 - . g54.t1 Scaffold_3 AUGUSTUS stop_codon 228742 228744 . - 0 transcript_id "g54.t1"; gene_id "g54"; Scaffold_3 AUGUSTUS CDS 228742 230085 0.56 - 0 transcript_id "g54.t1"; gene_id "g54"; Scaffold_3 AUGUSTUS start_codon 230083 230085 . - 0 transcript_id "g54.t1"; gene_id "g54"; # protein sequence = [MRPPNSYLGYHIHISYFILWLREYTVRYRRSKHLRDEARQYGLEWPTYSSRLAMFYARAKQTFFTPNSHYELNLPSDM # LAPFHMTNSSPHPDPAVFDQVAIETQRMLKESLQRFVSAQFNNVGNNRVICGLIGGTVFCLVGALLPIIYNFTMGQSRWSRLSALPGLWLGLSVLFAS # LHGVCLGVYIFGDLRQLRRFELSRPPISKPQPYRPRPVISSPITSLPVSPTQITSIDNYTEDFGILPPPPAHTRFSFPSSHHSVPSVYSPSASSSDLS # YSGSDGMIHISPAYYDPEPIEGPATSPGGIIALPAKQKSAFDDDDDDEENRPPFGATAAFIHPFDHFEDDDYDLNNPKRPLVQERQRVSSFDFDALPP # PPAARVQPRSPPPPPQPRRPPYPIHSDSPKSTSSLQLTPSIMVIQPEQETPIRNSPQRVSFVVSSPDAILTNGLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g54 ### # start gene g55 Scaffold_3 AUGUSTUS gene 234248 235330 0.62 - . g55 Scaffold_3 AUGUSTUS transcript 234248 235330 0.62 - . g55.t1 Scaffold_3 AUGUSTUS stop_codon 234248 234250 . - 0 transcript_id "g55.t1"; gene_id "g55"; Scaffold_3 AUGUSTUS CDS 234248 234793 0.81 - 0 transcript_id "g55.t1"; gene_id "g55"; Scaffold_3 AUGUSTUS CDS 234878 235330 0.7 - 0 transcript_id "g55.t1"; gene_id "g55"; Scaffold_3 AUGUSTUS start_codon 235328 235330 . - 0 transcript_id "g55.t1"; gene_id "g55"; # protein sequence = [MSDIHEKELQADLKSGVEKLMRENNNLNYTEALSRVTKDMLKNNPFVPPTSGCPINDLPNELLAHIFYVGMEMEEEGP # SEDELEEEDDEYEDELDLLDWDSDDEGEENHTPANKRKDTGKGKAGRGEEQSEKEEEEEEEEAGLPFQVLVSHSPLLWTTLRFQLGTSLDKAKIWLAR # SKGHPLQIEIDCTSSDEEDEEEVIASSSPNNVTDPPDNASENEGSPLESEPSYLTKAQISEIMDIIIPAVDRWRIFSVTASYYNSIHLILERLSKCSS # APLLEVFEMYHYEDCDEFDAFSPPELNTKFTIFGGVAPKLKSVALWESTLTGIPLFPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g55 ### # start gene g56 Scaffold_3 AUGUSTUS gene 236593 236964 0.78 + . g56 Scaffold_3 AUGUSTUS transcript 236593 236964 0.78 + . g56.t1 Scaffold_3 AUGUSTUS start_codon 236593 236595 . + 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_3 AUGUSTUS CDS 236593 236964 0.78 + 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_3 AUGUSTUS stop_codon 236962 236964 . + 0 transcript_id "g56.t1"; gene_id "g56"; # protein sequence = [MTTAINTEIEELKKKIRLSHDAPKIVTPSSKGSKEDDVAMVDVHSTEHLDVHMHGSSNPHSPQSQPDTNMGGVSHGSP # MSLDPPSPHQARSDIGSGQPLSTNSHIPSPHRVRSLSDLYGDDLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g56 ### # start gene g57 Scaffold_3 AUGUSTUS gene 237881 238147 0.45 + . g57 Scaffold_3 AUGUSTUS transcript 237881 238147 0.45 + . g57.t1 Scaffold_3 AUGUSTUS start_codon 237881 237883 . + 0 transcript_id "g57.t1"; gene_id "g57"; Scaffold_3 AUGUSTUS CDS 237881 238147 0.45 + 0 transcript_id "g57.t1"; gene_id "g57"; Scaffold_3 AUGUSTUS stop_codon 238145 238147 . + 0 transcript_id "g57.t1"; gene_id "g57"; # protein sequence = [MVYSPSVFTVFAVGAVSCVLAAPIPAFISDSLAPTGGRSIETNPVSGNFNVVFDDTGNGVDVEQKHPEFELEIEEEEV # RLNQPVTPCF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g57 ### # start gene g58 Scaffold_3 AUGUSTUS gene 238875 239684 0.76 + . g58 Scaffold_3 AUGUSTUS transcript 238875 239684 0.76 + . g58.t1 Scaffold_3 AUGUSTUS start_codon 238875 238877 . + 0 transcript_id "g58.t1"; gene_id "g58"; Scaffold_3 AUGUSTUS CDS 238875 239684 0.76 + 0 transcript_id "g58.t1"; gene_id "g58"; Scaffold_3 AUGUSTUS stop_codon 239682 239684 . + 0 transcript_id "g58.t1"; gene_id "g58"; # protein sequence = [MSASVVAGASSGPSQTLSGQVTSQTPSKDVVSSDPFGPSQTSTSQVTGTSQRPSKDVVPSDLSEPSQTSTGQAISQIS # SVSAEPTASPTPSHSPGDGSGPVKNGFNPKHIRLGLAAANAKLGATPTASDESGPGSALPTPGIGDSPTSSFTRSPSTGAKSGMPSSVVARSPSAPPT # PDESTEAVNMSQAALQEKLAALAAQQATNSAERAKQVDAAQDFFNTASGSSVKLPSIQEQPAKTQNPKRRSVSSGTPTTHSARALYHYGQDLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g58 ### # start gene g59 Scaffold_3 AUGUSTUS gene 240465 241649 0.69 + . g59 Scaffold_3 AUGUSTUS transcript 240465 241649 0.69 + . g59.t1 Scaffold_3 AUGUSTUS start_codon 240465 240467 . + 0 transcript_id "g59.t1"; gene_id "g59"; Scaffold_3 AUGUSTUS CDS 240465 241649 0.69 + 0 transcript_id "g59.t1"; gene_id "g59"; Scaffold_3 AUGUSTUS stop_codon 241647 241649 . + 0 transcript_id "g59.t1"; gene_id "g59"; # protein sequence = [MASRTREDVFRLPVFKLNNKHTQAMNSVVFTNAHKDGSITFLSREYMSRTLQAHCTNFEYRDDGYRYRSFLNVLGTLA # SVQSPQLQTIPPSVLTDIPEYVHEELYVLLMRITLGITASQYDTSVVVIETLSFKRTAFSVEHAELASSAIENCCSRLHISQLSPTTSEKSFVLTRKL # SSDKANALFEVMFAFLNMHRCPLDPIVDLQHCMAVIAVLQWAVKDGEAFEKIILFDDSPSGDLSTALKALRTQSLVESLQNLHPEDCLKQMVTHIAGG # MIEYPSKYDTYALYVQASKCSGNLFLEETKSISSEVISRMKLLLKPPHADFKPNSEAALVEHLSKNKTKFLFIRPRSTLQHAGFSTNGVGRGKHTREL # NPHLDTGGRLCKIFDLVCTEQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g59 ### # start gene g60 Scaffold_3 AUGUSTUS gene 244343 244795 0.86 + . g60 Scaffold_3 AUGUSTUS transcript 244343 244795 0.86 + . g60.t1 Scaffold_3 AUGUSTUS start_codon 244343 244345 . + 0 transcript_id "g60.t1"; gene_id "g60"; Scaffold_3 AUGUSTUS CDS 244343 244795 0.86 + 0 transcript_id "g60.t1"; gene_id "g60"; Scaffold_3 AUGUSTUS stop_codon 244793 244795 . + 0 transcript_id "g60.t1"; gene_id "g60"; # protein sequence = [MVDNSCDTDNDDFLPPFILSICRNANEFDKVIRDDSNTKGGFDELVAKDLDQNELDAVERSARLDVAGTTWTDAEFTS # EPDSYSDDTLIPNFDPQFHRVATLDGDSWKLDSDELVNLLVQEFGSLGEDEKLIFEADAFMFSDVLIVVCLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g60 ### # start gene g61 Scaffold_3 AUGUSTUS gene 245002 245644 0.24 + . g61 Scaffold_3 AUGUSTUS transcript 245002 245644 0.24 + . g61.t1 Scaffold_3 AUGUSTUS start_codon 245002 245004 . + 0 transcript_id "g61.t1"; gene_id "g61"; Scaffold_3 AUGUSTUS CDS 245002 245020 0.24 + 0 transcript_id "g61.t1"; gene_id "g61"; Scaffold_3 AUGUSTUS CDS 245115 245644 1 + 2 transcript_id "g61.t1"; gene_id "g61"; Scaffold_3 AUGUSTUS stop_codon 245642 245644 . + 0 transcript_id "g61.t1"; gene_id "g61"; # protein sequence = [MCTYASMSSIQGLSILDPNNPRIFQVSLGEDVDVSGIVEFDTEESAQEWRKEVGGALFLQRHHRREAIGSDFSDASDG # IRVSYPLHKIASVKMVESFNKNVAIIRVEGSEQNEGQLYLAPILRVPAWLALEDHINTAKRRVAALSRTPEAPAKPHPPRWPQVRYDFGLKQASSTLI # RIRNVT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g61 ### # start gene g62 Scaffold_3 AUGUSTUS gene 246277 246975 0.65 + . g62 Scaffold_3 AUGUSTUS transcript 246277 246975 0.65 + . g62.t1 Scaffold_3 AUGUSTUS start_codon 246277 246279 . + 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_3 AUGUSTUS CDS 246277 246975 0.65 + 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_3 AUGUSTUS stop_codon 246973 246975 . + 0 transcript_id "g62.t1"; gene_id "g62"; # protein sequence = [MRIINSASPISGKILKIHGLRLELEGSPDLKFQFKTQDIRDEVIRRINVSRYLLVPESSIFSTPALSTSSSSTPTRGS # RPSTPQSSNFSLPPTSPPTSPARSALDAISPLERGTALLASAGMKYPISAILSLPKVINMESNVLISRPSMHFVCLTIGSRGDVQPYIALGVGLKKEH # HRVTIVTHEEYREWIEGFGLEFKQAGGDPGALMKLSVENKVQARLSGPHASLMLVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g62 ### # start gene g63 Scaffold_3 AUGUSTUS gene 256544 256993 0.6 + . g63 Scaffold_3 AUGUSTUS transcript 256544 256993 0.6 + . g63.t1 Scaffold_3 AUGUSTUS start_codon 256544 256546 . + 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_3 AUGUSTUS CDS 256544 256993 0.6 + 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_3 AUGUSTUS stop_codon 256991 256993 . + 0 transcript_id "g63.t1"; gene_id "g63"; # protein sequence = [MDFPDNETTAFWVGTEEGNVYQANRYDRAGAKAGLNQYDVYKAHAGPVMGLHFHPTSGSVDFSDLFLTSSVDWTVKLW # RAKSLAKPSTTLHAISPLYSFDESDDPVYDVKWHPTHPAVFGAVDGSGKFDLWNLNMDTEVRSLYLYLVLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g63 ### # start gene g64 Scaffold_3 AUGUSTUS gene 257374 258399 1 - . g64 Scaffold_3 AUGUSTUS transcript 257374 258399 1 - . g64.t1 Scaffold_3 AUGUSTUS stop_codon 257374 257376 . - 0 transcript_id "g64.t1"; gene_id "g64"; Scaffold_3 AUGUSTUS CDS 257374 258399 1 - 0 transcript_id "g64.t1"; gene_id "g64"; Scaffold_3 AUGUSTUS start_codon 258397 258399 . - 0 transcript_id "g64.t1"; gene_id "g64"; # protein sequence = [MNENGSDYSEFFSALPSEHLFFTDTSLAYEDNSSNSGIYARNIHDILGANPETENEIRSVTPHCFNCGSSSHMVNACP # EQVDRALVSLSRQMNEFYRDMFSLDRIGGDFSARIYSVEEWKSVRLDWINSFNPGEIKGHDLRQALGIIPAEDDSQAQDEWLQNMAVWGYPPGWISRW # DPKELMKERVLSQCIGNPQESEQSFHIFGEEGNSETVLDQLKDPSKLLNSSVDQTLKRWAFYPPLRFSSSLLPVYNGVALPPVETKSQVSYYVPFSAV # LPAPPPPPGSPPPLPPPPPIEPPPPLPPSLPPSTPPSLPSTAFLSALLPLRPKTQAEDSDMDMSDEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g64 ### # start gene g65 Scaffold_3 AUGUSTUS gene 259005 259754 0.9 - . g65 Scaffold_3 AUGUSTUS transcript 259005 259754 0.9 - . g65.t1 Scaffold_3 AUGUSTUS stop_codon 259005 259007 . - 0 transcript_id "g65.t1"; gene_id "g65"; Scaffold_3 AUGUSTUS CDS 259005 259754 0.9 - 0 transcript_id "g65.t1"; gene_id "g65"; Scaffold_3 AUGUSTUS start_codon 259752 259754 . - 0 transcript_id "g65.t1"; gene_id "g65"; # protein sequence = [MAQQDTTASRGLGTFYNLYGSNANASAMTAWVWGVSRIIDVLEETPAAQINTERIGVTGCSRDGKGALMAGAFEPRIA # LTIPQESGSGGDAGWRISLYEQNQGSVVQTATEIVTENVWFSPSFNNYVNTLNVLPYDHHSLLAMVAPRGLIAFENTDYVWLSPVSAFGCETGARTVY # QALGVPENHGFEQVGGHAHCAWPSSLTPALDAFINKFLLGQNVSTDEWSSNMVFNGVTWDQTQWINWETPTLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g65 ### # start gene g66 Scaffold_3 AUGUSTUS gene 261264 262154 0.94 - . g66 Scaffold_3 AUGUSTUS transcript 261264 262154 0.94 - . g66.t1 Scaffold_3 AUGUSTUS stop_codon 261264 261266 . - 0 transcript_id "g66.t1"; gene_id "g66"; Scaffold_3 AUGUSTUS CDS 261264 262154 0.94 - 0 transcript_id "g66.t1"; gene_id "g66"; Scaffold_3 AUGUSTUS start_codon 262152 262154 . - 0 transcript_id "g66.t1"; gene_id "g66"; # protein sequence = [MQVNPLPLPAQDQAYCIVSALESGHIDVPLEVFLDNAIPGSQATLPSLSFLLRHSKTNETFVFDLGFRKDLENYSSSI # VKLGLEKFVRVPQDVVDSLAKGGLSPLDVKTVCLSHCHFDHYGDPSHFVNSEFVVGADSAIHFNPGFPADPDSQCPSDLLPERRTRFVELSNQPLLGP # FPHALDFWGDGSLYLVDAGHLPGHIVLIARTSPDGGWILLGGDSAHHWNLITGESQIAEGRPGFPTGCAHLDKKEAELTIQRIREFWQLPRTRVILAH # DEPWYKENKDGAGFWPGHITSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g66 ### # start gene g67 Scaffold_3 AUGUSTUS gene 262536 263180 0.61 - . g67 Scaffold_3 AUGUSTUS transcript 262536 263180 0.61 - . g67.t1 Scaffold_3 AUGUSTUS stop_codon 262536 262538 . - 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_3 AUGUSTUS CDS 262536 263180 0.61 - 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_3 AUGUSTUS start_codon 263178 263180 . - 0 transcript_id "g67.t1"; gene_id "g67"; # protein sequence = [MLSHNCPQDVSESLIQGGLSPADVDTVCISHCHWDHTGDTRPFVKSEFIVGAGSESLFRPGYPEDPESPYSSDLLPKG # RTRFVELGEQPSLGPFPHALDLYSDGSLYIVDAAGHLPGHVILVARTSADGGWILLGGDSAHHWNLINGESGIASGRPGFPSGCAHLDKEAAELTIQR # IREFWKLPRTRVLLAHDESWYRENKGTAAFWPGCIESK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g67 ### # start gene g68 Scaffold_3 AUGUSTUS gene 264077 264514 0.6 - . g68 Scaffold_3 AUGUSTUS transcript 264077 264514 0.6 - . g68.t1 Scaffold_3 AUGUSTUS stop_codon 264077 264079 . - 0 transcript_id "g68.t1"; gene_id "g68"; Scaffold_3 AUGUSTUS CDS 264077 264387 0.65 - 2 transcript_id "g68.t1"; gene_id "g68"; Scaffold_3 AUGUSTUS CDS 264511 264514 0.6 - 0 transcript_id "g68.t1"; gene_id "g68"; Scaffold_3 AUGUSTUS start_codon 264512 264514 . - 0 transcript_id "g68.t1"; gene_id "g68"; # protein sequence = [MAAVARHIYLRKDVGIGALTKLHGGRNRRGNRPSHHADSSAAVQRKICQSLEKIGVLEQTDNGGRRISQDGQRDLDRI # ATAVVEAAKGDDEEDEEEEEEEEEEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g68 ### # start gene g69 Scaffold_3 AUGUSTUS gene 266560 267435 0.62 + . g69 Scaffold_3 AUGUSTUS transcript 266560 267435 0.62 + . g69.t1 Scaffold_3 AUGUSTUS start_codon 266560 266562 . + 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_3 AUGUSTUS CDS 266560 267435 0.62 + 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_3 AUGUSTUS stop_codon 267433 267435 . + 0 transcript_id "g69.t1"; gene_id "g69"; # protein sequence = [MIPLQFTSLSITEQSPLTTQPDPTAVLGLLKSCPQLESFTLSGWMEAENYRYHPLPVVSLPRLHTLHLRRTTLARAIL # SHIDAPVLSKLYLANLNISHRISPEYLEPGDSEDEAHDYSQSPWSDQATGMGLRNLIARCNPPIKALEMDYSDMRTKDFIYVFDHLTELEDFLIVASD # MSNTVIRLLKPYDEAALAANFNAASTSEESDNDPCLSPAPSLTVRLPHLRNLELYNCHRISGDAIVETLMQRVKYTDRFAPEDTMEEVIIADCEQFNY # QHQDMLSKEMGLRFKMD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g69 ### # start gene g70 Scaffold_3 AUGUSTUS gene 268371 268715 0.34 - . g70 Scaffold_3 AUGUSTUS transcript 268371 268715 0.34 - . g70.t1 Scaffold_3 AUGUSTUS stop_codon 268371 268373 . - 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_3 AUGUSTUS CDS 268371 268715 0.34 - 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_3 AUGUSTUS start_codon 268713 268715 . - 0 transcript_id "g70.t1"; gene_id "g70"; # protein sequence = [MTAVLTTSMTLRIILNIRGSLKSGGVFTGGTASSGHSSSRTTHVISTRSGGHHSSQAAHTYNLEDMRTTKPEANWSEP # DADNKVIAIDGAQLDPDGVRVTVDREVGYDQYHHTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g70 ### # start gene g71 Scaffold_3 AUGUSTUS gene 274970 276157 0.18 - . g71 Scaffold_3 AUGUSTUS transcript 274970 276157 0.18 - . g71.t1 Scaffold_3 AUGUSTUS stop_codon 274970 274972 . - 0 transcript_id "g71.t1"; gene_id "g71"; Scaffold_3 AUGUSTUS CDS 274970 276157 0.18 - 0 transcript_id "g71.t1"; gene_id "g71"; Scaffold_3 AUGUSTUS start_codon 276155 276157 . - 0 transcript_id "g71.t1"; gene_id "g71"; # protein sequence = [MARIMYPHKPPNLLNVQVPGQELVLAFAESFRDYLPAESQMSDSRVIEVSLKPFYLHPVRCSKRHQDNERDEYQLKSR # NTPSPPHYASGQQLVVRAPYANHKRRDSDTLRGYSPGGNSPTVMEAPPRVSPSVKGLSGGVSSRTSSNDKNAVNIAAKHRRSPTAPEPATGSGLLQAG # VVHNVQGRTWAAGDRDSGDGYDAYSGNEEKEREREARRERGRSQQLALSQVPQAKGPAPPPPNAAQHGYPPALGRHILVQFNPSQSIADRMLMNNAQV # NKKVYARLDMIGKGGSSRVFRVMTYASELYAIKKVALDKTDSETMAGYMNEIALLKRLEGNSRIIRLVDSEVKAGPGGSKGHLLLVMECGEIDLARLI # SERSQEGLDMVWIAYYWQQVRSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g71 ### # start gene g72 Scaffold_3 AUGUSTUS gene 276381 276587 0.31 - . g72 Scaffold_3 AUGUSTUS transcript 276381 276587 0.31 - . g72.t1 Scaffold_3 AUGUSTUS stop_codon 276381 276383 . - 0 transcript_id "g72.t1"; gene_id "g72"; Scaffold_3 AUGUSTUS CDS 276381 276587 0.31 - 0 transcript_id "g72.t1"; gene_id "g72"; Scaffold_3 AUGUSTUS start_codon 276585 276587 . - 0 transcript_id "g72.t1"; gene_id "g72"; # protein sequence = [MSSSSRMLLKGTGTKPQIDRISEAGTEGESDGGEDAYAGYGGHGHELFENNAYGTDTDAGQSFACAFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g72 ### # start gene g73 Scaffold_3 AUGUSTUS gene 276824 277291 0.27 - . g73 Scaffold_3 AUGUSTUS transcript 276824 277291 0.27 - . g73.t1 Scaffold_3 AUGUSTUS stop_codon 276824 276826 . - 0 transcript_id "g73.t1"; gene_id "g73"; Scaffold_3 AUGUSTUS CDS 276824 277291 0.27 - 0 transcript_id "g73.t1"; gene_id "g73"; Scaffold_3 AUGUSTUS start_codon 277289 277291 . - 0 transcript_id "g73.t1"; gene_id "g73"; # protein sequence = [MSVSSLLQDYASPSPMTPLSRAPSVSPSSSESSVIDELSFDYDYDEAGNIVRNSKGSRTSPQSFLSTPPTDTSGVSRL # ELPKSSSPPLRRASLSRSESAYPVLNGPATASSDREKVHSSSANPARSFHRAASGPIPSTTTADSAGPQFVLCLAPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g73 ### # start gene g74 Scaffold_3 AUGUSTUS gene 277624 280386 0.66 - . g74 Scaffold_3 AUGUSTUS transcript 277624 280386 0.66 - . g74.t1 Scaffold_3 AUGUSTUS stop_codon 277624 277626 . - 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_3 AUGUSTUS CDS 277624 279300 0.98 - 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_3 AUGUSTUS CDS 279376 280386 0.68 - 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_3 AUGUSTUS start_codon 280384 280386 . - 0 transcript_id "g74.t1"; gene_id "g74"; # protein sequence = [MSLTSSDEEYLQGVITTIESTPSDTPHMVDSNALLLLVAQLSTLNKAEDSTPAGSDNGQSRARGRPRALSTSSDSSSG # SNGTSRYPSRPPSRSGPPPSTPTHPQTPLDKRQRSAPLSSNPPSAYTKRPPPHRRKSDASPGRGYSSGGAGGDSDGTSGPGKRSRSRAGSQSITTPSS # SSTAFPLSPSGTFSPGDSPSRDRFLAESGSSSPEDSTTHLPRTDYDLVDSISRIPMPHSSDSDDSDDDQDGNTYTHFVFDPEHGPRSTTSSTASLLPG # ERLEALSRANTELAKRLQDAERTLSRKIGEHESELEELQYKLEELRSELARSKRDEKELRAKEISSLESEVARLTKELSTTRDSLHSLHKQYNEQTSI # SERYRGDLRIREDHIRSLQDQAGLHDIEIGRMTEREREWEDRVLKLEREVEEAREGCAELVRQKTENLGLKETIDRLRFEMDDMRSGMGNGLGTIGMP # GSGLNSRSNTISKSLGAELQSQLEREERERAERGDFGDDDDTEGEDTVVEEIVDDNDDEGNFVTTIIKRTRRKVASKAQAELPTPKKGYSERRIEEFE # DDKVNSFAFLVSFIHLHALVQEYADCAIQYDPLAFFDPDSEDGFWRSESLQTEAEALPIPPVERVMTEMDIQTDVLEEEEDNLTGSSSTPTPTVPSDE # PPAYPGPSTSHAEKAEEQREKEVQAELAVLRKWHRSLEGRDVMDIKNIIIHNSSGSSLSAPKGIMKDWARVQRVAGIDCDVVERLLATAVADEDMVED # EEEEGKKESFKSRLSLRRFSPRIPHLPANLNISSYIPPTLIYSSLSVLIGVMLAPHIANQMNEPYGGATYYDRRAWTSFNNLGGGGEGFPGFGAAGYQ # GGTEGALWKVLEAVFRRWCEVCAGTAYIGTTPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g74 ### # start gene g75 Scaffold_3 AUGUSTUS gene 286063 286431 0.9 - . g75 Scaffold_3 AUGUSTUS transcript 286063 286431 0.9 - . g75.t1 Scaffold_3 AUGUSTUS stop_codon 286063 286065 . - 0 transcript_id "g75.t1"; gene_id "g75"; Scaffold_3 AUGUSTUS CDS 286063 286431 0.9 - 0 transcript_id "g75.t1"; gene_id "g75"; Scaffold_3 AUGUSTUS start_codon 286429 286431 . - 0 transcript_id "g75.t1"; gene_id "g75"; # protein sequence = [MNLGDNQTLADRTNVAQAVRQAKQDVGQDSDKRTITISSDSEGQENDTVPPAFMAPKAYKLAKLTNRTSSATDNAALS # ELVLEFIKVMKSNTSRTLIKDGFAFLDALNKQLEDPSVFVVPMR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g75 ### # start gene g76 Scaffold_3 AUGUSTUS gene 296094 296591 0.44 - . g76 Scaffold_3 AUGUSTUS transcript 296094 296591 0.44 - . g76.t1 Scaffold_3 AUGUSTUS stop_codon 296094 296096 . - 0 transcript_id "g76.t1"; gene_id "g76"; Scaffold_3 AUGUSTUS CDS 296094 296591 0.44 - 0 transcript_id "g76.t1"; gene_id "g76"; Scaffold_3 AUGUSTUS start_codon 296589 296591 . - 0 transcript_id "g76.t1"; gene_id "g76"; # protein sequence = [MMAENQSLQHDNKQLNTLIKEYEQTLDTLMSEHFYILSCKFSLFTGTFRNRAQTVQENELSLIRHYESHLLQLEEENS # SRELEASTRISESISRLSELLRNCLREVGGERTRLSTYDDHENDSETEEDPDLLEREPWQSTDATHAEWALEREIELARLERENEET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g76 ### # start gene g77 Scaffold_3 AUGUSTUS gene 297472 298113 0.25 + . g77 Scaffold_3 AUGUSTUS transcript 297472 298113 0.25 + . g77.t1 Scaffold_3 AUGUSTUS start_codon 297472 297474 . + 0 transcript_id "g77.t1"; gene_id "g77"; Scaffold_3 AUGUSTUS CDS 297472 298113 0.25 + 0 transcript_id "g77.t1"; gene_id "g77"; Scaffold_3 AUGUSTUS stop_codon 298111 298113 . + 0 transcript_id "g77.t1"; gene_id "g77"; # protein sequence = [MIASKVMCDDTYSNKSWSVVAQGMFTVREVNQMEREMCGYLDWELTVDGEILTPFQARVTQDFAPLHGPYPIYSLQDV # SKHAPKATASKPNSPAPSPDSLNPHFPSFSQRHPSPTKTPTATAPIPMPRSSSTRSERLHVAIKTPSPSYSNSTSPASSISPQTPVGGEDFYTQIQDF # ATTSPPEFSIKEKTIAGWPVNHPLKNDIFARAVPAAW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g77 ### # start gene g78 Scaffold_3 AUGUSTUS gene 300034 302145 0.76 - . g78 Scaffold_3 AUGUSTUS transcript 300034 302145 0.76 - . g78.t1 Scaffold_3 AUGUSTUS stop_codon 300034 300036 . - 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_3 AUGUSTUS CDS 300034 301259 1 - 2 transcript_id "g78.t1"; gene_id "g78"; Scaffold_3 AUGUSTUS CDS 301400 301561 0.95 - 2 transcript_id "g78.t1"; gene_id "g78"; Scaffold_3 AUGUSTUS CDS 301620 302145 0.8 - 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_3 AUGUSTUS start_codon 302143 302145 . - 0 transcript_id "g78.t1"; gene_id "g78"; # protein sequence = [MSHPEKTKTDPHISSDDREVNATVPATMSLSGIRDPSLPASTKRPVTPSSLDSSVMFKKTKIVPSTMSVDVEDFSLTA # AQAQRKNVLEEDPMATNVQHNSVTCDVCGKIVKYTMFDLYHWNRHKTRCKSDLSLNSRSSSVISNNADSSLTAAQAERKRILDQDPLATNVQHNSVTY # TKTRCKPGLPGPSQSSSVSSNDADSSLTAAQAQRKGILEEDPLATNVQHNSVTCKDCSAFISDPASDTNSTLMLTAAQAERKQLLEEDTLATNIQHCS # VTCRACGKVVKYTMFDLFLWEKHKSRCKLDASVLQSSSSLISSISQANDTQPRIKDIDILYTAKPSRVSPFEAGETSTDHSLTEAQSKRKRVLELDPL # ASNVKHCSLTCKACGKLVKYTMFDLFHWNRHKARCKPVPSNMSSTQGEATSVTKGKRFTPLVASTKIANLASTKASVFSEEEDLVHSHAGPPLTTSLA # IPIASGFSSHEIAVRIASGSSSHETAMLCTTRSSVAIHADAKSTPRTRTYAAFAPPSAIPSARLRALKVATSGPIVRKASSVPDITLEVNSPTSLSLY # HLDFPMSIPIVLNRISMPPALAQRKQVARFAVILSQIAIQDLSNCMLVSRMFRYASTPFSVYTSIQWLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g78 ### # start gene g79 Scaffold_3 AUGUSTUS gene 303159 304124 0.5 + . g79 Scaffold_3 AUGUSTUS transcript 303159 304124 0.5 + . g79.t1 Scaffold_3 AUGUSTUS start_codon 303159 303161 . + 0 transcript_id "g79.t1"; gene_id "g79"; Scaffold_3 AUGUSTUS CDS 303159 304124 0.5 + 0 transcript_id "g79.t1"; gene_id "g79"; Scaffold_3 AUGUSTUS stop_codon 304122 304124 . + 0 transcript_id "g79.t1"; gene_id "g79"; # protein sequence = [MFDFVEVVQDQSVMIISDSDSDDIQFIGSRLSAGARQQVVQRPNPSTLDSTIERGRTSYSSISASRVRAAAPHNKNVT # PQTDMELKPTPALQTYPAPLIVPVAEGLVTSLPSSKTRISEDGPRVPVLPWPAPQSFVTKNELPSLNHVPHVQHIARPQQNAASEMTTLKIVRKARKV # TYRPPLSVTPPEISVSLSPASRSSTGPLTLADFVSELRDRNANTLLVTREYDSLTLVSANLRQWLTVGNQDGAEEVMRLADGRVSNQKETEMVAQARS # QRKKFKGRRFDTRSTTRTSLSFLDYQMDYAIRVVSIICTNDWLLRRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g79 ### # start gene g80 Scaffold_3 AUGUSTUS gene 316303 316914 0.69 + . g80 Scaffold_3 AUGUSTUS transcript 316303 316914 0.69 + . g80.t1 Scaffold_3 AUGUSTUS start_codon 316303 316305 . + 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_3 AUGUSTUS CDS 316303 316914 0.69 + 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_3 AUGUSTUS stop_codon 316912 316914 . + 0 transcript_id "g80.t1"; gene_id "g80"; # protein sequence = [MDEAESLSKVSTHTSQLSAPIFPLESGLEPLGRPGQSSLATEQQTFVTAPSEFTELSQVQTPEPTTQNLSPSPPDGEH # QNARGPSPSSSTALLRPSTSWKNDIGTSHAQSEPARRSIIRLPSFSRNGDSPHKAKKSVHYNLSPVESNSSLPPVSPSAVLERTGTDVSGTSAGAMNI # PAIDDQQIDWGDTVMRGMSRPMLENAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g80 ### # start gene g81 Scaffold_3 AUGUSTUS gene 331432 331833 1 - . g81 Scaffold_3 AUGUSTUS transcript 331432 331833 1 - . g81.t1 Scaffold_3 AUGUSTUS stop_codon 331432 331434 . - 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_3 AUGUSTUS CDS 331432 331833 1 - 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_3 AUGUSTUS start_codon 331831 331833 . - 0 transcript_id "g81.t1"; gene_id "g81"; # protein sequence = [MPAASSSRRKRVAPSSDIEDGPTQKSTREDVEEDDEQPQRVVKKEKKVVKGKGRAAEAYHSEEEEDDDDKIDVDSFAD # QPLDKSHIISMNGFASDWGTMIKTVQRTNNMVADVAVALADNVEGDVGKKVRFPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g81 ### # start gene g82 Scaffold_3 AUGUSTUS gene 335807 336922 0.56 + . g82 Scaffold_3 AUGUSTUS transcript 335807 336922 0.56 + . g82.t1 Scaffold_3 AUGUSTUS start_codon 335807 335809 . + 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_3 AUGUSTUS CDS 335807 336922 0.56 + 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_3 AUGUSTUS stop_codon 336920 336922 . + 0 transcript_id "g82.t1"; gene_id "g82"; # protein sequence = [MLGIDALFKSHLELEHLPSLRRLALDISIAYLLPILRRLASAYDARHSELSASESQVTMESLPSITHLYIPAIGYKSS # FRGPNDADSAHANDAPQLHPNQDQELLVEDTDVQPTGTAPVFHDLNKNLHEALEVLLPIHPVFGDLVELRCDADDLYNAADFAMASSTQFFQSQYYWR # MQAKEAAESDSVSSTRGVSQPYSTFVPFRRTDTVLALGEADADAEADAEVLTPTQFSLGSASLHRYPRPGTLSHSRLRLHVRKLRKHMPLCAAKGITP # IPVVRYWFNDVPTGLVFEERMWASGDGYASITGVGNWDTSVGGPDGEEIAAFAQAEEDVESMGGMQGLSMRGMEIWDTEKGRVLIVLFLLSAVVMLW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g82 ### # start gene g83 Scaffold_3 AUGUSTUS gene 341743 342648 0.88 + . g83 Scaffold_3 AUGUSTUS transcript 341743 342648 0.88 + . g83.t1 Scaffold_3 AUGUSTUS start_codon 341743 341745 . + 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_3 AUGUSTUS CDS 341743 342648 0.88 + 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_3 AUGUSTUS stop_codon 342646 342648 . + 0 transcript_id "g83.t1"; gene_id "g83"; # protein sequence = [MSESELAKTPAIDYLRPIVADADTGHGGLTAIMKLTKLFVEKGAAGIHVEDQAPGTKKCGHMAGKVLVPISEHINRLV # AIRLQYDILGVENLAVARTDSEAATLITSNIDDRDHPFILGCTNSSLPPLNKVMVDAERAGKVGDELQSIEDKWMAAANLQVFSSTLAQALAKEGKND # ATVKKFLALVSKSSYPDAVVIAQKEFGLQSVPYWDWDSPRTREGYYRYQGGTECAIHRAIAFAPYADLLWMETKKPILSQAQQFSAGVHAAYPGHWLA # YNLSPSFNWDAAGLNEKDMQSYVWELV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g83 ### # start gene g84 Scaffold_3 AUGUSTUS gene 347556 349720 0.19 + . g84 Scaffold_3 AUGUSTUS transcript 347556 349720 0.19 + . g84.t1 Scaffold_3 AUGUSTUS start_codon 347556 347558 . + 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_3 AUGUSTUS CDS 347556 348161 0.49 + 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_3 AUGUSTUS CDS 348222 348825 0.37 + 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_3 AUGUSTUS CDS 348942 349720 0.7 + 2 transcript_id "g84.t1"; gene_id "g84"; Scaffold_3 AUGUSTUS stop_codon 349718 349720 . + 0 transcript_id "g84.t1"; gene_id "g84"; # protein sequence = [MEKRTGSPSSEESDAKRARMSENATPVDPETAPGKRSELEPISAGEIGNLPPEGEPEPRPESGGRVRLLKADAEDDDG # GDISMADGADDDGDSGDDNDDEDPAQLEATRQRLEEQARKYLAAQTHEVIIPSFSAWFDMSKIHPVERRALPEFFNSRNRSKTPAIYKDYRDFMINTY # RLRPTEYLTLTACRRNLAGDVCAIMRNNSPYQFLVQVDPETRPATLAPPFTGHFRVILDTPRGLQSLHPGTRPSNPGAAAVNGVNSASQHTDSSTSAS # LKLRNSIYQTTNKSSRPVSASEATTLANGINGTNGSRTQGLYTCDTCGSDCSAVRYHHLKEKNFEICAPCYLEGRFPSNMFSGDFVKLSRAVVHGSTD # DDWTDQEVLLLLEGVEMYDDDWSKVQEHVGTHNPVMSVVAFLAGVVAPSVGAEAAKTALHELIKTDKDDQKPAADVTEGVETTDTKMTAAEGPDSEKQ # DDKMVEDSNEDTETNRPLTDRMSVDPSSTSANLPSPSSSKHSVPHSKVVRAAHLALNSSAKAAASLASAEDQQIKSSLSKLVNLTLTKLELKMTQFEE # LEEILEDERKGLESARLALVQERLGIKRSLEYVRGEIAKFQGMGVAAPQTLINAANGASLGTTGQGTQPTPVDPTPQLGEAIGPIGDGSLLQLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g84 ### # start gene g85 Scaffold_3 AUGUSTUS gene 352457 355131 0.21 - . g85 Scaffold_3 AUGUSTUS transcript 352457 355131 0.21 - . g85.t1 Scaffold_3 AUGUSTUS stop_codon 352457 352459 . - 0 transcript_id "g85.t1"; gene_id "g85"; Scaffold_3 AUGUSTUS CDS 352457 352916 0.89 - 1 transcript_id "g85.t1"; gene_id "g85"; Scaffold_3 AUGUSTUS CDS 353082 353100 0.63 - 2 transcript_id "g85.t1"; gene_id "g85"; Scaffold_3 AUGUSTUS CDS 353341 353700 0.77 - 2 transcript_id "g85.t1"; gene_id "g85"; Scaffold_3 AUGUSTUS CDS 354330 355131 0.31 - 0 transcript_id "g85.t1"; gene_id "g85"; Scaffold_3 AUGUSTUS start_codon 355129 355131 . - 0 transcript_id "g85.t1"; gene_id "g85"; # protein sequence = [MSYSPHAAATQLASALRGFDHLFANEISSAKRVFASETDPFHLVGAGCLCFLEASLGLETSKMSEATRLLALAEAGSR # AALKTAAKSKSRASAAFPPGLEYEIANADTVVLLGITHALSESYMGYLQCIYAMNSAHGKFSKLYKTVFPNGLDSHTTPSITPFSWTPSVTPSPAVSP # AITPKTSSSNLSLETSAFTSNSNKPAHPAVKPSLSFFNIAGRWGSGSSSPASSSTSSLSPPTPNGALSVVEAGNPEEIQNLKNLIIAGTAFGGYAGKP # FAPVVDLLCIHMKTGFIQLVFELAWIYLSQRHYVESAEAFIKLTELNSWSHGTYYFIAAGCHISLAHSDEVSPDEKEKYLNQAQRLLDAIPNLLDKRK # MGGKELPTEVLIKKRXAHIKDCPASTEPASSSSSYIDTSGAAPESIVESTSSLSLFEELTPYADNASACLRASRELLFAAHAFQSSIKVSTWIGGLAM # FELAVLDLKEVEVEENNEKNGNSINPGLSADMKNRWKKALESARIKLDAAMALAPNSVDLSSRLDSRVVMLRDELE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g85 ### # start gene g86 Scaffold_3 AUGUSTUS gene 362149 362868 0.61 + . g86 Scaffold_3 AUGUSTUS transcript 362149 362868 0.61 + . g86.t1 Scaffold_3 AUGUSTUS start_codon 362149 362151 . + 0 transcript_id "g86.t1"; gene_id "g86"; Scaffold_3 AUGUSTUS CDS 362149 362868 0.61 + 0 transcript_id "g86.t1"; gene_id "g86"; Scaffold_3 AUGUSTUS stop_codon 362866 362868 . + 0 transcript_id "g86.t1"; gene_id "g86"; # protein sequence = [MQSTSRSQTPRFNSAYPPTPDSIPSTSSVSSELTRQLSASPALSSISSHSHRSQRLIQQQQPQYQMSMSPASSAISPS # AYGFHLPGPQPNSLLPSSSSQPPSNPVISRPYAKPKQRKQRLFNVDRKAICEYHLAHPNEKQELIARQYGVERSTISKILKAQGKWLNIELGDARGCG # TNGTGLPLRLAKHRPSKFPPVELEMQRWLVEISDKYYASLPDPSTYPFDPQIPRRFTDQTRVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g86 ### # start gene g87 Scaffold_3 AUGUSTUS gene 370643 372403 1 - . g87 Scaffold_3 AUGUSTUS transcript 370643 372403 1 - . g87.t1 Scaffold_3 AUGUSTUS stop_codon 370643 370645 . - 0 transcript_id "g87.t1"; gene_id "g87"; Scaffold_3 AUGUSTUS CDS 370643 372403 1 - 0 transcript_id "g87.t1"; gene_id "g87"; Scaffold_3 AUGUSTUS start_codon 372401 372403 . - 0 transcript_id "g87.t1"; gene_id "g87"; # protein sequence = [MLASPPPPSSDNTNSNIHDTSGAPPPSSINAPKSKKRRVTISGAPALNTDVRIAADQTNSTPISPVVIGFTVQRDNPS # EVEQIRSMLTVKQQQQALIEQRRGSTSGIMSPTIAAGPSAAAGEGHPKSSLQGTRSVRRSPNSGTNNRRHTVIIQAGTNRPLSPNSNIVHTQAPPASV # ASHSLPPPPISFARRRANQIGGGKKKPADIMISPRDAHTPDQFAPSIQSAPPIPHAGQQGSGLVGRFPMALPRLPSVMGDNVRRTVGGNVPPTPTRFS # AQRMAISQGVSHPITGISGRSPPNASVPISSTLVPSTPSALHNPGYTGEKSAFLAPFESFYDALNDSKQLKTWLSEQLQRSKVLIQNLTQQQDKLHET # VDSLVEKKVAGMRTEIVGLNRRVEELEDALRVATSSRRPSIEGPASGNKGKQTVRNGNLLGTSITEGYTFPPIATIDRERLRSESSEHRMSPGWTHDK # DSRDTQDSEHGSPVLYESRRLSLSSSRLEPRAQSMESVVRPFASPSLPFREVPSVSHPPPTSSKLPRGGRPLGPGRHHSSPRLPGPVQDSLVMSSPRR # EESRRSSIVDGSIDDRES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g87 ### # start gene g88 Scaffold_3 AUGUSTUS gene 379113 379905 0.77 - . g88 Scaffold_3 AUGUSTUS transcript 379113 379905 0.77 - . g88.t1 Scaffold_3 AUGUSTUS stop_codon 379113 379115 . - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_3 AUGUSTUS CDS 379113 379675 0.99 - 2 transcript_id "g88.t1"; gene_id "g88"; Scaffold_3 AUGUSTUS CDS 379725 379905 0.77 - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_3 AUGUSTUS start_codon 379903 379905 . - 0 transcript_id "g88.t1"; gene_id "g88"; # protein sequence = [MILFKYIEDKDVFQTFYTTKLSKRLIHGVSASDESEASMISKLKEACGFEYTNKLQRMFTDMSLSKDLTDSFKERMQQ # NHDDMDMTFSVMVLGTNFWPLNPPSHEFVIPAEILPTYDRFQKYYQQKHSGRKLTWLWNYCKNELRTNYLNQKYILMTSSYQMAVLVQYNKNDTLSLE # ELIAATSIPKELMTQILAVFVKAKVLINEETDQYDLNPGQCWNNRRAKLTPFKASSPRRSVSILISQSRLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g88 ### # start gene g89 Scaffold_3 AUGUSTUS gene 379952 380916 0.4 - . g89 Scaffold_3 AUGUSTUS transcript 379952 380916 0.4 - . g89.t1 Scaffold_3 AUGUSTUS stop_codon 379952 379954 . - 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_3 AUGUSTUS CDS 379952 380782 1 - 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_3 AUGUSTUS CDS 380911 380916 0.4 - 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_3 AUGUSTUS start_codon 380914 380916 . - 0 transcript_id "g89.t1"; gene_id "g89"; # protein sequence = [MKKHTKLAGAVLRLIEQQRNGETIDQGLVKKVVDSFVSLGLDETDTNKACLDVYREHFEGPFITATEKFYKQESESFL # AEHSVSEYLKKAEERLKEEEDRVDRYLNTQTRKALIGKCEHVLIREHAPLMWDSFENLLDFDKDEDLQRMYALLSRIPEGLDPLRKRFEEHVKKAGLL # AVSKLAGEGTTEEALDPKAYVDALLEVHQKNSETVTRSFRGEAGFVASLDKACRDFANRNAATGNSNTKSPELLAKHADLLLRKNNKLAEEGDLEGAL # NRAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g89 ### # start gene g90 Scaffold_3 AUGUSTUS gene 387210 387920 0.84 - . g90 Scaffold_3 AUGUSTUS transcript 387210 387920 0.84 - . g90.t1 Scaffold_3 AUGUSTUS stop_codon 387210 387212 . - 0 transcript_id "g90.t1"; gene_id "g90"; Scaffold_3 AUGUSTUS CDS 387210 387920 0.84 - 0 transcript_id "g90.t1"; gene_id "g90"; Scaffold_3 AUGUSTUS start_codon 387918 387920 . - 0 transcript_id "g90.t1"; gene_id "g90"; # protein sequence = [MSLPTLRRSLARNRNFARCISSSSSSDPQHSKTTSFGFQTIPENAKESMVKSVFDSVASKYDLMNDAMSMGVHRLWKD # QFVGDLKPGRRGPMKCIDVAGGTGDIALRILDFAREKYADRETSVEVVDINEQMLKEGYRRFKKTMYHNSKFYSHGTLTQSLHVKLLAPQISFHEANA # QSLPKEKFRDNSYDLYTIAFGIRNVTSIPAVLDEAYRVLKPGATFACLEFNKVDNPLLGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g90 ### # start gene g91 Scaffold_3 AUGUSTUS gene 387995 388627 1 + . g91 Scaffold_3 AUGUSTUS transcript 387995 388627 1 + . g91.t1 Scaffold_3 AUGUSTUS start_codon 387995 387997 . + 0 transcript_id "g91.t1"; gene_id "g91"; Scaffold_3 AUGUSTUS CDS 387995 388627 1 + 0 transcript_id "g91.t1"; gene_id "g91"; Scaffold_3 AUGUSTUS stop_codon 388625 388627 . + 0 transcript_id "g91.t1"; gene_id "g91"; # protein sequence = [MSVKGKEKAKVIGQYPSSKKNLPETHLILDLTDESSDSESENSSSSSSSEDEEESITQEFLDSLLEKARQNADLQDKE # EQRAQEDQEDVLILDKIDHQPYVFNSQLNELSSFFVVSFSYNSIPALDPGNLPPSYFNTSGFSKNQNGNESFPSGAAFSLSRDPLVESAESALAKVAK # SSLSASSSLLPPPEFHHGKALTKRQRKEVQLPHF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g91 ### # start gene g92 Scaffold_3 AUGUSTUS gene 391900 392340 0.34 - . g92 Scaffold_3 AUGUSTUS transcript 391900 392340 0.34 - . g92.t1 Scaffold_3 AUGUSTUS stop_codon 391900 391902 . - 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_3 AUGUSTUS CDS 391900 392340 0.34 - 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_3 AUGUSTUS start_codon 392338 392340 . - 0 transcript_id "g92.t1"; gene_id "g92"; # protein sequence = [MDRREMFKRETDARADRSYCCKAKHSSLESIMLSVFQTHNTALLSPLAQHVVGIALDGKIIQGTVADVIMNNTILAAK # LIESETGSLKTYSKSFGEEQPMQKELHNSQGALVLAEEMEIGHVSWEACKLLVGCLVHEFIIPQSNCI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g92 ### # start gene g93 Scaffold_3 AUGUSTUS gene 396327 398293 0.45 - . g93 Scaffold_3 AUGUSTUS transcript 396327 398293 0.45 - . g93.t1 Scaffold_3 AUGUSTUS stop_codon 396327 396329 . - 0 transcript_id "g93.t1"; gene_id "g93"; Scaffold_3 AUGUSTUS CDS 396327 397359 0.92 - 1 transcript_id "g93.t1"; gene_id "g93"; Scaffold_3 AUGUSTUS CDS 397454 397539 0.67 - 0 transcript_id "g93.t1"; gene_id "g93"; Scaffold_3 AUGUSTUS CDS 397659 398109 0.92 - 1 transcript_id "g93.t1"; gene_id "g93"; Scaffold_3 AUGUSTUS CDS 398202 398293 0.68 - 0 transcript_id "g93.t1"; gene_id "g93"; Scaffold_3 AUGUSTUS start_codon 398291 398293 . - 0 transcript_id "g93.t1"; gene_id "g93"; # protein sequence = [MPRRPSKKSKSAGKPRNTNRPDAKINKWNDRDQILLNNEEEEDDGDIDDDEVFALQMEDEDDEEDEESEAMEENENQS # SRASPKAAKSKQKATAKGKGKGKESQLESSDDDDEEEEETWGSGKAAYYSSNAAQIESDDEEALQLEEQEAKRLQAKARDDMNDEDFGLEDSIEANVT # GGSEYKTDPECLALAGDWTDSATTLMKTKQKLEKNDASTLSCVFAIILPNISPLILIQLAETLLTYTTTLAFYLYLRASQKYAQKPELLRSHPVMQRL # LKLKQSLITLEDLNFAVSDDDDSGDEEEEEENEDDIMQDARQLWEREHSNEDEDEDVDSDELDQLLADARSITNSNSNRVIIQPKAPALTHPPKKKRK # TDSESEKSSLSMFDLVEPEFVSSKTTSSTSPYAAADAFGEATSLQHADTADKSARRKTLRFHTSRIESANARRSNARSNALGGDDDIPYRERKKDRED # RLAREAAARVRTQGGADLDDTEPEPRRPDDNDGDGDEEMEGANGYYDLVRNKLRRRRSERKRSMKPQGLIGTWSSFYYILNAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g93 ### # start gene g94 Scaffold_3 AUGUSTUS gene 400246 400662 0.6 + . g94 Scaffold_3 AUGUSTUS transcript 400246 400662 0.6 + . g94.t1 Scaffold_3 AUGUSTUS start_codon 400246 400248 . + 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_3 AUGUSTUS CDS 400246 400662 0.6 + 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_3 AUGUSTUS stop_codon 400660 400662 . + 0 transcript_id "g94.t1"; gene_id "g94"; # protein sequence = [MDVAQVLALVHNAQQGRTIALPGPSTLTYEYLLDLVSSLTFQPPSRAPVVPKSVALAVAKAAQAVWWPLLSPDEVVRR # YIDDADTPGDWDSVGVTPSEIEQHAIQYVRRYRSAENFSRPNVFPPRPVVSHVYSASTHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g94 ### # start gene g95 Scaffold_3 AUGUSTUS gene 404500 405233 0.84 + . g95 Scaffold_3 AUGUSTUS transcript 404500 405233 0.84 + . g95.t1 Scaffold_3 AUGUSTUS start_codon 404500 404502 . + 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_3 AUGUSTUS CDS 404500 404670 0.85 + 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_3 AUGUSTUS CDS 404805 405233 0.99 + 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_3 AUGUSTUS stop_codon 405231 405233 . + 0 transcript_id "g95.t1"; gene_id "g95"; # protein sequence = [MWIVLFNALDEFGVKELNENDRSGSPPENVQNRGYIEDAMRRVGEEALNGALRIAALKLDPAVVEFHIIAAGHLLARF # GRPEVATCIDGLKQYSHSYEEAGEHAQDIRKTYEQVRNSGVDLNHMAALVKQIAAFPTTTTEPEILPGGHEPMSPSVLGSFQMNGMSNMDGTGILMDV # DEESTAFVAAHKNEVCASQTSRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g95 ### # start gene g96 Scaffold_3 AUGUSTUS gene 406463 407440 0.98 + . g96 Scaffold_3 AUGUSTUS transcript 406463 407440 0.98 + . g96.t1 Scaffold_3 AUGUSTUS start_codon 406463 406465 . + 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_3 AUGUSTUS CDS 406463 407440 0.98 + 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_3 AUGUSTUS stop_codon 407438 407440 . + 0 transcript_id "g96.t1"; gene_id "g96"; # protein sequence = [MANEKRRSWRLSISSSTGTECQESDGQHDADISTSPSITSSHKRRWSLTPNFSKNLPLNSIDGPSDHALERISSTQPS # ITKEGSRTGSFGKSLSSMMGGIPGLSNLTLSRTSTKDSVTNNEDARGRSMSKNKHYRSSSHVPSTTETTSKSHSRARSQSPFSFRRFRSQRDSSPVPP # LPLSSTSSEVSLVPDTNPSPNIRPRTAFTDDADVLDYGSGDETETVNGETDGEYTEDEDSGDEIDIFDDVTERNTERNAVVELPAAGALGLYDADADI # DPDPLGEGVNVVVPPEPYFPSTIHSHPLALPQEQNAMPDVEKAQSIMNLCH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g96 ### # start gene g97 Scaffold_3 AUGUSTUS gene 408131 408454 0.93 + . g97 Scaffold_3 AUGUSTUS transcript 408131 408454 0.93 + . g97.t1 Scaffold_3 AUGUSTUS start_codon 408131 408133 . + 0 transcript_id "g97.t1"; gene_id "g97"; Scaffold_3 AUGUSTUS CDS 408131 408454 0.93 + 0 transcript_id "g97.t1"; gene_id "g97"; Scaffold_3 AUGUSTUS stop_codon 408452 408454 . + 0 transcript_id "g97.t1"; gene_id "g97"; # protein sequence = [MVARRRLKRPPRKSAHLATHRVHVSLADAGIDRVAAKVDEDVKQMRDQIQRDDAQRSGTVHKDPGAEAALEREAREER # IDEDGDEGDEEVDDEAAGVKVAGTASLQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g97 ### # start gene g98 Scaffold_3 AUGUSTUS gene 410434 410787 0.48 - . g98 Scaffold_3 AUGUSTUS transcript 410434 410787 0.48 - . g98.t1 Scaffold_3 AUGUSTUS stop_codon 410434 410436 . - 0 transcript_id "g98.t1"; gene_id "g98"; Scaffold_3 AUGUSTUS CDS 410434 410787 0.48 - 0 transcript_id "g98.t1"; gene_id "g98"; Scaffold_3 AUGUSTUS start_codon 410785 410787 . - 0 transcript_id "g98.t1"; gene_id "g98"; # protein sequence = [MELDILSSPNGMNASVQSLSRLNRVYNQNDSNHGGITQIPDLQKAPQNAVESTLEYDLGNGDKAISQYKGREYIQLAA # LYWCMFLAGWNDGSTGPLLPRIQEVYNARRQLDVFGIII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g98 ### # start gene g99 Scaffold_3 AUGUSTUS gene 419342 420434 0.68 - . g99 Scaffold_3 AUGUSTUS transcript 419342 420434 0.68 - . g99.t1 Scaffold_3 AUGUSTUS stop_codon 419342 419344 . - 0 transcript_id "g99.t1"; gene_id "g99"; Scaffold_3 AUGUSTUS CDS 419342 419835 1 - 2 transcript_id "g99.t1"; gene_id "g99"; Scaffold_3 AUGUSTUS CDS 419903 420434 0.68 - 0 transcript_id "g99.t1"; gene_id "g99"; Scaffold_3 AUGUSTUS start_codon 420432 420434 . - 0 transcript_id "g99.t1"; gene_id "g99"; # protein sequence = [MSWGSTGSVKASFSVDGYSTSQTFTANTAANNGLTNSTNYPFYSNTSLSSGNHTLTVNVTSVSGNLPFIIDYLTYQPN # FDNIDSKPNFTAQAGIGSSTGPDSNPGSSAGSTSSDTTSKSHAGAIAGGVIGGLLAIAAILGGILLWRRRSRFDKPKYSARGRANVLDSNERLMVETP # GNILYPMQHLAQDLKSVSGPPKALSTEMHSGSDYTSASGATTPTAPGSDSSRPLTDNEKQTELRRRLDEIASLMQQMEVQTSADSSSSAPVKGSGDSN # VLDLQARIDRLTRENERLMETYVVPPAYEGVEGTTTTGESVLGEHVPGNARNEKRILRLAYEPRDSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g99 ### # start gene g100 Scaffold_3 AUGUSTUS gene 423764 424714 0.94 + . g100 Scaffold_3 AUGUSTUS transcript 423764 424714 0.94 + . g100.t1 Scaffold_3 AUGUSTUS start_codon 423764 423766 . + 0 transcript_id "g100.t1"; gene_id "g100"; Scaffold_3 AUGUSTUS CDS 423764 424714 0.94 + 0 transcript_id "g100.t1"; gene_id "g100"; Scaffold_3 AUGUSTUS stop_codon 424712 424714 . + 0 transcript_id "g100.t1"; gene_id "g100"; # protein sequence = [MTVHEPSSKCTLMANTPQADIELLLADSLTSKILQKQSGVTLDKDRAHIRLRYSRQMHSLEISQCVTGPQGKEWRKRT # LGISSLDPAIEPALSNFANAEAEGLSRLSKFLRVCVSLEEEETIYGQEHDTTVLARSLNPDLVANSLVFKNPHVTNRVASSSRTLAQSFSVSSVDLRL # APRPPKFSSMSKRLAQDDQELEDIITPPEKQFREIDYSTKALSLTASDITPSWYRNGFCSTELIASTQPLQTRYIPSAGWCIRYDSKVSQGGRYKVMF # LDGEILDIDVDEEWVEHIVPDLDGTGKKQRYVFVLSMLLMKH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g100 ### # start gene g101 Scaffold_3 AUGUSTUS gene 425246 425686 0.59 - . g101 Scaffold_3 AUGUSTUS transcript 425246 425686 0.59 - . g101.t1 Scaffold_3 AUGUSTUS stop_codon 425246 425248 . - 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_3 AUGUSTUS CDS 425246 425686 0.59 - 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_3 AUGUSTUS start_codon 425684 425686 . - 0 transcript_id "g101.t1"; gene_id "g101"; # protein sequence = [MDLIENVNLATSNQYSLHAGSSSCVQSSSATSNQTGTTTSTNCTVVPSEDENTGCVVEDTQSDSFGAGFAENNGGVYA # VLWDESGIAMWFFNRSSVPSDISSSQPDPTSWSTASAWYPASGCSPSSVFGPQTITLVCVQWTSCYDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g101 ### # start gene g102 Scaffold_3 AUGUSTUS gene 427973 428722 0.84 - . g102 Scaffold_3 AUGUSTUS transcript 427973 428722 0.84 - . g102.t1 Scaffold_3 AUGUSTUS stop_codon 427973 427975 . - 0 transcript_id "g102.t1"; gene_id "g102"; Scaffold_3 AUGUSTUS CDS 427973 428722 0.84 - 0 transcript_id "g102.t1"; gene_id "g102"; Scaffold_3 AUGUSTUS start_codon 428720 428722 . - 0 transcript_id "g102.t1"; gene_id "g102"; # protein sequence = [MLKSTLFWFCALISTIHATLVTDVQGIAFQSPFAGKSVSNVTGVVTAKTSGGFYISGTSSSDVRASNGLFIFSETTTV # LNKVAVGDMVSVTGTVSEFRSSSDPDDLTATEITSPTAANVVVLSTSNTVSPVKLGTDRIPPTQALSALDVGPDGWLSVPNNQSRVDTVNATLVPTDY # GLDFWASLEGQLVTVPSPLSVAFPNDFGEFWVVGDWPVTGLNSRGGLSITIGKYDFVPFSLTSNLFLVSNRPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g102 ### # start gene g103 Scaffold_3 AUGUSTUS gene 434261 435902 0.54 + . g103 Scaffold_3 AUGUSTUS transcript 434261 435902 0.54 + . g103.t1 Scaffold_3 AUGUSTUS start_codon 434261 434263 . + 0 transcript_id "g103.t1"; gene_id "g103"; Scaffold_3 AUGUSTUS CDS 434261 434926 0.54 + 0 transcript_id "g103.t1"; gene_id "g103"; Scaffold_3 AUGUSTUS CDS 434985 435902 1 + 0 transcript_id "g103.t1"; gene_id "g103"; Scaffold_3 AUGUSTUS stop_codon 435900 435902 . + 0 transcript_id "g103.t1"; gene_id "g103"; # protein sequence = [MWKSRPSIISKPLEEASKSKKGKGKDKQKEVPPEAGDNMRVLWIYFHPSMYDEVFSALRTSTSQTLEAAGSQGVIVDV # ELIDIRGEVGIFEIMGPKSNQVLRGSLSPVMAQASDDFKKFWASLGNIQSCGSVPRGMIIGFLVNDPRLRFVVNWRQRAYSIVSSRFPPKNAKVQLPV # GNSVSSSIGVFPSAALAACNVWEQNIRNQLKNPRYQTKDINARRAQNLIPGTPLNPLRQDDRIPVMLIQTSYQHSASNDTESIEGWTFIFPAGWSMAF # FQQLTYTGTRVAGQRERQTQAFEAGTPYFPSDYPSTSAYKTHISARAEKEKAKWARTPAAKRVNYRKLGTRSPWIPDWEVVLGLKEMPDELLDDDDDD # EENVDDVEDMQDLITTQREPEQSLEQQREDFLVDDDPAVGPWLLRDVEISSIVSDLSEDLVPSQSLLATLNRLRAKRSLEPLESTIKPDNLLKSALVS # VRITICSKGSPSDLSLVYSIPDPELQEWRKGLTRAGVDPIPAEVEFVNVSTMIALSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g103 ### # start gene g104 Scaffold_3 AUGUSTUS gene 436354 437097 0.84 - . g104 Scaffold_3 AUGUSTUS transcript 436354 437097 0.84 - . g104.t1 Scaffold_3 AUGUSTUS stop_codon 436354 436356 . - 0 transcript_id "g104.t1"; gene_id "g104"; Scaffold_3 AUGUSTUS CDS 436354 437097 0.84 - 0 transcript_id "g104.t1"; gene_id "g104"; Scaffold_3 AUGUSTUS start_codon 437095 437097 . - 0 transcript_id "g104.t1"; gene_id "g104"; # protein sequence = [MDRIPGSPSPQKVKPPFTTSNAHIPRAPSSPSKLPLPGSSRTRVPSSSTFNPILPAKNPSYPRIVHHTHTSSATYRPP # RKDEQMLSLNGSPLANPFWTDGLLPPDSRSSGDMGEPRTLKRTQSNISIRRDPSFVSGLPPRADSQSSFYPGTSSKPHSRNNSDATLAESTTGPYSGL # PKTSFETPYAPTKKYMVTISTKDGHILEFDPLQTSPKALDALEGITDSAKKQAREEMGCLVEAAVDKWKIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g104 ### # start gene g105 Scaffold_3 AUGUSTUS gene 437322 437522 0.76 - . g105 Scaffold_3 AUGUSTUS transcript 437322 437522 0.76 - . g105.t1 Scaffold_3 AUGUSTUS stop_codon 437322 437324 . - 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_3 AUGUSTUS CDS 437322 437522 0.76 - 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_3 AUGUSTUS start_codon 437520 437522 . - 0 transcript_id "g105.t1"; gene_id "g105"; # protein sequence = [MKEFGEKYHGNPVIAVTGSQKEKLAAQVGDGLGEIDKTERKRKWMAIQETRDGDDAESSKDSKSGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g105 ### # start gene g106 Scaffold_3 AUGUSTUS gene 443541 444197 0.95 + . g106 Scaffold_3 AUGUSTUS transcript 443541 444197 0.95 + . g106.t1 Scaffold_3 AUGUSTUS start_codon 443541 443543 . + 0 transcript_id "g106.t1"; gene_id "g106"; Scaffold_3 AUGUSTUS CDS 443541 444197 0.95 + 0 transcript_id "g106.t1"; gene_id "g106"; Scaffold_3 AUGUSTUS stop_codon 444195 444197 . + 0 transcript_id "g106.t1"; gene_id "g106"; # protein sequence = [MKLKSLRWLGESTTSPSAKVIIRHSLGAFTQETSDNDNLYTFDVLRILYGYRSMVDLIVECIDLFQVVDVQDNDQLDY # LEGQVRACILYSNCRLNFYQMKLDPKIPIPDITVALTLLSAGVIEVPISYDGKTIMLQRDDVLPWILDIYRQSNYDRESELQLPALVWNSLFDWYRDK # VGMEVVRQTLHGYLGAHEEYTSNSILEATQYLSDAIYFRYMD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g106 ### # start gene g107 Scaffold_3 AUGUSTUS gene 445579 448259 0.49 - . g107 Scaffold_3 AUGUSTUS transcript 445579 448259 0.49 - . g107.t1 Scaffold_3 AUGUSTUS stop_codon 445579 445581 . - 0 transcript_id "g107.t1"; gene_id "g107"; Scaffold_3 AUGUSTUS CDS 445579 446120 0.97 - 2 transcript_id "g107.t1"; gene_id "g107"; Scaffold_3 AUGUSTUS CDS 446204 448259 0.49 - 0 transcript_id "g107.t1"; gene_id "g107"; Scaffold_3 AUGUSTUS start_codon 448257 448259 . - 0 transcript_id "g107.t1"; gene_id "g107"; # protein sequence = [MDVMMSMRAQAVISPTTNTTSPTRSTFSSQDSTGNGYPISPASPTTPTVGSHSVSGHDAASVSSTRSSKRARPSSSHG # KSPSVAGIGSGAVLSLKGLFGSKTAVGHTSGRQRSSSRASGVDEWDDPPNPRGARVERTESVVSVGSSKSSVIPKGNNLISILRATSPPNEGSTVGFI # SSGSGMGVHAPAVDFSALGIHSSPAQTPQSQLDRKILQRPLAHDDHDGSMTARPLLFGNDTAAPFDTAAGGTREDRRTPRTLSVSETFSLQPPPRKRW # TSTSDVHTPPVLNTPSSHQLQLQESPFIKDRRNLDDFDVLGGAPSISRLNTSGSGSLTPEPPTNSSPATKRTSGQSAFSFSFGTPPGSGNLDVEYRPR # SLSSRSARSARSGQSVRSGDTAEEELEELDVPVSGFDGHSSSSRTRRASGGSGFGSSPDVDKRSSMSSGKRNSVGVSQGKRWSRQLPKRLTPPSGPPP # AAPSTPPSSPAHSVIKGTNQSPVKSLPKILPTHPYSGAATEQRASMMTTRSTRSTSSRPSSSHSSVVSNLPSFSKRASASSAMSVLSTTSLQASGTTT # PVSSGTHAVGNGITGHTRPTSSHRSSLAPPPRPAPTFALPPAPGEASVPPMLTPPMSAPVSSTNNKSSFRDSITSRAFRLSLMAPKPPPSGVLPPRPD # ELEHPKVLPALSPRGIRTDAMDAVHVTRGPLPPTPVSGVPASTPSRGVSIKQRLRILSAPSPSSAPPASPRSSTRPTTIMAPLTGASPPGTPTFAHGL # THYFENSGSFHAVATPTTPSLPAPKIHHVEDEPDVEPELTSLSPPPRRGSKRISLPEVEAPPAIPEDEPSPLQRMPIEDNRPNDTNKPFSLSRPASVI # SFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g107 ### # start gene g108 Scaffold_3 AUGUSTUS gene 448351 449568 0.92 - . g108 Scaffold_3 AUGUSTUS transcript 448351 449568 0.92 - . g108.t1 Scaffold_3 AUGUSTUS stop_codon 448351 448353 . - 0 transcript_id "g108.t1"; gene_id "g108"; Scaffold_3 AUGUSTUS CDS 448351 449568 0.92 - 0 transcript_id "g108.t1"; gene_id "g108"; Scaffold_3 AUGUSTUS start_codon 449566 449568 . - 0 transcript_id "g108.t1"; gene_id "g108"; # protein sequence = [MSGSTSTPTSPSSKRSSVLSTASSSSRNSALLEFSPFKFGRKKKLPPPRQNPNLRMNLILPDVLEISAANSLSTPPAG # EDADPMEDEETRERVRLREEAAQALGLSIAGHQNHSDDYSESGHSVASNGTLRIREEDRTTEILDQADGELPTLNNNHHYQPSPLTSTTSLHPPLSPT # STHGRNRSGSMPPAFPYHPSALPPSLQQNLNQAPLPLVTAVPSFPSTPRALASFIQTASSGTLPKYYPSSSLRIFAMSKQWKSRHLVLTSPTNVPSGS # NSLPLTFVSGSSTSHVHVSYLHLFKSASPDEREMERLEITEDSVVFISEEEIGGKKGVVQVAGVDVGFVSDGKKAGSSKKDSAKTKDKEQVKGREQAM # WLFHIADPLEKQRWIESIKNKVFGQRCVLSSLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g108 ### # start gene g109 Scaffold_3 AUGUSTUS gene 451949 452137 0.46 - . g109 Scaffold_3 AUGUSTUS transcript 451949 452137 0.46 - . g109.t1 Scaffold_3 AUGUSTUS stop_codon 451949 451951 . - 0 transcript_id "g109.t1"; gene_id "g109"; Scaffold_3 AUGUSTUS CDS 451949 452137 0.46 - 0 transcript_id "g109.t1"; gene_id "g109"; Scaffold_3 AUGUSTUS start_codon 452135 452137 . - 0 transcript_id "g109.t1"; gene_id "g109"; # protein sequence = [MKDLILADFGKRNSVNIASLTVSEIRDIILGQEIAAPSVQRQQMAELEKSSEAQAQVTAIQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g109 ### # start gene g110 Scaffold_3 AUGUSTUS gene 454835 455365 0.85 - . g110 Scaffold_3 AUGUSTUS transcript 454835 455365 0.85 - . g110.t1 Scaffold_3 AUGUSTUS stop_codon 454835 454837 . - 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_3 AUGUSTUS CDS 454835 455365 0.85 - 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_3 AUGUSTUS start_codon 455363 455365 . - 0 transcript_id "g110.t1"; gene_id "g110"; # protein sequence = [MSGEQFSLKDAVWNLTNEQTKERTAQAFLRVSDDGLLIYSFLTLLLTLIQGVQQFNNRIRQVLMSSGSTTFSKIVNKW # NTALIGLMTYYREAVIHTNELLDSLVKAENKIQTRVKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVAGKTHPNFLNVNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g110 ### # start gene g111 Scaffold_3 AUGUSTUS gene 458065 459192 0.87 - . g111 Scaffold_3 AUGUSTUS transcript 458065 459192 0.87 - . g111.t1 Scaffold_3 AUGUSTUS stop_codon 458065 458067 . - 0 transcript_id "g111.t1"; gene_id "g111"; Scaffold_3 AUGUSTUS CDS 458065 459192 0.87 - 0 transcript_id "g111.t1"; gene_id "g111"; Scaffold_3 AUGUSTUS start_codon 459190 459192 . - 0 transcript_id "g111.t1"; gene_id "g111"; # protein sequence = [MRFPPFDDEEPPLDYGDNVLDVEPLEAIQLELDTEEDAAIIDWFYDPKPLIDTPAVNGSSYKYWSLSLPVMANLYRLG # RTLLSDQPDRNASYLFDKKSFFTAKALNVAIPGGPKFEPLYRDMDSFDEDWNEFNDINKVIIRQQIRTEYKVAFPHLYNSLPRSVRISPYHTPKNVYI # RTDDPDLPAFYFDPLINPISNRGTTPKNMPLVSHEDSIFGPNGAEDDEFELPEDITPFLEDKDLENDLTADGIALWWAPEPYSRRSGRMRRAQDIPLV # KNWYLEHCPPNMAVKVRVSYQKLLKCYVLNELRTRPEKAMAKKNLFRQLKATKFFQTTKLDWVEAGLQVCRQGYNMLNLLIHRKNLNYLHLDYNMNLK # PVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g111 ### # start gene g112 Scaffold_3 AUGUSTUS gene 463253 463546 0.97 - . g112 Scaffold_3 AUGUSTUS transcript 463253 463546 0.97 - . g112.t1 Scaffold_3 AUGUSTUS stop_codon 463253 463255 . - 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_3 AUGUSTUS CDS 463253 463546 0.97 - 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_3 AUGUSTUS start_codon 463544 463546 . - 0 transcript_id "g112.t1"; gene_id "g112"; # protein sequence = [MKFRDSTTSDVVGRVPSETGDEDVPLEGKSAQADEQEDNHSRPSKEGEENEDLHLGASSSEKDPKTRKSTRGIEGFEK # WERDEMEALLGELNGHLGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g112 ### # start gene g113 Scaffold_3 AUGUSTUS gene 463713 464303 0.43 - . g113 Scaffold_3 AUGUSTUS transcript 463713 464303 0.43 - . g113.t1 Scaffold_3 AUGUSTUS stop_codon 463713 463715 . - 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_3 AUGUSTUS CDS 463713 464303 0.43 - 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_3 AUGUSTUS start_codon 464301 464303 . - 0 transcript_id "g113.t1"; gene_id "g113"; # protein sequence = [MFTRDGEKVEGFPSSIVPTLEEKTVMEHRPPGAEADDKPIADKLSEGTLSGSDGKSETEDSSTESSPLKGDSTLQNIS # NTEVTNRTPEDPRVDEELLGAPANASISPQTDNQPPQARSHVDDADEQERAAPRARSMIRKQLTSKLGSKWTLPTPRPKVDPQAFDDPICDVFWKDVW # VASSVHNVCAMSILVQPERH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g113 ### # start gene g114 Scaffold_3 AUGUSTUS gene 467090 468730 0.28 - . g114 Scaffold_3 AUGUSTUS transcript 467090 468730 0.28 - . g114.t1 Scaffold_3 AUGUSTUS stop_codon 467090 467092 . - 0 transcript_id "g114.t1"; gene_id "g114"; Scaffold_3 AUGUSTUS CDS 467090 467595 0.54 - 2 transcript_id "g114.t1"; gene_id "g114"; Scaffold_3 AUGUSTUS CDS 468154 468730 0.3 - 0 transcript_id "g114.t1"; gene_id "g114"; Scaffold_3 AUGUSTUS start_codon 468728 468730 . - 0 transcript_id "g114.t1"; gene_id "g114"; # protein sequence = [MKWFHESPKDENAPDSPFGREDGAQAIPDDDRIGPSSLRRVKTEELAPSPETQKAGRVKWGRLRSLLPQVANQNPSSG # PGPSAVTSSAVNITDELITGGLSTLMLRLWFEHDEKGHRRVPVLLHRLRLRVSDSLHPLQGHKSVFRIECEYANGAARWVIYRQLRDFISLHTHYAVS # NAYNRNVDGLPEFPRTNPDFTIERPKRYYRQGLSLLHPDSLSDEKAENDADNRRMSVNTDTEHMSLMGSIRGHFSQVLHFGNHTRARTTSNVGRQDDH # DDDTSSISSRSSVSSRVATPMLDPSTHVNPLGPAEDENMGEEHPWSNNKKKKKANVHEVSKHTFFITNSQMRWKLFARNQVCGNDM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g114 ### # start gene g115 Scaffold_3 AUGUSTUS gene 469551 470324 0.63 - . g115 Scaffold_3 AUGUSTUS transcript 469551 470324 0.63 - . g115.t1 Scaffold_3 AUGUSTUS stop_codon 469551 469553 . - 0 transcript_id "g115.t1"; gene_id "g115"; Scaffold_3 AUGUSTUS CDS 469551 470324 0.63 - 0 transcript_id "g115.t1"; gene_id "g115"; Scaffold_3 AUGUSTUS start_codon 470322 470324 . - 0 transcript_id "g115.t1"; gene_id "g115"; # protein sequence = [MLSLFGGDCFAIAQGVGAKLVGDWASCHSTTWDFNAPEIGARDLTNQFTKSGYPLGVMVNGNGERFVDEGEDYRNYTY # ARFGKAILSQPGGFAFQVWDSKMLDILRKEEYGDGVVEKVYADTIEDLARKLAEVGLTDQVKFIETFQVYNAAVTQHKLENPDWHWDPAVKDGLSTQS # SHLSLSPPKSHWAESIDKPPFMAVKVCCGITFTFGGLAIDPESASVLSESGPIPGLFCAGEMVGGLFYKNYPVCRCYYTSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g115 ### # start gene g116 Scaffold_3 AUGUSTUS gene 477816 480074 0.89 - . g116 Scaffold_3 AUGUSTUS transcript 477816 480074 0.89 - . g116.t1 Scaffold_3 AUGUSTUS stop_codon 477816 477818 . - 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_3 AUGUSTUS CDS 477816 480074 0.89 - 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_3 AUGUSTUS start_codon 480072 480074 . - 0 transcript_id "g116.t1"; gene_id "g116"; # protein sequence = [MTLQEYISSRPKACHKVHIATLLRLLKEAVKSNNKLAVGYVAADILHLRADPERNRALRHLILDTEHRLIWPNTILAI # LNALAWGSQLDKFTDYHLKTLAHRITVERERTPFAGDFSVLLHSNIMRRLELLHRVPVGARSVSYELPDIVEAAFELLSYLLLLKNESLILELFQALT # EKLFIPPEAVQQAPTTSTDFYYIVSVTLSRACLYWYKRGLAHRLLLRYLPSGVDLTTAIRQKNASLNSPTPSPADEQSIEEPQQSLDPQLLDLITDTL # YATLRNPNLFELELCVDVISRVHLLAPIQGGIIRLVYTAATECNSGNVARRLYAFTREPAIEKEHHYPGPQGRAILFLMAFLTQEKGNTHLARVLANE # VVENDTFLPVNDRPKFLTLVASQSFGKATRTLWERYAIGKDKASVVGYNALLTRIVRLFTRMARLIEADLPDNGEDASDTLQNEQLGDSSINIGWEVN # HAGSNHEASSNASQRGDPNGKPSVAELSERAKDIRLFVQRVIEAFVQVHEPLAHAKHANLSSLARAYFVIGDFTKGFEVFRNLIRRREVPDLHDINIG # LSALAEHNPRSAARMIEVMTQRGIQPNSVTFGTVIHQALVHGDMQLVGDLLQLARQAGNIQLSPQGLFSLTRASVILEDGSGTRKNAPLKDALELFKS # LPDNGRLSSPDMGKFMVFAALREGEPVLAFEFWKLLLKYSSEWDDQEQIFVRRLLRRSIIQTLGSGMSRSNMLNQLWERPPYHAMK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g116 ### # start gene g117 Scaffold_3 AUGUSTUS gene 482579 483457 0.4 + . g117 Scaffold_3 AUGUSTUS transcript 482579 483457 0.4 + . g117.t1 Scaffold_3 AUGUSTUS start_codon 482579 482581 . + 0 transcript_id "g117.t1"; gene_id "g117"; Scaffold_3 AUGUSTUS CDS 482579 482582 0.54 + 0 transcript_id "g117.t1"; gene_id "g117"; Scaffold_3 AUGUSTUS CDS 482637 482757 0.42 + 2 transcript_id "g117.t1"; gene_id "g117"; Scaffold_3 AUGUSTUS CDS 483016 483457 0.69 + 1 transcript_id "g117.t1"; gene_id "g117"; Scaffold_3 AUGUSTUS stop_codon 483455 483457 . + 0 transcript_id "g117.t1"; gene_id "g117"; # protein sequence = [MQGSPAESAGLVPYGDYIIGWSGGVLSAENDFYDLVEAVRSFFGLLHRIPPPDPDHVPGSTPPELIEEDDYHEEQLFV # PADVHVESGLSRVAEWRDQENLNRGTMPPLPIHAKPSSSMEYESWSEASGPETAVPGSHTPDRYQMNEEDEDYISPSQETPRRSSPLSHASPPNFKRA # SNSLSGTFMNGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g117 ### # start gene g118 Scaffold_3 AUGUSTUS gene 491308 492149 0.49 - . g118 Scaffold_3 AUGUSTUS transcript 491308 492149 0.49 - . g118.t1 Scaffold_3 AUGUSTUS stop_codon 491308 491310 . - 0 transcript_id "g118.t1"; gene_id "g118"; Scaffold_3 AUGUSTUS CDS 491308 491929 0.66 - 1 transcript_id "g118.t1"; gene_id "g118"; Scaffold_3 AUGUSTUS CDS 492139 492149 0.5 - 0 transcript_id "g118.t1"; gene_id "g118"; Scaffold_3 AUGUSTUS start_codon 492147 492149 . - 0 transcript_id "g118.t1"; gene_id "g118"; # protein sequence = [MLQSYDSCDLGTYPNQTNKAGTSPEGALTGNSGNPISYLPGQRWSACTCSGGDHPGPSVSTGRGVPEIDIIEAQIDVN # NDFKGQVSQSFQIAPFNYDYQIDNSTTTFYDDTLTEFNSYQGGQYQQAVSALTYIPDTAYGNQSFIKYGYEWWSNPDSRSEGYITWYSNGKESWTLPA # SAIGADSVTEISNRLIPEEPMVCTNIRLDSPSYH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g118 ### # start gene g119 Scaffold_3 AUGUSTUS gene 495579 496454 0.7 + . g119 Scaffold_3 AUGUSTUS transcript 495579 496454 0.7 + . g119.t1 Scaffold_3 AUGUSTUS start_codon 495579 495581 . + 0 transcript_id "g119.t1"; gene_id "g119"; Scaffold_3 AUGUSTUS CDS 495579 496454 0.7 + 0 transcript_id "g119.t1"; gene_id "g119"; Scaffold_3 AUGUSTUS stop_codon 496452 496454 . + 0 transcript_id "g119.t1"; gene_id "g119"; # protein sequence = [MSIDLTLDRIERLYRLIQAYTRPTIHIAGTNGKGSVSALTSSILTAAGLSVGRFNSPHLITIYDCIYVNNQEVSPQTY # HEARDNVEGVAHDNSIEISSFEMLVLTALLIFERVKVDIVVMEVGMGGRLDATNVIPDEVVMISALTAVDLDHQAFLGDTVAAITKEKASIARRGKPF # VMGPQKHSEVAEVARMVVQEAGGDFFSAPSALQMPSEDQRRPESYSQFQPPSPCPIELNMPCFRDPFNALLPLHGSHQLENVGLSAFIISVAVDYPSC # SSLGLRDRVTPQVVVRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g119 ### # start gene g120 Scaffold_3 AUGUSTUS gene 506082 506447 0.58 + . g120 Scaffold_3 AUGUSTUS transcript 506082 506447 0.58 + . g120.t1 Scaffold_3 AUGUSTUS start_codon 506082 506084 . + 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_3 AUGUSTUS CDS 506082 506447 0.58 + 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_3 AUGUSTUS stop_codon 506445 506447 . + 0 transcript_id "g120.t1"; gene_id "g120"; # protein sequence = [MGAAAARTFDLKIVTKSGPEYTFSSINKEEHEPTESYFKDKKIRIKNEMVPDADLLMAAAVGDDDEDMASVDSDDSGP # RGKPARTGFDDDEDSENDGWPGSVFYMLRIFILFFRGFPSIIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g120 ### # start gene g121 Scaffold_3 AUGUSTUS gene 507984 510753 0.52 - . g121 Scaffold_3 AUGUSTUS transcript 507984 510753 0.52 - . g121.t1 Scaffold_3 AUGUSTUS stop_codon 507984 507986 . - 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_3 AUGUSTUS CDS 507984 510167 0.93 - 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_3 AUGUSTUS CDS 510232 510753 0.58 - 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_3 AUGUSTUS start_codon 510751 510753 . - 0 transcript_id "g121.t1"; gene_id "g121"; # protein sequence = [MPMRPRRSLSLLASVFQSSQSEDSNTAPSTAPSTAPSTPSSEDHFFSSDSSIEIPPISREPAYYDDLRSSNIDILSVS # SASATVEETSLLDSDPFADLSAPPVVIPPTTDRPSLAITRPPNSPLSLSGSASRSRSATLIQSPVRPLYQKRPLHSSPSMPSLSTLATANVKITKKAR # KGKVGAGLPSEPWDLLRDVTVSTPKSEIPSLPHYSSEEDEEDYGKLCSRLSIVDEHPGLGDRLSDEFKLSGVEDDFSPKPSSPIPIKSSNFEDLGRSR # SSSTSSGSSYEPTDWFSQGGTTFPDFDVHSSSITSLHSSQTSIPDAYSLSSSSSSSFSDHSDQSFDPMVISHSYPHEYPSSLPKFSLSLELPTGHSTE # LLDEEEFSALSSSPCQTARQRVDSPYHEEAINMNSLHVSDPLDEAAQFEPGSSASTIRASPLKNNPHMAGIQKLPRSQSRRRRGVLSTEMWIKGNTSS # CEEPAVDGDDYSRGRSASASGLSSSYAGNHGAGGYSGRVYSVGGLGGGGHGLGGHGGDDGDDGNKRNRRVVPGSFATYQSDEDEEDESADEDDYGLPS # GLPPAQTQTQFDDDDVPLARSIPTALKAQQSIRIKDREARDKRRKEREIRALARDQQRQHQAAINSSSIPTQEAAPNVARPARITSASQKPTSSFAID # DLTRKLENVQTRGRPDSRPSPPSADAASRFNAVLSKDVATSAPPIRTLRPMRSFHRPGSSQKVSDTPPLPISAEARLTRSTTRGRARSTASREDPSST # IASQARAIPISTPVDEPGTAKVERKRTVKSADGIKSARTSTEHSRPPPPLPAPAEVIARQNHAKITLTQQRVFIGDRQRFVVVEISSSTSAGEVVRMV # EAQGAFKEWRGSGGWMLFEIAQDFGMGMDACCHPLFAHY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g121 ### # start gene g122 Scaffold_3 AUGUSTUS gene 515043 515975 0.75 + . g122 Scaffold_3 AUGUSTUS transcript 515043 515975 0.75 + . g122.t1 Scaffold_3 AUGUSTUS start_codon 515043 515045 . + 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_3 AUGUSTUS CDS 515043 515106 0.75 + 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_3 AUGUSTUS CDS 515161 515975 0.76 + 2 transcript_id "g122.t1"; gene_id "g122"; Scaffold_3 AUGUSTUS stop_codon 515973 515975 . + 0 transcript_id "g122.t1"; gene_id "g122"; # protein sequence = [MNVFAIGASRNIGYYSSLRLLAAGCNITFLLRSPSVFDTDETIQSYVRSGKAHLVKGDALVQSDVQHAWDEALTHGAV # DLVLFTVGEFDYIYFEVPHDKWLNSGHTGGLPSFKLSKGFVVSPANLVTQSLLNVLCTMPSQQPQPRLITISSTGLTHSSFALIPFVLKPLYALLSVP # HKDKVGAERVIAHCAGWKWEVDSDEEPGDDILGERWLERDGLPVAGSFKNVLVIRPALLTDGECKAEKGGKKNAYRVKEGDFSAYTVSRKDVGHFVAD # AVLNRWNEFENKLVTIGY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g122 ### # start gene g123 Scaffold_3 AUGUSTUS gene 519379 520048 0.49 + . g123 Scaffold_3 AUGUSTUS transcript 519379 520048 0.49 + . g123.t1 Scaffold_3 AUGUSTUS start_codon 519379 519381 . + 0 transcript_id "g123.t1"; gene_id "g123"; Scaffold_3 AUGUSTUS CDS 519379 519394 0.73 + 0 transcript_id "g123.t1"; gene_id "g123"; Scaffold_3 AUGUSTUS CDS 519467 519649 0.49 + 2 transcript_id "g123.t1"; gene_id "g123"; Scaffold_3 AUGUSTUS CDS 519744 520048 0.96 + 2 transcript_id "g123.t1"; gene_id "g123"; Scaffold_3 AUGUSTUS stop_codon 520046 520048 . + 0 transcript_id "g123.t1"; gene_id "g123"; # protein sequence = [MVDTTALNAWHSVNGAQLTVIEETVPVSSALPNALSVVIPSGSSGQVGVGNEGYFGEFPQVISTIRPSSFNGTATVGL # QTSTGEFLGGTNVTLSGSQTSWLQVNTTIQPTITPDSLTNNFTMTVDGAELAGQTINFAMFSLFPPTFKNRPNGMRIDIAEVSRDIVPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g123 ### # start gene g124 Scaffold_3 AUGUSTUS gene 522728 524022 0.28 - . g124 Scaffold_3 AUGUSTUS transcript 522728 524022 0.28 - . g124.t1 Scaffold_3 AUGUSTUS stop_codon 522728 522730 . - 0 transcript_id "g124.t1"; gene_id "g124"; Scaffold_3 AUGUSTUS CDS 522728 523140 0.83 - 2 transcript_id "g124.t1"; gene_id "g124"; Scaffold_3 AUGUSTUS CDS 523305 524022 0.34 - 0 transcript_id "g124.t1"; gene_id "g124"; Scaffold_3 AUGUSTUS start_codon 524020 524022 . - 0 transcript_id "g124.t1"; gene_id "g124"; # protein sequence = [MYDKAELLSPEPQPEKKIDKDRDTEPPNPQSKRFKLDAKLDRDAITLVKTETAEANIPPYSRSSLSPHTSNSILASNN # LNKNVHTSPDNSVKRNHSPQIRSRPVANHNKDPPPEYTSSLDTYGFVVSQSPAHVQQPVSSTIPIALIAPLALRSGFPLLETPRNNNTNTSLTLNQVQ # QMYRALLANTHAQTAAQYQPQAQPSFQAQAQAQLIMQPISNNQNQPRCAVSFQQLVNAPVPPVSPNNFQSPAVPLTLVQPPQHDIDPSSFSTPAQFPS # NLANDVDGSQPQFYSASLDPYNSGVTPFQHLHVLEPILNANRTSQGFLFSPLNTFDVEDVQNLLLPQNTDQAMDRLLDENLVQEDPFQASMGLVWMQR # VGLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g124 ### # start gene g125 Scaffold_3 AUGUSTUS gene 525466 526677 0.34 + . g125 Scaffold_3 AUGUSTUS transcript 525466 526677 0.34 + . g125.t1 Scaffold_3 AUGUSTUS start_codon 525466 525468 . + 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_3 AUGUSTUS CDS 525466 525598 0.36 + 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_3 AUGUSTUS CDS 525665 526677 0.96 + 2 transcript_id "g125.t1"; gene_id "g125"; Scaffold_3 AUGUSTUS stop_codon 526675 526677 . + 0 transcript_id "g125.t1"; gene_id "g125"; # protein sequence = [MSKGMERLLKRMLSPNADLRCNADEAMQDIYWAQLQQSNHINEHPSYTSSIVFEKDWTKLSETKQKTQASSPLATQTP # SCHATDDKNREGSDVPNSRSPPGLESPRNAASRPLAKSKSQGKMVTGMVEGTKSRFQSFAVYTRIDCVHSDVPRKRIAAHIDLSPIKASPPASPAQAR # KNIASHNGASNKPSQRVPFGTVHTRNAENLPTAPHRRLGGKPSIQDLTKRHSKVGMLDELVNGPPGTRKAQGKGWKGKENHVSQRVRDWERERERLRE # ISRLEEIERGRDAEPSNSSDTEPEVVDITPELEQVGTSESAQTDLRSQDKDTESRIPPTAIAGTWLPSLDLGMKSSASRTVPIISEPSTPAPAVDTSF # IPGKSLLLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g125 ### # start gene g126 Scaffold_3 AUGUSTUS gene 527429 528397 0.81 + . g126 Scaffold_3 AUGUSTUS transcript 527429 528397 0.81 + . g126.t1 Scaffold_3 AUGUSTUS start_codon 527429 527431 . + 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_3 AUGUSTUS CDS 527429 527724 0.82 + 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_3 AUGUSTUS CDS 527869 528397 0.82 + 1 transcript_id "g126.t1"; gene_id "g126"; Scaffold_3 AUGUSTUS stop_codon 528395 528397 . + 0 transcript_id "g126.t1"; gene_id "g126"; # protein sequence = [MSSFVTSVYASPATGTFPDNTSGTQDLSVPQLQTPSRQRRATVSTRSPDPVINGPVTSFFDVDHGSPSKRKEKSKSHG # NLFQLHIAPAAALGAELDKRESSENLGWNVSVSLSSKPNDESGDELTSSPFRVEPYAPRPTTSSHSIPDTPTQKRVEGVYDRFLMATSGVKRLGKGYQ # SDNVGPVHNTISHANHTKQSHRAFYSVRKPLQMPPPVASEDQAKAVAVDEFGIIGYSTESTGVTVLKDENNGTVALVRRAFKAIVPGKTVNRRLSRMN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g126 ### # start gene g127 Scaffold_3 AUGUSTUS gene 530209 531711 0.27 + . g127 Scaffold_3 AUGUSTUS transcript 530209 531711 0.27 + . g127.t1 Scaffold_3 AUGUSTUS start_codon 530209 530211 . + 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_3 AUGUSTUS CDS 530209 530332 0.79 + 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_3 AUGUSTUS CDS 530804 530808 0.62 + 2 transcript_id "g127.t1"; gene_id "g127"; Scaffold_3 AUGUSTUS CDS 530847 531056 0.34 + 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_3 AUGUSTUS CDS 531202 531711 0.36 + 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_3 AUGUSTUS stop_codon 531709 531711 . + 0 transcript_id "g127.t1"; gene_id "g127"; # protein sequence = [MTSNDTALITAYQPKTWDLSAFNITDGWLLDSIAQEVDPSTDEYFLTSALSLFDNEGTAWELDSSSSRGLLLDFDASN # NSVSLNKQWIPYNVTVSESQGNVGILDSGNTLIGYIACCAWNLPNSFLLADRAYHYNWTATPNTRPSVFVETDGSNTTVYTSWNGATEVDTWQLSGST # ADSPQLAVPISNTSRSGFETAISVTGTSTNFTYFQVAALNSNKKIIVYSNFTASDGSQQNPAANQTVDSSNSSGSDSPSSGSTQVTVGSRMITFVLVT # LRILFTLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g127 ### # start gene g128 Scaffold_3 AUGUSTUS gene 532849 533244 0.85 - . g128 Scaffold_3 AUGUSTUS transcript 532849 533244 0.85 - . g128.t1 Scaffold_3 AUGUSTUS stop_codon 532849 532851 . - 0 transcript_id "g128.t1"; gene_id "g128"; Scaffold_3 AUGUSTUS CDS 532849 533244 0.85 - 0 transcript_id "g128.t1"; gene_id "g128"; Scaffold_3 AUGUSTUS start_codon 533242 533244 . - 0 transcript_id "g128.t1"; gene_id "g128"; # protein sequence = [MLHFFQDLGKSSNDLLGKDYPFNTTSLEIKTKANDVSFKVAGNNAGGAIIGDLEAKYGNKKHGFTLTNTWTTANVLKS # QIELENQLAKGLKVDILSSLAPEKGTKSAVINAAFKQSGLHTRAALDVFKVCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g128 ### # start gene g129 Scaffold_3 AUGUSTUS gene 535685 535912 0.62 + . g129 Scaffold_3 AUGUSTUS transcript 535685 535912 0.62 + . g129.t1 Scaffold_3 AUGUSTUS start_codon 535685 535687 . + 0 transcript_id "g129.t1"; gene_id "g129"; Scaffold_3 AUGUSTUS CDS 535685 535912 0.62 + 0 transcript_id "g129.t1"; gene_id "g129"; Scaffold_3 AUGUSTUS stop_codon 535910 535912 . + 0 transcript_id "g129.t1"; gene_id "g129"; # protein sequence = [MSQAATTVRPKPRPKPLPKATSSTVFANTSAPSTLSSANKVTYDNVKDNDEMFMRNRGKDGWAKLRKISKGELSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g129 ### # start gene g130 Scaffold_3 AUGUSTUS gene 536808 537587 0.47 + . g130 Scaffold_3 AUGUSTUS transcript 536808 537587 0.47 + . g130.t1 Scaffold_3 AUGUSTUS start_codon 536808 536810 . + 0 transcript_id "g130.t1"; gene_id "g130"; Scaffold_3 AUGUSTUS CDS 536808 536926 0.47 + 0 transcript_id "g130.t1"; gene_id "g130"; Scaffold_3 AUGUSTUS CDS 537032 537587 0.66 + 1 transcript_id "g130.t1"; gene_id "g130"; Scaffold_3 AUGUSTUS stop_codon 537585 537587 . + 0 transcript_id "g130.t1"; gene_id "g130"; # protein sequence = [MAYRGNRFFSSVTPQTLNIWSDAEFGEPLETKLSNTSSLIPPSNIIEIDSDEEDDRIGPSRFMYNNDDDHLNASVALQ # TGAPAGDDQDEDRFKLVLRSALTSKDITLNVRSTTKCGAIVNAFLKKAGLMEKYPALSADGSSLQKKTKSRRSVVGSTINKVPKLSIDGDKVGNDIEI # GDYDLEEGDMVEVVDCSNRILAWYKYLYVYCCDGLPVKFLLARNYIID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g130 ### # start gene g131 Scaffold_3 AUGUSTUS gene 537695 539862 0.1 + . g131 Scaffold_3 AUGUSTUS transcript 537695 539862 0.1 + . g131.t1 Scaffold_3 AUGUSTUS start_codon 537695 537697 . + 0 transcript_id "g131.t1"; gene_id "g131"; Scaffold_3 AUGUSTUS CDS 537695 537963 0.68 + 0 transcript_id "g131.t1"; gene_id "g131"; Scaffold_3 AUGUSTUS CDS 538059 538318 0.93 + 1 transcript_id "g131.t1"; gene_id "g131"; Scaffold_3 AUGUSTUS CDS 538368 538565 0.9 + 2 transcript_id "g131.t1"; gene_id "g131"; Scaffold_3 AUGUSTUS CDS 539015 539166 0.26 + 2 transcript_id "g131.t1"; gene_id "g131"; Scaffold_3 AUGUSTUS CDS 539255 539531 0.85 + 0 transcript_id "g131.t1"; gene_id "g131"; Scaffold_3 AUGUSTUS CDS 539627 539862 0.56 + 2 transcript_id "g131.t1"; gene_id "g131"; Scaffold_3 AUGUSTUS stop_codon 539860 539862 . + 0 transcript_id "g131.t1"; gene_id "g131"; # protein sequence = [MFKRSKTKPTQRNRGLPEDDIADERSPAAETAGTGTDVDLTTDSESPLLAVKKFKDRTKKSQPKSRLSFGAEEDDEVR # VSSAQESNILRSESSFLTFSVIHFNSKFPDNLDQATISPSRNGPTYDAAYLQELKKSTPSSRAPPQTSVDPYDADMSMSTDVTMDLGDVSMLDVVDIT # GESDTLIHTESAIKNAKERRERLRKSGVSPSEDYISLSVTRKADDQGPHPESRLVREEDELGEGDDAQLTTSHASNTASLNTVAQERDQLDIREKELR # ALVSNAEDKRAWFSSFSEWYPLLEKLESEHISLLQERFDIITKRRLQDVEDDLSTFLGPLPSTQEDTTQNLMSLVGKFADQIPPLLVGNAKNDAVYGT # SDIKTSRQRQVMRDVKSKEFLDPAKGRWGTWRSQYEETYVAAFGGLGVVSAWEFWARLESVGWDCIQAWFITFWSHVHDSLTLASDRTPKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g131 ### # start gene g132 Scaffold_3 AUGUSTUS gene 539919 540540 0.63 + . g132 Scaffold_3 AUGUSTUS transcript 539919 540540 0.63 + . g132.t1 Scaffold_3 AUGUSTUS start_codon 539919 539921 . + 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_3 AUGUSTUS CDS 539919 540119 0.63 + 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_3 AUGUSTUS CDS 540184 540540 0.7 + 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_3 AUGUSTUS stop_codon 540538 540540 . + 0 transcript_id "g132.t1"; gene_id "g132"; # protein sequence = [MEGRELGPEGDLVSSMVSTAIIPRLSKIIETGALDVYSSSHVRRAVDLSEELQASVSEVDQGHLKLQIFYKAVIACFT # KAVSENEALLAKFNSAGHGSASTFNPEAIPARKRYLARQLKLISNLTRWRKSTGELFGVGQLITKVVDGCMDVADSGWDVGGEEALKKVRLYQRRRTG # TLTCNIFCH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g132 ### # start gene g133 Scaffold_3 AUGUSTUS gene 541151 542551 0.54 - . g133 Scaffold_3 AUGUSTUS transcript 541151 542551 0.54 - . g133.t1 Scaffold_3 AUGUSTUS stop_codon 541151 541153 . - 0 transcript_id "g133.t1"; gene_id "g133"; Scaffold_3 AUGUSTUS CDS 541151 542551 0.54 - 0 transcript_id "g133.t1"; gene_id "g133"; Scaffold_3 AUGUSTUS start_codon 542549 542551 . - 0 transcript_id "g133.t1"; gene_id "g133"; # protein sequence = [MIHSQTISSSMTKFTTSDTVLRLSHVHPLWRETCISVSSLWSHIHIIRASSDEVERTEMFLERSGTSLLTIEFHARAN # TIPYTPEANRMIQKLFAACERWKGASFSIQAQSIEQVMIALFGENGTPQLDQKFHFPFLETFSFTSRPESQNRRFFDMFQQKSTPRLHNLVIPNYTTF # LPFAFGQITDLTLSKMNKDFPDLSVLCPHLVRLKIGQTFGESNEPTPAHAATTFELPKLETMIVSCSGPGRLWSMLTLPSLRNLALEAITFMPLEHVA # ILNMLRRSGCGLGLRRLTLAYMDITDVDVMSMLSLVPQLEEFVLHETLLRQQKILTPRLLMVLKLPNTNRDLATTVNDSTFVSPAVTRAHFIPNLAYI # ELQVYYFPTFGLDLLFDMLSSRAVISSGDHLSSFSTRQASGILKQIVLCFVLDEVNPPVQIPLELENMVNRLRLVSTSHIQSMVQCGQEWKKEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g133 ### # start gene g134 Scaffold_3 AUGUSTUS gene 549251 549925 0.63 - . g134 Scaffold_3 AUGUSTUS transcript 549251 549925 0.63 - . g134.t1 Scaffold_3 AUGUSTUS stop_codon 549251 549253 . - 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_3 AUGUSTUS CDS 549251 549925 0.63 - 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_3 AUGUSTUS start_codon 549923 549925 . - 0 transcript_id "g134.t1"; gene_id "g134"; # protein sequence = [MGFNNCRYNNYIHDDSNRQSGIDALGAGFMNGSMDDDDDEPQEKYNPFTSAKEQEASKHAMLAAAIGPRKTPTPPPQY # IASPRPGYAASVEALSRPEPAAIPATRQSPNGLSISTSNNPFATPMDHQAFPNGPHMPQPIAVPNTPHPLQPPMTPITPVFARPTKQQDIRFDEKPIM # RGAGEGTSIPSRGEKGDDFWRRFSMVVKEENSKPSQQKQRFVYCPTSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g134 ### # start gene g135 Scaffold_3 AUGUSTUS gene 553088 553624 0.53 + . g135 Scaffold_3 AUGUSTUS transcript 553088 553624 0.53 + . g135.t1 Scaffold_3 AUGUSTUS start_codon 553088 553090 . + 0 transcript_id "g135.t1"; gene_id "g135"; Scaffold_3 AUGUSTUS CDS 553088 553624 0.53 + 0 transcript_id "g135.t1"; gene_id "g135"; Scaffold_3 AUGUSTUS stop_codon 553622 553624 . + 0 transcript_id "g135.t1"; gene_id "g135"; # protein sequence = [MSSHSTQSHNAKFAVQNLFDISNWACIVTGGGTGIGLMIAQAFANNGARVYITSRRKSVLDNAVNTWGSSLAHPKGQL # IALECDITDKKSIQKLVEEVEGREKNIDVLVNNAGISLGTSQVEKGDESAKQLSEELFGEDLVKWEDVYRTNVIGHFFTTAAFIPLLAATVPFILAVP # QR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g135 ### # start gene g136 Scaffold_3 AUGUSTUS gene 556735 557682 0.94 + . g136 Scaffold_3 AUGUSTUS transcript 556735 557682 0.94 + . g136.t1 Scaffold_3 AUGUSTUS start_codon 556735 556737 . + 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_3 AUGUSTUS CDS 556735 557682 0.94 + 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_3 AUGUSTUS stop_codon 557680 557682 . + 0 transcript_id "g136.t1"; gene_id "g136"; # protein sequence = [MDVDGEGNNRSDIPYFPSYILDLPQSVSSSIHNIIDFVFLPGFHNPTIAVLFNERPTWTGRLEEAKDTCGLIIFSMSN # SFSSWGGISSTFTVITNIPNLPYDAYALVPCISGVAGLVILTSNSIVYVDQATKKLMLPVNGWATRVSDIAAVNVTDVAQTRDLALEGSRAAFISETT # LLLILARGDAYTVTLAMDGKAVSGLSISDKPMVKTTIPSLAMSVTASSPHAGRDVDAHTIPFIFVGSTQGPSVLLKTNMVESEEDDTDREVDNGNDVR # APAGEDDDMYDDDAGKEISYCYTLFVFTLNRHLRSFSYLCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g136 ### # start gene g137 Scaffold_3 AUGUSTUS gene 558520 559982 0.47 + . g137 Scaffold_3 AUGUSTUS transcript 558520 559982 0.47 + . g137.t1 Scaffold_3 AUGUSTUS start_codon 558520 558522 . + 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_3 AUGUSTUS CDS 558520 558537 0.76 + 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_3 AUGUSTUS CDS 558697 559239 0.52 + 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_3 AUGUSTUS CDS 559356 559982 0.75 + 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_3 AUGUSTUS stop_codon 559980 559982 . + 0 transcript_id "g137.t1"; gene_id "g137"; # protein sequence = [MFDFGPTSKYLTGCFFTDHTGMLEKNVFSPNPKVDLGQRSSDGLNNQWLLLVRPQGVLELWSLPKMTLAFSVAIPFAT # LENVLMDSGEGVASSIPVPAATTVTSATSPSAPPVPPTAPAMLRSQSQTQDVTMTPVESDAGDAGAAMQNKEKPESMNHTKETDGRDTGAIEQVLLAP # LGETRPELHLFVLLRSGQLAIYQAIPAPAPPLHSTAVEALNGVEPISPTIAATPSTLNSRLVRLRIAFVKVLSKTFELQNSNIAGAGNGPGGVGSMGS # ASGSALTDQKKFTRMFLPFVTPNVSSSLTIPQNKQKKGTTTYSGVFFTGENPSWIISTDRGGVHLYPSGHAVVHAFTACPVLASRDPRIGGEFLIYSD # EVIPSKQSSDITFIFRPTGTYLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g137 ### # start gene g138 Scaffold_3 AUGUSTUS gene 567384 567824 0.67 + . g138 Scaffold_3 AUGUSTUS transcript 567384 567824 0.67 + . g138.t1 Scaffold_3 AUGUSTUS start_codon 567384 567386 . + 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_3 AUGUSTUS CDS 567384 567824 0.67 + 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_3 AUGUSTUS stop_codon 567822 567824 . + 0 transcript_id "g138.t1"; gene_id "g138"; # protein sequence = [MPAPTSTIYPDNVPTRQRSMYIIRYTREMEEHDPVLRKLITSGCCYFPTNCVERRLGGWDTRTEPSDRLVEENPSAVL # RRLEPELRDAYGRKVKAEYCSTAPIPINVETNGWTKVMVQAEMINTEESDPAEDEYGLTDDESGSEWE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g138 ### # start gene g139 Scaffold_3 AUGUSTUS gene 571107 571672 0.96 + . g139 Scaffold_3 AUGUSTUS transcript 571107 571672 0.96 + . g139.t1 Scaffold_3 AUGUSTUS start_codon 571107 571109 . + 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_3 AUGUSTUS CDS 571107 571256 0.96 + 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_3 AUGUSTUS CDS 571388 571672 0.96 + 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_3 AUGUSTUS stop_codon 571670 571672 . + 0 transcript_id "g139.t1"; gene_id "g139"; # protein sequence = [MFSPVGSKATVCAFTSQPGIIFTGHESGKVALFNYKTGEEVDSNERAHGDIHDTKTLDVIKTFTTETPLNSAAIAPNK # PYVLLGGGQEAMSVTTTSLRQGKFETRFWHKVFEEEVGRVKGHFGPINTCVFLLDPIHKKVDGLVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g139 ### # start gene g140 Scaffold_3 AUGUSTUS gene 574082 574918 0.62 - . g140 Scaffold_3 AUGUSTUS transcript 574082 574918 0.62 - . g140.t1 Scaffold_3 AUGUSTUS stop_codon 574082 574084 . - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_3 AUGUSTUS CDS 574082 574264 0.91 - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_3 AUGUSTUS CDS 574382 574918 0.62 - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_3 AUGUSTUS start_codon 574916 574918 . - 0 transcript_id "g140.t1"; gene_id "g140"; # protein sequence = [MKEINTSTTAAKNSIQDLERNIAAEIQRSAQDTQEKRDDFTRRMDEARATVAEQESIIKQLSAANSDILRRAQSAEQD # GQAKQAELEQLKQNIGTVENSLRQLQRDQDNKYSAYGPGMSQVVARIQQMKWYGDEPLGPLGRYVKVKDPDAWADLLAQQLGGSLTAFAVTDPRDRDS # LKRDRFDYSSGEPAPDVLTVLRAVEVRGQIRLLHPDTALSSLFDRLKTRTSNESSLIKPGLRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g140 ### # start gene g141 Scaffold_3 AUGUSTUS gene 576046 576693 0.48 - . g141 Scaffold_3 AUGUSTUS transcript 576046 576693 0.48 - . g141.t1 Scaffold_3 AUGUSTUS stop_codon 576046 576048 . - 0 transcript_id "g141.t1"; gene_id "g141"; Scaffold_3 AUGUSTUS CDS 576046 576693 0.48 - 0 transcript_id "g141.t1"; gene_id "g141"; Scaffold_3 AUGUSTUS start_codon 576691 576693 . - 0 transcript_id "g141.t1"; gene_id "g141"; # protein sequence = [MTHSLNLHDARGPHDRQLTVTTISTMAKRLVSPNSDDEDAQDASPAFKRARTDGASDIEPNNRSQRRGPRNKGKGRAP # GEDGNSSSDDDQEPEVHADHIDDDQFEEQYHERVEKAVDAKRHIVGVSCNDICSFLSSYGSCAAQGVAEHGIIESIEMHQFMCHRFLSFQFGPQINFI # IGELNQQVLLHSLDLEIPRTQREYVLELSALLTSSSSSM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g141 ### # start gene g142 Scaffold_3 AUGUSTUS gene 577378 578145 1 + . g142 Scaffold_3 AUGUSTUS transcript 577378 578145 1 + . g142.t1 Scaffold_3 AUGUSTUS start_codon 577378 577380 . + 0 transcript_id "g142.t1"; gene_id "g142"; Scaffold_3 AUGUSTUS CDS 577378 578145 1 + 0 transcript_id "g142.t1"; gene_id "g142"; Scaffold_3 AUGUSTUS stop_codon 578143 578145 . + 0 transcript_id "g142.t1"; gene_id "g142"; # protein sequence = [MSDVVKKGSDDSSATVTSQVTDSPTIPDVDNYVAYTIKNTKALPPVTWSNLLNELNWLSVYILTIPPLVGFVGAFYVK # LQWETAVWAVAYYFLTGLGTYPFAPLGLRSNITSGITAGYHRLWAHRAFNASLPLQYVLAILGAGSLQGSIKWWSRGHRAHHRYTDTELDPYNAHKGF # WFSHVGWMLVKPRRKPGVADVSDLRHNPVVKWQHKHYLSLILFMGFILPSIVAYVGWGDAKGGFIYAGVIRLVFVHHVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g142 ### # start gene g143 Scaffold_3 AUGUSTUS gene 587907 588759 0.2 + . g143 Scaffold_3 AUGUSTUS transcript 587907 588759 0.2 + . g143.t1 Scaffold_3 AUGUSTUS start_codon 587907 587909 . + 0 transcript_id "g143.t1"; gene_id "g143"; Scaffold_3 AUGUSTUS CDS 587907 587916 0.25 + 0 transcript_id "g143.t1"; gene_id "g143"; Scaffold_3 AUGUSTUS CDS 587975 588759 0.37 + 2 transcript_id "g143.t1"; gene_id "g143"; Scaffold_3 AUGUSTUS stop_codon 588757 588759 . + 0 transcript_id "g143.t1"; gene_id "g143"; # protein sequence = [MNKDLRHFLLGCGSERGSKCGSKCETKSECEREREQESERERGLECERKWESKSERERERECERERESKSKSKVSVDS # NVNASGNPNLNASENPNSNASESPNPNASENLSVNVSENLNVNGNAWVNADVDVRVNGKVNGNAWANVNADVKNVDADANANVDSNANVDPNANANAN # VDPNVDSNANANVDPNVNANANVDPNVDPNANANVDPNVDPNANANVNVNSDVNVDARVNVNVRAKAKSTWDGTGKDEGKNERPKMGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g143 ### # start gene g144 Scaffold_3 AUGUSTUS gene 589951 591327 0.71 + . g144 Scaffold_3 AUGUSTUS transcript 589951 591327 0.71 + . g144.t1 Scaffold_3 AUGUSTUS start_codon 589951 589953 . + 0 transcript_id "g144.t1"; gene_id "g144"; Scaffold_3 AUGUSTUS CDS 589951 590125 0.73 + 0 transcript_id "g144.t1"; gene_id "g144"; Scaffold_3 AUGUSTUS CDS 590541 590881 0.76 + 2 transcript_id "g144.t1"; gene_id "g144"; Scaffold_3 AUGUSTUS CDS 590938 591327 0.9 + 0 transcript_id "g144.t1"; gene_id "g144"; Scaffold_3 AUGUSTUS stop_codon 591325 591327 . + 0 transcript_id "g144.t1"; gene_id "g144"; # protein sequence = [MQWTREVESTASTTSSSASITSTASTATSTASGSFGGLTTASTTSTTTLTSSTTSASCAATVTSENPSIPSTPPSPSP # GYDSQGNSSMESFMDVDSGEATSGPCTIHFPGAGKVVSCGATYLDDFNDDRFSEERKENLYYPFSSRPEWEMASFLLNSSLSMQEIDHYLQLELNNLS # FKTAQRLHEITDLLPPVPTWRARVMKTTPLYPSRTPVVLYYRNAVEVLQDLMKSPLICDSLNFTPLQIFEDSRKLVRVYDSWLSGNRAWQMQVSRPHI # NVELSISNQNLEPASRRSDSVRHDPII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g144 ### # start gene g145 Scaffold_3 AUGUSTUS gene 594234 594953 1 - . g145 Scaffold_3 AUGUSTUS transcript 594234 594953 1 - . g145.t1 Scaffold_3 AUGUSTUS stop_codon 594234 594236 . - 0 transcript_id "g145.t1"; gene_id "g145"; Scaffold_3 AUGUSTUS CDS 594234 594953 1 - 0 transcript_id "g145.t1"; gene_id "g145"; Scaffold_3 AUGUSTUS start_codon 594951 594953 . - 0 transcript_id "g145.t1"; gene_id "g145"; # protein sequence = [MFNPCIDSISSPLTATNAFQSLAKISSDLLPTELQLMKFAGHYLRLSDEIQYFDWDSFLQAVLDYNGKDLVLIYPDGI # AVLTEKGRGGELIKGSSDKPTLGRANEPIIPRDQLSAVSDITDYIVYFVTQVVGVSMDAGAIYDTVLNAFTNLKWASESGFADFSSSSTGTNSSWEYR # ITFSAPYSGSSESFLSFVSTIYLEADITNESSWWGLVSSSKQHFHCDITGLKFQVIKGFQDPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g145 ### # start gene g146 Scaffold_3 AUGUSTUS gene 596373 596873 0.44 + . g146 Scaffold_3 AUGUSTUS transcript 596373 596873 0.44 + . g146.t1 Scaffold_3 AUGUSTUS start_codon 596373 596375 . + 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_3 AUGUSTUS CDS 596373 596873 0.44 + 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_3 AUGUSTUS stop_codon 596871 596873 . + 0 transcript_id "g146.t1"; gene_id "g146"; # protein sequence = [MSINAPCFSGRDLLTLLGDDLTFDKYQNNTINQQSATVSIMVDKIVDFLRVVLSVALSEEDISALSKNIETTFTNLKE # AKDNGWADFSTSSSSSNSSWEYRVLFAFPNPDLPNFFYSLVTTIKLEADIQEESSWWGLESSTRKNFAATIDAMELVVLKGFKDPLKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g146 ### # start gene g147 Scaffold_3 AUGUSTUS gene 599687 600217 0.65 + . g147 Scaffold_3 AUGUSTUS transcript 599687 600217 0.65 + . g147.t1 Scaffold_3 AUGUSTUS start_codon 599687 599689 . + 0 transcript_id "g147.t1"; gene_id "g147"; Scaffold_3 AUGUSTUS CDS 599687 600217 0.65 + 0 transcript_id "g147.t1"; gene_id "g147"; Scaffold_3 AUGUSTUS stop_codon 600215 600217 . + 0 transcript_id "g147.t1"; gene_id "g147"; # protein sequence = [MTAIQVMQFSGYFVDLKQPKTFHWDQFLDGINNYKGMSINCVTFFRLRLTLLVLGDDLTFDKYQNNTINQQSATVSTM # VDKIVDFLRVVLSIALTKEDIDALTKNIDTTFRNLREAKDHGWADFSTSNSSSNSSWEYRVLFAFPNPDLPDFFYSLVTTIKLEADIKEESSWWPAAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g147 ### # start gene g148 Scaffold_3 AUGUSTUS gene 605738 606070 0.66 + . g148 Scaffold_3 AUGUSTUS transcript 605738 606070 0.66 + . g148.t1 Scaffold_3 AUGUSTUS start_codon 605738 605740 . + 0 transcript_id "g148.t1"; gene_id "g148"; Scaffold_3 AUGUSTUS CDS 605738 606070 0.66 + 0 transcript_id "g148.t1"; gene_id "g148"; Scaffold_3 AUGUSTUS stop_codon 606068 606070 . + 0 transcript_id "g148.t1"; gene_id "g148"; # protein sequence = [METRGWWDAQAEEELKTRHRADVLKAFKRAETQSRWELGELFTDIYAGEEPWNIVSDLSLWLQFKLTWDVIQKEQRKE # LGRLLKKYGEDWEPWRRELQKYKNEGRDLIKE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g148 ### # start gene g149 Scaffold_3 AUGUSTUS gene 608473 609063 0.48 - . g149 Scaffold_3 AUGUSTUS transcript 608473 609063 0.48 - . g149.t1 Scaffold_3 AUGUSTUS stop_codon 608473 608475 . - 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_3 AUGUSTUS CDS 608473 608763 0.53 - 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_3 AUGUSTUS CDS 608871 608982 0.48 - 1 transcript_id "g149.t1"; gene_id "g149"; Scaffold_3 AUGUSTUS CDS 609041 609063 0.93 - 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_3 AUGUSTUS start_codon 609061 609063 . - 0 transcript_id "g149.t1"; gene_id "g149"; # protein sequence = [MLDLDRDPITGQKYWYKIPQSPNASEKKQQVLPDKLQTMFANKQIRVQQGMALKPSEKLGVLSTIRTGFIRDLLKNYV # TDDTLGSIPWETSRGGDMRCFSHAVYCMERWSENPEEVKDHGTLAKMEKWLAGEGVFCFVSSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g149 ### # start gene g150 Scaffold_3 AUGUSTUS gene 610927 612411 0.5 - . g150 Scaffold_3 AUGUSTUS transcript 610927 612411 0.5 - . g150.t1 Scaffold_3 AUGUSTUS stop_codon 610927 610929 . - 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_3 AUGUSTUS CDS 610927 611853 1 - 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_3 AUGUSTUS CDS 612208 612411 0.51 - 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_3 AUGUSTUS start_codon 612409 612411 . - 0 transcript_id "g150.t1"; gene_id "g150"; # protein sequence = [MNSFKSKLGELNAVRSKLTTEKKELEEKVSTLEGQTRNLEATLDSLKTEKESSGSASALPDGAADPDVERLNQRLQAL # NKAREEDAHKATAALEAAVSAAVAKVKDELQTREIPPDDFVAKHQAELKALEVRLIAAHQEELKNATGNKGSSTSGSEIDVQAAVAAAIAAHDKERDV # KIAEEISAAVERGRMEAASKMKLRDSQIVRVQTKLKEYEAQIQTWKQEGILPKDAKVAPLSGKAPPPPSPSTSSNLSTPVTPSTAPAPTTASANASLP # RKPSVPSATPSSSTIVSTPPGIGRGRGGPSAVVRGAIRGAARGAPGTGRGAKPSQPLSGGITIQGAAKRPAPESAADDTLAKRLKPAAGNPVTLRRPP # PPGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g150 ### # start gene g151 Scaffold_3 AUGUSTUS gene 612654 614397 0.21 - . g151 Scaffold_3 AUGUSTUS transcript 612654 614397 0.21 - . g151.t1 Scaffold_3 AUGUSTUS stop_codon 612654 612656 . - 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_3 AUGUSTUS CDS 612654 613004 0.65 - 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_3 AUGUSTUS CDS 613052 613295 0.48 - 1 transcript_id "g151.t1"; gene_id "g151"; Scaffold_3 AUGUSTUS CDS 613404 613618 0.83 - 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_3 AUGUSTUS CDS 613672 613809 0.63 - 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_3 AUGUSTUS CDS 613948 614397 0.55 - 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_3 AUGUSTUS start_codon 614395 614397 . - 0 transcript_id "g151.t1"; gene_id "g151"; # protein sequence = [MGVSHITAQTQELSKTREALAIAETSKVHLEERVGDLTKHMKGNEEKLAVYERRGGAYSSMEQSDLTREQQLESEVAG # LRYLQSPYLPYSTLTLSIRSALKVAEFDLTQAKGHVQQFQSISEANETALTEFQSTHEEYIASTDAQIAKSEKQYEDDRVAWSNDKKTLEDTIVDLST # SENDRNSHENDVKQQEQRAKVAEERYSNEVLSHAESIKALDNLKKQLASVQATIRDYQVAAETATSKLATSEGSWQQQKQTLDNETKDLRQRSQAARI # RQAAETTTSTSSEADVNDSSDVKLSEMRSVVAYLRKEKEIVDLQLDLSKQENTRLKSQIEHLYQNLNETRQTLSEEREKAVEAATSGAKHEELIKRIN # QLNILRESNATLRADGEARAKRIKELETKLDLLGNQLEPAKEEARVAKAELQARDTQIKRLEEENRRWQGRNQQLLTKVCHHTIAVHRELTVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g151 ### # start gene g152 Scaffold_3 AUGUSTUS gene 615062 616742 0.37 - . g152 Scaffold_3 AUGUSTUS transcript 615062 616742 0.37 - . g152.t1 Scaffold_3 AUGUSTUS stop_codon 615062 615064 . - 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_3 AUGUSTUS CDS 615062 615829 0.74 - 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_3 AUGUSTUS CDS 615933 616742 0.39 - 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_3 AUGUSTUS start_codon 616740 616742 . - 0 transcript_id "g152.t1"; gene_id "g152"; # protein sequence = [MIDLCSQFKLDSLTQQLQLAQSEVERVNVELTTKSEEYGNYRRTKQAELVALQASLNDMTQNHSSLQANLKALQTSHA # SQTHQLTQALTKVQDLNGQIAEQEATYSTETNSLHRLVEVLEAREKQAKDFVENMERDWAELGERADEREANLKADIEKERRAREEAENRIEQLEKVL # DKMGRGELPIPGRGAAGTPSRRTSGVFDEVHDGLVGLSPTIAMVSKTQKSGKSFTEVYADYVRLQDLYEKKCIESKNMEAAMEDVLAQLEERVSLASE # LAQAISDRDVQYQAAQDNAQKLHKSSREIDLLQQQLDDLGLQVRALLKEIGRRDDPNLPSDEELENVIAAEVVEDVITNNLVLFRSIDEVQLQNQRLL # RIVRGMGEKMEEAEKKQKAKMEAEQAEAIREAHETMENLAAELDRQKKHSDNVIQAYVKERDALKAIIARSNHNEGHTGIPTDSSEIGVSDASSSVAK # ELAEIQSQFDTYRTEMGVDSVKLREDNIAAHREIGQLQAALAKASAKNENQIGMA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g152 ### # start gene g153 Scaffold_3 AUGUSTUS gene 616877 617554 0.95 - . g153 Scaffold_3 AUGUSTUS transcript 616877 617554 0.95 - . g153.t1 Scaffold_3 AUGUSTUS stop_codon 616877 616879 . - 0 transcript_id "g153.t1"; gene_id "g153"; Scaffold_3 AUGUSTUS CDS 616877 617554 0.95 - 0 transcript_id "g153.t1"; gene_id "g153"; Scaffold_3 AUGUSTUS start_codon 617552 617554 . - 0 transcript_id "g153.t1"; gene_id "g153"; # protein sequence = [MVGTRRTSKFPSTTEDEGGPSTTEDSHNSSFIVPIPEDFDIEAFTSLIPNFDIHSPSPESLVNLYQLLLEQSGAVDAA # QRDVDELRAESERKDVELDQALQDREQSSKDLEQQVERLQEELTQVKQERDHLCVLNLPFLYFNWLMHSLIVPVASQNELQTRITGLASSQTTSSREA # EELKHRLEDAEREKRDLINVISRLKQDGSERDGELGFLPNTLYITLIVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g153 ### # start gene g154 Scaffold_3 AUGUSTUS gene 619031 620739 0.67 - . g154 Scaffold_3 AUGUSTUS transcript 619031 620739 0.67 - . g154.t1 Scaffold_3 AUGUSTUS stop_codon 619031 619033 . - 0 transcript_id "g154.t1"; gene_id "g154"; Scaffold_3 AUGUSTUS CDS 619031 619911 0.93 - 2 transcript_id "g154.t1"; gene_id "g154"; Scaffold_3 AUGUSTUS CDS 619992 620739 0.69 - 0 transcript_id "g154.t1"; gene_id "g154"; Scaffold_3 AUGUSTUS start_codon 620737 620739 . - 0 transcript_id "g154.t1"; gene_id "g154"; # protein sequence = [MACELNSITSCHVILSSTLTFIFINLQRALVHGEFAARWKFKNVQSQTGLLKRVKGKRRGSQKDEKGKAKEVVDEGDD # SFGSGEAAADRHSSSSNSIVDDQNVNIPAVVVSGYMSPTAPHPKSPYQELLNPPRADFSRTSSALTSSSASYSHSGSSANLPQSLSITPITSNSAPPT # PSTAGVESYSNTRGMTPFYKLKDHAVVWDHDLDVIIKMDMDRETSELLPNEFKLVVMQRVIPGDPDAPRNPRLDECYSESVYVFCRHFNPSEIIITQL # TIYLEHSGGDTNYIAPLLPKAEIFNGVADLLDDDVYITRPRALDLWGPYHNQQELEMDLLGGTSIPELQSAAAEKSRSKSRVRARSKSRLTHTRIPSN # GKNSMISAEDMNSDADFYIDEDDSDIEESRYEVPFDVSRLPLAYGPKTTEMLIEAIFNPVRVTHHDSKGNPFTYYVSPEEVREEQARKLERLRDKDRT # VRAPYLGNESPSLYSADDNSSHSGYTENSEVGRGRSGMRGWWSSKKKTPAAVSSTPTGSSRPGTPGTPVTVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g154 ### # start gene g155 Scaffold_3 AUGUSTUS gene 621171 621530 0.97 + . g155 Scaffold_3 AUGUSTUS transcript 621171 621530 0.97 + . g155.t1 Scaffold_3 AUGUSTUS start_codon 621171 621173 . + 0 transcript_id "g155.t1"; gene_id "g155"; Scaffold_3 AUGUSTUS CDS 621171 621530 0.97 + 0 transcript_id "g155.t1"; gene_id "g155"; Scaffold_3 AUGUSTUS stop_codon 621528 621530 . + 0 transcript_id "g155.t1"; gene_id "g155"; # protein sequence = [MPSDSQYPAEIFVKYLAASPDSQETDKAKGQVDAQNQPGERPGKQYRFPDDLKPVDDVYANGKLYKGSGKLEGKVAWI # SGGDSGIGRATAILFALEGADMTIVFKDGEEKDAEDTRNYM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g155 ### # start gene g156 Scaffold_3 AUGUSTUS gene 621743 622057 0.8 + . g156 Scaffold_3 AUGUSTUS transcript 621743 622057 0.8 + . g156.t1 Scaffold_3 AUGUSTUS start_codon 621743 621745 . + 0 transcript_id "g156.t1"; gene_id "g156"; Scaffold_3 AUGUSTUS CDS 621743 622057 0.8 + 0 transcript_id "g156.t1"; gene_id "g156"; Scaffold_3 AUGUSTUS stop_codon 622055 622057 . + 0 transcript_id "g156.t1"; gene_id "g156"; # protein sequence = [MAGLTASQWEDTFALNIHSYFHITRAALPHMPRGGSIINMASINAFVGRDDLLDYTSTKGAVVSFTRGLSNQVVGEKG # IRVNGVLSLFIYNLTSAVTHFDLNNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g156 ### # start gene g157 Scaffold_3 AUGUSTUS gene 623310 623978 0.45 - . g157 Scaffold_3 AUGUSTUS transcript 623310 623978 0.45 - . g157.t1 Scaffold_3 AUGUSTUS stop_codon 623310 623312 . - 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_3 AUGUSTUS CDS 623310 623978 0.45 - 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_3 AUGUSTUS start_codon 623976 623978 . - 0 transcript_id "g157.t1"; gene_id "g157"; # protein sequence = [MGPSTPWIPTTPWTVGSPAVRVNPRLAPGGLRWDLLHHPDQARYINDFGALKAPKFSDNALTMAPQSSGGPRMKVSKV # EITSSSHAVLNYWMSIWGPIPLPHHKVFDVLSAVYNYLAQPLTAQETKLLLDTPQNVGHALRAKEARANDSWALACVILQEEGYRRIDVIGVHRGFGG # ISVEKITPTGLPAAAAEGNDEPEQEAEVELTIALSPLPGDADENWM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g157 ### # start gene g158 Scaffold_3 AUGUSTUS gene 629042 629491 0.82 - . g158 Scaffold_3 AUGUSTUS transcript 629042 629491 0.82 - . g158.t1 Scaffold_3 AUGUSTUS stop_codon 629042 629044 . - 0 transcript_id "g158.t1"; gene_id "g158"; Scaffold_3 AUGUSTUS CDS 629042 629491 0.82 - 0 transcript_id "g158.t1"; gene_id "g158"; Scaffold_3 AUGUSTUS start_codon 629489 629491 . - 0 transcript_id "g158.t1"; gene_id "g158"; # protein sequence = [MSQRQYPSRVNIGSDNKGSQSELTRETPYVSHLTKERGKIGKSTARIARQVIRSMCALYVVNDGNGSILGATGNVWDD # GFGVIGLFRLDGRGVPLSFRCMSSKSPPGANIKSKSAAGQLAKIVIESSKGNTRNSHDNGRLVSEDSLILV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g158 ### # start gene g159 Scaffold_3 AUGUSTUS gene 637426 637905 0.23 + . g159 Scaffold_3 AUGUSTUS transcript 637426 637905 0.23 + . g159.t1 Scaffold_3 AUGUSTUS start_codon 637426 637428 . + 0 transcript_id "g159.t1"; gene_id "g159"; Scaffold_3 AUGUSTUS CDS 637426 637459 0.82 + 0 transcript_id "g159.t1"; gene_id "g159"; Scaffold_3 AUGUSTUS CDS 637541 637905 0.23 + 2 transcript_id "g159.t1"; gene_id "g159"; Scaffold_3 AUGUSTUS stop_codon 637903 637905 . + 0 transcript_id "g159.t1"; gene_id "g159"; # protein sequence = [MGLANVVKGNLDGAGQIKMTKDGKVLLSEMQIQNPTAAMIARTAVAQDDQVGDGTTSVVLLVGELLKQADRYISEGVH # PTVIAEGFDLAKKEALAVCSFFSQFEPCLMFTSRIPIPISYVFSSWMPSNNLRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g159 ### # start gene g160 Scaffold_3 AUGUSTUS gene 639830 640123 1 - . g160 Scaffold_3 AUGUSTUS transcript 639830 640123 1 - . g160.t1 Scaffold_3 AUGUSTUS stop_codon 639830 639832 . - 0 transcript_id "g160.t1"; gene_id "g160"; Scaffold_3 AUGUSTUS CDS 639830 640123 1 - 0 transcript_id "g160.t1"; gene_id "g160"; Scaffold_3 AUGUSTUS start_codon 640121 640123 . - 0 transcript_id "g160.t1"; gene_id "g160"; # protein sequence = [MVFAVNPTAAKSFEAFQAAALATGTNSTTTNSTASAATSGTSTASTASGSTVASASAAVASQSAVGAATTANGATALA # SSAIAGLVAVFGVGIGLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g160 ### # start gene g161 Scaffold_3 AUGUSTUS gene 642831 643546 0.48 - . g161 Scaffold_3 AUGUSTUS transcript 642831 643546 0.48 - . g161.t1 Scaffold_3 AUGUSTUS stop_codon 642831 642833 . - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_3 AUGUSTUS CDS 642831 643148 0.62 - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_3 AUGUSTUS CDS 643253 643546 0.49 - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_3 AUGUSTUS start_codon 643544 643546 . - 0 transcript_id "g161.t1"; gene_id "g161"; # protein sequence = [MQNSALPPSLSPKPHPEPETLPEMELDIPPSPPPVEETLASRRAKRQAILAKYTNIGVSVSPSPVTTTGFSSAVQALQ # TPSTVSDHASHDSSLHQQNTDFALAKEDDEKSSELKKQEENVNANVGEQILAADYDPSLDRREDEGKRIQPLVKVEERNVEEVVEEEDEDDVDDMFAV # AVNDKPKVKKVKKVTVRPLAMSWVPLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g161 ### # start gene g162 Scaffold_3 AUGUSTUS gene 643639 643986 0.81 - . g162 Scaffold_3 AUGUSTUS transcript 643639 643986 0.81 - . g162.t1 Scaffold_3 AUGUSTUS stop_codon 643639 643641 . - 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_3 AUGUSTUS CDS 643639 643986 0.81 - 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_3 AUGUSTUS start_codon 643984 643986 . - 0 transcript_id "g162.t1"; gene_id "g162"; # protein sequence = [MTNIPAGSKRPLDGAGGSSNSESRDRKRPRDDPKDWRDVHLKTSSRKVSPSNRRDSYDRDRRSHHDAERRRRSREHGK # SRRDRDDSRDKRTEPRRLDPTPPRYTPRHDEEKEEGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g162 ### # start gene g163 Scaffold_3 AUGUSTUS gene 646902 647768 0.68 - . g163 Scaffold_3 AUGUSTUS transcript 646902 647768 0.68 - . g163.t1 Scaffold_3 AUGUSTUS stop_codon 646902 646904 . - 0 transcript_id "g163.t1"; gene_id "g163"; Scaffold_3 AUGUSTUS CDS 646902 647768 0.68 - 0 transcript_id "g163.t1"; gene_id "g163"; Scaffold_3 AUGUSTUS start_codon 647766 647768 . - 0 transcript_id "g163.t1"; gene_id "g163"; # protein sequence = [MVPFLTKNRSFQVLKLNNNGLGPAGGQVLANALLDSAKLSKAEGKTSNLRTFICGRNRLEDGSASAWAEAFAAHGGLI # EVRMPQNGIRMDGITALAGGLAKNRNLQYIDLQDNTFTFEGGLTGVKTWANSLRAWPDLHTLNLSDCFLSANGEVPELVTVLAEGSNPKLHSLQLQNN # NLEGETSQLLAENIMENMRNLKYLELQWNDFEEEDEHLSALRVSMKQRGGKLSVTDEEEDEEEQDDAEEEAEARAEKEAELEMDLEEKAFQGKTEKYE # ADELANLMSKVELE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g163 ### # start gene g164 Scaffold_3 AUGUSTUS gene 650031 650552 0.62 + . g164 Scaffold_3 AUGUSTUS transcript 650031 650552 0.62 + . g164.t1 Scaffold_3 AUGUSTUS start_codon 650031 650033 . + 0 transcript_id "g164.t1"; gene_id "g164"; Scaffold_3 AUGUSTUS CDS 650031 650552 0.62 + 0 transcript_id "g164.t1"; gene_id "g164"; Scaffold_3 AUGUSTUS stop_codon 650550 650552 . + 0 transcript_id "g164.t1"; gene_id "g164"; # protein sequence = [MKSVNIGVTRNVSNGRIGIVSQQNRWYRASGAASSILPFARMHSPTHSGIEVSEPMAMAYDGMAPMSVHAASVAAATY # DVDLGHLGMADGNNNDHGIYESPSLLPSFRRPSDSTTLVLASRVDPFNEEVDPRAEPSRMRSVDRLRVSGELPLHSSLTSSLIANVNVSRGSLGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g164 ### # start gene g165 Scaffold_3 AUGUSTUS gene 652640 653733 0.23 + . g165 Scaffold_3 AUGUSTUS transcript 652640 653733 0.23 + . g165.t1 Scaffold_3 AUGUSTUS start_codon 652640 652642 . + 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_3 AUGUSTUS CDS 652640 652924 0.65 + 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_3 AUGUSTUS CDS 653061 653388 0.35 + 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_3 AUGUSTUS CDS 653462 653733 0.75 + 2 transcript_id "g165.t1"; gene_id "g165"; Scaffold_3 AUGUSTUS stop_codon 653731 653733 . + 0 transcript_id "g165.t1"; gene_id "g165"; # protein sequence = [MSPATQIATTANLFSPIKIGDMLLNHRVVMAPLTRLRTTKTSAVLKVVKEYYSQRASTPGTFLISEGTVISPRATGFQ # PCAPGIWSDEQITAWKESYDPTYDVISAGDIPMAEGEVPRPMTVEEIQASIGDFVQAATNAVHKAGFDGVELHGAYGFLIDQFIQDVSNNRTDKYGGS # IENRARFALEVVDAVAKAVGEDKTAIRFNMGMKDPIPTFTYLISQLKEKQPNLAYLHLIQSRDLDDPKQSNEKFFDMWSPRPLVVADGFTREKALKFA # ERDGVLIAFGKRFISNVSVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g165 ### # start gene g166 Scaffold_3 AUGUSTUS gene 655533 656137 0.4 + . g166 Scaffold_3 AUGUSTUS transcript 655533 656137 0.4 + . g166.t1 Scaffold_3 AUGUSTUS start_codon 655533 655535 . + 0 transcript_id "g166.t1"; gene_id "g166"; Scaffold_3 AUGUSTUS CDS 655533 655829 0.42 + 0 transcript_id "g166.t1"; gene_id "g166"; Scaffold_3 AUGUSTUS CDS 655913 656137 0.64 + 0 transcript_id "g166.t1"; gene_id "g166"; Scaffold_3 AUGUSTUS stop_codon 656135 656137 . + 0 transcript_id "g166.t1"; gene_id "g166"; # protein sequence = [MTVEEIQASIRDFVQAATNAVHKAGFDGVELHGANGFLIDQFIQDVSNNRTDKYGGSIENRVRFALEVVDAVAKAVGD # DKTAIRLSPWSKEQGRSRSSLLKEKQPNLAYLHLIQSRDLDDQKQSNEIFFDLWSPQPLVVADGITREKALKFAEREGLLAAFGRQFISNVSNSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g166 ### # start gene g167 Scaffold_3 AUGUSTUS gene 660019 661410 0.54 + . g167 Scaffold_3 AUGUSTUS transcript 660019 661410 0.54 + . g167.t1 Scaffold_3 AUGUSTUS start_codon 660019 660021 . + 0 transcript_id "g167.t1"; gene_id "g167"; Scaffold_3 AUGUSTUS CDS 660019 661410 0.54 + 0 transcript_id "g167.t1"; gene_id "g167"; Scaffold_3 AUGUSTUS stop_codon 661408 661410 . + 0 transcript_id "g167.t1"; gene_id "g167"; # protein sequence = [MREKLTLKAPESFEIPHTRMATMFNGFLHTRYLTISAPEEYFRELFSLKAPLWPSLERLSIEVQNPSECKLTVDDYNT # PDITTFTNSPKLREVRLVSEAKQNSTPFIPRVSLPCSHLTRLILRDGSDKFWPDLSIRIVFRSCAPTLEYCEIRSYGFLDDFYDSDSESNDEKEQLVT # FPHLIDLFLDFGTGKHHRTYNTMSCVMLWNVAFPALKNFRLWTTVPPIIYPNVEMNVGADKSLDETMKILQQRSKFKLQKFQLFFAGWHALGIASFLE # LVPSLEVLDLRGTYYGWTDTVRSISTRDDYLPNLRCVRVNDRTSFSPGWEEMEPSYGEHATLIRDMISRRCIPVGKLETVVFNIRRPSPNNFSDGNGP # MPRNFKRVIREIEKSRTSMPSEVRIHLEKFPLGQYTDFSWSMPGFPPSWYEHQEDGEKTGQDIADSDEDSEMEPAEIPDLEFIPMEVDDNY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g167 ### # start gene g168 Scaffold_3 AUGUSTUS gene 674784 675830 0.82 + . g168 Scaffold_3 AUGUSTUS transcript 674784 675830 0.82 + . g168.t1 Scaffold_3 AUGUSTUS start_codon 674784 674786 . + 0 transcript_id "g168.t1"; gene_id "g168"; Scaffold_3 AUGUSTUS CDS 674784 675830 0.82 + 0 transcript_id "g168.t1"; gene_id "g168"; Scaffold_3 AUGUSTUS stop_codon 675828 675830 . + 0 transcript_id "g168.t1"; gene_id "g168"; # protein sequence = [MTGVLFANYDFNSSSSLSSPSRSRPHQEKRPLNSPGPSTNDTPSKGTSSLKSIFGSPSTNEFNSPSPSRSEPIFATPS # KAWVPPFPGSPSFSRPQRPLDKSNLGYLAFPTAVSPLAATSNLTSEASDRSHILQSSHSSPSAEETNAPPPPPVDPLEEKHRARLEREEVERVRGEED # WVRSGGILRDSEGKRDFARTEKVREEIRLREWEKEVQERWDGYERRWAELQAKERKGDSKYSFQDIPWPVHVGERDSKTKSRRSGTWGTVTLTAKVEL # SDLNRENVEKFLTDGLKVRGCKVTRKERVRTSLLRWHPDKMTALVSKVIDDDRKDVESGISAVVRCLQDMNSKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g168 ### # start gene g169 Scaffold_3 AUGUSTUS gene 676850 677246 0.82 - . g169 Scaffold_3 AUGUSTUS transcript 676850 677246 0.82 - . g169.t1 Scaffold_3 AUGUSTUS stop_codon 676850 676852 . - 0 transcript_id "g169.t1"; gene_id "g169"; Scaffold_3 AUGUSTUS CDS 676850 677022 0.82 - 2 transcript_id "g169.t1"; gene_id "g169"; Scaffold_3 AUGUSTUS CDS 677132 677246 0.94 - 0 transcript_id "g169.t1"; gene_id "g169"; Scaffold_3 AUGUSTUS start_codon 677244 677246 . - 0 transcript_id "g169.t1"; gene_id "g169"; # protein sequence = [MTVFIANYPDATDNGVAYNRQKTAIESAIQAYGTDHIGDPNGSVGNQGAAILTPLIDDTKSMLQSLGVTLKVGNADAG # SFFNDKVLADVDYGVSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g169 ### # start gene g170 Scaffold_3 AUGUSTUS gene 679132 679995 0.51 - . g170 Scaffold_3 AUGUSTUS transcript 679132 679995 0.51 - . g170.t1 Scaffold_3 AUGUSTUS stop_codon 679132 679134 . - 0 transcript_id "g170.t1"; gene_id "g170"; Scaffold_3 AUGUSTUS CDS 679132 679995 0.51 - 0 transcript_id "g170.t1"; gene_id "g170"; Scaffold_3 AUGUSTUS start_codon 679993 679995 . - 0 transcript_id "g170.t1"; gene_id "g170"; # protein sequence = [MSSACVSSPPSQPSSAKSQTKTTLLANTRTMNTTEPSPLLITGELLGSKRARTISTSSVDTIRINSGKKKSTSSNKRA # RASEPSSGSGCDQNIIEDIRRIRQRKSSTYSADTIRAPESSAVTFPIFCDPPERTSPQSETPSTAASKKKDPRKVTPPQLNPGKTAPSVAVTSVRHAP # PPPIITNLVRSRVSSIKRSSSRPTSPAAILSNYHPTGFEPLPSHLQEWQPSSTHFMLSDDEGSACDDKASSQVTAWKDQWDHVHPGMSDLAITICFHK # KQPFFDVWDLPDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g170 ### # start gene g171 Scaffold_3 AUGUSTUS gene 681641 683852 0.48 + . g171 Scaffold_3 AUGUSTUS transcript 681641 683852 0.48 + . g171.t1 Scaffold_3 AUGUSTUS start_codon 681641 681643 . + 0 transcript_id "g171.t1"; gene_id "g171"; Scaffold_3 AUGUSTUS CDS 681641 682067 0.98 + 0 transcript_id "g171.t1"; gene_id "g171"; Scaffold_3 AUGUSTUS CDS 682192 682438 0.49 + 2 transcript_id "g171.t1"; gene_id "g171"; Scaffold_3 AUGUSTUS CDS 683147 683852 0.68 + 1 transcript_id "g171.t1"; gene_id "g171"; Scaffold_3 AUGUSTUS stop_codon 683850 683852 . + 0 transcript_id "g171.t1"; gene_id "g171"; # protein sequence = [MREGKWVVFKDIDRGSNEVLALIKPLIESLGLDKWIGGRASLEVVGRGEVVAADTFAIFATRSALPSRNGTFATPTFY # GAHKLHEVVVASPTAEELTLIVQSRYPRLSSQATSGLIRLWQAVRELGTTVSARDVGLRELEKFSRDVFFGSGVTASARAHTGLIAHTVGSQLGLEQE # RQEWLLSRWMPDFDVETDRDGRRTALRVGRTRLLAKPMKREITSSTPRPILLDEVNLASAETLECIAGLLRNPTASITLTEQGSLEPVPRHPNFRLFA # CMNPATDVGKKDLPPNIRSRFTEIDVPPPDADRETLLSIVAQYIGPSAVSDKASIMDVCEFYIAVKDLAETRQIADGANHRPHFSMRTLARALTFASD # IASNYGLRRALWEGCLMAFTMVLDIPSSEKVVALAQKHLLAGVKNVRSALAKEPTLPPSCAPENFVKLGPFFLEHGPLPLDPADDYF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g171 ### # start gene g172 Scaffold_3 AUGUSTUS gene 684389 686372 0.24 + . g172 Scaffold_3 AUGUSTUS transcript 684389 686372 0.24 + . g172.t1 Scaffold_3 AUGUSTUS start_codon 684389 684391 . + 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_3 AUGUSTUS CDS 684389 685580 0.3 + 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_3 AUGUSTUS CDS 685693 686372 0.37 + 2 transcript_id "g172.t1"; gene_id "g172"; Scaffold_3 AUGUSTUS stop_codon 686370 686372 . + 0 transcript_id "g172.t1"; gene_id "g172"; # protein sequence = [MIAPSYGKKIVAVFRELQKRRQTDRVFESKQGFATLRDLFRWAGRDAVGYQELAENGYMLLAERARRDEDKIVVKEVI # ESTMGVKINERMLYDFQSRGPEFAQFLDCDPSGASLIWTKAMQRLFVLVARALRFNEPVLLVGETGSGKTSVCQVYADITSRRLHGLNCHQNTETADL # IGGLRPIRNRASLEAEALQKAGVLSSKIGSELDSHDVATLQSQLDMLLKSTTLTSPTRDALEELQSKILKSKAIFEWHDGPLIEAMRNGDVFLLDEIS # LADDSVLERLNSVLEPSRTLVLAEKAADLHHHPSLVAHESFKLVATMNPGGDYGKKELSPALRNRFTEIWVPSIDDPADLHMIISCWWKHKKFATIYD # RSPGFRGMAFSKRRRYFVLESQGYTEEIFVSRMYLLARRIHLLMKCPQHHAAHMTYLDGLESTPSLSSLSETSLRQMKLAAVARLNELVPCPTSDPFI # PQHDPSISYLLGSFVIPRGSKLVQHHTFSFQVPTTQANAMRVVRACQLAKPILLEGSPGVGKTSLITALAQVSGHELCRINLSDQTDLIDLFGSDLPV # DGGKAGEFAWKDGEFLRALREGWWVLLDEMNLAPRLFLKGSMPSSTTEALSTFRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g172 ### # start gene g173 Scaffold_3 AUGUSTUS gene 686572 687498 0.48 + . g173 Scaffold_3 AUGUSTUS transcript 686572 687498 0.48 + . g173.t1 Scaffold_3 AUGUSTUS start_codon 686572 686574 . + 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_3 AUGUSTUS CDS 686572 687498 0.48 + 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_3 AUGUSTUS stop_codon 687496 687498 . + 0 transcript_id "g173.t1"; gene_id "g173"; # protein sequence = [MIAFNSSLHHMVSIERSLGKEGAPWEFNLRDVLRWIELLKRPSERQLLPVDHVRTVYSHRFRTSSDRHLALALFERTF # GCSFDYSRNPVWTISSSTITVGQFCSERHNSSTPARPKRLLKSQLSALEALGCAISNSKLSIVTGARDSGKTAVVETLAVLTGNVLHKVHINNTTDAM # DLLGGFEQVDLQTRFKEIAFAAIAAVEQQLRVQADSNIDIEAYLSLRRAVTETSLEESRAIQEIISRLSKGSFSAAVFAQLSLAQTQIKEVLSSEQDR # RAGRLSGLMEFLFEHLKLAIGFYWTVLTLQSICP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g173 ### # start gene g174 Scaffold_3 AUGUSTUS gene 689516 692733 0.34 + . g174 Scaffold_3 AUGUSTUS transcript 689516 692733 0.34 + . g174.t1 Scaffold_3 AUGUSTUS start_codon 689516 689518 . + 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_3 AUGUSTUS CDS 689516 689614 0.35 + 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_3 AUGUSTUS CDS 689695 692733 0.98 + 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_3 AUGUSTUS stop_codon 692731 692733 . + 0 transcript_id "g174.t1"; gene_id "g174"; # protein sequence = [MAKLSEYETNLYSQAQLALLNTEQVLSRPEQLAIASCFLAADDLSKRDTHPVTFGQGVDSPALILPELESALAHSVPF # RRAVETYLQPVFASSEHPAEDYLEYVTRLGLCWISAGKLLLDLFIPDAPIDPAAVQNHIFEFWSQRAASLTKEYDLHSELEKSITGNIENGVTAYLRT # SLDAAQEHLANRPTAVFSRDVTRLHMLWSEVLQFQEHILSPTKLDALISDLKTGDRSADLREQVIQRSIVGFMQRVQTVYAEFDDIIFPIYYAILHLQ # TGLRILKQGSILNPVTESAVTALTGFPAIRSAQASVVPQNIGVVPGLQVFQRLLISMAAISLERTSGVEIKCHMSLIENTYEQASRLWHIDQSKEEEY # QKASESLYRQNHTVHAMESDAEIEEREFAELFPSFENVLSDDAPSSGNLNMSSPTHQISETDIKHFVHLHNVLFSGEGFTASSYRSVQLTNLPALITS # MTVFTDTLDYNALPLCISLLAERIEETGEPSKPRAIYNFYADANLHETRKAIKVLTKTKERLHTLIEEWPDQMVLRHLIERCDVILALDLRSPVAKVL # AALEQLLFHTEDWEVYANKENSLRDSRSELIELIVEWRRLELNCWQILFAAETKTFEDGVLPWWFRLYDAIIRGPLDVLENAIGSTTELSAYLGDLLP # LLDDFIRGSSIGQFRVRLQLLKSFGDLCYHLKIIHSGLKAETLERILRIVNATVGYFMAFSSSVAAELSTGRATLEVEIRNLIKLASWKDVNVHALKQ # SAQRTHRQLYKLIRKYRELLRQPVSSRLENFSKSSKDEDSVHEHRQLGIVKAPDPTFPGTISDISAPTHLVNLGRTYRRLEQLISKSIAPLITSRSAD # VVEAFAVDIIVTSKELSSISLPPSLSAERREKQQKALLTRKRKAWSDLLKELKRAGFAAHVKPDVLLQNQSTRWIREQPLLIGTSDFNFEKIEMYWNR # LNGLFPLLRANVHLHHADLSTRELQRGVTFLESIFSIAAESRARYVLSSRGSVRAKFKFLQIIRFFQWLYSTSTPSPSYAESRFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g174 ### # start gene g175 Scaffold_3 AUGUSTUS gene 693095 694263 0.54 + . g175 Scaffold_3 AUGUSTUS transcript 693095 694263 0.54 + . g175.t1 Scaffold_3 AUGUSTUS start_codon 693095 693097 . + 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_3 AUGUSTUS CDS 693095 693925 0.9 + 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_3 AUGUSTUS CDS 693991 694263 0.64 + 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_3 AUGUSTUS stop_codon 694261 694263 . + 0 transcript_id "g175.t1"; gene_id "g175"; # protein sequence = [MDLCVEDESRLRPYIYPIIHWLRSLDLSYSSIARTLPDPTVACNGNEIINVCLATTEVLLAKSSNPPSSAEEDRDHYI # REDYQGVREFTSIFKIDQVIELLNRSLKGFAAGSAFDVNRYLPFLELYSNLLHLQLASHGHWTKSLLKLNFVLCSVLDTICRQGFCKPPEPDEDGTAS # GDGVAEVNDGAGMGEGSGANNVSKDIEDESQVEGLQGDKNDANEPRDEQDDDAIEMSQDFDGDMEDVPDDGSQAEEQEEDSQSNPDPEEQVHDLDSSD # PAAQSGESEVVAKEGGNKTDAKEDADSPETNDEAVEPQPDHEDEEAKQETGEEDSTYPDASGAPMDEYVPEADALELPEDGYGHGECGGRNRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g175 ### # start gene g176 Scaffold_3 AUGUSTUS gene 694756 695043 0.74 + . g176 Scaffold_3 AUGUSTUS transcript 694756 695043 0.74 + . g176.t1 Scaffold_3 AUGUSTUS start_codon 694756 694758 . + 0 transcript_id "g176.t1"; gene_id "g176"; Scaffold_3 AUGUSTUS CDS 694756 695043 0.74 + 0 transcript_id "g176.t1"; gene_id "g176"; Scaffold_3 AUGUSTUS stop_codon 695041 695043 . + 0 transcript_id "g176.t1"; gene_id "g176"; # protein sequence = [MNPTFRESSRSLADALKEVQRRFDEIFDSEGQDVPKDQVGASEQPAALEYLRPDDTDHDMQALGPAQEEQVAKLQELN # LVDDERIPIANASPSRH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g176 ### # start gene g177 Scaffold_3 AUGUSTUS gene 702861 703396 0.37 - . g177 Scaffold_3 AUGUSTUS transcript 702861 703396 0.37 - . g177.t1 Scaffold_3 AUGUSTUS stop_codon 702861 702863 . - 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_3 AUGUSTUS CDS 702861 703154 0.87 - 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_3 AUGUSTUS CDS 703289 703396 0.37 - 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_3 AUGUSTUS start_codon 703394 703396 . - 0 transcript_id "g177.t1"; gene_id "g177"; # protein sequence = [MVGQEPFLLDGTIRENLDITGCKSDDDVWAAIESAQIQLLALARSLLSGKKIILLDEATAALDGETDDSIQEVIRSSF # KDCTCITIAHRIKTIKDYDQVVVLNHGLVEEMGDPAELLQKEGSVFRELAQASEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g177 ### # start gene g178 Scaffold_3 AUGUSTUS gene 703573 704838 0.2 - . g178 Scaffold_3 AUGUSTUS transcript 703573 704838 0.2 - . g178.t1 Scaffold_3 AUGUSTUS stop_codon 703573 703575 . - 0 transcript_id "g178.t1"; gene_id "g178"; Scaffold_3 AUGUSTUS CDS 703573 704220 0.86 - 0 transcript_id "g178.t1"; gene_id "g178"; Scaffold_3 AUGUSTUS CDS 704311 704838 0.21 - 0 transcript_id "g178.t1"; gene_id "g178"; Scaffold_3 AUGUSTUS start_codon 704836 704838 . - 0 transcript_id "g178.t1"; gene_id "g178"; # protein sequence = [MEELPDSTKSIAMRSYMHYCRAASWYCIAVYLLLLLLTVGIQTITPVYLQVWSTYNDSHFSNRKSVVAYLPGYAAIEI # AYTFALCYVFYYMIMILSQNASRNLHEWQFSAVMHAPMSFFDSTQVGQTINRFSQDITYIDGGLPLALYDFFYQMVRAIGGIIVMIIALPYMAAVVFG # ATSKRVRRLDLASKSPLYTLYQETMMFDALLTVRAAGAEGHFLDSSEILLARSQRPFYLSRNVAAWLVSSIGIMTSIVNTSVVLLAIGTRRSASAGLF # AAAMSQAISLQDMLNTMLTSWTKLEMAAVSLERNLDLVNLVPEDDDDKSQGPGISDDNEWPSRGEIELTNVMAKYRVTPILKDVSFRAPAGSSLGICG # RTGSGKRYVAASFIIRPLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g178 ### # start gene g179 Scaffold_3 AUGUSTUS gene 708872 709258 0.56 + . g179 Scaffold_3 AUGUSTUS transcript 708872 709258 0.56 + . g179.t1 Scaffold_3 AUGUSTUS start_codon 708872 708874 . + 0 transcript_id "g179.t1"; gene_id "g179"; Scaffold_3 AUGUSTUS CDS 708872 709258 0.56 + 0 transcript_id "g179.t1"; gene_id "g179"; Scaffold_3 AUGUSTUS stop_codon 709256 709258 . + 0 transcript_id "g179.t1"; gene_id "g179"; # protein sequence = [MGRISRTLAELGGDVIGIKPTPFLKYSNGKLPEWGYNELVPDIHTQKARMAELSNGYLFLPGGFGTLEEFCAFRMWRK # LGEYTPYKIPKIFINIAVGIIKAPLVILNFENYYEDLVKWIELGADEGFN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g179 ### # start gene g180 Scaffold_3 AUGUSTUS gene 711612 712205 0.33 - . g180 Scaffold_3 AUGUSTUS transcript 711612 712205 0.33 - . g180.t1 Scaffold_3 AUGUSTUS stop_codon 711612 711614 . - 0 transcript_id "g180.t1"; gene_id "g180"; Scaffold_3 AUGUSTUS CDS 711612 712083 0.68 - 1 transcript_id "g180.t1"; gene_id "g180"; Scaffold_3 AUGUSTUS CDS 712150 712205 0.33 - 0 transcript_id "g180.t1"; gene_id "g180"; Scaffold_3 AUGUSTUS start_codon 712203 712205 . - 0 transcript_id "g180.t1"; gene_id "g180"; # protein sequence = [MSLSGKRIYMLRHGQAMHNVDKFWPERDPPLTELGIQQSEAVALPIIPDLVVCSPMKRTIQTMYKVLSKLELNEDPKI # EIWPDLREATNAPHNNGSSKADISSAYPLLDFERCNEEWDYEENTEENVTARAAEVLKELKSRPETNILVVGHRVLFWYIVGGKRFVNCGEYAFNSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g180 ### # start gene g181 Scaffold_3 AUGUSTUS gene 715654 717291 0.35 + . g181 Scaffold_3 AUGUSTUS transcript 715654 717291 0.35 + . g181.t1 Scaffold_3 AUGUSTUS start_codon 715654 715656 . + 0 transcript_id "g181.t1"; gene_id "g181"; Scaffold_3 AUGUSTUS CDS 715654 717291 0.35 + 0 transcript_id "g181.t1"; gene_id "g181"; Scaffold_3 AUGUSTUS stop_codon 717289 717291 . + 0 transcript_id "g181.t1"; gene_id "g181"; # protein sequence = [MAKLLRTISCNQKGFVWEKSQQRWLCSRVISLVLLSFRLHHTQFDGWCLPIILEHLQEAYAATTVSEDWIKASPPFSN # FIQWVSSQPPADAIDYWRKKLESIAVPKWPNNAPNILLKTPMKGTTNHSIISTFNDTEKLSTFCAEHEITLSSLISAALAMVLGLYEDSDDVLFGVVT # SGRTGDVPGIEDIVGYCVSTVPCRVHIPTDVSLEAIVEAVHGDLLGSTPYQFLGLNDIITTAFPIPHDILRVLLTIENLPGLFEENSDFLGQNLRGFA # IDVSYPFAVTVFPSPDNRQLKFHFQWDSEFLSRADVDWFQSHMYAILHAIIDHPSSQLRKSDFLANGETENILSLGRSVPDPPASVRPFFHQLVDEMG # HQYPDKIAIERDNHQGRLTFKEYVARANQVAHALQGKGVRPEYMVPVLFNQNTTNTDITIAFLAILKAGGAFVPLNSAWPEDRLQYCIHQTRGQILIC # ETGLEGIATKLASLSELPLHVSRIEDLVRGQPSYTPATPTLQMDSLSCAMFTSGTNGEPKGVLIEHGNIISSISK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g181 ### # start gene g182 Scaffold_3 AUGUSTUS gene 721338 725103 0.47 - . g182 Scaffold_3 AUGUSTUS transcript 721338 725103 0.47 - . g182.t1 Scaffold_3 AUGUSTUS stop_codon 721338 721340 . - 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_3 AUGUSTUS CDS 721338 723408 1 - 1 transcript_id "g182.t1"; gene_id "g182"; Scaffold_3 AUGUSTUS CDS 723486 723819 0.64 - 2 transcript_id "g182.t1"; gene_id "g182"; Scaffold_3 AUGUSTUS CDS 723912 725103 0.7 - 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_3 AUGUSTUS start_codon 725101 725103 . - 0 transcript_id "g182.t1"; gene_id "g182"; # protein sequence = [MPKRLVELVKHYPYAGITQSSTEHDLLPRPRFSTRRYDALFVHIDTESPLSGPKASRHSLQMVADALNAITPSTDTPP # YSIWREVQQTAAAGDEELLYSPSVGRFPAVGRVLSDETLGILSLLADDEIQRESSINFVSRTNSPKEDTDRTGPGQRSTSTSIHARQLSVSSSDTAMP # QRPSFNNLGLNLDWNSFSSSGFSQSSPLLTPLAETLLESKDSEVTSPSVTPSRKGSKKSVKTPPHQSRRSLDVLPPITIPTTPGTWSQLQNDLTTTSG # ITAKTSSRVTKVELIPLDEGFIDFWNDSLLDPITDVEAWPKFVVCRLKTSIGTQAKKVEWIVVEQQYIKPAPKILSVARSPTSHSTDTSAHETTVEST # SSPKSPAMRASSPRPSLSSVNASVKREMGEILAQEEPKSPKVASPPKKVVEVPAVVEEEQEVQETKKDLVVAHAKAEIGSESIVSPGVAVAFTGIGAA # GVSADIAELAVEVQQNVPHPDMEEQQKNLIPAAMQAFNDPLIPIERLMNIAPKESSTVKEFSSTIQTDPRAAFDGSTSPELLPQVVASSVVESAPAVE # AIEADADVPVELAIDEPAPQVQKETTLEEVAEQIPDVQELESVVDVPVDEIVEDEPVTLETVTEPTDVQEPVTNVSASDASQSIPEPAQFVKEPAVAP # IFVIEPTTTDEPEPMTEETVVNDSWGSARSIHEPIVQELAEETAEATLVEEPEHARDVSSPQGPISTTVEDAPEPASPEETMPASRAESVLVQEQIDG # PQAESQLPPEAAVEEVEDGPASAIASMNLESGSADLVVERFGNIKPAEELPVVNEAPAQEAEIITPSTDDLEDSQALALSEASTTIFSSELDPPPPAP # IESTLVDLVDASAVSVEATEPATHIAERVHEISLPEDTAPETEDNIPVAVEQSNDASNTQLPEMEAASEVVVSPPAFETSLPEPSQEVPESAENVKSK # PQEPDTSVEPSNNHAPDLMPSIPVESATSVNPTSEHAKTVNEDAIARENSEPAEDVVEVPEQPATIDDVEAEQNESLVRSEPLRESSPGLENDTVSLS # EVPVVNAPVIPPASPSAHPVVIDTHPEELKGNVPEDISDDDISDDLPDKYLSPAPATVVFAGETVGPALALNSSEIVTAALAGEAGDVDGKGEAVGDE # IGADDADDVKESEVGNGTRSYEAMHDEVESKHEAERKCPFDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g182 ### # start gene g183 Scaffold_3 AUGUSTUS gene 726398 726955 0.76 - . g183 Scaffold_3 AUGUSTUS transcript 726398 726955 0.76 - . g183.t1 Scaffold_3 AUGUSTUS stop_codon 726398 726400 . - 0 transcript_id "g183.t1"; gene_id "g183"; Scaffold_3 AUGUSTUS CDS 726398 726955 0.76 - 0 transcript_id "g183.t1"; gene_id "g183"; Scaffold_3 AUGUSTUS start_codon 726953 726955 . - 0 transcript_id "g183.t1"; gene_id "g183"; # protein sequence = [MSTYVNRIHDISNSGDPTPLVAHAYVRYLGDLSGGQTIRHSLAKAYDLDEASGEGLSFYAFKELSSSKPASLGEMKRI # KDWFRNGMNEGAGDNTSVKGIGDLVISFTRVSYVRCFVLLAVIAQEAKDVFRYNGDLFNAILEDPEQVRKDSPVTPKAQYSSGIAVSSVLAVITAGRS # SFKPRPAPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g183 ### # start gene g184 Scaffold_3 AUGUSTUS gene 731698 731976 0.75 + . g184 Scaffold_3 AUGUSTUS transcript 731698 731976 0.75 + . g184.t1 Scaffold_3 AUGUSTUS start_codon 731698 731700 . + 0 transcript_id "g184.t1"; gene_id "g184"; Scaffold_3 AUGUSTUS CDS 731698 731976 0.75 + 0 transcript_id "g184.t1"; gene_id "g184"; Scaffold_3 AUGUSTUS stop_codon 731974 731976 . + 0 transcript_id "g184.t1"; gene_id "g184"; # protein sequence = [MSIDQHRPFTIIEITNPVNGEDGVIRYPDPPLAALAIHVDVDNIQPDLSEFVTQFVDGDRISVAGDERNSTVQPLVND # NSTAVTSGVTEGVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g184 ### # start gene g185 Scaffold_3 AUGUSTUS gene 745626 746174 0.76 - . g185 Scaffold_3 AUGUSTUS transcript 745626 746174 0.76 - . g185.t1 Scaffold_3 AUGUSTUS stop_codon 745626 745628 . - 0 transcript_id "g185.t1"; gene_id "g185"; Scaffold_3 AUGUSTUS CDS 745626 746174 0.76 - 0 transcript_id "g185.t1"; gene_id "g185"; Scaffold_3 AUGUSTUS start_codon 746172 746174 . - 0 transcript_id "g185.t1"; gene_id "g185"; # protein sequence = [MSVSISTPRGDTPSKRSTLDTVPTPSTSFSGRASPRDVSADIERLAEELRQYDQNRAEENRDLGDALRDLREELLGLS # DSHPIPSQEPPQTPSCPRYPRQPQYPRQPQYPQQPYPHYAEERVGSSRAMNADENRSLSLAPSSLNRTPSSTSSMSFLSSHHSDDWLLYPTPQPPGSL # VSRRSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g185 ### # start gene g186 Scaffold_3 AUGUSTUS gene 762942 764410 0.34 + . g186 Scaffold_3 AUGUSTUS transcript 762942 764410 0.34 + . g186.t1 Scaffold_3 AUGUSTUS start_codon 762942 762944 . + 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_3 AUGUSTUS CDS 762942 763238 0.81 + 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_3 AUGUSTUS CDS 763429 763821 0.86 + 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_3 AUGUSTUS CDS 764099 764136 0.43 + 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_3 AUGUSTUS CDS 764203 764410 0.43 + 1 transcript_id "g186.t1"; gene_id "g186"; Scaffold_3 AUGUSTUS stop_codon 764408 764410 . + 0 transcript_id "g186.t1"; gene_id "g186"; # protein sequence = [MEISTSREENRVPDQAFGSERTDISEQAKYNLLAQDKGVIKLLTKEPTHDAHRIDYELAKRDCEQPQSNHIDVQSTSI # ETVQFENSWDQINLLTKAEWETRNSDANTVNETASFTPDAKETTSNNFEVHCGIPTVIKNDPGLQNGREALQNLPDAKDGESIHASLHVQYPLSLEQK # TSTEEVQVMQHHSSKILIDSRAKSKKMKASGGEGSVAEKTAEFLVLKDSENQVEKFLHQNLRRSNSSELGTEEPKNSVLKDTLKIENRGHEESPSRST # TLPRNSEFCADLLSLPETVHDANSKDLQASYLHSVIK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g186 ### # start gene g187 Scaffold_3 AUGUSTUS gene 769775 770302 0.98 - . g187 Scaffold_3 AUGUSTUS transcript 769775 770302 0.98 - . g187.t1 Scaffold_3 AUGUSTUS stop_codon 769775 769777 . - 0 transcript_id "g187.t1"; gene_id "g187"; Scaffold_3 AUGUSTUS CDS 769775 770302 0.98 - 0 transcript_id "g187.t1"; gene_id "g187"; Scaffold_3 AUGUSTUS start_codon 770300 770302 . - 0 transcript_id "g187.t1"; gene_id "g187"; # protein sequence = [MLWFPDAFAYVDVGLGAEFTDLLLAWIALERSSQWNTNPQVRLPTSNRPALLARWVDKKRYNTKGNEPLKEECGIDFS # ENVKQWWVSLQPEWRRTACQESSASSDSNSRQQQDWSRIDKFGINGWYGIIVCLKWWGENLQYREGGSAARQEWVDTLKDVCNMMKDLTRYRVAQVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g187 ### # start gene g188 Scaffold_3 AUGUSTUS gene 776166 777047 0.3 + . g188 Scaffold_3 AUGUSTUS transcript 776166 777047 0.3 + . g188.t1 Scaffold_3 AUGUSTUS start_codon 776166 776168 . + 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_3 AUGUSTUS CDS 776166 776424 0.45 + 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_3 AUGUSTUS CDS 776725 777047 0.43 + 2 transcript_id "g188.t1"; gene_id "g188"; Scaffold_3 AUGUSTUS stop_codon 777045 777047 . + 0 transcript_id "g188.t1"; gene_id "g188"; # protein sequence = [MNPEVENSISPSSLEPEDVGAMQQLDRERSSETIRQGESSQAKNDKLEKEKAAVEQEVLKLQLENKELQSSLRVIEAT # NSKKLQVCYDKDTQLRRSDQRLLEIDSALQGYRSLEQEWAISSGTLEEELTAAKQEVGRLKAENGDIQLTLEDMQTSASRVLQVSASRVTDTPSLHRS # VHSSGKIAGTTERTTIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g188 ### # start gene g189 Scaffold_3 AUGUSTUS gene 780191 780616 0.6 + . g189 Scaffold_3 AUGUSTUS transcript 780191 780616 0.6 + . g189.t1 Scaffold_3 AUGUSTUS start_codon 780191 780193 . + 0 transcript_id "g189.t1"; gene_id "g189"; Scaffold_3 AUGUSTUS CDS 780191 780616 0.6 + 0 transcript_id "g189.t1"; gene_id "g189"; Scaffold_3 AUGUSTUS stop_codon 780614 780616 . + 0 transcript_id "g189.t1"; gene_id "g189"; # protein sequence = [MIDFAREHNNQQLENFWTYVLVVVKTFGERGMSDEEDGVEDVLIDGVPTQQDIKKVKKLWFRHETFEALFQQVDETPK # VETRIFTQQGPVSMKRVRSNIIDNRKPPPGYPKGIFRPEYLDSLLEYELENLEFAEGEFEILT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g189 ### # start gene g190 Scaffold_3 AUGUSTUS gene 780751 781083 0.66 + . g190 Scaffold_3 AUGUSTUS transcript 780751 781083 0.66 + . g190.t1 Scaffold_3 AUGUSTUS start_codon 780751 780753 . + 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_3 AUGUSTUS CDS 780751 781083 0.66 + 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_3 AUGUSTUS stop_codon 781081 781083 . + 0 transcript_id "g190.t1"; gene_id "g190"; # protein sequence = [MPRNKGYAQFLSSKFVEGRGVSAPEDLPTINEAALVTPAQSSSNPVSRMLKKEGRKQRTSTAPANRDDLRSSDHSLST # FFDEDAMVDELTVISAPEFGSCLGLIDTTGCA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g190 ### # start gene g191 Scaffold_3 AUGUSTUS gene 782459 783406 0.43 + . g191 Scaffold_3 AUGUSTUS transcript 782459 783406 0.43 + . g191.t1 Scaffold_3 AUGUSTUS start_codon 782459 782461 . + 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_3 AUGUSTUS CDS 782459 783406 0.43 + 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_3 AUGUSTUS stop_codon 783404 783406 . + 0 transcript_id "g191.t1"; gene_id "g191"; # protein sequence = [MDFKAARPFGGFMDVTSHHTCFLCKCWHISHIGRTDFENWRPADIEFLKRGAQEWINAKTVAQRKQVENFYGTRSSEL # WRLPYWNPIMQLLIEPMHTLFSILMQRFARRALGLDNPEPDSNGAVLDDSEQDNPKRKKGKAKKKQIYISFYHDFTPPPHPSDLTPLGTKPEIGRISD # TLQALVDDSEVQDQRLSLLEWNDLTPEQKTARLSRNKQFVSTIQSDPRAFQGVYDLYQLLSSPAPAKDAEKLKFLKKLSSYRWIVLAFVCNNLVEFPA # AKRESEDKKETEANDFLSQSSIHKGDITVKMFGQALAHWVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g191 ### # start gene g192 Scaffold_3 AUGUSTUS gene 798041 799770 0.06 - . g192 Scaffold_3 AUGUSTUS transcript 798041 799770 0.06 - . g192.t1 Scaffold_3 AUGUSTUS stop_codon 798041 798043 . - 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_3 AUGUSTUS CDS 798041 799042 0.85 - 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_3 AUGUSTUS CDS 799316 799521 0.36 - 2 transcript_id "g192.t1"; gene_id "g192"; Scaffold_3 AUGUSTUS CDS 799572 799770 0.14 - 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_3 AUGUSTUS start_codon 799768 799770 . - 0 transcript_id "g192.t1"; gene_id "g192"; # protein sequence = [MVREFPLPEGFGDRGAGSSAKEAGGVPNTFPTASKYANPPTAESECQDSDMSFSFMKCVLDHIRETVLMYIHRSFFAQ # AIIDQPTNPLKSVYAPSFLAAYRASAAILKSVREQFILWPNSCARFWTMWTFAFTAAARLALAAAQSKSPEQPLADGELWNIKKEEIDLNDELSIFAG # HTRLVSATTVTSGTSEIPPAGVQIAGPSGFILTPVASMNGPTTGLRQHRSSSQLRRQYHTDVDMEYDQMYDRHPSQSYQQHHPVTSLRPLHHRASFSS # SYQENDRGPHSTSMNGWYDQRHREDYDMHTQNNHPPTISIPPAPASSSIDERSPHQPMQFNYSYDRSSRTGPSPVATASTYSWSPHSPYPSRHSSSPV # RLSHPQYGPSSSQMPSDTPMHSFHNPPPPTQMYSGPGVTGFGPPIPPHSLPMHPPGNAALADLGLASRDSRLDERWSSFMQDSGLLDEVNFSQGNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g192 ### # start gene g193 Scaffold_3 AUGUSTUS gene 800374 800976 0.98 - . g193 Scaffold_3 AUGUSTUS transcript 800374 800976 0.98 - . g193.t1 Scaffold_3 AUGUSTUS stop_codon 800374 800376 . - 0 transcript_id "g193.t1"; gene_id "g193"; Scaffold_3 AUGUSTUS CDS 800374 800976 0.98 - 0 transcript_id "g193.t1"; gene_id "g193"; Scaffold_3 AUGUSTUS start_codon 800974 800976 . - 0 transcript_id "g193.t1"; gene_id "g193"; # protein sequence = [MVGAIYARKYAKDRGEIVGEGNYDSDEHFVNLSNSRGRQLKHGSEEVPESTSIPGPLPPLGVDYSGPHDLALLFMVFA # LGALLEPIPSNGHSSDSPSGSSPNSNISTGAASRPSPNALGEHYHQLAQAALSLQPVLEKPSIVTIQCLHVMSIYNAMSGEGTANPSSDTDSAGNNLT # GESKTGQSETSMEMTWSLLPWPPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g193 ### # start gene g194 Scaffold_3 AUGUSTUS gene 803984 806157 0.47 - . g194 Scaffold_3 AUGUSTUS transcript 803984 806157 0.47 - . g194.t1 Scaffold_3 AUGUSTUS stop_codon 803984 803986 . - 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_3 AUGUSTUS CDS 803984 804271 0.88 - 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_3 AUGUSTUS CDS 804343 804774 0.62 - 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_3 AUGUSTUS CDS 805993 806157 0.72 - 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_3 AUGUSTUS start_codon 806155 806157 . - 0 transcript_id "g194.t1"; gene_id "g194"; # protein sequence = [MSLPAKPREMSSRSSYEEREGLLAENDRFDPYDDPFDKELTTQPSDEDGWPRSKMQTLAQVDLFAAALHDSLVDRNLT # DIVDIVFVSDHGMTDTSHPTLIYVDDDDMLGEQGLSAVVHEDGWPAMGLRFNSKKNESYYLEKLLTSQHPHAEGFDVYTKHTMPSRWHFAHHDRIAPV # WIVPKIDYALTTRKEGDVGMSKGNHGYDNNEHSMHAMFVAHGPFSAVVKDLHRSSFSAWLPWKNKGWHSTSDDTYVMDSFPNVEVYGLVAKLLGTENY # ASHNMVLKGSGKIFLGHWFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g194 ### # start gene g195 Scaffold_3 AUGUSTUS gene 807140 809823 0.05 + . g195 Scaffold_3 AUGUSTUS transcript 807140 809823 0.05 + . g195.t1 Scaffold_3 AUGUSTUS start_codon 807140 807142 . + 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_3 AUGUSTUS CDS 807140 807161 0.34 + 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_3 AUGUSTUS CDS 807242 807661 0.45 + 2 transcript_id "g195.t1"; gene_id "g195"; Scaffold_3 AUGUSTUS CDS 807730 807985 0.39 + 2 transcript_id "g195.t1"; gene_id "g195"; Scaffold_3 AUGUSTUS CDS 809085 809434 0.65 + 1 transcript_id "g195.t1"; gene_id "g195"; Scaffold_3 AUGUSTUS CDS 809494 809527 0.91 + 2 transcript_id "g195.t1"; gene_id "g195"; Scaffold_3 AUGUSTUS CDS 809586 809823 0.71 + 1 transcript_id "g195.t1"; gene_id "g195"; Scaffold_3 AUGUSTUS stop_codon 809821 809823 . + 0 transcript_id "g195.t1"; gene_id "g195"; # protein sequence = [MPKNDVENQHWQALTDKNNGIIGPDGLVIQYDSIVPKAPDGQLVVVFDSGFTFNQVPRDISDAIYGRVQGAIYDSTNE # WWTIPCGQMLNVSLNFGGVNYPVHPLDTVDDNFGITSSNGTHMCIGSFQPITTAFSLLGNYDMIMGMSFLRNVYAVLNYGDWADDDTDSDPFLQLLST # TNVDAAHNDFVQVRMGGVDTTASSQWALLPASEEVHSPVSEEEKKKEYQEMILSRWPVCKWCVAGSSFVRPILIIITGNIELANLDFGGYIVPEQAYS # AYLQFFQVYANPSVVSASQSSSNPAGQGLIGLGPNSGSNVYAEFNNNTGASVCDRIFIQNTSSPNYITVNLGRTDDPSADFPGNITIGETLDGLGNIT # SEPKLEVTTVSIHDTGDQHFQILIDSDGIIGPDNQSISYTTEVDSTSNSKQATAVLDTGFSLSQVPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g195 ### # start gene g196 Scaffold_3 AUGUSTUS gene 813024 813846 0.59 + . g196 Scaffold_3 AUGUSTUS transcript 813024 813846 0.59 + . g196.t1 Scaffold_3 AUGUSTUS start_codon 813024 813026 . + 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_3 AUGUSTUS CDS 813024 813608 0.61 + 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_3 AUGUSTUS CDS 813667 813846 0.85 + 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_3 AUGUSTUS stop_codon 813844 813846 . + 0 transcript_id "g196.t1"; gene_id "g196"; # protein sequence = [MHTYLIKPEQKAQSVRYKIKLVAANYLPAITVALPHQIEMLGHISAEAAKRSTKAPVDDDKDTRGGLQAGKTYPFHMS # LTNPLYDPIQVRLSVQRMHVAAAVSSGEGGTIDKARRPPFAISIPTTPFSVAPFAEAWEYEDDEEMFGLDDDELEARLSGREKEPKPRSKTVGILEKR # ANVTVVGGEVALGKEARGEFNMLVAYTYRSDDPAPSEGHDISPSKKAALETKTFAFYTVVDLGNIIPKEEARIDPYDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g196 ### # start gene g197 Scaffold_3 AUGUSTUS gene 814949 815962 0.83 + . g197 Scaffold_3 AUGUSTUS transcript 814949 815962 0.83 + . g197.t1 Scaffold_3 AUGUSTUS start_codon 814949 814951 . + 0 transcript_id "g197.t1"; gene_id "g197"; Scaffold_3 AUGUSTUS CDS 814949 815962 0.83 + 0 transcript_id "g197.t1"; gene_id "g197"; Scaffold_3 AUGUSTUS stop_codon 815960 815962 . + 0 transcript_id "g197.t1"; gene_id "g197"; # protein sequence = [MVSITASSSSAPSSSDAISTEEMRPRAGPLPSKRGEIGFREDLEKEETVQGEDSSSSLPERHPADRDSPPTSNPAADA # PAAIPTTFPGSPASTSDDASTSALKKPKTLLSFLKRKKFGGIQLGTLIVFAIQLFITFGTIGAWTVAGLFLSGKAQSRSNDSTMSAASATIFVHVIFA # VAFLSQCLFLERRIYVMRAQRYAFLHPAEILPFSRRGQPVDDSVAFSPWNRPPLPTYAAALAQSGVGTGDVEDHLIAAPPPPAYGNTRGSTLLLSGFL # NANLRAQRPISVRTEISQHHQDRPVSYVSDDEEWEVIQNADRARRLEETLTTLERPGNRNSRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g197 ### # start gene g198 Scaffold_3 AUGUSTUS gene 818294 819286 1 - . g198 Scaffold_3 AUGUSTUS transcript 818294 819286 1 - . g198.t1 Scaffold_3 AUGUSTUS stop_codon 818294 818296 . - 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_3 AUGUSTUS CDS 818294 819286 1 - 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_3 AUGUSTUS start_codon 819284 819286 . - 0 transcript_id "g198.t1"; gene_id "g198"; # protein sequence = [MLDTFISIYPDYRLIPSGSTTGHDILEDVLDIFKFIANLSVDIAPEQTEQNPRPVQYRVDPKRIAVSGSSAGALCAYL # AAMHAAPKPKAVLSLYGLGGNFLIPQYYTPKHSVFFRGREMLNPALFSDFLYPKCLSPSSQVITDSLNTYFPPDAPADVVAIPGLETNTGPPGFPSNR # RMFLGRLYLQLGEFLDYYTGEYEPGLSVALRKKAEDIKLTRSDSDSSSANNLEKILASRIPEKHRSLFPSLCPPDAYASWPPVYFFHGSLDSAVHVQE # SQHLHNLLIKAGIRSILNIAEGMEHSFDYQPDADVIHAEAFNEIGSWLDEILRETS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g198 ### # start gene g199 Scaffold_3 AUGUSTUS gene 831468 834913 0.45 + . g199 Scaffold_3 AUGUSTUS transcript 831468 834913 0.45 + . g199.t1 Scaffold_3 AUGUSTUS start_codon 831468 831470 . + 0 transcript_id "g199.t1"; gene_id "g199"; Scaffold_3 AUGUSTUS CDS 831468 833164 0.6 + 0 transcript_id "g199.t1"; gene_id "g199"; Scaffold_3 AUGUSTUS CDS 833949 834096 0.48 + 1 transcript_id "g199.t1"; gene_id "g199"; Scaffold_3 AUGUSTUS CDS 834212 834913 0.84 + 0 transcript_id "g199.t1"; gene_id "g199"; Scaffold_3 AUGUSTUS stop_codon 834911 834913 . + 0 transcript_id "g199.t1"; gene_id "g199"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDPAVYRVVSLV # TPVDLVVPAVPAVLVVLVDLVDLVPQSLLTSPTSNELCWNSSRGSRVPLRPLVPSSPPRPPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFND # RPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDS # AALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSASGSSAPFTPKPKPFSGG # KPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDRKTNPQLLAC # KDAGMEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRI # TKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYS # DTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFWVLQILSSFYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g199 ### # start gene g200 Scaffold_3 AUGUSTUS gene 835368 836093 0.54 + . g200 Scaffold_3 AUGUSTUS transcript 835368 836093 0.54 + . g200.t1 Scaffold_3 AUGUSTUS start_codon 835368 835370 . + 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_3 AUGUSTUS CDS 835368 836093 0.54 + 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_3 AUGUSTUS stop_codon 836091 836093 . + 0 transcript_id "g200.t1"; gene_id "g200"; # protein sequence = [MVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFWKARFYEPRLSWISKPYTKHH # LALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRN # KPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGLQLSSSSWIDLPNKLYLFQLTTPLLPNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g200 ### # start gene g201 Scaffold_3 AUGUSTUS gene 836248 836880 0.78 + . g201 Scaffold_3 AUGUSTUS transcript 836248 836880 0.78 + . g201.t1 Scaffold_3 AUGUSTUS start_codon 836248 836250 . + 0 transcript_id "g201.t1"; gene_id "g201"; Scaffold_3 AUGUSTUS CDS 836248 836880 0.78 + 0 transcript_id "g201.t1"; gene_id "g201"; Scaffold_3 AUGUSTUS stop_codon 836878 836880 . + 0 transcript_id "g201.t1"; gene_id "g201"; # protein sequence = [MGKLSVSIRLSNSTSGSIVPTNKMTGRLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVN # LDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRLLVLLKNSQKNILVLSRSSVDLVLFLRAQAPDYLRRFTGFPRLTAGAGYAE # SFPNRTQSPPPPIEVDGEEEYNVAEIRLQAGQKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g201 ### # start gene g202 Scaffold_3 AUGUSTUS gene 840781 841436 0.43 - . g202 Scaffold_3 AUGUSTUS transcript 840781 841436 0.43 - . g202.t1 Scaffold_3 AUGUSTUS stop_codon 840781 840783 . - 0 transcript_id "g202.t1"; gene_id "g202"; Scaffold_3 AUGUSTUS CDS 840781 841231 0.73 - 1 transcript_id "g202.t1"; gene_id "g202"; Scaffold_3 AUGUSTUS CDS 841306 841436 0.43 - 0 transcript_id "g202.t1"; gene_id "g202"; Scaffold_3 AUGUSTUS start_codon 841434 841436 . - 0 transcript_id "g202.t1"; gene_id "g202"; # protein sequence = [MKSDLARDFVVNLDELHGFLREEILLAQSRYKEQADRKRISHPEKISWSFQGHQSTCTLSYLRAQAPGLSSPHSPGFP # RLTAEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAKILDSKLDRRYKHCPLRYYIRWAGYEGTDNEFSWVATDELHADELYRRSTPDTLTNLDLDHKKH # LFLSPLSPCSTEVTLCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g202 ### # start gene g203 Scaffold_3 AUGUSTUS gene 845817 846516 0.13 - . g203 Scaffold_3 AUGUSTUS transcript 845817 846516 0.13 - . g203.t1 Scaffold_3 AUGUSTUS stop_codon 845817 845819 . - 0 transcript_id "g203.t1"; gene_id "g203"; Scaffold_3 AUGUSTUS CDS 845817 846010 0.63 - 2 transcript_id "g203.t1"; gene_id "g203"; Scaffold_3 AUGUSTUS CDS 846087 846516 0.13 - 0 transcript_id "g203.t1"; gene_id "g203"; Scaffold_3 AUGUSTUS start_codon 846514 846516 . - 0 transcript_id "g203.t1"; gene_id "g203"; # protein sequence = [MGKQPQRRAASETPCDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGDLVDPVLLSL # LTFPTSNVLCWNSSRDSRVPLKPSVPFSRSRHPLTALNPRARSRSQRYSTVRTPKTQDILRQSRPAKEWFVPDILDPDLDSLPAWTSSFKALVKELQD # NFGVYDAQGEAEDEGNQEHPEIQHPVQHPGC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g203 ### # start gene g204 Scaffold_3 AUGUSTUS gene 851573 852040 0.55 - . g204 Scaffold_3 AUGUSTUS transcript 851573 852040 0.55 - . g204.t1 Scaffold_3 AUGUSTUS stop_codon 851573 851575 . - 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_3 AUGUSTUS CDS 851573 852040 0.55 - 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_3 AUGUSTUS start_codon 852038 852040 . - 0 transcript_id "g204.t1"; gene_id "g204"; # protein sequence = [MSTQPQQPQPQPAQMNSTSPSISNPMSNPSNASASDGVELVRKSGMSSCVCVCVCVRRGIKYEYAVEPGSIVDQSNVD # QSNEVQSTEVRSNEVQVPSTGANTHATTTDPTTTNANPNPEVPFKERVIGVAKKTRGTVCIIFLTTHTRCGTLNAER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g204 ### # start gene g205 Scaffold_3 AUGUSTUS gene 855978 856670 0.77 - . g205 Scaffold_3 AUGUSTUS transcript 855978 856670 0.77 - . g205.t1 Scaffold_3 AUGUSTUS stop_codon 855978 855980 . - 0 transcript_id "g205.t1"; gene_id "g205"; Scaffold_3 AUGUSTUS CDS 855978 856670 0.77 - 0 transcript_id "g205.t1"; gene_id "g205"; Scaffold_3 AUGUSTUS start_codon 856668 856670 . - 0 transcript_id "g205.t1"; gene_id "g205"; # protein sequence = [MSNDNRLPVSDDIIDRILLFSPTFTSLQATILTCKSFYHVFQTHPKSIVRAVASNITGPALPQALECIRHPDIAKCSH # RFRPPTHWGESDEEDEDEEDGGGGGDGSEHSSDDDDDDDDDSARAKRLESVVQETNEQRSRSEENNTRPVGDDTGDIQSAPITIEETYKILANAKVVA # RLEDLFSFRQVNILTWGVVKSTNQPTPPFLLSLDTSTAPSPPANSPQQNRETSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g205 ### # start gene g206 Scaffold_3 AUGUSTUS gene 859604 860891 0.93 + . g206 Scaffold_3 AUGUSTUS transcript 859604 860891 0.93 + . g206.t1 Scaffold_3 AUGUSTUS start_codon 859604 859606 . + 0 transcript_id "g206.t1"; gene_id "g206"; Scaffold_3 AUGUSTUS CDS 859604 860172 0.95 + 0 transcript_id "g206.t1"; gene_id "g206"; Scaffold_3 AUGUSTUS CDS 860228 860373 0.97 + 1 transcript_id "g206.t1"; gene_id "g206"; Scaffold_3 AUGUSTUS CDS 860426 860501 0.96 + 2 transcript_id "g206.t1"; gene_id "g206"; Scaffold_3 AUGUSTUS CDS 860567 860891 0.99 + 1 transcript_id "g206.t1"; gene_id "g206"; Scaffold_3 AUGUSTUS stop_codon 860889 860891 . + 0 transcript_id "g206.t1"; gene_id "g206"; # protein sequence = [MSHHHVVVKSLPFTSALGRTKPVSHFRHIVEHDRSRAQKFMAGLHPHGPNPFVEARKRRHGHHHHATGGSGAATTPSG # DSNSDSIDVTDSAVTYLMDVTIGGQDFSLLIDTGSSNTWCGANTKFKPNSSVESTRESVNVSYGSGSFSGTEYTGPVVLGGSSGLSIPNQSFGVASTA # QGFSDTDGILGRLHGFDSRFDGNLYTIPFLTEVHLGTVSGTSEVPTVTDNLANNGTISTESIGISYNPTTGENIANGELTFGGVDQSKTTSDVTYVDI # TSTSPASNYWGIDQTITYGSSGTTILDSTAGIVDTGTTLLLIATDAFQAYQKATKATLDQTTGLLKLSSSEFSNLQSLFFQIGDVSLSFPFTLPFSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g206 ### # start gene g207 Scaffold_3 AUGUSTUS gene 866359 866712 0.72 - . g207 Scaffold_3 AUGUSTUS transcript 866359 866712 0.72 - . g207.t1 Scaffold_3 AUGUSTUS stop_codon 866359 866361 . - 0 transcript_id "g207.t1"; gene_id "g207"; Scaffold_3 AUGUSTUS CDS 866359 866712 0.72 - 0 transcript_id "g207.t1"; gene_id "g207"; Scaffold_3 AUGUSTUS start_codon 866710 866712 . - 0 transcript_id "g207.t1"; gene_id "g207"; # protein sequence = [MSVAVKKSPLFNDRKSFKRPRPSWAHNAEDERKRKTPVKANGSSPNNYHQSSSDTQKSMKTRKPLPKKQNNALSLGSS # PSVASLKQIALQEQRSKLPIAKGTRIYDVFGYVKFLILR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g207 ### # start gene g208 Scaffold_3 AUGUSTUS gene 869571 870233 0.98 - . g208 Scaffold_3 AUGUSTUS transcript 869571 870233 0.98 - . g208.t1 Scaffold_3 AUGUSTUS stop_codon 869571 869573 . - 0 transcript_id "g208.t1"; gene_id "g208"; Scaffold_3 AUGUSTUS CDS 869571 870233 0.98 - 0 transcript_id "g208.t1"; gene_id "g208"; Scaffold_3 AUGUSTUS start_codon 870231 870233 . - 0 transcript_id "g208.t1"; gene_id "g208"; # protein sequence = [MLLQRAGSGTIPPHGFAIPEWNSLASSWKSIPPLVEDTVTLGPAVVELGHDDAEGEDELKDCKFNVEDREFGWDNEHP # KRHVDVQEFRISWRPITNGQYYDTFKKNKDKFHVPASWVEEDGEIRVKFLHSLVQNWAEMIPKVRTLYGPVPLSVAEDWPIFASYDDLSTYATVKGGR # LPTEPELRLFYDKFQCGFEGGANLGFRNWHPVPYVALMMELSID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g208 ### # start gene g209 Scaffold_3 AUGUSTUS gene 871333 872369 0.56 - . g209 Scaffold_3 AUGUSTUS transcript 871333 872369 0.56 - . g209.t1 Scaffold_3 AUGUSTUS stop_codon 871333 871335 . - 0 transcript_id "g209.t1"; gene_id "g209"; Scaffold_3 AUGUSTUS CDS 871333 871969 0.58 - 1 transcript_id "g209.t1"; gene_id "g209"; Scaffold_3 AUGUSTUS CDS 872080 872369 0.85 - 0 transcript_id "g209.t1"; gene_id "g209"; Scaffold_3 AUGUSTUS start_codon 872367 872369 . - 0 transcript_id "g209.t1"; gene_id "g209"; # protein sequence = [MPAEIVDVQTSENLRAIQLQILDGLQRPAGQKNLPTMLLYDERGLRLYDDITTMAPEYYLFGAEEDILKKHATDIVMA # MHNTTGCIPGETVIELGAGPSRVPPITYYALDLEKRELERTLNAIAISDIGSDLKGKVETKGMWGTYDDGLKYLKSTGLYAPTAIDRPSRLEASMRFD # ARDLSPSSTTSGSDSSGAHVFDVSPPSTPEEVQAPLHIMFLGSSLGNFNRKDGAAFLHSLPLRPGSGDTLLLGLDHANEKDLIEEAYNDPRNHTKKFI # MNGLRGAGRALGNETLFLEDKWDYVNVCFLVIKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g209 ### # start gene g210 Scaffold_3 AUGUSTUS gene 883375 884814 0.25 - . g210 Scaffold_3 AUGUSTUS transcript 883375 884814 0.25 - . g210.t1 Scaffold_3 AUGUSTUS stop_codon 883375 883377 . - 0 transcript_id "g210.t1"; gene_id "g210"; Scaffold_3 AUGUSTUS CDS 883375 884814 0.25 - 0 transcript_id "g210.t1"; gene_id "g210"; Scaffold_3 AUGUSTUS start_codon 884812 884814 . - 0 transcript_id "g210.t1"; gene_id "g210"; # protein sequence = [MSSTRQLALIDSLLGLFIYPRQAEALSHHLEMIRHHMRTVYTISKNRQIIRSGYPSEPILSSTALSVVRRIDYKYKCD # TLAEILSKSDSFLAPDPGQRGEQVAMIILLRAYAATVEEMSSTLAAGQSESFHYGKAVPLLKFLKHLFKTEFHSIFVESRPDNHPEGEIFEQAFKDYT # VRFNHFVRAENSSVMTAEAAFVMYLRCAAVMGSAHNKEFDIMIPAVYSKGNDPLNSKKVTAILVSLKRIPFSGKVITHPIDERVIPFFRPFGRKSAVK # RLRISLTVPYISLAMNLAAPYTQTRNTQENYFIEKGKTRGKGKGEQKKNGSKATERTMIRNHREYISLAEVRAGDSPIRQSSRSALREHPRYCIFAYG # LSVYSNVDVDEYRSLLQVTDFFADHPREQTMKEVYAMKPFWTVGSSFGFVDMNESFLTAGIDDEYRVDGVHAQTDTSNDETDEDEMDEDEAGEDETGE # DERDKDQTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g210 ### # start gene g211 Scaffold_3 AUGUSTUS gene 887938 888444 0.93 + . g211 Scaffold_3 AUGUSTUS transcript 887938 888444 0.93 + . g211.t1 Scaffold_3 AUGUSTUS start_codon 887938 887940 . + 0 transcript_id "g211.t1"; gene_id "g211"; Scaffold_3 AUGUSTUS CDS 887938 888444 0.93 + 0 transcript_id "g211.t1"; gene_id "g211"; Scaffold_3 AUGUSTUS stop_codon 888442 888444 . + 0 transcript_id "g211.t1"; gene_id "g211"; # protein sequence = [MILRVVVLATLGCLTAHAANPDLLRLGPQGVNFWKLDQLHDSQQLPVNGLILQDSSEAPLQLPHEPNNKPEFTAQWFE # QPLDHFGSSTNDTFMQRYWVNKRHYQPGSLVSFFCLTVGKQAGRQGFAEVFCLASADLVLGQNTLFGYWYRRYTCSGDRRIGCRAGTQVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g211 ### # start gene g212 Scaffold_3 AUGUSTUS gene 891752 892861 0.45 + . g212 Scaffold_3 AUGUSTUS transcript 891752 892861 0.45 + . g212.t1 Scaffold_3 AUGUSTUS start_codon 891752 891754 . + 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_3 AUGUSTUS CDS 891752 892318 0.82 + 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_3 AUGUSTUS CDS 892667 892861 0.57 + 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_3 AUGUSTUS stop_codon 892859 892861 . + 0 transcript_id "g212.t1"; gene_id "g212"; # protein sequence = [MTSLDDLASHSPSLQEQKLTADSDDGDTASQRSISLSSPAVSARNSVQVDHPQLRQSESYESSNTSRYNFHDVDDPLS # SDTLSKRESRPYTLDTDFSSDADDMSYASHDMVQHESPNTSASGSILDEPKAPSPMLSPPTYPPRRHSDVESIAESFASGSSKKARPESILLQPPPGK # LVLGIALVDFNHLIAASALLVKTPDVTRSTVQKAVVVLASKPVFGPIKDKLGVVTTALFQQRYTFSDLSLCCHHQQF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g212 ### # start gene g213 Scaffold_3 AUGUSTUS gene 894418 894906 0.71 + . g213 Scaffold_3 AUGUSTUS transcript 894418 894906 0.71 + . g213.t1 Scaffold_3 AUGUSTUS start_codon 894418 894420 . + 0 transcript_id "g213.t1"; gene_id "g213"; Scaffold_3 AUGUSTUS CDS 894418 894906 0.71 + 0 transcript_id "g213.t1"; gene_id "g213"; Scaffold_3 AUGUSTUS stop_codon 894904 894906 . + 0 transcript_id "g213.t1"; gene_id "g213"; # protein sequence = [MQPTLLKHTSIDSIASRSSASTDTSSGSSSPARLTSWGAGIGSFMSSRVGRFSLSKSPSATPAPPPAALPLPTPPIPP # STLIAPDITPVFIEPLTPRRAVTSPQIVDPVDIDRAPMSPIDSLLHTLDAPPHPVRDKEEHSGHVLDDNEDESEEGYSAVAMAM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g213 ### # start gene g214 Scaffold_3 AUGUSTUS gene 895291 898755 0.15 - . g214 Scaffold_3 AUGUSTUS transcript 895291 898755 0.15 - . g214.t1 Scaffold_3 AUGUSTUS stop_codon 895291 895293 . - 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_3 AUGUSTUS CDS 895291 896602 0.99 - 1 transcript_id "g214.t1"; gene_id "g214"; Scaffold_3 AUGUSTUS CDS 896721 897112 0.84 - 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_3 AUGUSTUS CDS 898020 898496 0.29 - 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_3 AUGUSTUS CDS 898576 898755 1 - 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_3 AUGUSTUS start_codon 898753 898755 . - 0 transcript_id "g214.t1"; gene_id "g214"; # protein sequence = [MPRPGQPPPSTLRNRNRITNKTRLKIIHGDIDVDQIIPDEDEEKNRLLQSVAGVDQEDANEHHLQAVLSQAASQAASG # KATKDNEQLAAFIPIPEHSGFAENYTSLYPADRWKDPVSYIQSSSVIDEYTAAALADGCTYYMDERDKEWLDRNNEEARGEGTSAQGSVLTSSGRVSG # RSAKGKGKEYEDAQPSLMSEDEFELVMGLFEKITQEKTEFLHHIGYVQPTITPYGSRLFKYISAPSELGQPSTDADAAAGLVPKRSIRLRYGRGGRTF # IDRRPHSSQGNFKRCRRIMTSDDDEDAMEVDDVESHEEADRRLSERWRFDADDGPPYGPNGAEEQDRVLVDDFDSNIPVIKDGKRESYTPYRLGMTPP # MMPIAPRTSSQPQVPVQGVTPVSQQVHAHQSVPISQQLKLPSSVSTQQARASGSNQPTVSQPPTALSTVQSSASRPSAVIPSPQVIHNGRPAMNMPRV # DMMKLAFNHSLPSALQSKIEPISQSDVGNHTKSQPDEQHQLVRSKSQQQQVAQSSQPDQSQVQISTTTAVNGLHPTYAALANANPSAYNISHYMPHYP # ANPVSSGLNNQQLQHLKSVFNSANAGGSQNYNSALFTQMQMPKNSSAVANGTSGTPAVNGSSNIHNFTAPPVRPMQRVQSGSTVNGSSSSPPRPASTV # NGIQHDPSASPSPRMMHALVPGEHIPARTSSANGSRTGFRPPSNGMQNGAQIVYGPNSIQQQQMLQMHSQSPPQPVYNSPQAYSLSPSPPKMQPVSMP # NAGSPLLQQQQQQVVGNSQGVY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g214 ### # start gene g215 Scaffold_3 AUGUSTUS gene 907800 908291 0.84 + . g215 Scaffold_3 AUGUSTUS transcript 907800 908291 0.84 + . g215.t1 Scaffold_3 AUGUSTUS start_codon 907800 907802 . + 0 transcript_id "g215.t1"; gene_id "g215"; Scaffold_3 AUGUSTUS CDS 907800 908291 0.84 + 0 transcript_id "g215.t1"; gene_id "g215"; Scaffold_3 AUGUSTUS stop_codon 908289 908291 . + 0 transcript_id "g215.t1"; gene_id "g215"; # protein sequence = [MVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCKFIRVSG # SELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRGESGSGGGDSEVQRTMLELLNQLDGFESTKNIKVIMATNRIGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g215 ### # start gene g216 Scaffold_3 AUGUSTUS gene 910904 911263 0.79 + . g216 Scaffold_3 AUGUSTUS transcript 910904 911263 0.79 + . g216.t1 Scaffold_3 AUGUSTUS start_codon 910904 910906 . + 0 transcript_id "g216.t1"; gene_id "g216"; Scaffold_3 AUGUSTUS CDS 910904 911263 0.79 + 0 transcript_id "g216.t1"; gene_id "g216"; Scaffold_3 AUGUSTUS stop_codon 911261 911263 . + 0 transcript_id "g216.t1"; gene_id "g216"; # protein sequence = [MTKNAKVNQRKSVDCQKTAVVQEDTCPANHSGKQAERRGESAEDEFSAIAHAYNVSLLDNVEPGNEAEYQGDQVYIEK # TVLDKKSVILNAFQRSFGCFVDVPLKLLRPDRHNLEMFTPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g216 ### # start gene g217 Scaffold_3 AUGUSTUS gene 912931 913344 0.72 + . g217 Scaffold_3 AUGUSTUS transcript 912931 913344 0.72 + . g217.t1 Scaffold_3 AUGUSTUS start_codon 912931 912933 . + 0 transcript_id "g217.t1"; gene_id "g217"; Scaffold_3 AUGUSTUS CDS 912931 913344 0.72 + 0 transcript_id "g217.t1"; gene_id "g217"; Scaffold_3 AUGUSTUS stop_codon 913342 913344 . + 0 transcript_id "g217.t1"; gene_id "g217"; # protein sequence = [MTTAPSGSNSTDYFSSQDSDFLEALAQAILPGDIGYDSQLNSPELRRNEEVDEIREFSPPPPNQQALKVPLKRKLEDE # AHQHDKDTQNEEIYGAARFGDFGQYMRRKRAKLQIQNKDIAGKAGIFHGISIYVSIAGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g217 ### # start gene g218 Scaffold_3 AUGUSTUS gene 913794 914327 0.44 + . g218 Scaffold_3 AUGUSTUS transcript 913794 914327 0.44 + . g218.t1 Scaffold_3 AUGUSTUS start_codon 913794 913796 . + 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_3 AUGUSTUS CDS 913794 914327 0.44 + 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_3 AUGUSTUS stop_codon 914325 914327 . + 0 transcript_id "g218.t1"; gene_id "g218"; # protein sequence = [MRNSDWRAAHTSIAPDFIDGFYKNSRLHHLSSWKAELKELLREAQERAESGQEEQYSKNAEEAGIAPQVIGQGLSMRG # AGIVLQSPTKNKAKPVETRSNDVKGKSRAVEPSEEQRVIMHCDFDCFFVAAGLTKRPDLKGKPVVVCHSQGKQGGDASTSEIASSSYEAREFGIKNGM # R] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g218 ### # start gene g219 Scaffold_3 AUGUSTUS gene 915419 916180 0.51 + . g219 Scaffold_3 AUGUSTUS transcript 915419 916180 0.51 + . g219.t1 Scaffold_3 AUGUSTUS start_codon 915419 915421 . + 0 transcript_id "g219.t1"; gene_id "g219"; Scaffold_3 AUGUSTUS CDS 915419 916180 0.51 + 0 transcript_id "g219.t1"; gene_id "g219"; Scaffold_3 AUGUSTUS stop_codon 916178 916180 . + 0 transcript_id "g219.t1"; gene_id "g219"; # protein sequence = [MSLSEPGGRPIATGDEKIIADHAWRLLKTLNFDPKELRGLGIQIQKLESKDASNVNSHYSDNKGQGMFPFLKNKVGGD # DTTNSNSRSAHPVETTGLDVSRRDEPNDLPSFSQVDLSIFDALPQEIKQELESEYKRRSISPFVYAPPDPAPDQPAGKIVPFALGAARREKPPTIPLF # PRKASGGPDVRRITAQLDPRRSSLSPRKPKYNRYTKLPGLASWKVPASELLKLDIDPDVFAVLPKNVQREQITAAVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g219 ### # start gene g220 Scaffold_3 AUGUSTUS gene 917690 918322 0.64 - . g220 Scaffold_3 AUGUSTUS transcript 917690 918322 0.64 - . g220.t1 Scaffold_3 AUGUSTUS stop_codon 917690 917692 . - 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_3 AUGUSTUS CDS 917690 918322 0.64 - 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_3 AUGUSTUS start_codon 918320 918322 . - 0 transcript_id "g220.t1"; gene_id "g220"; # protein sequence = [MQIDKTTQALFLPDDDEDENENESSIIVDTSDDLFIASARSIRKTSSSSTLSVSTRITTPPASSLILDVNDKTSEMID # LTLDENNYSLLSSDDNHLQTQNEPIHRPEVIRTEASQSSVGDVKLRLDVPKLAERWATLHPNLHGEKSKRELVNKLGKTSSSSLSDDAGVSATDTQTS # EAALSRVISKDFEMESSLVSLLCEDGRNLGQNKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g220 ### # start gene g221 Scaffold_3 AUGUSTUS gene 918434 919186 0.98 - . g221 Scaffold_3 AUGUSTUS transcript 918434 919186 0.98 - . g221.t1 Scaffold_3 AUGUSTUS stop_codon 918434 918436 . - 0 transcript_id "g221.t1"; gene_id "g221"; Scaffold_3 AUGUSTUS CDS 918434 919186 0.98 - 0 transcript_id "g221.t1"; gene_id "g221"; Scaffold_3 AUGUSTUS start_codon 919184 919186 . - 0 transcript_id "g221.t1"; gene_id "g221"; # protein sequence = [MLPFTKSANVQGSVNTQASQAHDIGGAKDDGTVDPGATTSLLSYGDVDCRLADTRPEEYTFHGTSADVAEESLGIDDP # QISLIPSVSHEPKTIEVNPPEQPSPHSKETPVPPRTVVINTTGASWNRPKNSFGEPVNLSMQSPRIPGLAGTPNKSVYPILAQHTKNQMEPPLKKRKS # EVANEDDTDEEISGEDNRKDKDIRRNPLRVGIVSTPRLWYRRHRRPNSPTTLPERPIGKKCDLKSLDLRGVAVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g221 ### # start gene g222 Scaffold_3 AUGUSTUS gene 921420 922294 0.87 - . g222 Scaffold_3 AUGUSTUS transcript 921420 922294 0.87 - . g222.t1 Scaffold_3 AUGUSTUS stop_codon 921420 921422 . - 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_3 AUGUSTUS CDS 921420 921835 0.98 - 2 transcript_id "g222.t1"; gene_id "g222"; Scaffold_3 AUGUSTUS CDS 921907 922294 0.87 - 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_3 AUGUSTUS start_codon 922292 922294 . - 0 transcript_id "g222.t1"; gene_id "g222"; # protein sequence = [MRNRPIGIGVQGLADAFMALKMPFDSPEAKELNTKIFETIYHGACEASCEMAKTDGPYETWMGSPAQQGQLQFDLWGV # TPTDLWDWNTLKESISKYGMRNSLLTAPMPTASTSQMLGFNECFEPYTRLVCEFQVVCPWLLRDLVDLGLWDDAMKNMLIAHHGSVQNIPAIPDNIKS # IYKTVWEISQKKVLDLAADRGAFICQSQSLNVHLASPTMGQLTSMHFYGWKKGLKTGMYYLRTKPAAQAIQFTVDAAGVKRRQNAPGQSCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g222 ### # start gene g223 Scaffold_3 AUGUSTUS gene 931723 932148 0.76 - . g223 Scaffold_3 AUGUSTUS transcript 931723 932148 0.76 - . g223.t1 Scaffold_3 AUGUSTUS stop_codon 931723 931725 . - 0 transcript_id "g223.t1"; gene_id "g223"; Scaffold_3 AUGUSTUS CDS 931723 932148 0.76 - 0 transcript_id "g223.t1"; gene_id "g223"; Scaffold_3 AUGUSTUS start_codon 932146 932148 . - 0 transcript_id "g223.t1"; gene_id "g223"; # protein sequence = [MVLACKHDHSVLAFEYVFSEDPTRMYPHAKFLLAEAYFSLTTQDKIMARQFGLNEFAARSVQKNIVLSPNVKRTVLIT # GCSAGGIGHALAKEFHSRGTPGSSELVYERSGALVFHLQGYVSLPQPETLNRWWNWRDLGLPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g223 ### # start gene g224 Scaffold_3 AUGUSTUS gene 943632 945550 0.36 + . g224 Scaffold_3 AUGUSTUS transcript 943632 945550 0.36 + . g224.t1 Scaffold_3 AUGUSTUS start_codon 943632 943634 . + 0 transcript_id "g224.t1"; gene_id "g224"; Scaffold_3 AUGUSTUS CDS 943632 945102 0.58 + 0 transcript_id "g224.t1"; gene_id "g224"; Scaffold_3 AUGUSTUS CDS 945174 945550 0.51 + 2 transcript_id "g224.t1"; gene_id "g224"; Scaffold_3 AUGUSTUS stop_codon 945548 945550 . + 0 transcript_id "g224.t1"; gene_id "g224"; # protein sequence = [MKRVEAASGAKYSYQQNTHSFSSSSGSAAPAVQQKPQQIPKIAPNVGSGYKPVGKVDMAALRNQQPPALPTTKRPVPQ # QTQTAGSLYGSARQSAPEDAWPEEQVQQQRGQPPPPLPATSRPTTTTTTTTRSGFGSMSLGGGAAAPTSRLSPPPSSAPPPSSISSTVPTKPTAQDDL # IAPVGTAYTPVSLPKPGKLRNPFEKMAAAGQESTTTPARATGGGGGGAGKLTWSQRQAMAKKEQQQAEEDTPPPPPAPAAASRPAAAVSSFTRPIPAA # TRAPISPAPTSSPASAAASNVPRTFGAMKLGGGGASAIRQPSPVLAQDEEEEEETWEAPPAPVSRSVPPPPAPGPPAVPVTARPAQPPASGGPPPPPP # PPPPPPALPAAAGGPPPPPPPPPPPPVVSGGPPPPPPPPPPPPMASVVPHVPEPEPEPEPEYTPEDTEPQTQTHPTPIHGHGICAAVLYSYEATEDNE # LSLNEGEMVQGIEELDEGWWKCGTGGGGGAPPPPPPPPPPPPPPPPPPPPPPPVAPAAPPAPIPPPRSPSPTPAPTSHEPETETETDGYTAIALYDYE # AAEDNELTFKEGDVIVGIEAVSDEWWSGRVEGGTEVGLFPANYVETR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g224 ### # start gene g225 Scaffold_3 AUGUSTUS gene 946438 947954 0.27 - . g225 Scaffold_3 AUGUSTUS transcript 946438 947954 0.27 - . g225.t1 Scaffold_3 AUGUSTUS stop_codon 946438 946440 . - 0 transcript_id "g225.t1"; gene_id "g225"; Scaffold_3 AUGUSTUS CDS 946438 947135 0.28 - 2 transcript_id "g225.t1"; gene_id "g225"; Scaffold_3 AUGUSTUS CDS 947231 947954 0.27 - 0 transcript_id "g225.t1"; gene_id "g225"; Scaffold_3 AUGUSTUS start_codon 947952 947954 . - 0 transcript_id "g225.t1"; gene_id "g225"; # protein sequence = [MPQVWLECPYRIPLLFVPAGYIIYLSKALIWLSKWIIARLQDIIQTCRGKQPSYDPWTNSKKKNSFPALLQASLKDVE # LVHLKNEDSHRSILEDILVWLLSLESNQSIQEILDQPIVRFLLCNWRSEYSKLENHADRAARAIWATLSKLPKSDLPKPNIEFPFHSPAFLSSKVGDS # FMKGTTDHWNHLVSNNKSEIISKYFKCSKSKYLKELGITNKWKDDALLKAASNKDFEMTKVLVENENNADVNAQGGQYGNALQAAAFQGNLDVIKLLV # ENNADVNAQGGKYGNVLQAAAFQGNLDAVKFLVENNAEVNAQGGLFGNALQAAAWRGELDIVKYLVEQCAEVNAQGGLFGNALQAAAWRGKLDMVKFF # VVKNADVNAQGEQYGNTLQAAAAGYKDSPDMIKFLVEHNAQGGCYGNTLQAAAYWGKLDIVKYLVEHGADVMAQGIHGTALQAAECGTYDEIAKFLER # CTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g225 ### # start gene g226 Scaffold_3 AUGUSTUS gene 953447 955740 0.6 + . g226 Scaffold_3 AUGUSTUS transcript 953447 955740 0.6 + . g226.t1 Scaffold_3 AUGUSTUS start_codon 953447 953449 . + 0 transcript_id "g226.t1"; gene_id "g226"; Scaffold_3 AUGUSTUS CDS 953447 953726 0.82 + 0 transcript_id "g226.t1"; gene_id "g226"; Scaffold_3 AUGUSTUS CDS 953780 953946 0.72 + 2 transcript_id "g226.t1"; gene_id "g226"; Scaffold_3 AUGUSTUS CDS 953995 955740 1 + 0 transcript_id "g226.t1"; gene_id "g226"; Scaffold_3 AUGUSTUS stop_codon 955738 955740 . + 0 transcript_id "g226.t1"; gene_id "g226"; # protein sequence = [MKLVQVKKYPFILSANKCNANSAPAPVPSTISSHLEPEHSRPSDNPIPPSTDTAVQGDVDIPAQKQASSQVNINKEET # APPLLGISSYQSPYTGGRTFNYKEKYPDDEPLGDELNDNSRVFKVYLDEAENFDDDLMRGFRETIDSLLVFAALFSGVVTSFVIATISALQPDYSQIT # AVLLVEQVQILRAAGNITAINAIPKSSVDLQNASVATDDLWINGLFLASLSLALVTALLSVLVKQWLQAYSSILAGSAQQKALIRQFRYNGFVKWKVP # EIVGILPLILHTSLALFLIGLSLYILGLHSSLSWIVVTVTSLTFTFYLGSLLMPQVWLECPYRIPLLFVPAEYIIYPSKVLLWSFRWIIVKFQDVTQT # AKKRNDSPEHWGLNSNSKKKDSFPSILQASLKNTELEHLTKEDKKKSIMEDILVWLLSLESNQSIQEILDQPIYGFLRYLEHYKYSKLENYADRVAKA # FWTTLPKFKRHNSQKLNSQVPLVLHEFIFSYEARELLKKGTVAHWNYLMSNWKLDIISKYFKYSKSRLTEMDFEKLGITQEWKDNALLEAVSDFYWEL # VKVLVENGANANAQGGKYETILQAAAFNGNLDAVRFLVENNAEVNARGWFFGNALQVAAYGANVNMVKFLVENNADVNAQGGLFGNALHVAVSRADVN # MVKFLIENNADVNAQEGPYGNALQAAAFGGNVDIVKFLVQNNANVNAQGGQYGNALQAAAYGEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g226 ### # start gene g227 Scaffold_3 AUGUSTUS gene 959677 960093 0.48 - . g227 Scaffold_3 AUGUSTUS transcript 959677 960093 0.48 - . g227.t1 Scaffold_3 AUGUSTUS stop_codon 959677 959679 . - 0 transcript_id "g227.t1"; gene_id "g227"; Scaffold_3 AUGUSTUS CDS 959677 960093 0.48 - 0 transcript_id "g227.t1"; gene_id "g227"; Scaffold_3 AUGUSTUS start_codon 960091 960093 . - 0 transcript_id "g227.t1"; gene_id "g227"; # protein sequence = [MGETEVEIVETGETRESFGKEEGGREWKSMSMVLAEGGEVDPAQGPNANANAPENAEKSKGSERQRSNTLDRPLPITT # ASGTDVSHHPSASTSQPPTSISMMPAIPEPWGPSSHISNSNANAIPSIADDASVLPAPRM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g227 ### # start gene g228 Scaffold_3 AUGUSTUS gene 960854 962644 0.69 - . g228 Scaffold_3 AUGUSTUS transcript 960854 962644 0.69 - . g228.t1 Scaffold_3 AUGUSTUS stop_codon 960854 960856 . - 0 transcript_id "g228.t1"; gene_id "g228"; Scaffold_3 AUGUSTUS CDS 960854 961680 0.94 - 2 transcript_id "g228.t1"; gene_id "g228"; Scaffold_3 AUGUSTUS CDS 961841 962397 0.78 - 1 transcript_id "g228.t1"; gene_id "g228"; Scaffold_3 AUGUSTUS CDS 962495 962528 0.75 - 2 transcript_id "g228.t1"; gene_id "g228"; Scaffold_3 AUGUSTUS CDS 962641 962644 0.84 - 0 transcript_id "g228.t1"; gene_id "g228"; Scaffold_3 AUGUSTUS start_codon 962642 962644 . - 0 transcript_id "g228.t1"; gene_id "g228"; # protein sequence = [MNPFERNSTLSGLSAYSPTGSRRFGSPRPRTSSAATAASSPKRSSSLRSATKPTRAQSPSSFTPPSNTRSGSTRVRSP # QPQPSSSSSSSQYQPTSPSPSNRVRSPIPIGSRLAPREREIRDAWEREIKEREAREVKEREKIAKEKEKFQPPYVHRSLQTKKKSLELPDLALTQVTT # PTPSSASAAAQAIPIPERQPGAEAKAAQATQAKLVLAESDSEEINNSNAVAQSPSLLIPPISPPAHRVNPQPSEGEPTYLVKISWHGGGKEVFLTRAG # DDDWNGRKTMEKEVEEEEGSEENSEKQTHESIIAGKGPTQVCHSGTTFSTIIALPRGTHHLRFLVDGQARVADDLPTAVDDNGSLANYVAVGLGSVGD # AAAGDAAGDIASGDSPTTLVVAEGVDGAEVVAVAVDDVDVVVAQPEKTPRPGDDHISEFVVPDIHPHPTRVDSHSSFWSENEYTESHPRRCRLPLRRL # YLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g228 ### # start gene g229 Scaffold_3 AUGUSTUS gene 964223 964909 0.87 + . g229 Scaffold_3 AUGUSTUS transcript 964223 964909 0.87 + . g229.t1 Scaffold_3 AUGUSTUS start_codon 964223 964225 . + 0 transcript_id "g229.t1"; gene_id "g229"; Scaffold_3 AUGUSTUS CDS 964223 964909 0.87 + 0 transcript_id "g229.t1"; gene_id "g229"; Scaffold_3 AUGUSTUS stop_codon 964907 964909 . + 0 transcript_id "g229.t1"; gene_id "g229"; # protein sequence = [MEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKSQAKLIKSALGFFTESAGDWATPHLLHFNAEHPP # FGGNWEEFLKEFGQRFESVDPGMEARSEIKNLKQSKGQTVAEFAQKFKDIGDRTGMSDIDLRERFFTALLPEIRQNLIIVNIAQGLAPTLKEAIKRAI # SVDVYMHDPTMTGRNSGHTPTHAAHTTPADPHAMDIDATQPTLVMGILGRHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g229 ### # start gene g230 Scaffold_3 AUGUSTUS gene 973711 974358 0.94 + . g230 Scaffold_3 AUGUSTUS transcript 973711 974358 0.94 + . g230.t1 Scaffold_3 AUGUSTUS start_codon 973711 973713 . + 0 transcript_id "g230.t1"; gene_id "g230"; Scaffold_3 AUGUSTUS CDS 973711 973879 0.95 + 0 transcript_id "g230.t1"; gene_id "g230"; Scaffold_3 AUGUSTUS CDS 973961 974358 0.99 + 2 transcript_id "g230.t1"; gene_id "g230"; Scaffold_3 AUGUSTUS stop_codon 974356 974358 . + 0 transcript_id "g230.t1"; gene_id "g230"; # protein sequence = [MFCIHDSFYVVESSQHSYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTP # PAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSVSDASFATAQSIPTTGSEDTVVTPTEMLFQSLRPSN # ELLLHSLVVLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g230 ### # start gene g231 Scaffold_3 AUGUSTUS gene 974941 977094 0.93 - . g231 Scaffold_3 AUGUSTUS transcript 974941 977094 0.93 - . g231.t1 Scaffold_3 AUGUSTUS stop_codon 974941 974943 . - 0 transcript_id "g231.t1"; gene_id "g231"; Scaffold_3 AUGUSTUS CDS 974941 977094 0.93 - 0 transcript_id "g231.t1"; gene_id "g231"; Scaffold_3 AUGUSTUS start_codon 977092 977094 . - 0 transcript_id "g231.t1"; gene_id "g231"; # protein sequence = [MPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNHKMKSLGEMSKDERIKFIRLKK # FQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQK # VHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIE # RAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRR # RVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKNDLWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g231 ### # start gene g232 Scaffold_3 AUGUSTUS gene 977208 977794 0.45 - . g232 Scaffold_3 AUGUSTUS transcript 977208 977794 0.45 - . g232.t1 Scaffold_3 AUGUSTUS stop_codon 977208 977210 . - 0 transcript_id "g232.t1"; gene_id "g232"; Scaffold_3 AUGUSTUS CDS 977208 977707 0.52 - 2 transcript_id "g232.t1"; gene_id "g232"; Scaffold_3 AUGUSTUS CDS 977788 977794 0.45 - 0 transcript_id "g232.t1"; gene_id "g232"; Scaffold_3 AUGUSTUS start_codon 977792 977794 . - 0 transcript_id "g232.t1"; gene_id "g232"; # protein sequence = [MNRIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELD # QLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKDHQLDMNYQKEVTKLFQKILELDDLFGNISKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g232 ### # start gene g233 Scaffold_3 AUGUSTUS gene 978096 980403 0.52 - . g233 Scaffold_3 AUGUSTUS transcript 978096 980403 0.52 - . g233.t1 Scaffold_3 AUGUSTUS stop_codon 978096 978098 . - 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_3 AUGUSTUS CDS 978096 978564 1 - 1 transcript_id "g233.t1"; gene_id "g233"; Scaffold_3 AUGUSTUS CDS 978657 978897 0.54 - 2 transcript_id "g233.t1"; gene_id "g233"; Scaffold_3 AUGUSTUS CDS 978972 980403 0.95 - 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_3 AUGUSTUS start_codon 980401 980403 . - 0 transcript_id "g233.t1"; gene_id "g233"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSES # TETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVLTEPPTNKLEERIK # LNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVEKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g233 ### # start gene g234 Scaffold_3 AUGUSTUS gene 980433 981829 0.57 - . g234 Scaffold_3 AUGUSTUS transcript 980433 981829 0.57 - . g234.t1 Scaffold_3 AUGUSTUS stop_codon 980433 980435 . - 0 transcript_id "g234.t1"; gene_id "g234"; Scaffold_3 AUGUSTUS CDS 980433 981117 0.58 - 1 transcript_id "g234.t1"; gene_id "g234"; Scaffold_3 AUGUSTUS CDS 981216 981829 0.57 - 0 transcript_id "g234.t1"; gene_id "g234"; Scaffold_3 AUGUSTUS start_codon 981827 981829 . - 0 transcript_id "g234.t1"; gene_id "g234"; # protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPKFDPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIP # PSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESY # FANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g234 ### # start gene g235 Scaffold_3 AUGUSTUS gene 988634 989584 0.79 + . g235 Scaffold_3 AUGUSTUS transcript 988634 989584 0.79 + . g235.t1 Scaffold_3 AUGUSTUS start_codon 988634 988636 . + 0 transcript_id "g235.t1"; gene_id "g235"; Scaffold_3 AUGUSTUS CDS 988634 989584 0.79 + 0 transcript_id "g235.t1"; gene_id "g235"; Scaffold_3 AUGUSTUS stop_codon 989582 989584 . + 0 transcript_id "g235.t1"; gene_id "g235"; # protein sequence = [MALKPVASWLSSRIGRPEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMD # PGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPP # THTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGP # APFSLFPNESVQIASSTPTSASAPVAATPSPPNQDFSNQIGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g235 ### # start gene g236 Scaffold_3 AUGUSTUS gene 989700 990776 0.91 + . g236 Scaffold_3 AUGUSTUS transcript 989700 990776 0.91 + . g236.t1 Scaffold_3 AUGUSTUS start_codon 989700 989702 . + 0 transcript_id "g236.t1"; gene_id "g236"; Scaffold_3 AUGUSTUS CDS 989700 990776 0.91 + 0 transcript_id "g236.t1"; gene_id "g236"; Scaffold_3 AUGUSTUS stop_codon 990774 990776 . + 0 transcript_id "g236.t1"; gene_id "g236"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVRRRMGNSVSYKTTGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g236 ### # start gene g237 Scaffold_3 AUGUSTUS gene 1003739 1004962 0.96 - . g237 Scaffold_3 AUGUSTUS transcript 1003739 1004962 0.96 - . g237.t1 Scaffold_3 AUGUSTUS stop_codon 1003739 1003741 . - 0 transcript_id "g237.t1"; gene_id "g237"; Scaffold_3 AUGUSTUS CDS 1003739 1004962 0.96 - 0 transcript_id "g237.t1"; gene_id "g237"; Scaffold_3 AUGUSTUS start_codon 1004960 1004962 . - 0 transcript_id "g237.t1"; gene_id "g237"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEI # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGDRSETRGEYFPSSLIPMEGRRNSVAKQGYVYC # TEPLTTDQEPYGLNLPLRGLTYRTTRRSKYFGTQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g237 ### # start gene g238 Scaffold_3 AUGUSTUS gene 1006793 1007619 0.42 - . g238 Scaffold_3 AUGUSTUS transcript 1006793 1007619 0.42 - . g238.t1 Scaffold_3 AUGUSTUS stop_codon 1006793 1006795 . - 0 transcript_id "g238.t1"; gene_id "g238"; Scaffold_3 AUGUSTUS CDS 1006793 1007270 0.45 - 1 transcript_id "g238.t1"; gene_id "g238"; Scaffold_3 AUGUSTUS CDS 1007363 1007619 0.49 - 0 transcript_id "g238.t1"; gene_id "g238"; Scaffold_3 AUGUSTUS start_codon 1007617 1007619 . - 0 transcript_id "g238.t1"; gene_id "g238"; # protein sequence = [MNFSLKANISSPRNEEETRRLALKLRAKKNNEIPSASSSSSSVPNMLPLVSPTSGYPPPAPLSSRQVPLPSKVPIAEV # IAREQHIRKLLKIKHGHFVYLGQGGDSFNVDSQLNERATSINHSQILRLPEDIRTGNDVGDFDYNGNMGRGSTASSGGSHYYGSQPGPVVGFGSGNAN # LDGYGGGHGRNYGAYSGDYNRGYENSYGQGGRSDKVDDGGYIAGHNIEEVFLVYKAMEKVIGSRWGRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g238 ### # start gene g239 Scaffold_3 AUGUSTUS gene 1011720 1012166 1 + . g239 Scaffold_3 AUGUSTUS transcript 1011720 1012166 1 + . g239.t1 Scaffold_3 AUGUSTUS start_codon 1011720 1011722 . + 0 transcript_id "g239.t1"; gene_id "g239"; Scaffold_3 AUGUSTUS CDS 1011720 1012166 1 + 0 transcript_id "g239.t1"; gene_id "g239"; Scaffold_3 AUGUSTUS stop_codon 1012164 1012166 . + 0 transcript_id "g239.t1"; gene_id "g239"; # protein sequence = [MANPIADPNVDANANPKVKPGPNVSLARVDANGKANANVDANPNPNVDPSANPNADPNVDANANANPKVKPGPNVSLR # VDVDARVDANVDANPNPNVDANANPNVDANANLNVDANVNPNPNVDAKANPNVDGNANLNADMTHFYLSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g239 ### # start gene g240 Scaffold_3 AUGUSTUS gene 1013862 1014293 1 + . g240 Scaffold_3 AUGUSTUS transcript 1013862 1014293 1 + . g240.t1 Scaffold_3 AUGUSTUS start_codon 1013862 1013864 . + 0 transcript_id "g240.t1"; gene_id "g240"; Scaffold_3 AUGUSTUS CDS 1013862 1014293 1 + 0 transcript_id "g240.t1"; gene_id "g240"; Scaffold_3 AUGUSTUS stop_codon 1014291 1014293 . + 0 transcript_id "g240.t1"; gene_id "g240"; # protein sequence = [MGKKRLVKRLPDFPLPPLLPQPPPLPLPPQQPPLAPKPLSLPPQPPPQLLPPPLPQPPSPPPQPPLLPPPPPKPPPQL # QPPPPPPLPSSPSIDYLYTRMRDADIKLTSPSKAKLHNDRFSVSEYGGELLEGRVEEPGYAGGRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g240 ### # start gene g241 Scaffold_3 AUGUSTUS gene 1015008 1018610 0.55 - . g241 Scaffold_3 AUGUSTUS transcript 1015008 1018610 0.55 - . g241.t1 Scaffold_3 AUGUSTUS stop_codon 1015008 1015010 . - 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_3 AUGUSTUS CDS 1015008 1018610 0.55 - 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_3 AUGUSTUS start_codon 1018608 1018610 . - 0 transcript_id "g241.t1"; gene_id "g241"; # protein sequence = [MVDCGATALFLNQDFVTRNHVRCAPLHKPIDVFNIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGL # PWLWKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPELEPPAENPHIEVPLEATLEPSESATVEEPPIHRIRANHKTRRAWV # KAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRF # LEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLF # EPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVK # VAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTQQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALM # QKQDDGQWHPVAFRSASMQPAERNYEIFDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNT # QADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDD # LRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTD # LYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDW # AEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREVRQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAED # INLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVK # WKGYDAGHNSWEPQPTSVEHQKLFGPFIKNTQRRQNLDHRGQWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g241 ### # start gene g242 Scaffold_3 AUGUSTUS gene 1018797 1019963 0.91 - . g242 Scaffold_3 AUGUSTUS transcript 1018797 1019963 0.91 - . g242.t1 Scaffold_3 AUGUSTUS stop_codon 1018797 1018799 . - 0 transcript_id "g242.t1"; gene_id "g242"; Scaffold_3 AUGUSTUS CDS 1018797 1019963 0.91 - 0 transcript_id "g242.t1"; gene_id "g242"; Scaffold_3 AUGUSTUS start_codon 1019961 1019963 . - 0 transcript_id "g242.t1"; gene_id "g242"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g242 ### # start gene g243 Scaffold_3 AUGUSTUS gene 1021146 1022121 0.75 + . g243 Scaffold_3 AUGUSTUS transcript 1021146 1022121 0.75 + . g243.t1 Scaffold_3 AUGUSTUS start_codon 1021146 1021148 . + 0 transcript_id "g243.t1"; gene_id "g243"; Scaffold_3 AUGUSTUS CDS 1021146 1021341 0.75 + 0 transcript_id "g243.t1"; gene_id "g243"; Scaffold_3 AUGUSTUS CDS 1021742 1022121 0.95 + 2 transcript_id "g243.t1"; gene_id "g243"; Scaffold_3 AUGUSTUS stop_codon 1022119 1022121 . + 0 transcript_id "g243.t1"; gene_id "g243"; # protein sequence = [MEGWSPPTSSSLTIADIDSASPTFLGSSSSSTPTPDSASPISTNANSGSNAASTNAGSVPTTDLSTATVTSENPSIPS # TPPSPSPGYDSQGNSSMESFMDVDSGEATSGPCTIHFPGAGKVVSCGATYLDDFNDDRFSEERKENLYYPFSSRPEWEMASFLLNSSLSMQEIDNYLQ # LELVGLTFVSVGSPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g243 ### # start gene g244 Scaffold_3 AUGUSTUS gene 1023139 1024326 0.99 + . g244 Scaffold_3 AUGUSTUS transcript 1023139 1024326 0.99 + . g244.t1 Scaffold_3 AUGUSTUS start_codon 1023139 1023141 . + 0 transcript_id "g244.t1"; gene_id "g244"; Scaffold_3 AUGUSTUS CDS 1023139 1024326 0.99 + 0 transcript_id "g244.t1"; gene_id "g244"; Scaffold_3 AUGUSTUS stop_codon 1024324 1024326 . + 0 transcript_id "g244.t1"; gene_id "g244"; # protein sequence = [MFWDHDAKWAIQAVGASHIDFRFSIHQPIVGYRSFKEGISSLKQVTGRAQRDVQRYLIPLISGAVIPKFITALRALMD # FRYAGQAPRFNQASTLRVQTALNEFHENKDIIQDLKARVNPKGVPIIHWEIPKLEFMQSVAPSISASGPIMQWTADTTEHVHITLVKDPARSGNNHDF # EVQICRHLDRQSRVRRFDLVTAMVDAGVDFRLDDIEGDEGRGDIGHDREERDEEDEEVDAKISSSEELMTCLHPVSQKLFGSFRPKQNFFLKARLLKQ # DASALLPLRIFTDNISGEISAFKVNRDPDLKTLTIEQVSNPYSLPDFSGACLDFLERIQAKTQTFVIGGRRSLNQSISLPFTRVKVWSRICIQTKTYF # NTDLLADSHTIFAAPPSPGWEFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g244 ### # start gene g245 Scaffold_3 AUGUSTUS gene 1036514 1036846 0.99 - . g245 Scaffold_3 AUGUSTUS transcript 1036514 1036846 0.99 - . g245.t1 Scaffold_3 AUGUSTUS stop_codon 1036514 1036516 . - 0 transcript_id "g245.t1"; gene_id "g245"; Scaffold_3 AUGUSTUS CDS 1036514 1036846 0.99 - 0 transcript_id "g245.t1"; gene_id "g245"; Scaffold_3 AUGUSTUS start_codon 1036844 1036846 . - 0 transcript_id "g245.t1"; gene_id "g245"; # protein sequence = [MSDPEYHSEHRPQEEPVAVRRHPLPTSLNWLLTNIFNSNPQSQEELDAHFARQLYMEDQEQQAAWQAQQQQQRPRPTF # SGRRDSYPQPAQEKDTMTEISDQFNKIAESLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g245 ### # start gene g246 Scaffold_3 AUGUSTUS gene 1038391 1039203 0.33 + . g246 Scaffold_3 AUGUSTUS transcript 1038391 1039203 0.33 + . g246.t1 Scaffold_3 AUGUSTUS start_codon 1038391 1038393 . + 0 transcript_id "g246.t1"; gene_id "g246"; Scaffold_3 AUGUSTUS CDS 1038391 1038419 0.34 + 0 transcript_id "g246.t1"; gene_id "g246"; Scaffold_3 AUGUSTUS CDS 1038539 1038570 0.51 + 1 transcript_id "g246.t1"; gene_id "g246"; Scaffold_3 AUGUSTUS CDS 1038626 1039203 0.9 + 2 transcript_id "g246.t1"; gene_id "g246"; Scaffold_3 AUGUSTUS stop_codon 1039201 1039203 . + 0 transcript_id "g246.t1"; gene_id "g246"; # protein sequence = [MGLITERSSYKSQRVQLPSPSELTFAEFDSTFFPVSSLRTRSGSSSSTLSSRPNTCERAEAAERSDRYKLAVEVLRTV # YHEFYDEHVRLAQEEIDKLKFSNEPLLEESPWITFFNSTDGEEQVIQLGEVHTIILENAFDDSEELYYYCCAPASQNMEELEFFTNFVPHADAPEFDL # DEFLAWDEDARDSFSFPWQNLEDPDRSSSVIFFVLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g246 ### # start gene g247 Scaffold_3 AUGUSTUS gene 1042479 1042772 1 - . g247 Scaffold_3 AUGUSTUS transcript 1042479 1042772 1 - . g247.t1 Scaffold_3 AUGUSTUS stop_codon 1042479 1042481 . - 0 transcript_id "g247.t1"; gene_id "g247"; Scaffold_3 AUGUSTUS CDS 1042479 1042772 1 - 0 transcript_id "g247.t1"; gene_id "g247"; Scaffold_3 AUGUSTUS start_codon 1042770 1042772 . - 0 transcript_id "g247.t1"; gene_id "g247"; # protein sequence = [MGSRILSRSFGVERVDIDGGDDGEEMNPEADKSIGSAMDVDEHDETTGVEDTSIQDDSPSEDGDEGEEDAIDISMVPI # ADLLNVRLPSTYYVCFTPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g247 ### # start gene g248 Scaffold_3 AUGUSTUS gene 1051935 1052888 0.95 + . g248 Scaffold_3 AUGUSTUS transcript 1051935 1052888 0.95 + . g248.t1 Scaffold_3 AUGUSTUS start_codon 1051935 1051937 . + 0 transcript_id "g248.t1"; gene_id "g248"; Scaffold_3 AUGUSTUS CDS 1051935 1052888 0.95 + 0 transcript_id "g248.t1"; gene_id "g248"; Scaffold_3 AUGUSTUS stop_codon 1052886 1052888 . + 0 transcript_id "g248.t1"; gene_id "g248"; # protein sequence = [MHPSGFRFVVNVKGAVSCLVKTHTFSSKHSLETSHTDVLIPRSPVMLNSHIHGLNVIEPGHLDSGSQNLLSGPFPDLS # LWTHLLFESEDGPVSALTNDSGLGQLTEEDEDGGNHAGIEVADGHINVVAGMAVNNEYLSQGQLPPLSLDIDSLPSSFGINPLVLAGQSQPAEQVAPV # LLAINVAKPLPPIVPQPMDVRLPDPQPTESIMPSAKRQRYRKLSVGESSQSMYMSTPLTTAEDKRRRNTAASARFRLKKKEREIALDKQTKELEARVN # ELEKQCEGLRRENGWLKGLVVGVTGGAQKSSTGLQPRREEILC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g248 ### # start gene g249 Scaffold_3 AUGUSTUS gene 1061837 1062460 0.32 + . g249 Scaffold_3 AUGUSTUS transcript 1061837 1062460 0.32 + . g249.t1 Scaffold_3 AUGUSTUS start_codon 1061837 1061839 . + 0 transcript_id "g249.t1"; gene_id "g249"; Scaffold_3 AUGUSTUS CDS 1061837 1062460 0.32 + 0 transcript_id "g249.t1"; gene_id "g249"; Scaffold_3 AUGUSTUS stop_codon 1062458 1062460 . + 0 transcript_id "g249.t1"; gene_id "g249"; # protein sequence = [MYPLRQVNEPPMFVAGEKLGQKVFPGQGGMGGGMPSGGAGMGMGMGAGIPSGMPGMQSGIGGGVGGGMPGGITGNMGG # NMGMPGGAGAFNQQQAQALIAQQNSNMEMLEARRTHSLGGRAGPLPPGAPVPGAPGMHGPPVPGPHGRGIPPPGVGVPGVPPGRRPVGAPGGQGSPDD # DDSGDEIDSISTRTHALMRYKRNHDLMNEVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g249 ### # start gene g250 Scaffold_3 AUGUSTUS gene 1069786 1070832 0.99 - . g250 Scaffold_3 AUGUSTUS transcript 1069786 1070832 0.99 - . g250.t1 Scaffold_3 AUGUSTUS stop_codon 1069786 1069788 . - 0 transcript_id "g250.t1"; gene_id "g250"; Scaffold_3 AUGUSTUS CDS 1069786 1070832 0.99 - 0 transcript_id "g250.t1"; gene_id "g250"; Scaffold_3 AUGUSTUS start_codon 1070830 1070832 . - 0 transcript_id "g250.t1"; gene_id "g250"; # protein sequence = [MLLPLWPGDTDPPSQAHSQHVYPPSQSSFKKPVLPLEKRTFLLVWYKALEPQLPSLKGGKDGDRKAGADKEKEEVALA # VIDSLIGFSPDTEKETKDKDKKDKKSKSNSNKSAGSGKDSGKDSGKDSGKSSHASPTSSSDSTGFLRSSRSLGGIGIGGGSGRGSGTGSATASGTHHS # NLTWAQLHANDERNILLPGFLITVRRVSYRDLQGTGVRVPDEGVTVNGPLEEAWRECFNIPDSMSGIMADSGSPLTPSFMPDPTILAVCHSRESGVEF # DPEALISLGLCKVLNPLPMGMVAEDFVENGAEMSGQDGWGFGGMELKLKLTPVGRSVMEMCWVGGLALMSFGPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g250 ### # start gene g251 Scaffold_3 AUGUSTUS gene 1070961 1072346 0.65 - . g251 Scaffold_3 AUGUSTUS transcript 1070961 1072346 0.65 - . g251.t1 Scaffold_3 AUGUSTUS stop_codon 1070961 1070963 . - 0 transcript_id "g251.t1"; gene_id "g251"; Scaffold_3 AUGUSTUS CDS 1070961 1072346 0.65 - 0 transcript_id "g251.t1"; gene_id "g251"; Scaffold_3 AUGUSTUS start_codon 1072344 1072346 . - 0 transcript_id "g251.t1"; gene_id "g251"; # protein sequence = [MAFSLTRYHKPSHVTSSSAAMRARSATPSEGFVNSQHARLPPHLKAAGVVGSSGSSALPVPRATANRIILLAPRRVQE # AFTSTTTTKMLADHGLLSPPSGSLSRNEKDRIRDIDGDKRKKSLPGDGKSARSSPSPEKMRRKKSISASQPQLPSRSSSATPPPVPALPTTPNTPASL # SPSAQITPLNSSSLSPPAIYPNSFSDDAPSTNIEGPPSSSSTSTTSTSLASSSTSVSQRMSSCTTDTDNTDHTEHTDRSSTLVDSELSEISSTSASEA # SASESSVGSSRPHRHRIPRRKLHEYDHDHNEDEADESSYNDDDHDDDLYGYRPHRDGGPSRVARTPHNETYGTVDFSSANDRQRILQIVSDSSSSSSS # SPFSILRFINRNVRTGVIDSLDPSASALRATAGPAFDPPWLTFPSRGKQEQQRRVVDNLNMSFKDVGLLPSTPLDGLEVAALVEVLEVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g251 ### # start gene g252 Scaffold_3 AUGUSTUS gene 1072508 1074081 0.59 - . g252 Scaffold_3 AUGUSTUS transcript 1072508 1074081 0.59 - . g252.t1 Scaffold_3 AUGUSTUS stop_codon 1072508 1072510 . - 0 transcript_id "g252.t1"; gene_id "g252"; Scaffold_3 AUGUSTUS CDS 1072508 1073985 0.86 - 2 transcript_id "g252.t1"; gene_id "g252"; Scaffold_3 AUGUSTUS CDS 1074054 1074081 0.62 - 0 transcript_id "g252.t1"; gene_id "g252"; Scaffold_3 AUGUSTUS start_codon 1074079 1074081 . - 0 transcript_id "g252.t1"; gene_id "g252"; # protein sequence = [MTTPPTRSIREPDDEAGEELEGEVSPTVTTVDVTPRPSVAPTHPDALVYPYRRPRSRPSSSAEAGSGSNSPTSVLAKS # ASVSSSSARGAHISRALPGRYSSNGREDVEFSSDDDSYEFDNIDYSEGDDGEENIEISSARFSMTSGGTGNYFGGHASYGPPEGYRDREGSVATLRIK # RPDSGGDRDRPPPIFTSPFASTSAVASPSSSVPPSFDTGMARPPSVSATPTSPSADTTPSGMDADFDFAYITSFGADLSADPSSSVPDFVRPRRVSAM # SLSGTSSNRETSGRKDSLGKSLFFSWLSGRRPSTATVASSNSSNMFIHDDTFAQTLLKWGGEGYKEQRKDWTIRREVHPVSSSSSSAPTSSGNKEEKL # KRITTTSTAPRMSTATNITAVTSTAVGTSHGFLSPEPPSSLNKDREASHSHTKSQSHDTSKDSRSQEKDHSHKEREKERLRRSTMHWRGMPVGSEEVW # GNDLLGKFAVYREEVGRGAKGELLYFECQLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g252 ### # start gene g253 Scaffold_3 AUGUSTUS gene 1077764 1081506 0.6 + . g253 Scaffold_3 AUGUSTUS transcript 1077764 1081506 0.6 + . g253.t1 Scaffold_3 AUGUSTUS start_codon 1077764 1077766 . + 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_3 AUGUSTUS CDS 1077764 1079893 0.6 + 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_3 AUGUSTUS CDS 1079956 1081506 0.95 + 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_3 AUGUSTUS stop_codon 1081504 1081506 . + 0 transcript_id "g253.t1"; gene_id "g253"; # protein sequence = [MGNTASPNFSGFQFQSIGKSQSDNQISLLKRLSSVKTSGSNEHDDQDHSTQTHDIDVSQGSTSVPTAAEVDTSSVAIS # SVPSRRTLFQTLGNNEQVTSVPVQYGPKVDIFGQRFPFVLPSSRPVDSMNSTTVSQSVVGTSTGNNAVDEVVSLPSSSIPISKPPSDLPSIPFQSTIS # RASSCASNSSHIDLTYPMSTPQSPQQPPFPFVVKSELARAAVHIPSKDHLNFSSLTQGDSSSSSAPTPTSFGPSFAALNEIHSRLLSTFHDLSSESSE # TIAQASAKLASAFECASRAQNLAQESLKLTQTASSTLVDSLEAGKDSHETADKAISLVETSMKILAAYETKHAKGIAEMKEATERIGGWIDEEQQRLR # LTKEAKAKAEKELQAREKKAGEVREAKERREEAQEKIEDQKKEKSANEAQERGNKKKRGPVARFFNLTNDVNHVIMSGPSCITAHDPPTSHAPAALVD # ATDSLSVNSSFNFSIDASTSALDSLDSLEKADAWIEKLKTIENTARRAREEKEMQMERIMKDKNRQREEYKQAEETRQRQAAEQERQRLEAEQEDRRR # KEENERRQNDIAAAEGARCDNLEEEKQRCEAANLAAEKELVEAQLRKKAIEEREQKLRSKLEQEQEQAQAWKQAAIDEQQRRREALQQSQAGRKLGSQ # RATPVGNIGLPSVPIIPSIPSVVSPTFTSTSTRPFNPSALPKSSTVPKLTKKQRQKARKAEALAQQQPVSGNVPLGPTESPSLIASKVTLPTAASGVH # QNPKTQSMPLNPDHRTSVSNYPHSPRNNISLGLIDGSVSRSSNSPILHTNSTDTGNILLQSSAPKSPEVRAANMRFVVKGAGAGMDNSTSSDSNANWR # ERKLAIRKSKPEYDIPMFKNEDDDRDSMKCLRSPAKMTIPVVSHPTPDLSTPLLEATSNPQVLPPAAEGHSRVGNQSRNSSEYIPGDASGAGLGYTPI # TPNVAKARSTSAKGVISVPSLLKQPTNNPTLTSTSAPAPLQEPTSQARPVTGASRRPPSAPAPSNSQTHPTSQGNLTAPNTSVCPPPATALSESQNRP # VSRASPNAVASPVSQMSAPIRSLSPIAPNDGGWANVRIPDSASEYIARSGRRGHNHNSPSPNSIGSGQHMSLEGSPFVPRSPLRRLVVLFHIENKLNV # TDDFLPILINVNVLLLARIVEVILLLWDMVLTLVDHLIAMAKIYEEAEAEVVLVLPPNRATFKSGPGLHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g253 ### # start gene g254 Scaffold_3 AUGUSTUS gene 1086067 1086657 0.72 + . g254 Scaffold_3 AUGUSTUS transcript 1086067 1086657 0.72 + . g254.t1 Scaffold_3 AUGUSTUS start_codon 1086067 1086069 . + 0 transcript_id "g254.t1"; gene_id "g254"; Scaffold_3 AUGUSTUS CDS 1086067 1086657 0.72 + 0 transcript_id "g254.t1"; gene_id "g254"; Scaffold_3 AUGUSTUS stop_codon 1086655 1086657 . + 0 transcript_id "g254.t1"; gene_id "g254"; # protein sequence = [MAITIAWQFSGPLTDTTRFSLFFDEIGFEPVVVYHKNEHGKTVTHVQEVKEVSWRPSPTNTILLGSVFKTSSLVCRFG # DSADFRKHIFDTIKDVQELQSQTIALLEGRQKEFGMVQTGPYFDPRLRQHPTIEDDLDWINTVFLFLSLTDLPMSSGGPAHVSPMATPLVTATSLETW # NKKFNLLCLARYPSLPLNRC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g254 ### # start gene g255 Scaffold_3 AUGUSTUS gene 1088446 1089563 0.66 - . g255 Scaffold_3 AUGUSTUS transcript 1088446 1089563 0.66 - . g255.t1 Scaffold_3 AUGUSTUS stop_codon 1088446 1088448 . - 0 transcript_id "g255.t1"; gene_id "g255"; Scaffold_3 AUGUSTUS CDS 1088446 1089160 0.8 - 1 transcript_id "g255.t1"; gene_id "g255"; Scaffold_3 AUGUSTUS CDS 1089211 1089563 0.68 - 0 transcript_id "g255.t1"; gene_id "g255"; Scaffold_3 AUGUSTUS start_codon 1089561 1089563 . - 0 transcript_id "g255.t1"; gene_id "g255"; # protein sequence = [MERHFHKSTTKGLALAVASVASASTSKLVRGVKDVATKSIHAGSSPVSSDIESSPHGLPPPSASLATDVIDEEEEGIR # EHWPGTQEVTEEESAEGKEERERREIEEETRSLMEIIHSDGFFDGSRLGDRSSKADASSGEPSNKTRVWLTPNIAYDQFDWEVNAHSNGANPQPSNDT # PNNNTSEPPSSKDKISFAVPEIKQTDFASTSQSESQNPNRPPVLRNQDTYTPRNPAHSYPSRYPQFHTLFAQFPKTLILIGDAERLTTEVGNLARAMG # KDCDCGGETANTKDAGFKEEEDLPREGLVSLGGGCVQVRWIPDAVHDVFMIPPGWWDEKIKSEVWEDVKTWMTGFHEASIM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g255 ### # start gene g256 Scaffold_3 AUGUSTUS gene 1091964 1092308 0.58 - . g256 Scaffold_3 AUGUSTUS transcript 1091964 1092308 0.58 - . g256.t1 Scaffold_3 AUGUSTUS stop_codon 1091964 1091966 . - 0 transcript_id "g256.t1"; gene_id "g256"; Scaffold_3 AUGUSTUS CDS 1091964 1092308 0.58 - 0 transcript_id "g256.t1"; gene_id "g256"; Scaffold_3 AUGUSTUS start_codon 1092306 1092308 . - 0 transcript_id "g256.t1"; gene_id "g256"; # protein sequence = [MADITLPKSTATVSVKALNIASPRTSIPAALFVTPVKPGRERLASPDYAFLIEHPSGRMVLFDLGPMKDFSKLPPAMQ # GLLAQGGFEMSVDADITEQLKAGGVSVDDIDSVIWR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g256 ### # start gene g257 Scaffold_3 AUGUSTUS gene 1099560 1100983 0.39 - . g257 Scaffold_3 AUGUSTUS transcript 1099560 1100983 0.39 - . g257.t1 Scaffold_3 AUGUSTUS stop_codon 1099560 1099562 . - 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_3 AUGUSTUS CDS 1099560 1100057 0.99 - 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_3 AUGUSTUS CDS 1100121 1100149 0.89 - 2 transcript_id "g257.t1"; gene_id "g257"; Scaffold_3 AUGUSTUS CDS 1100301 1100314 0.64 - 1 transcript_id "g257.t1"; gene_id "g257"; Scaffold_3 AUGUSTUS CDS 1100403 1100983 0.45 - 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_3 AUGUSTUS start_codon 1100981 1100983 . - 0 transcript_id "g257.t1"; gene_id "g257"; # protein sequence = [MIWKVDDSAFEGWGADHWVPKDFDPVWRIDASPRKVGQVLFHPTASNVVAGATGDYTVKLWDLARTEDPRNVLSGHND # AIQSLAFNSTGTLLVTTCRDRKLRLFDPRAGSDAVRVTDGHGGIKGARVVWMGDHDRIATTGFSKMSDRQVAIWETGSLSNLKTTTIDQSSGVMMPFW # SENNILFLGEYHYIYAFLDGNIQPIAFIVPRRADGFQSDIFPPAPSSEPSMSANDFFSGKNAPRKVVDLASGASFVSSAPPSAVPVPVSASMPSPAPL # TPSYSTPAPASQTPSAPVITKSYSIPTPSSTTTAEPPSPAPAPTIQKSNSRDDSTLGQENAQLRKELREARELIRNLELQVEAQRANARKAAQALLDA # A] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g257 ### # start gene g258 Scaffold_3 AUGUSTUS gene 1105008 1106249 0.73 - . g258 Scaffold_3 AUGUSTUS transcript 1105008 1106249 0.73 - . g258.t1 Scaffold_3 AUGUSTUS stop_codon 1105008 1105010 . - 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_3 AUGUSTUS CDS 1105008 1105556 0.96 - 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_3 AUGUSTUS CDS 1105617 1106249 0.77 - 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_3 AUGUSTUS start_codon 1106247 1106249 . - 0 transcript_id "g258.t1"; gene_id "g258"; # protein sequence = [MTTPRQKLINAHMAAAGIGIQEYQDFGEYEEDEAHVASEQDTNYSMFDLNIDSVDVTLSLWRWLDGRGLVEDAVVKGV # RGVLGAVSEYLSLDVSYPDPITVDRRSVLYDPEHPLDPASFRHESHVGDFELDSLQLEDVLITVYQPGGFRPYTASIFRADIRTFRKRWMFYDFLSAE # NIVGQFDNCLFSLHKPQSIGRTTGSELHDGDWARMSRIRIDGVSIDHLQASTSMEGPVSWITSGKLDAVLDIKFPKDPDDALALNVILEEIADAISNT # LSTSPALDPLRQRIPGQRELAKPPLSAPDTEEFTASVNLEQSKEPKVVIELDLRFRDVKAAVPIFTSDLSYVNNALIRPIVAFMKYVYCYTICVIAHD # PQPQCQSDLGPHTLSSRESSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g258 ### # start gene g259 Scaffold_3 AUGUSTUS gene 1118221 1120757 0.48 - . g259 Scaffold_3 AUGUSTUS transcript 1118221 1120757 0.48 - . g259.t1 Scaffold_3 AUGUSTUS stop_codon 1118221 1118223 . - 0 transcript_id "g259.t1"; gene_id "g259"; Scaffold_3 AUGUSTUS CDS 1118221 1119031 0.65 - 1 transcript_id "g259.t1"; gene_id "g259"; Scaffold_3 AUGUSTUS CDS 1119352 1120757 0.79 - 0 transcript_id "g259.t1"; gene_id "g259"; Scaffold_3 AUGUSTUS start_codon 1120755 1120757 . - 0 transcript_id "g259.t1"; gene_id "g259"; # protein sequence = [MELSQLNDVIQDVASGISTAIQDSISGANSAITSAIDAINKVNPFGNISIPQISSPDLSALNNVSLPSSFQDSLNQLN # SSLPTFSQLKDDINAMCVYLRDHCMTFADYYIFLSSLDTPFELLKKDINDTFAGLSFNSSLLTIPEQNEVSFCDQLDTSVVDDLGQDLIKITKIGVII # IILLALLLVGLNCLLEWYKWRCQQAHLQYTREAWSTDPSVTQSKGFGAPSVTLTDHNLLMLQANGSHPLITRIMNQLSARLHFSPTTYTNLSWFLHYI # FHAPALACFLIGFFGLLSVEIQLIAVHPLEAKYSALAASTATDFSNTIATSMNASMYNQSATYANNVNSHIDTLQSSINDGLFGWVNGTTTTLNDTLA # TFYSDIQDAISDAFNGTLLEEPLQEFLACFIGSKVEAIEDALTFLNNNLQIDMPRMNDSILVLSPESINEVSQPIAAAAVGDGSDDNGGFVGKLVNAQ # ELGKFFRCWDSRKKPFPAISKPFKLVPAVGNQPERAGLGQDDQFGKTWFTRLTGTFTRKISDPQSVSPTPPSDRTRPDLRISIDRASSTRTLAQDPDG # AKDGEPHSRWSTSPEVTKIAPWMGMLSPTRRSYDHGPPPNRTMRQDVRSIPADVNSVYESSAVHVGHAPLAPPLHHGFTGILRSNIQAPSTLAPPQDR # HRRSSSVPAWKMSAPAASSVTPVTRFLTSHSARRSSNVDPFATPFDDEHQVIVERAPPRQSYQTNPFTVVAM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g259 ### # start gene g260 Scaffold_3 AUGUSTUS gene 1122431 1122970 0.43 - . g260 Scaffold_3 AUGUSTUS transcript 1122431 1122970 0.43 - . g260.t1 Scaffold_3 AUGUSTUS stop_codon 1122431 1122433 . - 0 transcript_id "g260.t1"; gene_id "g260"; Scaffold_3 AUGUSTUS CDS 1122431 1122970 0.43 - 0 transcript_id "g260.t1"; gene_id "g260"; Scaffold_3 AUGUSTUS start_codon 1122968 1122970 . - 0 transcript_id "g260.t1"; gene_id "g260"; # protein sequence = [MIIRYSELRGSGSHSFTLLQVDIKYMTAKGVYYANTPKMPALRTADSTAMMILQALRGSSEREADARAGKWLDPSKPL # AKDARCSTLGIVGMGNIGKLVSGHMQHFGMKVVYYNRNRLPPYEENGAEFVSFEELLVRSDVISLHCPLNEGTRHLFNKQGAFLSRLNRTEFAKAILR # SER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g260 ### # start gene g261 Scaffold_3 AUGUSTUS gene 1123783 1124859 0.98 - . g261 Scaffold_3 AUGUSTUS transcript 1123783 1124859 0.98 - . g261.t1 Scaffold_3 AUGUSTUS stop_codon 1123783 1123785 . - 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_3 AUGUSTUS CDS 1123783 1124859 0.98 - 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_3 AUGUSTUS start_codon 1124857 1124859 . - 0 transcript_id "g261.t1"; gene_id "g261"; # protein sequence = [MHPRLSFLLLCVLTVTHIAAAYRPYRPHDSSDLVQPHRVPRSFKSDNKREVSPPQTPSHVNASIRAVSESTVSSSHPT # QIPPCSSDCSPVALSADASPSARQAINEPGSLGVAMDTLKSQPVPRYANTTITPPVPSLAARQIHNADYGSSNAPSSSSDSNSTEQAHPSSSASHPSA # TDSADSNNRREETTEHVRTGPPAARTAALRRLETSDLKPVYNKNSTTTIPSVNPTETNFSRRFPRASALRRTYLFDMLPGTDNDTSSSNSTGSKSDNS # SERRVPRAAAMRRINVPGLPEVKNSTTPPSTMKSDDSATRDNSTSVGTNGSNGNSTKFDNDFANSSPNQPERRLAFRFRRGRQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g261 ### # start gene g262 Scaffold_3 AUGUSTUS gene 1141785 1142414 0.6 + . g262 Scaffold_3 AUGUSTUS transcript 1141785 1142414 0.6 + . g262.t1 Scaffold_3 AUGUSTUS start_codon 1141785 1141787 . + 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_3 AUGUSTUS CDS 1141785 1142414 0.6 + 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_3 AUGUSTUS stop_codon 1142412 1142414 . + 0 transcript_id "g262.t1"; gene_id "g262"; # protein sequence = [MPQQEQRSPSQTQSEEQQRQTPSSPSGEGGTNRLGGIDDPPSLSQSCMSIVRSFERGEKAKVVALLEIQAILAAANLS # QESLAQSFSLYLKLLDSIENRKSKAAERGGNQEPDTVTASRKHPLEEEGEESEDDFDSKIPLAERLTKLYYPGSTEHPLLSESTFPNLLRKPVLSSQI # LPVNQSMPDPLSLKTVSIFSNEDWDDIITGKPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g262 ### # start gene g263 Scaffold_3 AUGUSTUS gene 1142807 1143879 0.61 + . g263 Scaffold_3 AUGUSTUS transcript 1142807 1143879 0.61 + . g263.t1 Scaffold_3 AUGUSTUS start_codon 1142807 1142809 . + 0 transcript_id "g263.t1"; gene_id "g263"; Scaffold_3 AUGUSTUS CDS 1142807 1143200 0.61 + 0 transcript_id "g263.t1"; gene_id "g263"; Scaffold_3 AUGUSTUS CDS 1143314 1143879 0.99 + 2 transcript_id "g263.t1"; gene_id "g263"; Scaffold_3 AUGUSTUS stop_codon 1143877 1143879 . + 0 transcript_id "g263.t1"; gene_id "g263"; # protein sequence = [MLNHEDVNLVKGTTRVDVQTLPSPADTNTSVQNATGMTTLAKIAQTERWSKRPRYARAFMWDSVENPTEKMSLAESSV # YMTPLPRPPANVVLDEIRKNPHLFNITTPINVDRFRALLDSHPNQVFVESVCTVDKEITERVFSPTFRSLLPGMQCVPVVVVPKPHSNKFRLAVDHSA # EPFALNSLIDRRDVKVKLDDLHDLGVALIRVRRVYGRSVNLVVFKSDVSAAYRRLPMDPRWQLKQVVGFGDGYNVDQCNNFGSRDVGGLFGSFMALVL # WIAIYVKFIIDLFAWVNDTFGWDFEGNLAYYAPYADFYPHDKPGY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g263 ### # start gene g264 Scaffold_3 AUGUSTUS gene 1145051 1145827 0.6 + . g264 Scaffold_3 AUGUSTUS transcript 1145051 1145827 0.6 + . g264.t1 Scaffold_3 AUGUSTUS start_codon 1145051 1145053 . + 0 transcript_id "g264.t1"; gene_id "g264"; Scaffold_3 AUGUSTUS CDS 1145051 1145827 0.6 + 0 transcript_id "g264.t1"; gene_id "g264"; Scaffold_3 AUGUSTUS stop_codon 1145825 1145827 . + 0 transcript_id "g264.t1"; gene_id "g264"; # protein sequence = [MTITMPVEARADLSQAIRKLAVVGNRWTLKEYQHLGGWINWSLNVYPLLRPALSALYEKMAGKTKSNQRIWTNKAVVR # ELLWFVEKLDVSDGVRMLDSEEWGLEEVELVIYCDACPTGMGYWFCHDSRLLGYQCAVPRPDDSEKPIFYYEALTVISSILHAIKLSTVRRVFVFTDN # TNTVDMFHALKAKQLYNPLLLTAIDHSICSNLQFRVAHIPGDENDIADALSRFDYTRILQLVPSMEIYNFTPPQLVLGAELL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g264 ### # start gene g265 Scaffold_3 AUGUSTUS gene 1148818 1149639 0.96 - . g265 Scaffold_3 AUGUSTUS transcript 1148818 1149639 0.96 - . g265.t1 Scaffold_3 AUGUSTUS stop_codon 1148818 1148820 . - 0 transcript_id "g265.t1"; gene_id "g265"; Scaffold_3 AUGUSTUS CDS 1148818 1149639 0.96 - 0 transcript_id "g265.t1"; gene_id "g265"; Scaffold_3 AUGUSTUS start_codon 1149637 1149639 . - 0 transcript_id "g265.t1"; gene_id "g265"; # protein sequence = [MLFNLAIADFRLSEHPGDVVLYDKVVNHTEQADDVLMTTMCPTSFQSKLNQFGEYSAQTGFIASVPKCVYAVYGKEET # EGLPFTLYGKRLKKKKEMKYMGIWHQTTGVDMYQQQYKESAEKAKKTAGAVLHAKVFVGKNIPIWDLWLLYMGRVDPYLKNGAEVIVDIYDVRRKQLE # SVQHYFIRRMLGLNDKSMVALLFSETGLWPIRYRRIILFLKNLKYLVQLKRDHLAWKACRQAYELAEQGKNSVFMEMVQVLDRLPHRVVWNIPNSRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g265 ### # start gene g266 Scaffold_3 AUGUSTUS gene 1153257 1154311 0.14 - . g266 Scaffold_3 AUGUSTUS transcript 1153257 1154311 0.14 - . g266.t1 Scaffold_3 AUGUSTUS stop_codon 1153257 1153259 . - 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_3 AUGUSTUS CDS 1153257 1153769 0.62 - 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_3 AUGUSTUS CDS 1153835 1154311 0.25 - 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_3 AUGUSTUS start_codon 1154309 1154311 . - 0 transcript_id "g266.t1"; gene_id "g266"; # protein sequence = [MDRVRDGIGGCWSGSMEGFGRRRIWSRFKRDMKVMGRRMPRMPMIAIPFLDRPRTVRFVPSSRSRTTSVVSPTSSAVS # GPTYSVVSTATAPTAPTATTRTVPRFAGTPAASVYSTTTTSSTTASSVTPPEPTNLLYQTGPAVSVHPPTPGTTPTPRKTRAIEEEISLPGPSTNSSG # SASGLTTDNELLGTSRGSRYSLFPVSTKKPDLRLTESDSDDDEGDDDTSSTTTETPTPDAGTLRDISLEVVEAAEAEQSEQLDQITPTQSPVTTEHPI # LPTLPDTTNDLNGNNNELLITGIDLPTVPKTPLPPADQVPDIPDVDVDYDSWEKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g266 ### # start gene g267 Scaffold_3 AUGUSTUS gene 1172266 1173241 1 - . g267 Scaffold_3 AUGUSTUS transcript 1172266 1173241 1 - . g267.t1 Scaffold_3 AUGUSTUS stop_codon 1172266 1172268 . - 0 transcript_id "g267.t1"; gene_id "g267"; Scaffold_3 AUGUSTUS CDS 1172266 1172701 1 - 1 transcript_id "g267.t1"; gene_id "g267"; Scaffold_3 AUGUSTUS CDS 1172751 1173241 1 - 0 transcript_id "g267.t1"; gene_id "g267"; Scaffold_3 AUGUSTUS start_codon 1173239 1173241 . - 0 transcript_id "g267.t1"; gene_id "g267"; # protein sequence = [MTKPKAKDDVEREQLSLASFLLITLLLPSLLTAPTERDIRIINVVNRFYAAASAPSFSSAFYDSLTSDETPPLNSTFL # AEGTRSLRTIILTRHLQRILDALPAAQIPKTDSNSSAIPVVNSDSQKSNIVAITVSPGISRADTVARILNADWTSTDGYSIMGVFLYLLALPLLHLCT # KSSVAAVQSVLHVLFLPTPFKFLSQTIQNQPKAKNDSLIDKSVTESPEEVLKPGALYAECAVVRLKVPSPPPEGVADGNRNDKGNGNGKAAEKEPQTL # DLPDDGEFGGELAGRRVWEAFEAALKAWRKPTRH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g267 ### # start gene g268 Scaffold_3 AUGUSTUS gene 1174178 1174453 0.48 + . g268 Scaffold_3 AUGUSTUS transcript 1174178 1174453 0.48 + . g268.t1 Scaffold_3 AUGUSTUS start_codon 1174178 1174180 . + 0 transcript_id "g268.t1"; gene_id "g268"; Scaffold_3 AUGUSTUS CDS 1174178 1174453 0.48 + 0 transcript_id "g268.t1"; gene_id "g268"; Scaffold_3 AUGUSTUS stop_codon 1174451 1174453 . + 0 transcript_id "g268.t1"; gene_id "g268"; # protein sequence = [MSGSLISAVSWVKRGVALQNPSKYVLDDQELERVSALARIELEDAQVELKRAHNAAKSMGKSDINGEDGDSDVDVEVI # EGDRDGDEGDWVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g268 ### # start gene g269 Scaffold_3 AUGUSTUS gene 1174525 1175638 0.48 + . g269 Scaffold_3 AUGUSTUS transcript 1174525 1175638 0.48 + . g269.t1 Scaffold_3 AUGUSTUS start_codon 1174525 1174527 . + 0 transcript_id "g269.t1"; gene_id "g269"; Scaffold_3 AUGUSTUS CDS 1174525 1174648 0.49 + 0 transcript_id "g269.t1"; gene_id "g269"; Scaffold_3 AUGUSTUS CDS 1174700 1174734 0.64 + 2 transcript_id "g269.t1"; gene_id "g269"; Scaffold_3 AUGUSTUS CDS 1174832 1175638 0.97 + 0 transcript_id "g269.t1"; gene_id "g269"; Scaffold_3 AUGUSTUS stop_codon 1175636 1175638 . + 0 transcript_id "g269.t1"; gene_id "g269"; # protein sequence = [MDVDPEAAPPNPNSDSKTTTSKDDDLSQYNLDDYDDDTPGDNISHFSNINNIADDEDDIEAERSELEVLPSDNLLVVA # KTEDEISQLEIYVYEESEANLYVHHDLMLPNFPLCLEWLDFPPASSSSSTMNNDPSNLGFGNYIAVGTLDPEIEIWSLDVVEAMYPNSVLGRPDKTKA # HIPVPLGTGKKKKKKTKSRQTEKAYHVDAVLGLSWNKKQRNLLASASADKTVKLWDLSRDPTITGGEGGALRSFDVHKDKVQAVQWNEKDPAVLLTGS # YDRTVRTFDSRAPEGGVGAFLGKCRGTEMGSVEREWVLCKYHPLSVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g269 ### # start gene g270 Scaffold_3 AUGUSTUS gene 1177784 1178554 0.97 - . g270 Scaffold_3 AUGUSTUS transcript 1177784 1178554 0.97 - . g270.t1 Scaffold_3 AUGUSTUS stop_codon 1177784 1177786 . - 0 transcript_id "g270.t1"; gene_id "g270"; Scaffold_3 AUGUSTUS CDS 1177784 1178554 0.97 - 0 transcript_id "g270.t1"; gene_id "g270"; Scaffold_3 AUGUSTUS start_codon 1178552 1178554 . - 0 transcript_id "g270.t1"; gene_id "g270"; # protein sequence = [MSSPYLPAPPLLSYPIPIDPSLQSVGSSLGNLGRQQFHSRQLAEEYSPSPSLAMSPILSTLPEAFASNAADCVTGSAL # YDGMKPYHIESPRSLMLPPFSAQSVSPSVPGASNKLIPEVQLPPMSTISIPFTSTVLAPMSIRYLFPNPQPPPPPPTKPYLMQADGKATKSEICQEFV # AVETYTQKLLHDVTVLAKENQIMKEYLGSMPKRRLALTRVRTGIGPPSRALVDARMLRDMSRFSVVALTDMLFMALRYTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g270 ### # start gene g271 Scaffold_3 AUGUSTUS gene 1183176 1183460 0.37 + . g271 Scaffold_3 AUGUSTUS transcript 1183176 1183460 0.37 + . g271.t1 Scaffold_3 AUGUSTUS start_codon 1183176 1183178 . + 0 transcript_id "g271.t1"; gene_id "g271"; Scaffold_3 AUGUSTUS CDS 1183176 1183460 0.37 + 0 transcript_id "g271.t1"; gene_id "g271"; Scaffold_3 AUGUSTUS stop_codon 1183458 1183460 . + 0 transcript_id "g271.t1"; gene_id "g271"; # protein sequence = [MPKISSDVVDGTKHENTVPEQPVSFAIMSLSPEYPNQQAHDSSNHADSSKHGKNEDREASATIRSKRSLRGDNPHSTT # KVKVNYQLSQTPYMDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g271 ### # start gene g272 Scaffold_3 AUGUSTUS gene 1184304 1184651 0.67 + . g272 Scaffold_3 AUGUSTUS transcript 1184304 1184651 0.67 + . g272.t1 Scaffold_3 AUGUSTUS start_codon 1184304 1184306 . + 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_3 AUGUSTUS CDS 1184304 1184651 0.67 + 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_3 AUGUSTUS stop_codon 1184649 1184651 . + 0 transcript_id "g272.t1"; gene_id "g272"; # protein sequence = [MQCVAYDRTFLEDLRSNKAASTVTDLDSKVVQPTSKSKMKSRMKGSAKRQGIAAGSAPEGSVSSAPGLRRSARERKPS # ERTFLEADSDPDVNLDGSMSDLTNSDYLYSSGEEGEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g272 ### # start gene g273 Scaffold_3 AUGUSTUS gene 1188011 1189838 0.2 + . g273 Scaffold_3 AUGUSTUS transcript 1188011 1189838 0.2 + . g273.t1 Scaffold_3 AUGUSTUS start_codon 1188011 1188013 . + 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_3 AUGUSTUS CDS 1188011 1188851 0.34 + 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_3 AUGUSTUS CDS 1188938 1189444 0.34 + 2 transcript_id "g273.t1"; gene_id "g273"; Scaffold_3 AUGUSTUS CDS 1189498 1189838 0.84 + 2 transcript_id "g273.t1"; gene_id "g273"; Scaffold_3 AUGUSTUS stop_codon 1189836 1189838 . + 0 transcript_id "g273.t1"; gene_id "g273"; # protein sequence = [MELAHRWGFHEVMKLATREIEKLEMPDIDRIVAYHKFELDRSLLLHRYAALTAREEPLNLEEGMALGMDTTLKIFRAR # EVARATPAADGSRSPTSATLPDDEMQSLIVDLFEIPEYSEPLPDDEPPRPQPTKKSPVKAAPVKKTQETPSAVPIAPEEPPAPPAPPAKPNRTSNATT # NATPTTATATTKSTNSSAWGATGSTANKPASPWASSATTNSKSNNASSSAAATTTSTPLADVPLASTDVSPPSLIPRWMKAARMLRLLTRMLTNGDKD # VKKASPGGLGGITNTLNTMFNQLSTDATNNDTSGAATGNGTAETPASAANIKDSDLPRSPTPTGGNKNRKKPSNDDRSVTDSGLDIDGGSDSGSMKTV # EELSDDDETRVDSGEHDNFHDEDDSVTSDKDEKRESRKGDDVVSDENKRHAEIVTVNDEEEAAIHGEAMASVTAPHGALVAAHGDAAGANIGLGAIAG # SSEIVTTAQVVDSEDIPLSKLVPSNTLYPGAADDTDQTALEFATTTTSEAPEPSIEVHSDAAAAHNDLKEESPAANTTNTLTHTSGKRNNFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g273 ### # start gene g274 Scaffold_3 AUGUSTUS gene 1190064 1190648 0.95 + . g274 Scaffold_3 AUGUSTUS transcript 1190064 1190648 0.95 + . g274.t1 Scaffold_3 AUGUSTUS start_codon 1190064 1190066 . + 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_3 AUGUSTUS CDS 1190064 1190648 0.95 + 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_3 AUGUSTUS stop_codon 1190646 1190648 . + 0 transcript_id "g274.t1"; gene_id "g274"; # protein sequence = [MSTVPAPQVDSKSLVEAEAPLPDKSEDTNASISPAGDVSNSPAQDNAISSTKPRDTNSLTVDSGDQVTSDHLSTELVP # EISSQQHKDTKAATPIQDDKVATGEGNTEPSSSIVPQAEPSVEETPGKGDDSKPLGTLLRDTEAGTQEPLTTTQQETLSVLSPLKDEIRAASNSNGVQ # PETPNDPKILDGTDHVFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g274 ### # start gene g275 Scaffold_3 AUGUSTUS gene 1194492 1195145 1 + . g275 Scaffold_3 AUGUSTUS transcript 1194492 1195145 1 + . g275.t1 Scaffold_3 AUGUSTUS start_codon 1194492 1194494 . + 0 transcript_id "g275.t1"; gene_id "g275"; Scaffold_3 AUGUSTUS CDS 1194492 1195145 1 + 0 transcript_id "g275.t1"; gene_id "g275"; Scaffold_3 AUGUSTUS stop_codon 1195143 1195145 . + 0 transcript_id "g275.t1"; gene_id "g275"; # protein sequence = [MSTSTSATDLKAIVKEGYDAIAPKYHSWAAPRLTQKRTEYIERLGKSLPKGSKVLELGCGAGLPATQQLVDQGFEVLG # VDISSSQLTLAKEHVPRAQFMEGDMTAIEFEKGSFDAVMAFYSLFHLPRDEHGPMLKKMVDWLKPGGWLLFNLHTDEKDHMRDDWMGVKMFSTGLGIE # GNRQMLVEYGAGLIDVEDVIDKEFVGRFEEDFHWICAKKSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g275 ### # start gene g276 Scaffold_3 AUGUSTUS gene 1195622 1196332 0.31 - . g276 Scaffold_3 AUGUSTUS transcript 1195622 1196332 0.31 - . g276.t1 Scaffold_3 AUGUSTUS stop_codon 1195622 1195624 . - 0 transcript_id "g276.t1"; gene_id "g276"; Scaffold_3 AUGUSTUS CDS 1195622 1196201 0.83 - 1 transcript_id "g276.t1"; gene_id "g276"; Scaffold_3 AUGUSTUS CDS 1196253 1196332 0.32 - 0 transcript_id "g276.t1"; gene_id "g276"; Scaffold_3 AUGUSTUS start_codon 1196330 1196332 . - 0 transcript_id "g276.t1"; gene_id "g276"; # protein sequence = [MSSAIVLDDYDITPEEFESFLKVFYNPKYYFYDLERPYEEWASILKLSNLWDFPNVKELAIKELQKLDIPLVDRIVLY # QDHDVDSKLRVPLYAELASREATLDHDESTRLGFRTTIVIFQARERLRSLASGGKSPLPDEVGPDAAKEVITNLFKALPPLGDATPPATPRPRLNGLD # SPRRPSSGFGFNTHSRNPSVSGQLLIIHFVSSSWFTDNCRYRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g276 ### # start gene g277 Scaffold_3 AUGUSTUS gene 1197710 1198990 0.58 - . g277 Scaffold_3 AUGUSTUS transcript 1197710 1198990 0.58 - . g277.t1 Scaffold_3 AUGUSTUS stop_codon 1197710 1197712 . - 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_3 AUGUSTUS CDS 1197710 1198990 0.58 - 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_3 AUGUSTUS start_codon 1198988 1198990 . - 0 transcript_id "g277.t1"; gene_id "g277"; # protein sequence = [MSITSYFFPISKAKSKRVSATGSVNRTTSEGKAKPRPTPYPETAERKPSQPATLNVSQTPSSSSILTSSTSNPDTTSF # TNGNHPRYMNLKRIAEETIEAVESGSFQLGGTIYDLKVAVNEMRSSTEFWSPDSKRLASWAATRMVRPDIRRNVDISLQEISSLEGSRFLAAQISAQY # SATTASSYFSSSAATPTATPKIGLLNFASATKPGGGFLNGASAQEESIARSSTLYYSLTTRNADEFYKLHKRMKHNGKWNGLGKGKKQDLSDAGEQME # GHTRDAGFYTHAMIYSPSVLLFRDDTGSWLKPLPVDVLTSAAVNAGDIRTKHHIKNATKSEKRALEARIEKEMKERMARILHIFALKGVRNLVLGSFG # TGVFKNNVEVVARLWKELLLETGAPFEKSFDRVVFAVLGKETYETFEEVLQLDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g277 ### # start gene g278 Scaffold_3 AUGUSTUS gene 1203185 1203877 0.22 + . g278 Scaffold_3 AUGUSTUS transcript 1203185 1203877 0.22 + . g278.t1 Scaffold_3 AUGUSTUS start_codon 1203185 1203187 . + 0 transcript_id "g278.t1"; gene_id "g278"; Scaffold_3 AUGUSTUS CDS 1203185 1203877 0.22 + 0 transcript_id "g278.t1"; gene_id "g278"; Scaffold_3 AUGUSTUS stop_codon 1203875 1203877 . + 0 transcript_id "g278.t1"; gene_id "g278"; # protein sequence = [MFSPTSLGYQMRKVSVTNSAISLFRLDVFSDAGDTATDSSSSSIFDQYSGLSRQNTTSSISSFTPESSTKPNSVRPSD # TGSLSLRAHAVPQPIIFDNPNSAISPSDDDSLASSPTLFSHSAPFPSALSPPPTPSDSLSGSFPPILQNIRKPFIIAHDKETQKLFDNPDGLVPWGAQ # YELARGVILREWTWEDVREKIHNFTGKSDADTMHSVCYIMKDVTLPKLLKTDIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g278 ### # start gene g279 Scaffold_3 AUGUSTUS gene 1206717 1207223 0.23 + . g279 Scaffold_3 AUGUSTUS transcript 1206717 1207223 0.23 + . g279.t1 Scaffold_3 AUGUSTUS start_codon 1206717 1206719 . + 0 transcript_id "g279.t1"; gene_id "g279"; Scaffold_3 AUGUSTUS CDS 1206717 1207223 0.23 + 0 transcript_id "g279.t1"; gene_id "g279"; Scaffold_3 AUGUSTUS stop_codon 1207221 1207223 . + 0 transcript_id "g279.t1"; gene_id "g279"; # protein sequence = [MAQRLCKVGCIPMDAATKIAETVGTSELGAKNVTQILLEARRLDLDLIEKHVDRAFHKFCSIAGTTKDFDDEKKKKKG # KSSQSDVMAPAIALFAQEIHGLTNTLPNIDQVKASYAYSKGKTVNFGKTVAFRTLCEIQVAASSEGGAPCLRLLDQVKSISGGARRLFQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g279 ### # start gene g280 Scaffold_3 AUGUSTUS gene 1212554 1214662 0.8 + . g280 Scaffold_3 AUGUSTUS transcript 1212554 1214662 0.8 + . g280.t1 Scaffold_3 AUGUSTUS start_codon 1212554 1212556 . + 0 transcript_id "g280.t1"; gene_id "g280"; Scaffold_3 AUGUSTUS CDS 1212554 1214662 0.8 + 0 transcript_id "g280.t1"; gene_id "g280"; Scaffold_3 AUGUSTUS stop_codon 1214660 1214662 . + 0 transcript_id "g280.t1"; gene_id "g280"; # protein sequence = [MPIHIPPDVEDPTPRSIHSQRLSPRSPVVDSDPWLRLSAAQKHAAGELAAQSSQLKASLEALKIESNSAEGAARKAKN # DLDHVRSLANRQKRASADLELRVKARRDELIQCEAFAKALSEPDLLALARARSGLATSPETTSGQDFEESAVEAIREASSNDGSIWSKIVSLVIGPRA # PDNYINSINMTLQARQELRYWKKVSNFWKKTARENNTNTGAPTPSTSNVSEIREILSDERKRAVQELTEKRKTMGLNTTCNASTSSGSLSSSSNESFK # LSYRLPESQPSFTSVMSTMSKSVSSRESTVPQSTDRLAPLASDLFKQDLLSSHSAQRMFSSSSHKSLWSSFAAEKQVQVISRPSEKSFGKRKAVSARD # SSASTVKSCVILADVDLILATFTVSKQLFFRIKRWPNWNFRGMLFILHDLDPRPDGSSSQIDSSSSSGHLSSLASFNSNASRQGVSISHLWTGPKSLP # EDIEPSHNSLTSAERALESFERICNRFSSASNLGSLQSISEESAFSNPAANGPQIVVHISEELSSESLSSAGSMGDLDAQFATLHPELCLPVSKAPFS # GDMTLVESGSEESNQGLTHHENDMTLVEVDREEGLKAIIKEDASLEDGPLTKKSRLPFFKIPDRLSQMSKMTGSSSKKSLSSFRSRNSSSTISTVASK # ENNGPRSVKNFLVGIPGFKPILPLRIIKKDKLGTNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g280 ### # start gene g281 Scaffold_3 AUGUSTUS gene 1218933 1219982 1 + . g281 Scaffold_3 AUGUSTUS transcript 1218933 1219982 1 + . g281.t1 Scaffold_3 AUGUSTUS start_codon 1218933 1218935 . + 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_3 AUGUSTUS CDS 1218933 1219982 1 + 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_3 AUGUSTUS stop_codon 1219980 1219982 . + 0 transcript_id "g281.t1"; gene_id "g281"; # protein sequence = [MDEENESKQPASSADTVVDPFHYNDYIKHEIQGEHTRTPPTPTPTMPPMNYKIPRHPNAIFSFPTPTPYSAPSGNPTL # TLAPCANGSASELFKCIVKKPDVVQMEINDEMQSNASDVTVQFLAELRVYTTVQTHRNICAFLGSLENVGMVLEYIDGRTLFDVISVRPELTVSKKID # YHNQLLDGLTHLHSYGLSHGDLSLLNIQVTNSSDTIKLLDFGRSVSADSVYANPEAEPIDPFTALAKRTSIFSPLPPSKTEQIHPGTRPFCAPEILRG # ECQDARLADAYSFGLIIVCLDRCETVDIRPWDQRKDLLPRDLFEGCSVFEDRARAYLQKWMTRRRLMKEDKMALP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g281 ### # start gene g282 Scaffold_3 AUGUSTUS gene 1221285 1221764 0.78 + . g282 Scaffold_3 AUGUSTUS transcript 1221285 1221764 0.78 + . g282.t1 Scaffold_3 AUGUSTUS start_codon 1221285 1221287 . + 0 transcript_id "g282.t1"; gene_id "g282"; Scaffold_3 AUGUSTUS CDS 1221285 1221764 0.78 + 0 transcript_id "g282.t1"; gene_id "g282"; Scaffold_3 AUGUSTUS stop_codon 1221762 1221764 . + 0 transcript_id "g282.t1"; gene_id "g282"; # protein sequence = [MLPPALPVSERVPQTSINRDVGSDDDDDTVGPQPAVRPNIKRIDERSYGGALLRGEGSAMAAFLQDGTESRIPRRGEI # GLTSDEIAQYEDVGYVMSGSRHRRMNAVRIRKENQVISAEEKRGILKLQKEERERRETILREEFSELVQESLKGAERPKAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g282 ### # start gene g283 Scaffold_3 AUGUSTUS gene 1241449 1242352 0.22 + . g283 Scaffold_3 AUGUSTUS transcript 1241449 1242352 0.22 + . g283.t1 Scaffold_3 AUGUSTUS start_codon 1241449 1241451 . + 0 transcript_id "g283.t1"; gene_id "g283"; Scaffold_3 AUGUSTUS CDS 1241449 1242023 0.22 + 0 transcript_id "g283.t1"; gene_id "g283"; Scaffold_3 AUGUSTUS CDS 1242115 1242352 0.22 + 1 transcript_id "g283.t1"; gene_id "g283"; Scaffold_3 AUGUSTUS stop_codon 1242350 1242352 . + 0 transcript_id "g283.t1"; gene_id "g283"; # protein sequence = [MPPGPGYNWICVLSSAAEIVGHAARYRASQVSRLSKEKASPHRARGVTLENDWNDLKAKAQTVEERLEVQERDGQRGE # EGRIVVPLQPAFAPTTSNSASVSILEPMETTEDRVAISKEAHTPSETASNTVSNVESSINSTSAMPFDEKPLEEGLFKSQSSATTESPTPVDPLEAEL # ERNKSALTEPAAAASTEIDLELTRELLFTGLAASLGYGAASEFLRPSTSSANASDTPNRSVLLTDANIGRLVSKLSQMRGAALKLGQFLSIQGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g283 ### # start gene g284 Scaffold_3 AUGUSTUS gene 1244838 1245920 0.71 + . g284 Scaffold_3 AUGUSTUS transcript 1244838 1245920 0.71 + . g284.t1 Scaffold_3 AUGUSTUS start_codon 1244838 1244840 . + 0 transcript_id "g284.t1"; gene_id "g284"; Scaffold_3 AUGUSTUS CDS 1244838 1245920 0.71 + 0 transcript_id "g284.t1"; gene_id "g284"; Scaffold_3 AUGUSTUS stop_codon 1245918 1245920 . + 0 transcript_id "g284.t1"; gene_id "g284"; # protein sequence = [MQTSPRWRDLTLNVDVVRFSAPLHSCLIGLRLPELQSACIVQPTGYGISTLDLLSGAPKLRDLHALSLPLSWTNPHSL # SQITHLSYCPSFTNFYELLDWCPQLKTLYLSNFEHDRDIRARSIPAKQVPITSLTVSLAGYYPMVQDILLDSMESLVAPALTSLVLEQHGELPDNLYA # PPSPFNAVDSFLARSACPLTVLVLDSMPLTDCEVVALLKRLPSLVELTVTESKFENALPITLDFVESLHSHKRSALRSSVNPILPKLQTLVLEVQVTA # SEFEREGSTLALIDVTVSRWLPEKSYAASIGSRACGLSSCTYWVLLDQANSNSWNLMTNRACDSWLEKAGILNTDRPGIKSEGVVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g284 ### # start gene g285 Scaffold_3 AUGUSTUS gene 1248746 1249483 0.6 - . g285 Scaffold_3 AUGUSTUS transcript 1248746 1249483 0.6 - . g285.t1 Scaffold_3 AUGUSTUS stop_codon 1248746 1248748 . - 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_3 AUGUSTUS CDS 1248746 1249037 0.82 - 1 transcript_id "g285.t1"; gene_id "g285"; Scaffold_3 AUGUSTUS CDS 1249090 1249247 0.96 - 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_3 AUGUSTUS CDS 1249404 1249433 0.94 - 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_3 AUGUSTUS CDS 1249481 1249483 0.74 - 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_3 AUGUSTUS start_codon 1249481 1249483 . - 0 transcript_id "g285.t1"; gene_id "g285"; # protein sequence = [MDAIKLPPCHLPLEVAEGHEEVNEIWASAFPDESTVKEDAIYDAGFGNIQYMFSNPKLSPLVTAMTRVTYPVAMVRWN # YHHLDQFRIMNLDFYLNRKSHPKSVLARIIGSVKLVHGSEDVAYPKSYAEEFLRQLEEAGVEASLLEVPGAPHYLSPDFAAW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g285 ### # start gene g286 Scaffold_3 AUGUSTUS gene 1251511 1252355 0.56 - . g286 Scaffold_3 AUGUSTUS transcript 1251511 1252355 0.56 - . g286.t1 Scaffold_3 AUGUSTUS stop_codon 1251511 1251513 . - 0 transcript_id "g286.t1"; gene_id "g286"; Scaffold_3 AUGUSTUS CDS 1251511 1251981 1 - 0 transcript_id "g286.t1"; gene_id "g286"; Scaffold_3 AUGUSTUS CDS 1252041 1252245 0.63 - 1 transcript_id "g286.t1"; gene_id "g286"; Scaffold_3 AUGUSTUS CDS 1252300 1252355 0.86 - 0 transcript_id "g286.t1"; gene_id "g286"; Scaffold_3 AUGUSTUS start_codon 1252353 1252355 . - 0 transcript_id "g286.t1"; gene_id "g286"; # protein sequence = [MTVPFMDSYVRLLIQTCHRRKVAAMGGMAAQIPIKNDPAANDAVMEKVRLDKLREVLAGHDGTWIAHPLINKIALAVF # NEHMLGPNQYHVRREDVKVAAVDLLNPRVPGTITDEGVRSNISTSLAYTSAWIGGNGCIPLNYLMEDAATAEITRVQLWQWVKYNSRLESGQYITAEY # VEKLIDELAPDVKKIYPGVKEDNLKIAVDYLKGQIKKEWPSEFLTSDLMPYLAIADGAEPKWQKSAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g286 ### # start gene g287 Scaffold_3 AUGUSTUS gene 1261781 1262919 0.88 - . g287 Scaffold_3 AUGUSTUS transcript 1261781 1262919 0.88 - . g287.t1 Scaffold_3 AUGUSTUS stop_codon 1261781 1261783 . - 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_3 AUGUSTUS CDS 1261781 1262290 0.98 - 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_3 AUGUSTUS CDS 1262413 1262919 0.88 - 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_3 AUGUSTUS start_codon 1262917 1262919 . - 0 transcript_id "g287.t1"; gene_id "g287"; # protein sequence = [MRKHSLPRLGRSQTEEGLNIYNSEQLGIGKPSWDSFKSVDRSSSASLPLPSQIPFYTLPKVGELHNSDVGRLRGFVSE # VARSQVPESSAEDMDGPQLESRNSSGSSTDTLPSTSHSLSPSPPKAADPPSFRSPPPSSSGAQHNPNNPNAHAFRNNLLDCAHPASARTSSSTPEPPI # ILPPPSPPPNMGFMSRYAVSQRSMESKADTQTPPPPVPKIVDPSELPPVLPPSRTRSVTGNFLAGPSTSSASTSSASTSSASSTLSYPGAANLGNSSL # SAPGALGQSSMASRTVSPHSSATPPYAPFLSHMPPPADSWIEVETTPLEYRLNIRLPGFKRDGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g287 ### # start gene g288 Scaffold_3 AUGUSTUS gene 1267111 1267980 0.94 + . g288 Scaffold_3 AUGUSTUS transcript 1267111 1267980 0.94 + . g288.t1 Scaffold_3 AUGUSTUS start_codon 1267111 1267113 . + 0 transcript_id "g288.t1"; gene_id "g288"; Scaffold_3 AUGUSTUS CDS 1267111 1267980 0.94 + 0 transcript_id "g288.t1"; gene_id "g288"; Scaffold_3 AUGUSTUS stop_codon 1267978 1267980 . + 0 transcript_id "g288.t1"; gene_id "g288"; # protein sequence = [MTANPAPVSTAPVLPALPPAKETPYKSRTTDLLIFREGQLGDKRDAVIEDLGNMVPEVDLDWFFENLLPPMPKGIDTA # TVVEQLRKSGVVTENGWAGFSQNPQDERRHEDVVFAQLQPIFKAISDTVQELDPSLQPTFTLLMQPTKYPTSERACTSKPDNCWVAIEDVESIKNDPG # RFYTWYNIAGPAEDKKLPESSREQRNKVRFLITVFTSPFTQLVSVECRSDCLQHATNYVSRSLSSVYLWYDDAGSRTEGLVCVSGICSYYKGVRFPQG # MFLLSGLYYAHGDVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g288 ### # start gene g289 Scaffold_3 AUGUSTUS gene 1270164 1270610 0.99 - . g289 Scaffold_3 AUGUSTUS transcript 1270164 1270610 0.99 - . g289.t1 Scaffold_3 AUGUSTUS stop_codon 1270164 1270166 . - 0 transcript_id "g289.t1"; gene_id "g289"; Scaffold_3 AUGUSTUS CDS 1270164 1270610 0.99 - 0 transcript_id "g289.t1"; gene_id "g289"; Scaffold_3 AUGUSTUS start_codon 1270608 1270610 . - 0 transcript_id "g289.t1"; gene_id "g289"; # protein sequence = [MYSGNESPHRQGKGPRIPPKGIDVWFVPGITFGHRDAAVHGDPMTARHMQGQVEGFLWHKFGKAVSWQNAYSTELKLD # HVRFRMKHDAGYSTGYAIGIVDMGSGPGTATTDPFHGVYESVPTETGGDFEKLLEIFRKEYPAATPANGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g289 ### # start gene g290 Scaffold_3 AUGUSTUS gene 1275682 1277106 0.83 + . g290 Scaffold_3 AUGUSTUS transcript 1275682 1277106 0.83 + . g290.t1 Scaffold_3 AUGUSTUS start_codon 1275682 1275684 . + 0 transcript_id "g290.t1"; gene_id "g290"; Scaffold_3 AUGUSTUS CDS 1275682 1277106 0.83 + 0 transcript_id "g290.t1"; gene_id "g290"; Scaffold_3 AUGUSTUS stop_codon 1277104 1277106 . + 0 transcript_id "g290.t1"; gene_id "g290"; # protein sequence = [MPISYAFRDAFGVKDVVEDTKTTLRGEGMDYREFEPSEGFMHQGLGRERRIRAGLRYSKGGKRKYWLPTFSAAEPPGR # IERGVDRVVQKVAGRDQAEDVYAPLLQGQAEDVVHLAPDMIDDSDELVDLWSSSRVGVEEGFDLPFGDLDDDDEALFAHCKRYLFGDYNYPCIDASTE # FARAAIWDEEERILRDEHGAWFSPIRGSKGFMNIQQQRHVPGGYGAMGTSNRQYVDDAREERVIDMELEREERKVTGAVKMQWARNKNQTRPSGSGSR # SPQTGNGSRPTSHSPNVRVRVESAGSSSTPSASTPSRTPAGSPGASRLRSLPNPLSRSNSSNNESRTPPLPPDAVDLVVEASEDDDPKKRLRKVYRRG # FVARDEQGHPEERGEIEVKGHGRDRVEAGEEIAEAIEDEGEHVESAVERVEGDDVDLEIDRETTTGVAEQDSHGQDVVIARSTTPPAYARPRYDLDDD # NPWA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g290 ### # start gene g291 Scaffold_3 AUGUSTUS gene 1284205 1284981 0.53 + . g291 Scaffold_3 AUGUSTUS transcript 1284205 1284981 0.53 + . g291.t1 Scaffold_3 AUGUSTUS start_codon 1284205 1284207 . + 0 transcript_id "g291.t1"; gene_id "g291"; Scaffold_3 AUGUSTUS CDS 1284205 1284981 0.53 + 0 transcript_id "g291.t1"; gene_id "g291"; Scaffold_3 AUGUSTUS stop_codon 1284979 1284981 . + 0 transcript_id "g291.t1"; gene_id "g291"; # protein sequence = [MLQLGISSSNVYVPEGDSSTPAQLAGSEEDRFLKRLWQQPAILELLRGPRGVNLRQQWSAQLNLLIAIDCIDEESVVF # AENTVSMVIADLLALVVVDLSDIQFEHMGRWRLLSPYSSREKETKADLLFGLHLEDTIKQFDVKLSSLEGYKAIWPLVENLNPTYMRCITSMECKNIA # LGDPRGYLMLLLLTRLMTDGKVREFWPRLDCSGCQEFAESHAALARDAASVQIPDDDPGRELGIIPLLTLWFFVPSSIVFWL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g291 ### # start gene g292 Scaffold_3 AUGUSTUS gene 1285528 1286730 0.89 + . g292 Scaffold_3 AUGUSTUS transcript 1285528 1286730 0.89 + . g292.t1 Scaffold_3 AUGUSTUS start_codon 1285528 1285530 . + 0 transcript_id "g292.t1"; gene_id "g292"; Scaffold_3 AUGUSTUS CDS 1285528 1286730 0.89 + 0 transcript_id "g292.t1"; gene_id "g292"; Scaffold_3 AUGUSTUS stop_codon 1286728 1286730 . + 0 transcript_id "g292.t1"; gene_id "g292"; # protein sequence = [MIVISQIKVTTTTDEDDNDEDDPDEDDNDEDDTDNGDSDNSNDSPDQGNDSAGPRGGAGAGGNSGSGSSGQGRSSGGG # SSNARTKRSLKPTYSQGDNKRPRQHSDFQVVLNVSPISLANMFLILGFQRLHLAFNCPGEQLLSDGFSHYFFIPTAESSTGVSGGAATNITAALPVSV # PSGTVTPPRRGSLTSSLSSGSGTSSSDTDAFWSPTSTVSSIHSLPLSSPQYSPVRPKGITTTRSTDNSLTQTTSQSVVESLSATSLIESRPQNPLSII # DHAGVILDTKVHQSTIGIVWAGKMYLEGLASVPKPLRIVVKLADWERDSEAPEGSETLHGKALRSEAKIYHHLVGSNIGPHFYGVFNNSGSIALVLEY # MGKRLSNFGTLTDDRYFLSTYAKSCKLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g292 ### # start gene g293 Scaffold_3 AUGUSTUS gene 1289541 1290128 0.82 + . g293 Scaffold_3 AUGUSTUS transcript 1289541 1290128 0.82 + . g293.t1 Scaffold_3 AUGUSTUS start_codon 1289541 1289543 . + 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_3 AUGUSTUS CDS 1289541 1289600 0.82 + 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_3 AUGUSTUS CDS 1289685 1290128 0.82 + 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_3 AUGUSTUS stop_codon 1290126 1290128 . + 0 transcript_id "g293.t1"; gene_id "g293"; # protein sequence = [MVITLAPGTFTYQLLTSRVTCLTTEGDLNESDSNNSNNSPNQGNDSAGPRVCAGTEVNSASGSSDQDRSSGGGSSNAR # TKRSLGPTYSQRDNKRPRQHSDFQVILNASPISGGNICFLTLGFQELHLAFNCPRENLLSHGFSEYSVIPMVESSTGTSDSTATNITSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g293 ### # start gene g294 Scaffold_3 AUGUSTUS gene 1292630 1294716 0.98 - . g294 Scaffold_3 AUGUSTUS transcript 1292630 1294716 0.98 - . g294.t1 Scaffold_3 AUGUSTUS stop_codon 1292630 1292632 . - 0 transcript_id "g294.t1"; gene_id "g294"; Scaffold_3 AUGUSTUS CDS 1292630 1293389 0.99 - 1 transcript_id "g294.t1"; gene_id "g294"; Scaffold_3 AUGUSTUS CDS 1293473 1294716 0.98 - 0 transcript_id "g294.t1"; gene_id "g294"; Scaffold_3 AUGUSTUS start_codon 1294714 1294716 . - 0 transcript_id "g294.t1"; gene_id "g294"; # protein sequence = [MKFFLLRRFSHLIHRRTRSDSALPELSLPSQRDFPHSLSLGDLVQQLGDYSRYPNALPPTESRTTTSNRPLLAESSEN # PSVAIFYVEQCISQLQKENAQLQVTREHIKTQLELKSTELYSYKTRIASLNHSLSKLNLVIEAFEQELVSLGTSIDSIDQSFVLLLDIAVCGPVFHRT # RSAISSGFVFMDAIVDAIREAAEVPHSPWSALIPPVIGARSQDHYASALSITLRTRSDVRRIKNLARYWKSSAQEDEKHKDVITPSGSTLSEVQEVFT # TERQKAVDALWIKLKSGELPIRSTVVSQAREEDTALIHAFTVKPSAPSVNASSLFMPPDPQSIKPQMSASVAASIVTLNVSKCSLTMLFHFFYFLQAS # LTHSSSGESFPSTQSSGDSSIVGSAPSTSTRLCSEEAISPLPRESAGSDFTTKDAIQSLELIYNRFNNMKLDTINEASPVCPADTILPEAHTTCVPAE # NAFLSETDILSSDSDESGSDFEADFVIVSIPTSAESSSAKKRNSILKSLNISSRIPRRISISLSPTSFKSRSPTKSAKTGLNVPLKKGNLLSTPDRPG # DISKVLPMSVGSTTVRKLVGKTPKDRSTPSASRCQEARTSSPIANRPPSRPTISSSLKKDPQYITFAFHESRKCKKQHTLHLPSNWSRRCEWVVSKCV # R] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g294 ### # start gene g295 Scaffold_3 AUGUSTUS gene 1295937 1297407 0.22 + . g295 Scaffold_3 AUGUSTUS transcript 1295937 1297407 0.22 + . g295.t1 Scaffold_3 AUGUSTUS start_codon 1295937 1295939 . + 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_3 AUGUSTUS CDS 1295937 1295942 0.58 + 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_3 AUGUSTUS CDS 1295994 1296112 0.86 + 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_3 AUGUSTUS CDS 1296229 1296562 0.7 + 1 transcript_id "g295.t1"; gene_id "g295"; Scaffold_3 AUGUSTUS CDS 1296619 1297060 0.65 + 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_3 AUGUSTUS CDS 1297157 1297407 0.47 + 2 transcript_id "g295.t1"; gene_id "g295"; Scaffold_3 AUGUSTUS stop_codon 1297405 1297407 . + 0 transcript_id "g295.t1"; gene_id "g295"; # protein sequence = [MKGAFFFLVQNEDGDLFKVTIEHEDEEVKSLKIKYFDTVPVAYFYQFQKLGDDDEEPEFSSTSYRSFGMADPTAPLPN # EYFRPRPLENLALADELESLDPILDSKVLNILPNSDTPQIFAACGRGSRSSLRTLRHGLEVEESVSSDLPGIPNATYILTTLYSDAYDSYIILSFVNG # TLVLSIGETIEEVQDTGFLSSARTLAVQQIGTDALLQVHPEGIRHVLANGHVTEWKSPSGKTIVNATTNKRQVVVALSSAELVYFELDLEGQLNEYQD # RKAMGSTVLALSIAEVPEGRTEDTVPDPESTLETISLQALTAPPSSICIAEMLDASINKSQPTLFVNIGLQNGVLLRTVLDPTNGQLTDTRTRYLTYH # SSFPYNNLTSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g295 ### # start gene g296 Scaffold_3 AUGUSTUS gene 1298506 1299219 0.75 + . g296 Scaffold_3 AUGUSTUS transcript 1298506 1299219 0.75 + . g296.t1 Scaffold_3 AUGUSTUS start_codon 1298506 1298508 . + 0 transcript_id "g296.t1"; gene_id "g296"; Scaffold_3 AUGUSTUS CDS 1298506 1299219 0.75 + 0 transcript_id "g296.t1"; gene_id "g296"; Scaffold_3 AUGUSTUS stop_codon 1299217 1299219 . + 0 transcript_id "g296.t1"; gene_id "g296"; # protein sequence = [MVQTFASPIITLNTQGSRIIVGEMQESVSFVAYKAPENRLLVFADDSQSRWVSAVAMVDYNTVAIGDRFGNIIVNRLD # TKESDQVDEDPTGAGILHEKGILMGAPHKTKMVAHFHVGDLITSIHKVAMVAGGREILLYTGLHGTVGILVPFVSKEDVDFISTLEQHLRTEQSSLVG # RDQLSWRGYYTPVKAVVDGDLCETFARLPGSKQSAIAGELDRTVGEVLKKLEQLRVTTSGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g296 ### # start gene g297 Scaffold_3 AUGUSTUS gene 1301378 1302550 0.45 + . g297 Scaffold_3 AUGUSTUS transcript 1301378 1302550 0.45 + . g297.t1 Scaffold_3 AUGUSTUS start_codon 1301378 1301380 . + 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_3 AUGUSTUS CDS 1301378 1301527 0.67 + 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_3 AUGUSTUS CDS 1301666 1302550 0.73 + 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_3 AUGUSTUS stop_codon 1302548 1302550 . + 0 transcript_id "g297.t1"; gene_id "g297"; # protein sequence = [MFLSCLDSITKRLEYIKARNALITAMLPESNIDEIQACETEFSDAIERFQVTQLQTSFDDLKARLGPLDDSQLVVPTM # PNPPTIFHGRNEIVNEIANTLARRSIDGKLSRFCILGPGGLGKTSAALAVMQHPLIRSSFEEGQFWIPCNTANSPNALLDALAEGTGVNPQTKNLLRS # ILSRLSSLPGQSILLLDNFETPWLLDEGSQSRIQAILEQLNSLPNVAILLTMRSNSPPLRDWKHTDLPPVDLDNSRKIYLDIDGAAHDSPDFLLDTLG # HMPGAVYLMANLGANSLSTPTELLQQWRAGGINVMDHCIGLSMKSSFVADLQSSYSRFCRCFQLELFAVT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g297 ### # start gene g298 Scaffold_3 AUGUSTUS gene 1303541 1303867 0.85 + . g298 Scaffold_3 AUGUSTUS transcript 1303541 1303867 0.85 + . g298.t1 Scaffold_3 AUGUSTUS start_codon 1303541 1303543 . + 0 transcript_id "g298.t1"; gene_id "g298"; Scaffold_3 AUGUSTUS CDS 1303541 1303867 0.85 + 0 transcript_id "g298.t1"; gene_id "g298"; Scaffold_3 AUGUSTUS stop_codon 1303865 1303867 . + 0 transcript_id "g298.t1"; gene_id "g298"; # protein sequence = [MKSLQAPGDAILEVLNDALKHSYREPLPLAFTLLEYGEVYLKRRDWRAATLAYEEARNAISRLDKEGHRGIPDECNNK # IQVIRRYETQEVDPPEEELASLIPAPRLFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g298 ### # start gene g299 Scaffold_3 AUGUSTUS gene 1306437 1306811 0.51 + . g299 Scaffold_3 AUGUSTUS transcript 1306437 1306811 0.51 + . g299.t1 Scaffold_3 AUGUSTUS start_codon 1306437 1306439 . + 0 transcript_id "g299.t1"; gene_id "g299"; Scaffold_3 AUGUSTUS CDS 1306437 1306811 0.51 + 0 transcript_id "g299.t1"; gene_id "g299"; Scaffold_3 AUGUSTUS stop_codon 1306809 1306811 . + 0 transcript_id "g299.t1"; gene_id "g299"; # protein sequence = [MTETITNPPFIGINNFRDVGRVINACTSRHDCVEVCELNKLPRMKEGMLLRSGRLDEATAEDTQLMIDKYGLKTVIDL # RTKTEHLRSRDFEVQCERRWDTVKINFIGRKFELNLLKQLRWWQAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g299 ### # start gene g300 Scaffold_3 AUGUSTUS gene 1319639 1319917 0.97 - . g300 Scaffold_3 AUGUSTUS transcript 1319639 1319917 0.97 - . g300.t1 Scaffold_3 AUGUSTUS stop_codon 1319639 1319641 . - 0 transcript_id "g300.t1"; gene_id "g300"; Scaffold_3 AUGUSTUS CDS 1319639 1319917 0.97 - 0 transcript_id "g300.t1"; gene_id "g300"; Scaffold_3 AUGUSTUS start_codon 1319915 1319917 . - 0 transcript_id "g300.t1"; gene_id "g300"; # protein sequence = [MKKVIERMNNSVVAEQLAQQKIPKEKKKWPFGRKTSGTGKDDKNAAAAAAAAAAAGDDEEVEGMRVDFYLVVFLKFIA # SIVPTIEVDSTTSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g300 ### # start gene g301 Scaffold_3 AUGUSTUS gene 1320254 1320786 0.31 - . g301 Scaffold_3 AUGUSTUS transcript 1320254 1320786 0.31 - . g301.t1 Scaffold_3 AUGUSTUS stop_codon 1320254 1320256 . - 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_3 AUGUSTUS CDS 1320254 1320660 0.38 - 2 transcript_id "g301.t1"; gene_id "g301"; Scaffold_3 AUGUSTUS CDS 1320732 1320786 0.34 - 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_3 AUGUSTUS start_codon 1320784 1320786 . - 0 transcript_id "g301.t1"; gene_id "g301"; # protein sequence = [MDLVRYSTVAISFYGLTSFTRGVPCLRRATSLAYTDADEDAERLLNFGDSSAGGDGDEWVETHAGRKPNLDSAANPGE # IADIPDDNAQDDDLASGVGNMSLGNVPAMSEIPDIDEIPDMEEEDLEEGDAATAPVKATPNVIDPRCVIALYSLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g301 ### # start gene g302 Scaffold_3 AUGUSTUS gene 1321257 1323796 0.04 - . g302 Scaffold_3 AUGUSTUS transcript 1321257 1323796 0.04 - . g302.t1 Scaffold_3 AUGUSTUS stop_codon 1321257 1321259 . - 0 transcript_id "g302.t1"; gene_id "g302"; Scaffold_3 AUGUSTUS CDS 1321257 1321562 0.25 - 0 transcript_id "g302.t1"; gene_id "g302"; Scaffold_3 AUGUSTUS CDS 1321646 1322129 0.68 - 1 transcript_id "g302.t1"; gene_id "g302"; Scaffold_3 AUGUSTUS CDS 1323276 1323796 0.23 - 0 transcript_id "g302.t1"; gene_id "g302"; Scaffold_3 AUGUSTUS start_codon 1323794 1323796 . - 0 transcript_id "g302.t1"; gene_id "g302"; # protein sequence = [MNPYAYPAPGYYPPAQQYHPHPAPFYAPGYPTQLPPPSTTKLISSVKTLTHILLSSATNRSAKYPSLHHILAVDSTTL # KIDIKQKPRAGINASTFYAYADMYAMAIPTYHIRLISKAFPWSIEIKSTTPITCAAVWDALHSALQENIADSEWGMLAGEKKLRETIEKAAKKRGHKK # SKIAEAVPAEDSKKKSSEEKEEKKKRKEAKKLAKDVTATAEISSAEGKQDKEIIEDVEMANVTSTKEEKKRRKSRSGGEGEHSLVTGTETKEKQKKQK # KEVNEVEGQKKEEEQSSTEEQKKRKKRKEDDVVEVKEREQENLEQKTQKTGKKERKESEAEEREQPEDSEHPEAKTEKKRRKKVEKQAAEVIDQAKEK # SKEDKHKRKDKEQQKNVIKESTATKKSKTEQVSVVEEAKLDVQTEKKKEKKSKKSRKSVSEAES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g302 ### # start gene g303 Scaffold_3 AUGUSTUS gene 1327168 1328259 0.97 + . g303 Scaffold_3 AUGUSTUS transcript 1327168 1328259 0.97 + . g303.t1 Scaffold_3 AUGUSTUS start_codon 1327168 1327170 . + 0 transcript_id "g303.t1"; gene_id "g303"; Scaffold_3 AUGUSTUS CDS 1327168 1328259 0.97 + 0 transcript_id "g303.t1"; gene_id "g303"; Scaffold_3 AUGUSTUS stop_codon 1328257 1328259 . + 0 transcript_id "g303.t1"; gene_id "g303"; # protein sequence = [MQSFSSVKVEFCDLDGLQWTGSALRKRTVSRPDSNSCILSQCKNLNQNSPRRARAQTLFCPSSPSLSSSSLSPSSSYF # PSLDTPLSSPKCRKPEALTPLNNVDFAPNFDEKTVRACVSPVKAALDSQKHTASNRDLDSRPPAKQRRRSRSPVKGAFIGETKSSAKHESRSDILPTV # VYDSKPAMSTPPPPAYTGGAPMERLESSSSRRSLTRTYTQAEITFGVSPTVATEVMRGRERSRGFRVPSKLALEDTMVFDESEEVIESDLVGLGPIRL # SPPKADRERGQRLRGLAPQHPSSSARLFQSIVEEEDPLVTPTPERFSSVLEYPISPETPIQPRCSCADLTLLKRKRQSSETQNEIDQEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g303 ### # start gene g304 Scaffold_3 AUGUSTUS gene 1329499 1329915 0.67 + . g304 Scaffold_3 AUGUSTUS transcript 1329499 1329915 0.67 + . g304.t1 Scaffold_3 AUGUSTUS start_codon 1329499 1329501 . + 0 transcript_id "g304.t1"; gene_id "g304"; Scaffold_3 AUGUSTUS CDS 1329499 1329671 0.77 + 0 transcript_id "g304.t1"; gene_id "g304"; Scaffold_3 AUGUSTUS CDS 1329729 1329915 0.86 + 1 transcript_id "g304.t1"; gene_id "g304"; Scaffold_3 AUGUSTUS stop_codon 1329913 1329915 . + 0 transcript_id "g304.t1"; gene_id "g304"; # protein sequence = [MLGTTMVGLITSAVQWSSSFSHFPVAVLNPDGSYAPIILRLAWHSSGTYDKESKTGGSNYATMRFAPESQHGANAGLD # VARDLMENIKKEFPWISYGDLWTLGGMGAFVFENPFLLLDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g304 ### # start gene g305 Scaffold_3 AUGUSTUS gene 1335862 1336257 0.51 + . g305 Scaffold_3 AUGUSTUS transcript 1335862 1336257 0.51 + . g305.t1 Scaffold_3 AUGUSTUS start_codon 1335862 1335864 . + 0 transcript_id "g305.t1"; gene_id "g305"; Scaffold_3 AUGUSTUS CDS 1335862 1336257 0.51 + 0 transcript_id "g305.t1"; gene_id "g305"; Scaffold_3 AUGUSTUS stop_codon 1336255 1336257 . + 0 transcript_id "g305.t1"; gene_id "g305"; # protein sequence = [MHSIFNGSVSPASREQHIAIPLNEEEASIQPSFLPQSGSLSSLSPTDHDMSKEKERARLEIILEKECILLKGTGVDVE # PARLSGHVALYLSESTSIKEITLQFRGKARLPVPSHESYVEHSSIATQPRTHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g305 ### # start gene g306 Scaffold_3 AUGUSTUS gene 1336613 1337773 0.18 + . g306 Scaffold_3 AUGUSTUS transcript 1336613 1337773 0.18 + . g306.t1 Scaffold_3 AUGUSTUS start_codon 1336613 1336615 . + 0 transcript_id "g306.t1"; gene_id "g306"; Scaffold_3 AUGUSTUS CDS 1336613 1337773 0.18 + 0 transcript_id "g306.t1"; gene_id "g306"; Scaffold_3 AUGUSTUS stop_codon 1337771 1337773 . + 0 transcript_id "g306.t1"; gene_id "g306"; # protein sequence = [MIPHKAWACGDTVTALVKFSPLLKGVGVLNINTSIHETVKVYTRTGHQEHNRAVASMKHEIVGGKAVEVHEHEHRHRT # AQTPCGSPSPGTPSLSSSYRSTGSAGGYFAYSPNGSQTSQPGPSSLPASLSASPSSQLLRDPVEGLEMSQDDVVTYLLLPIPLNITPTHVLDPIHVTH # RIRWSILILNPDGHTSELRCSLPLHVLDPRLLNEARMNTAATRRLLIGGPEVPAEETEDDMELPSYHAHVRDRIANMYLPESATMRVTNPWVRDGVNS # LGGNSDVVSPWPRSRSGYSSPLDAHALSHLPHAPGSGDSTPLDWVNSELLLLHPDSDPHTQTIGHFSQTSSEVSPDHSNPSSSPVTRPNSRPTSSYPS # RRSSRASSPNVVAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g306 ### # start gene g307 Scaffold_3 AUGUSTUS gene 1338621 1340827 0.17 - . g307 Scaffold_3 AUGUSTUS transcript 1338621 1340827 0.17 - . g307.t1 Scaffold_3 AUGUSTUS stop_codon 1338621 1338623 . - 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_3 AUGUSTUS CDS 1338621 1339170 0.96 - 1 transcript_id "g307.t1"; gene_id "g307"; Scaffold_3 AUGUSTUS CDS 1339350 1339685 0.5 - 1 transcript_id "g307.t1"; gene_id "g307"; Scaffold_3 AUGUSTUS CDS 1340089 1340615 0.5 - 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_3 AUGUSTUS CDS 1340678 1340827 0.34 - 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_3 AUGUSTUS start_codon 1340825 1340827 . - 0 transcript_id "g307.t1"; gene_id "g307"; # protein sequence = [MSAAGLFDQCLKSSNPRAVWREIHDTDANGDIPSVRGGHAMCIDTQRRYIYLFGGWDGQTSLADFWRYDIKEQRWVVL # SANTSLESNGPGPRSCHKMVYDSKTNSIYVLGRLDDQDRPTSRAQTRNSESAGSPGFNRSSGAADETPTLSSRPMPSSEFCRYRCEDNTWADLDIDVN # GPRTIFDHQMVMDSEAQILYVFGGRAAEKDYDYSGLHSFNVRMKKWSLLQFGGLIHDRATLSESSNWLYRYPSRPGKWQKIQPLKGLHKSPTPSSSSP # QITANPPSRFAHQVVYDLPSKTVYLHGGTMMDSDSAKLREGNDGQTEEAPMKRLSDFWEMSLWRFKEMCETQAPVQSLIYLQNQVSEVVNHDDPSETQ # LFRSLLTHLLMNSSPISTVPSAIETESPRNNYAGNAKPQTDSSLLNISTGNSSDQLGHPGLLQSGLDSVHISSEPLPDLSSQNRTNTKIQTSEDPYER # KLHPTKDPTSQECFVQRTKTFEAILEFVDDDAKQPAGSLLELVDVDADLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g307 ### # start gene g308 Scaffold_3 AUGUSTUS gene 1347703 1349620 0.74 - . g308 Scaffold_3 AUGUSTUS transcript 1347703 1349620 0.74 - . g308.t1 Scaffold_3 AUGUSTUS stop_codon 1347703 1347705 . - 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_3 AUGUSTUS CDS 1347703 1348983 1 - 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_3 AUGUSTUS CDS 1349039 1349620 0.74 - 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_3 AUGUSTUS start_codon 1349618 1349620 . - 0 transcript_id "g308.t1"; gene_id "g308"; # protein sequence = [MSSSTHQFTRFSSDTLEGMFDGDPDSEWSLRIYKELFKKEEGSQDSEFNKHTRRIYKVWPRDPKGGGKPCLMSDLREL # SAGYRTNNSYHLWGATILDFYMFRSFNDECADAMLGFSSGSKLYAWMKAHGELYAKDELEWAEMEEKPRLRPAADILEIIEAKNLAILMGSCGISMRD # DDDGEAEEESDESENETISAIPRPFDYENYPDPWPLVPFSSKAPTLQSPIPFHLLPETLIVHDPFRLLNGGDPPDELDVDWTSVDDITHRYSLNLTVP # SIKDSIAAERAKMTEAAREGGPVFIGFSLEILNRTETGIGSSSTAQSGTAFKLTVPSPPASPSSIPEAHLFISPTEFVGKGHHSVVYRAEWDLPRSVF # SKYVICHRCVIEAAKKILSKDTISNAAGDTRSPSDEVGPADEIVGGNFILRKKHLPAIDMNFVREGQREDENTPCYSVRGETLDYLEYTGESIPTIHV # DTVPWYDSSSTDPAPCSHLAVTSSISGPLPGPVPPTASVSVIAKLSVYDDNHLEKEAKCYQSFGEDFSQHWSGYTVALPLRDPTPTGAITPNFYGFYS # KEEDKTKDNEEKVIDRDSFLSPILLIEDCGNPIEVKKLSLDDRCVQLHLRLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g308 ### # start gene g309 Scaffold_3 AUGUSTUS gene 1354076 1354348 0.38 + . g309 Scaffold_3 AUGUSTUS transcript 1354076 1354348 0.38 + . g309.t1 Scaffold_3 AUGUSTUS start_codon 1354076 1354078 . + 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_3 AUGUSTUS CDS 1354076 1354348 0.38 + 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_3 AUGUSTUS stop_codon 1354346 1354348 . + 0 transcript_id "g309.t1"; gene_id "g309"; # protein sequence = [MEVEEDNSINELKRENEVLKASMAKFEQEWNAALATLGIKFPNGKQPPSTSAPDESKDEGASESTSSNAESSQPSHSL # ATLIAAASQLPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g309 ### # start gene g310 Scaffold_3 AUGUSTUS gene 1354837 1355593 0.39 + . g310 Scaffold_3 AUGUSTUS transcript 1354837 1355593 0.39 + . g310.t1 Scaffold_3 AUGUSTUS start_codon 1354837 1354839 . + 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_3 AUGUSTUS CDS 1354837 1355049 0.39 + 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_3 AUGUSTUS CDS 1355162 1355593 0.48 + 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_3 AUGUSTUS stop_codon 1355591 1355593 . + 0 transcript_id "g310.t1"; gene_id "g310"; # protein sequence = [MNSQSGSKERRHTDEDDSVGDTTDEEAPLEAAMKLEEEEEEKKALAILLKRENVRCNDENNLDYILTVHTYRLHCEVD # VSREFMSNVFGGNTQYTFPAIGKDKFRKHGLNDFMYLSKSYNPVAPTIPGQSGLFFSHDNFWLSNINPTAKELEDAEQPGWAKVSQRVLTRLKPSHWL # YVGQYTVSFSRALAPSEWENLSEKVSNCSDVLRSHHIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g310 ### # start gene g311 Scaffold_3 AUGUSTUS gene 1359077 1359443 0.72 - . g311 Scaffold_3 AUGUSTUS transcript 1359077 1359443 0.72 - . g311.t1 Scaffold_3 AUGUSTUS stop_codon 1359077 1359079 . - 0 transcript_id "g311.t1"; gene_id "g311"; Scaffold_3 AUGUSTUS CDS 1359077 1359247 0.94 - 0 transcript_id "g311.t1"; gene_id "g311"; Scaffold_3 AUGUSTUS CDS 1359375 1359443 0.72 - 0 transcript_id "g311.t1"; gene_id "g311"; Scaffold_3 AUGUSTUS start_codon 1359441 1359443 . - 0 transcript_id "g311.t1"; gene_id "g311"; # protein sequence = [MDEDEDDDDDEDDEDEEEGSEEEEDEDDSMEEIDPSVIMAGRRTRGKKVDYTSAEALAKAGLKSSEKEEDDDDDEMKE # N] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g311 ### # start gene g312 Scaffold_3 AUGUSTUS gene 1360733 1361314 0.49 + . g312 Scaffold_3 AUGUSTUS transcript 1360733 1361314 0.49 + . g312.t1 Scaffold_3 AUGUSTUS start_codon 1360733 1360735 . + 0 transcript_id "g312.t1"; gene_id "g312"; Scaffold_3 AUGUSTUS CDS 1360733 1361314 0.49 + 0 transcript_id "g312.t1"; gene_id "g312"; Scaffold_3 AUGUSTUS stop_codon 1361312 1361314 . + 0 transcript_id "g312.t1"; gene_id "g312"; # protein sequence = [MPPIIKVFETLHDKYDTRPMLVHHGVSILLLDYVMVTALLLTTDIQEWMVVQKHDGEVNHELPPEVSGSDDFGPRSAP # PASTSALQWRKVLYGVPLYPKRQSSASTASHVRFPGNLNQIAKIVNGEPMYPSLYRESSSIDFSSSESESDQETESEDILDTRVQPSSTPSPHQVPLP # NLFSTLSRQPLHHLTLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g312 ### # start gene g313 Scaffold_3 AUGUSTUS gene 1363199 1363807 0.79 + . g313 Scaffold_3 AUGUSTUS transcript 1363199 1363807 0.79 + . g313.t1 Scaffold_3 AUGUSTUS start_codon 1363199 1363201 . + 0 transcript_id "g313.t1"; gene_id "g313"; Scaffold_3 AUGUSTUS CDS 1363199 1363807 0.79 + 0 transcript_id "g313.t1"; gene_id "g313"; Scaffold_3 AUGUSTUS stop_codon 1363805 1363807 . + 0 transcript_id "g313.t1"; gene_id "g313"; # protein sequence = [MNGKDLARHGNGADAGFKAVERKISSPPKNNNDNASSSRYPYTPSIHTHPLNLNLNSSLNMTRISPIPEKGSSPDTAR # TSADDNSPTTPDLQTQTQWSIGERPTPSASHTSMNEMQTPGPANIKAKGTPKKGAGSKKPDALTNASFPLPIEPPTSTINISGDVLAILKLSTSEKRT # GLLMSEKWSTPIFAFWAVFTLNSRKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g313 ### # start gene g314 Scaffold_3 AUGUSTUS gene 1365041 1366453 1 + . g314 Scaffold_3 AUGUSTUS transcript 1365041 1366453 1 + . g314.t1 Scaffold_3 AUGUSTUS start_codon 1365041 1365043 . + 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_3 AUGUSTUS CDS 1365041 1366453 1 + 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_3 AUGUSTUS stop_codon 1366451 1366453 . + 0 transcript_id "g314.t1"; gene_id "g314"; # protein sequence = [MLSQYDLILIQETHLCTEEEDALTKLDGFNFFVQSRTTAKQWEKQHGGVCAFVRKGIAASKSKLSSPDILVLDLGSLW # VINAYILPVLSRYIHFTDVAPEEQLFETIRICALVDSSKKTVVATDANGRTSSRTPKAAHLTRLSQDTEINARGLRILQLCEEMNLAIVNGTELESPN # RGSYTSHQHNGKAVVDYILVSDELCPMIQNLSVEVRPLSKKDQWSDHSKLSLVMSREIYTMTAQRSSQPKVPLTIPIHDEWTDTLYQEMLQSGKPPHL # LLRDFYGPVYYDQNPISVYTDGSCLENGKDYARAGSGICFGLQSNQNISLRVPGPETPTNNRAEAYAVLMLLAKVNPKRAMNIFCDSTYVIRECCYWA # GRHLSTGWKMPNGDLLKDICLLLKYRLAFTCFIWVKGHSGIPQNELADELAKIGCTKDIPRNYSPLVSSPWEGDPGNRQAIDVQKVSTIYRNTQNPEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g314 ### # start gene g315 Scaffold_3 AUGUSTUS gene 1366728 1367030 0.9 + . g315 Scaffold_3 AUGUSTUS transcript 1366728 1367030 0.9 + . g315.t1 Scaffold_3 AUGUSTUS start_codon 1366728 1366730 . + 0 transcript_id "g315.t1"; gene_id "g315"; Scaffold_3 AUGUSTUS CDS 1366728 1367030 0.9 + 0 transcript_id "g315.t1"; gene_id "g315"; Scaffold_3 AUGUSTUS stop_codon 1367028 1367030 . + 0 transcript_id "g315.t1"; gene_id "g315"; # protein sequence = [MLPEANLDPTEQKFFSLTIHEEEVADAKEHVLECNLNSAIGSDSISYKEIMDIPNENIASFLNFCVKNKTSTFKMVIC # NSDWHSKTWKECFRPKWLSPYC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g315 ### # start gene g316 Scaffold_3 AUGUSTUS gene 1367121 1368806 0.95 + . g316 Scaffold_3 AUGUSTUS transcript 1367121 1368806 0.95 + . g316.t1 Scaffold_3 AUGUSTUS start_codon 1367121 1367123 . + 0 transcript_id "g316.t1"; gene_id "g316"; Scaffold_3 AUGUSTUS CDS 1367121 1368806 0.95 + 0 transcript_id "g316.t1"; gene_id "g316"; Scaffold_3 AUGUSTUS stop_codon 1368804 1368806 . + 0 transcript_id "g316.t1"; gene_id "g316"; # protein sequence = [MASDLHTEQLTIRLILRTMIDKAKSLGTPLYFAYMDWTNAFPSTDRSVMWIKLFSMGVKGPMIDWLRMLYAKMAYVVR # VCGSHSEPFGGDMGVITGSPVSPNLFNLVVADFKVTEHPTDVVLHDKHVNHMLQADDTGMASTTPSSIQSKLRQFEQYASLTGFEVSVPKCMITVFGQ # EANADTVFMLHDKPLQKKKKLKYIGVHHQTGQGGIYKDNYQKLADKAKNAAGAVLHAKTFVGNDMPIKDMITMYWARVDPYLKSGSEFIMDVVVSHRE # QLEEVQHYFLRRALSIQKRSSLEVLFTETGVMPIRYRRIILFFKNMQYLISLPHHHLAWKAMREAYSLAQKGHTSIILEACRVLESLPIPVTWNIPEF # EDITAAHLNGLIEHIQDSMERTLQNALMTCPRTADTLKDRKEYDRKNKKMVFKALAFRHYLTVPTGKHRKALIHMVTGNHQLAVERLRWNERNRPRII # REHRICRICKCSVEDPAHVLFECKGSTELIKLRDSFMQKVISELPQYAKSYSNAWMLFRILLAETRITELFAKLTYDVLEVVYNTEMFVPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g316 ### # start gene g317 Scaffold_3 AUGUSTUS gene 1369459 1369929 0.9 + . g317 Scaffold_3 AUGUSTUS transcript 1369459 1369929 0.9 + . g317.t1 Scaffold_3 AUGUSTUS start_codon 1369459 1369461 . + 0 transcript_id "g317.t1"; gene_id "g317"; Scaffold_3 AUGUSTUS CDS 1369459 1369929 0.9 + 0 transcript_id "g317.t1"; gene_id "g317"; Scaffold_3 AUGUSTUS stop_codon 1369927 1369929 . + 0 transcript_id "g317.t1"; gene_id "g317"; # protein sequence = [MASGQPLTDADREPWLELIRTTAEHKSVELQLEKGCEKIHGLVVGCSSLKKYYRDILRGKRKEAADTNSAVLPEHLEP # PHPDLLPTYFVFIKGSRELLLGRMQKREGHFMKASMLDSQLQTLESPEGEEGVFVVDAEDSTEQQIAKVKEGLEKLDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g317 ### # start gene g318 Scaffold_3 AUGUSTUS gene 1377359 1378944 0.39 - . g318 Scaffold_3 AUGUSTUS transcript 1377359 1378944 0.39 - . g318.t1 Scaffold_3 AUGUSTUS stop_codon 1377359 1377361 . - 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_3 AUGUSTUS CDS 1377359 1378127 0.8 - 1 transcript_id "g318.t1"; gene_id "g318"; Scaffold_3 AUGUSTUS CDS 1378289 1378944 0.39 - 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_3 AUGUSTUS start_codon 1378942 1378944 . - 0 transcript_id "g318.t1"; gene_id "g318"; # protein sequence = [MESTDGGNVLGALGLIFRHSYSPKDKAPSHLDDDNLYEDGSGSRKSSNISFTSPTQSPGRKGKSRWTGKSKQDVPSFT # IDLPPLNLSQEHFEIPTLLPPPTAHTPLSDFTSLTYMSTPDTRNFRELSFNAPFSHLSNTSHPQPPAASPDYGKTVSHGAPLIRDGFHRSNESESEVD # FRSSLVSTRQEPDLQVHVQEFEVQSTNATFSTRRSVSRTAASIHSENDPRFPRERLVSDETLRPQSQDPSADVDLARHDRRKTVKSASRKSRLSVRFE # DDTDRLTSSSKNQSAELADDSLLVPPGRLEVPKAAFRLTPQRPVTSPISEADSKVATSFLDLSGSNSQSNSDSSQKEPSLASQGQGLKSRWSATTATD # LGSHNLRQESSDSQNSGGSTSSPSSNFPFPVSLPASPHHPEGFKPSPPVTPSSGTYQTLAPGRLNIHPHPFGIAMNPASPSDSVPISISDLHFRHSDS # EMTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g318 ### # start gene g319 Scaffold_3 AUGUSTUS gene 1382323 1382715 0.32 + . g319 Scaffold_3 AUGUSTUS transcript 1382323 1382715 0.32 + . g319.t1 Scaffold_3 AUGUSTUS start_codon 1382323 1382325 . + 0 transcript_id "g319.t1"; gene_id "g319"; Scaffold_3 AUGUSTUS CDS 1382323 1382715 0.32 + 0 transcript_id "g319.t1"; gene_id "g319"; Scaffold_3 AUGUSTUS stop_codon 1382713 1382715 . + 0 transcript_id "g319.t1"; gene_id "g319"; # protein sequence = [MSVIYFLPRHHHQLEGRLVSITAIKDASELSRAARVLGGDPTGMELISETLRSDARTDDNSTTGGETGDERFSKVLND # VESAFVVIDPQVNIETHLSTEFAHEDSDSVRVPALPVLDLTQADIARIVPAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g319 ### # start gene g320 Scaffold_3 AUGUSTUS gene 1385743 1386126 0.36 + . g320 Scaffold_3 AUGUSTUS transcript 1385743 1386126 0.36 + . g320.t1 Scaffold_3 AUGUSTUS start_codon 1385743 1385745 . + 0 transcript_id "g320.t1"; gene_id "g320"; Scaffold_3 AUGUSTUS CDS 1385743 1386126 0.36 + 0 transcript_id "g320.t1"; gene_id "g320"; Scaffold_3 AUGUSTUS stop_codon 1386124 1386126 . + 0 transcript_id "g320.t1"; gene_id "g320"; # protein sequence = [MITDMARVGEILPLTNNKRPRSSEDLRDQVQQSSAENREDRQIVGSYRVFHTPRDPLHGPHNFGPESEFGNEATQSFD # LSSFLNTTPSQGSSPEGSVLDTHDISLRTLSAHLDLQNSQSQIQILLKC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g320 ### # start gene g321 Scaffold_3 AUGUSTUS gene 1390401 1390952 0.53 + . g321 Scaffold_3 AUGUSTUS transcript 1390401 1390952 0.53 + . g321.t1 Scaffold_3 AUGUSTUS start_codon 1390401 1390403 . + 0 transcript_id "g321.t1"; gene_id "g321"; Scaffold_3 AUGUSTUS CDS 1390401 1390952 0.53 + 0 transcript_id "g321.t1"; gene_id "g321"; Scaffold_3 AUGUSTUS stop_codon 1390950 1390952 . + 0 transcript_id "g321.t1"; gene_id "g321"; # protein sequence = [MAEAEASKTADKLKSTVIFPIQQSQLSIPFDDKQILNDLGKPASLTYRPVSGQLQSSPSRSKKDSFGSKSSRSLKHSR # LPSILSLSSLSSSLAKSRLRSFSLTGKNKWTNSPATASMMDLNSENQHDPSTVSLSRSSSFCSPRPKRRAFLSGEMEVKHSADDTQVQLYDLGEKRNQ # DESQGRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g321 ### # start gene g322 Scaffold_3 AUGUSTUS gene 1401057 1402366 0.32 + . g322 Scaffold_3 AUGUSTUS transcript 1401057 1402366 0.32 + . g322.t1 Scaffold_3 AUGUSTUS start_codon 1401057 1401059 . + 0 transcript_id "g322.t1"; gene_id "g322"; Scaffold_3 AUGUSTUS CDS 1401057 1401679 0.32 + 0 transcript_id "g322.t1"; gene_id "g322"; Scaffold_3 AUGUSTUS CDS 1401736 1402366 0.96 + 1 transcript_id "g322.t1"; gene_id "g322"; Scaffold_3 AUGUSTUS stop_codon 1402364 1402366 . + 0 transcript_id "g322.t1"; gene_id "g322"; # protein sequence = [MPKVPTNKNSFVNPASLSLPSTSDDMFSSPSPEPQPGPSRKRPRTEQSSEDRKEARAHRNRIAAQNSRDRRKAQFSYL # ERRVAELEEENRQLRAGMGMSPAAATSAPVLVSSAPIKSSYDEARDRENEELKERIRTLEKGWDAVVKALAERGLPTGVAPSSNIEIVPSAVSPPALS # TSVMPPSPSSSTTFSSSSVSTSPIPSTVTLSPTGGDRKNPPSFPAAGELALYDPYCDNISAAADFEVPTGSQDAPPVDDATMESLFREIISDSESSPV # TQTHSELVSLPTESHSTYGLAQPKEFHSQATSAKEEMTIGLLDRDRRMRVDGLSTVHLNEEDASTEVDGLDLGLNHGRIENDMMDLSDYIGESASSPE # SSAAWSDIGLTLEAFLDILPGTQDVNDNIPTTGLWESFEGRIGLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g322 ### # start gene g323 Scaffold_3 AUGUSTUS gene 1415822 1416664 0.72 + . g323 Scaffold_3 AUGUSTUS transcript 1415822 1416664 0.72 + . g323.t1 Scaffold_3 AUGUSTUS start_codon 1415822 1415824 . + 0 transcript_id "g323.t1"; gene_id "g323"; Scaffold_3 AUGUSTUS CDS 1415822 1416664 0.72 + 0 transcript_id "g323.t1"; gene_id "g323"; Scaffold_3 AUGUSTUS stop_codon 1416662 1416664 . + 0 transcript_id "g323.t1"; gene_id "g323"; # protein sequence = [MSIGSYPDDETGRRRKQLFDNEETVSQYLDSPVVSYPLSDRSPGGISAKVKGKQRSYEDAEDSAIPNVQMSGLHLGIE # MSTGTRTSPRLELKDDDRRNARFRSSPTGSVYLDEDDVEEEFDCQRTETRSRKYTSQSSATGGRLGSSRAAVSRSGKRPVTSDEEDESALDQSADALP # TTIVSPTKPSGKKRKVNRYPCPVPLCKETFTRRNDVRRHIKNAAVHRDSPEALALLGEVVGAGTRCKYCNADLSRSDARMRHERASACGKRTTQKMKD # QMLLKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g323 ### # start gene g324 Scaffold_3 AUGUSTUS gene 1423526 1424539 0.8 - . g324 Scaffold_3 AUGUSTUS transcript 1423526 1424539 0.8 - . g324.t1 Scaffold_3 AUGUSTUS stop_codon 1423526 1423528 . - 0 transcript_id "g324.t1"; gene_id "g324"; Scaffold_3 AUGUSTUS CDS 1423526 1424539 0.8 - 0 transcript_id "g324.t1"; gene_id "g324"; Scaffold_3 AUGUSTUS start_codon 1424537 1424539 . - 0 transcript_id "g324.t1"; gene_id "g324"; # protein sequence = [MNVVHQESDLDYRLSAAASVSPLHPVVITKFIDDAQEIDVDAVAHQGKLLVHAISEHVENAGVHSGDATLVLPPFSLS # ESDMSRLKVIAEKVASAFKISGPFNMQIIKKSSAANEQAELKVIECNLRASRSFPFVSKVLGRNFVDTATAAIVGQDVPEPVDLMAQKRDYTAIKVSQ # FSWTRLPGADPSWEWVSGVPIVGSNPNFVLILTLEMASTGEVASFGKDIHEAYWASSLSTTGFKVPSAGSGMLLGGDINKPEMISVAKKLFELGFKLY # CSSPVVEEFLNDIPYISAKRIFFPTKDKRKLREVFDEYDIQCVINLANSRATSFTDEDYVARR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g324 ### # start gene g325 Scaffold_3 AUGUSTUS gene 1424853 1427276 0.24 - . g325 Scaffold_3 AUGUSTUS transcript 1424853 1427276 0.24 - . g325.t1 Scaffold_3 AUGUSTUS stop_codon 1424853 1424855 . - 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_3 AUGUSTUS CDS 1424853 1425434 0.6 - 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_3 AUGUSTUS CDS 1425484 1425993 0.51 - 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_3 AUGUSTUS CDS 1426295 1426596 0.6 - 2 transcript_id "g325.t1"; gene_id "g325"; Scaffold_3 AUGUSTUS CDS 1426664 1427146 0.45 - 2 transcript_id "g325.t1"; gene_id "g325"; Scaffold_3 AUGUSTUS CDS 1427231 1427276 0.9 - 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_3 AUGUSTUS start_codon 1427274 1427276 . - 0 transcript_id "g325.t1"; gene_id "g325"; # protein sequence = [MSLLRPQLTRNWIRHSAPAVGSYALKDGEHVLKSPSELARRISAKVLPKLPRPDVQKVVVVGSGGLSIGQAGEFDYSG # SQALKALSEEGVQAVLINPNIATWQTSHQLASEVYFLPITADYVAYVLEKERPDGILLTFGGQSALNVGIALDKMGVLERLGVQVLGTPIKTLEVSED # LYPTEIDIPVAQSTAVSSVNAALAAAETIGYPVILRSAFTLGGLGSGFANTPDELRDLSAKSLSLSPQVLIERSMKGWKELEYEVVRDGADVRRSPFE # ILTPKSIKVMSFPLPDPSSSLNMILSALASKATGYPLAYTAAKIALGYTLPELPNAVTKTTTACFEPSLDYIVTKIPKWDLAKFSSQVNRQVGSAMKS # VGEVMAIGRTFEESLQKAIRQVDPRWKGFEVYIEPEDLDNALTQPTDMRLFAIAYAMYRKNYTIDQLHDLTKIDKWFLYKVDNIVQTHHTLKAAGSLE # NIDAELMTRAKRMGFADTQIADLVSSTEDQVRAHRKSFGITPFVKRIDTLAAEFPAHTNYLYTTYNASEHDVEFDEHGTMVLGSGVYRIGSSVEFDWC # AVTCARKLRDMGKRTIMINYNPETVSTDFDEADRLYFEELGYERVMDIYELEQAQGVIVSVGVRVFPDRRES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g325 ### # start gene g326 Scaffold_3 AUGUSTUS gene 1429212 1429469 0.71 + . g326 Scaffold_3 AUGUSTUS transcript 1429212 1429469 0.71 + . g326.t1 Scaffold_3 AUGUSTUS start_codon 1429212 1429214 . + 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_3 AUGUSTUS CDS 1429212 1429469 0.71 + 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_3 AUGUSTUS stop_codon 1429467 1429469 . + 0 transcript_id "g326.t1"; gene_id "g326"; # protein sequence = [MSSTVRTVDDAEKGTLEHVSSMVTLDTMTSTASIKDVAHKELKRLPSDTSTLQARSPDSVSKSKGAEISKPDPPKPSP # RPKLANR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g326 ### # start gene g327 Scaffold_3 AUGUSTUS gene 1436801 1437298 0.36 + . g327 Scaffold_3 AUGUSTUS transcript 1436801 1437298 0.36 + . g327.t1 Scaffold_3 AUGUSTUS start_codon 1436801 1436803 . + 0 transcript_id "g327.t1"; gene_id "g327"; Scaffold_3 AUGUSTUS CDS 1436801 1437298 0.36 + 0 transcript_id "g327.t1"; gene_id "g327"; Scaffold_3 AUGUSTUS stop_codon 1437296 1437298 . + 0 transcript_id "g327.t1"; gene_id "g327"; # protein sequence = [MTPSNDTALLALTQWTRAAAQRNIDALVKVGDYYYHGLGVPDEKESFRYEKAAKYYQSAADTQMSALAMWNLGWMYEN # GVGVPQVIDVNISLALSNFDQDFHLAKRHYDLAAQTNSEAYLPVFFSLAKLYVRSIWHTILGGKGGLNIWFDEEDSEIQSGALFGSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g327 ### # start gene g328 Scaffold_3 AUGUSTUS gene 1437325 1437831 0.69 + . g328 Scaffold_3 AUGUSTUS transcript 1437325 1437831 0.69 + . g328.t1 Scaffold_3 AUGUSTUS start_codon 1437325 1437327 . + 0 transcript_id "g328.t1"; gene_id "g328"; Scaffold_3 AUGUSTUS CDS 1437325 1437831 0.69 + 0 transcript_id "g328.t1"; gene_id "g328"; Scaffold_3 AUGUSTUS stop_codon 1437829 1437831 . + 0 transcript_id "g328.t1"; gene_id "g328"; # protein sequence = [MELEYIDRVPERELESVSDQPSSTEEQIFYDDEGPWYLGKARDEFHRRRNSQSRVEEEDDPIQWARDRRNAEAREAEY # GGEDYLDAGLRPDEDDDDEYSETMLLVMLCVTVSVLIYVRTRIVRRMRHDQQQRQQQQQQQEEAVPEAPAGNGMFPAPGDPARDEWAMLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g328 ### # start gene g329 Scaffold_3 AUGUSTUS gene 1437877 1438700 0.83 + . g329 Scaffold_3 AUGUSTUS transcript 1437877 1438700 0.83 + . g329.t1 Scaffold_3 AUGUSTUS start_codon 1437877 1437879 . + 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_3 AUGUSTUS CDS 1437877 1437906 0.83 + 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_3 AUGUSTUS CDS 1437990 1438700 0.9 + 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_3 AUGUSTUS stop_codon 1438698 1438700 . + 0 transcript_id "g329.t1"; gene_id "g329"; # protein sequence = [MKYSLHEDFRSILSSLHYIYCSHIGIMGYSFDDLEPLVRQILSAPGTDLTTISAKRVRRELLSLDPSLTPEFVKANKL # DVDAVITRVFGEVSAAQNGEVIDAPEEPVTASRRYNSSDQEEAEQEEEEEDADDDDDEAEHMPKKSRKGPKKGLSDAELARQLSSEINGRSSTRRSAG # KGRAANGTPKKSRSKKKSATTIDSDDENTGEEGGKKTKKKRAGGGAAKGGFAKEYTLRYQIHISMRLDYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g329 ### # start gene g330 Scaffold_3 AUGUSTUS gene 1439312 1440646 0.4 - . g330 Scaffold_3 AUGUSTUS transcript 1439312 1440646 0.4 - . g330.t1 Scaffold_3 AUGUSTUS stop_codon 1439312 1439314 . - 0 transcript_id "g330.t1"; gene_id "g330"; Scaffold_3 AUGUSTUS CDS 1439312 1440447 0.4 - 2 transcript_id "g330.t1"; gene_id "g330"; Scaffold_3 AUGUSTUS CDS 1440511 1440646 0.41 - 0 transcript_id "g330.t1"; gene_id "g330"; Scaffold_3 AUGUSTUS start_codon 1440644 1440646 . - 0 transcript_id "g330.t1"; gene_id "g330"; # protein sequence = [MHALDAFSQNTVYYSNSALFEETTDFVKYPYKHYDIDDEVSVAIGLSSSASMLSPSSSSDYSVPESYSPTNSPQGNFP # ATMTCSPADIMPSTFSINDEYQKSPSAQNPLELNTFDTFYNNQSLRSSTSEIDTAEGWVETSSWSVRPPASFADFSNPRAAIDKEELLVHPAVPISPQ # QVDDFSTCATTTQKKTAKAHRRRNKKVQSQSIAPRLVSSSPADSYVARSPVSSISHNYHPLHSESSIDIVQPQASTSAVVSNVPITRKRKRSYQDEDF # SYYNVASHHRAAKERISYSEDGVESNDDDDPEYISCHVEDSEDDDYGGSQKQSARTKRSRASTSNISGSDPRFPCPAPGCRRIFNRSADQRRHSESAH # EHRRFPCIYCHAVLSRHDALIRHQVKARRCGRKARQAQGRVPNASFEADDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g330 ### # start gene g331 Scaffold_3 AUGUSTUS gene 1446216 1448046 0.64 - . g331 Scaffold_3 AUGUSTUS transcript 1446216 1448046 0.64 - . g331.t1 Scaffold_3 AUGUSTUS stop_codon 1446216 1446218 . - 0 transcript_id "g331.t1"; gene_id "g331"; Scaffold_3 AUGUSTUS CDS 1446216 1446748 0.79 - 2 transcript_id "g331.t1"; gene_id "g331"; Scaffold_3 AUGUSTUS CDS 1447865 1447891 0.69 - 2 transcript_id "g331.t1"; gene_id "g331"; Scaffold_3 AUGUSTUS CDS 1448007 1448046 0.75 - 0 transcript_id "g331.t1"; gene_id "g331"; Scaffold_3 AUGUSTUS start_codon 1448044 1448046 . - 0 transcript_id "g331.t1"; gene_id "g331"; # protein sequence = [MYKVKRLSPNRSTVSKGIDRDLFSNTPGAVDDASATTALYLLISTLRNYAISERSLRELKWKPNGLAKRSHDLTGHTL # AILGLGGIGMRLAELAHAFPMRIIYYSRHKVTDAPEWCEYFENVEEMLAQADVLSVHVPLNPNTVGLVGEKWIRALKKGAIIINTARGKVIDEDAMIR # ALEDGHVSNTFIQCCPCGNHEIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g331 ### # start gene g332 Scaffold_3 AUGUSTUS gene 1450063 1451059 0.37 + . g332 Scaffold_3 AUGUSTUS transcript 1450063 1451059 0.37 + . g332.t1 Scaffold_3 AUGUSTUS start_codon 1450063 1450065 . + 0 transcript_id "g332.t1"; gene_id "g332"; Scaffold_3 AUGUSTUS CDS 1450063 1450437 0.56 + 0 transcript_id "g332.t1"; gene_id "g332"; Scaffold_3 AUGUSTUS CDS 1450556 1451059 0.63 + 0 transcript_id "g332.t1"; gene_id "g332"; Scaffold_3 AUGUSTUS stop_codon 1451057 1451059 . + 0 transcript_id "g332.t1"; gene_id "g332"; # protein sequence = [MSFITSSLLALSLAASAYSSPLSTNYHNAPAQRSSFIPAPLIEENHLHGTINNSYIVKFRDGLSNALVANHLNFLQTK # HTESPLVGEDSGLRHVYEFGYSGYFHDDVVEQLRALPEVEYIERDQVGLARVSHRKKLTLGSFTKYDYVTYAGEGVDVYIIDTGIYVDHPEFNGRAHW # GVTIPQNDVDEDANGHGTHCAGTVASEAYGVAKKAEVYAVKVLGSNGSGTMSDVIKGVEWATAAAKQKAQSGSSKHKGSVANMSLGGGKSPTLDAVVN # KATDSGLHFAVAAGRFLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g332 ### # start gene g333 Scaffold_3 AUGUSTUS gene 1451337 1451693 0.74 + . g333 Scaffold_3 AUGUSTUS transcript 1451337 1451693 0.74 + . g333.t1 Scaffold_3 AUGUSTUS start_codon 1451337 1451339 . + 0 transcript_id "g333.t1"; gene_id "g333"; Scaffold_3 AUGUSTUS CDS 1451337 1451693 0.74 + 0 transcript_id "g333.t1"; gene_id "g333"; Scaffold_3 AUGUSTUS stop_codon 1451691 1451693 . + 0 transcript_id "g333.t1"; gene_id "g333"; # protein sequence = [MASPHTAGLLAYLLSIYPSVPFNPDLTPGFDVPTLIDPEQRAFASMYKVIHAALPPVISSFLPSPEIVEAATAPVPPK # TLSAAQLKRAVLSLATKGVITGTLPEGTPNLLIFNNATTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g333 ### # start gene g334 Scaffold_3 AUGUSTUS gene 1457920 1458591 0.67 + . g334 Scaffold_3 AUGUSTUS transcript 1457920 1458591 0.67 + . g334.t1 Scaffold_3 AUGUSTUS start_codon 1457920 1457922 . + 0 transcript_id "g334.t1"; gene_id "g334"; Scaffold_3 AUGUSTUS CDS 1457920 1458591 0.67 + 0 transcript_id "g334.t1"; gene_id "g334"; Scaffold_3 AUGUSTUS stop_codon 1458589 1458591 . + 0 transcript_id "g334.t1"; gene_id "g334"; # protein sequence = [MEQFVVFLETVALRRWGQSVDENSQKDTSDPSRLSTTPDIDDEEDRHDQVAVWNTLLELYLTLPGISSSLGSSAPQDE # IALKEKALRVLRSETIPYDTTHALILCSSRGYTKGLVLLWEKMGMYEDVLRFWMERDKEGATPEASTQVLKHLQLYGPKHPHLYTLVLRFLTSSPVLF # SRHMDDVKEVIQHIDQENIMPPLGIIQVLSRNDVASVGLVKNGSSSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g334 ### # start gene g335 Scaffold_3 AUGUSTUS gene 1459766 1460767 0.89 + . g335 Scaffold_3 AUGUSTUS transcript 1459766 1460767 0.89 + . g335.t1 Scaffold_3 AUGUSTUS start_codon 1459766 1459768 . + 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_3 AUGUSTUS CDS 1459766 1460767 0.89 + 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_3 AUGUSTUS stop_codon 1460765 1460767 . + 0 transcript_id "g335.t1"; gene_id "g335"; # protein sequence = [MPSTHEISILSYTHARQLPDFVFSTLEANRIDANVILPLLRKSSDSERSNLPISFNQLWLCCISYDSSITGTVDMVLS # CTENELGKYPIFIVPTRPRSLWTRNSLEVRLRKLAEALFKSVPRERVYSVFAPDIIVSLFSQQWSELAGVGINNEPYYAARLLSCTAVIPQPSTLPPF # GTCRLADTADTKTVAKLCRRFSEESEPFVLEREGAFKEARLLISKEQVWVHCVSGKITCIAAFTRNTADTATITKVYTHRSWRRQGCAKRLVREVTEH # LLGTGRSEVVLYVAHNNGSAAKVYESVGFVEPDGAVAIGHSVKWTEVGFDRNFVELGHW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g335 ### # start gene g336 Scaffold_3 AUGUSTUS gene 1464710 1467756 0.16 + . g336 Scaffold_3 AUGUSTUS transcript 1464710 1467756 0.16 + . g336.t1 Scaffold_3 AUGUSTUS start_codon 1464710 1464712 . + 0 transcript_id "g336.t1"; gene_id "g336"; Scaffold_3 AUGUSTUS CDS 1464710 1464950 0.97 + 0 transcript_id "g336.t1"; gene_id "g336"; Scaffold_3 AUGUSTUS CDS 1465209 1465733 0.44 + 2 transcript_id "g336.t1"; gene_id "g336"; Scaffold_3 AUGUSTUS CDS 1465873 1466011 0.31 + 2 transcript_id "g336.t1"; gene_id "g336"; Scaffold_3 AUGUSTUS CDS 1466134 1466599 0.38 + 1 transcript_id "g336.t1"; gene_id "g336"; Scaffold_3 AUGUSTUS CDS 1466737 1467756 0.99 + 0 transcript_id "g336.t1"; gene_id "g336"; Scaffold_3 AUGUSTUS stop_codon 1467754 1467756 . + 0 transcript_id "g336.t1"; gene_id "g336"; # protein sequence = [MSSHHSKTGEIRSLRSGRGSRRQDAREPAVLAKARGWHELEGDSEEGGLEDTRKNSLIAEKEAELTQIYEGHDSLVRL # TFSSASAPGPSRRTRRAHTERKNLLLPESSSFSPAASISAFNRKGNAFGNNDASELRPANNGSSLNGKTLDSPSSLSSSSKVKGKRKAIDAIQGATSS # SLTRSSRGKRRNKDDAESDNSNACIDLASTINRVHTNHPDISTPKPKRPSGILLRVPPRSSMIAPPSESTSVNEFDPIRRSRHHRAELNQSPSKFSNV # LSTKRKVDLTDHGSHPESTVSTLISCFSPLQRPLPPKYNYSLSDFLSSYTTDGSEEVPPDTLVERARTRTKFLEHIQKLREEGRLLDDLSVLELTPAE # AANKQQKSSDIWCHCIVDAAAYLESKSEEPSGVEIAGQIAKAIQDYWDVKTVKQEKMKAQEEKRIRALAKATIKLVVAEWKKAVFSGHILETQHGDLT # RLDRSRSHSRGSSISDWTENDSEDEAEDGKEEKDENKETGDDTVIGVDEEEGNNQQGASVVSHAQYDFSIEKVDQSTLPDIVIDMDSVGGREASSTSD # YHGTSDDLSHSSLPLLGKSEPVTIFAKPLNQPWDSTSLDTHEVLPPINGSTSFPPLHLDQPLDGDTSSPSTADVVTPPNEFEASIPIVDLASLQGGEF # MSETLAIKANSGGLGLKESFTSVAVDSLATVDPNNLTSEPLNGDGESMEYSFLQTQYQEDSDDQSQEAPFPAYLTPYIVTHVDWNPDNKIAPPVLLRG # VLRPYQFAGLEWLASLHSNNLNGILADEMGLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g336 ### # start gene g337 Scaffold_3 AUGUSTUS gene 1468434 1469684 0.48 + . g337 Scaffold_3 AUGUSTUS transcript 1468434 1469684 0.48 + . g337.t1 Scaffold_3 AUGUSTUS start_codon 1468434 1468436 . + 0 transcript_id "g337.t1"; gene_id "g337"; Scaffold_3 AUGUSTUS CDS 1468434 1469684 0.48 + 0 transcript_id "g337.t1"; gene_id "g337"; Scaffold_3 AUGUSTUS stop_codon 1469682 1469684 . + 0 transcript_id "g337.t1"; gene_id "g337"; # protein sequence = [MGNVHDDETKQRVSKLHTVLRPYLLRRLKRDVEKELPNKYEHLVLCSLSKRQRFLYDEFMARAHTRDALRSGVYQKIA # NILMQLRKVCNHPDLFEVRPIVTSFVMDRSAVADFEIKELLIRRQFLKNESEELDFELLGLSFLNLQNTSIATTLSTQAEAAGAIMMRLCEHPGPAPP # KDVRRIEKFLQYAEWRRRASLAARWSHTAYLNRLRYSRSPIYSSETISLVRSMYNPIIPLCHVNTRTAAFVDTVLPSLHKAVLSYEERSNEMSDVIDR # FAFITSNVVARDVARFALPGLLPSILKSVPLTFDDVLHKSAVKLSIAFPPPSLLQYDCGKLQRLTALLREKKAGGHRVLLFTQMTKILDILEIYLNFH # GYLYLRLDGATSIEDRQYVTERFNKDEKIFCFIASSRSGGVGIK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g337 ### # start gene g338 Scaffold_3 AUGUSTUS gene 1477012 1477602 0.69 + . g338 Scaffold_3 AUGUSTUS transcript 1477012 1477602 0.69 + . g338.t1 Scaffold_3 AUGUSTUS start_codon 1477012 1477014 . + 0 transcript_id "g338.t1"; gene_id "g338"; Scaffold_3 AUGUSTUS CDS 1477012 1477602 0.69 + 0 transcript_id "g338.t1"; gene_id "g338"; Scaffold_3 AUGUSTUS stop_codon 1477600 1477602 . + 0 transcript_id "g338.t1"; gene_id "g338"; # protein sequence = [MDHVAEYMLYSTKDKNENVALEACEFWLTFAEDVELAPFLQPLLGKVAPVLLDCMIYGEDDLLWLEGDAEDAEIPDKE # TDIKPRHYGSKSHGYERDANGEPTEAPKARIGAYGEETIDSDEDDDYLDDDEFVDEMSTEWNLRKCAAAALDVLAVRFSGDLLNVLLAPLKDKLWSND # WLQRESGILALGAMAEGKSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g338 ### # start gene g339 Scaffold_3 AUGUSTUS gene 1477871 1478794 0.93 + . g339 Scaffold_3 AUGUSTUS transcript 1477871 1478794 0.93 + . g339.t1 Scaffold_3 AUGUSTUS start_codon 1477871 1477873 . + 0 transcript_id "g339.t1"; gene_id "g339"; Scaffold_3 AUGUSTUS CDS 1477871 1478794 0.93 + 0 transcript_id "g339.t1"; gene_id "g339"; Scaffold_3 AUGUSTUS stop_codon 1478792 1478794 . + 0 transcript_id "g339.t1"; gene_id "g339"; # protein sequence = [MEGVSFPLESLVFELFILVSKLLRMVLDNNKRVQEAGCSAFATLEEDAGIELAPYLEPVLRNLVFAFDKYQHKNMLIL # YDAVGTLADAVGRELSNPTYVEILMPPLTNRWAKLKDDDIDLIPLLEVYIMHPLNLSSLNCFQCLASVTIAMGQAFLPYAPPVFERCCSIIHTSLLQY # QQFQQNPELDEPDKSFLVVALDLLSGLTQGLGMALEVLINQSQPNLLTLLTVCLKHPQAPVRQSAYALVGDMAMGCFSILRPFMPGIMSELILQLDPE # PKVEFVSASNNAAWSVGEVALRYGRGKPTLFFC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g339 ### # start gene g340 Scaffold_3 AUGUSTUS gene 1487262 1487897 0.88 - . g340 Scaffold_3 AUGUSTUS transcript 1487262 1487897 0.88 - . g340.t1 Scaffold_3 AUGUSTUS stop_codon 1487262 1487264 . - 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_3 AUGUSTUS CDS 1487262 1487897 0.88 - 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_3 AUGUSTUS start_codon 1487895 1487897 . - 0 transcript_id "g340.t1"; gene_id "g340"; # protein sequence = [MRDRVDIIQIISWNGKRPTYEPFPSNLKSDALDYGESHYIGPIKGIQPKSQGWVDGYPHDAFLKLTAYFGRAFKEGRY # PDINEDRIFAWARPHPKSAIASNDRVPRPENWDLVRNFNSRRPDADLSSQTDDKVWVVVLAKLPATVLIYGPKNLKVDVREGLTKISQTLEPGDGMEI # VMQRNEVVVTECSPLEFTFNPKPLLYNFNVFTACS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g340 ### # start gene g341 Scaffold_3 AUGUSTUS gene 1490717 1491331 0.98 + . g341 Scaffold_3 AUGUSTUS transcript 1490717 1491331 0.98 + . g341.t1 Scaffold_3 AUGUSTUS start_codon 1490717 1490719 . + 0 transcript_id "g341.t1"; gene_id "g341"; Scaffold_3 AUGUSTUS CDS 1490717 1491331 0.98 + 0 transcript_id "g341.t1"; gene_id "g341"; Scaffold_3 AUGUSTUS stop_codon 1491329 1491331 . + 0 transcript_id "g341.t1"; gene_id "g341"; # protein sequence = [MLEEPADVQYSTYSARNSDPFGFFALEAKLKAQRKEQSITTTSNAPYPQSWEPPHSPHKPRIRKRASGKNADSPSLPS # SPSPAKPRRVTKQGLAKATNTDETKIQKALSDDEKDCLDVASQDYQPRKRMKTKAVRRQGQRNGDKSVDPERLARDLKVLLPKRSSRRNGKRRSDSNS # HEADAKRLRGTTRDKQNKSDTGDQVGIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g341 ### # start gene g342 Scaffold_3 AUGUSTUS gene 1492800 1493623 0.8 - . g342 Scaffold_3 AUGUSTUS transcript 1492800 1493623 0.8 - . g342.t1 Scaffold_3 AUGUSTUS stop_codon 1492800 1492802 . - 0 transcript_id "g342.t1"; gene_id "g342"; Scaffold_3 AUGUSTUS CDS 1492800 1493273 0.82 - 0 transcript_id "g342.t1"; gene_id "g342"; Scaffold_3 AUGUSTUS CDS 1493327 1493623 0.81 - 0 transcript_id "g342.t1"; gene_id "g342"; Scaffold_3 AUGUSTUS start_codon 1493621 1493623 . - 0 transcript_id "g342.t1"; gene_id "g342"; # protein sequence = [MAALYGDDADYDEDGKPSWDDDINIGDIAMANDSESTRQKKKKKKKGEKAVEEDGVSVDAMDADIDKVDDDDWDGTEE # MRKKKIEEYMDEVYGLDFNDMVGGIPTRFQYTHVEPENFHLSPTEILMATDAELNEYMGIKKFAPYRKAGKWDSNRGDRLKELRQKIGERGYGGDITQ # DDKAVKKRKGKKERMRMKTLLDPDVGEDVEKEVEATGKSAMPENLKRKQPSGDVLDESEEAAQKKKRRRHKKKNHSEDSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g342 ### # start gene g343 Scaffold_3 AUGUSTUS gene 1494060 1495152 0.15 - . g343 Scaffold_3 AUGUSTUS transcript 1494060 1495152 0.15 - . g343.t1 Scaffold_3 AUGUSTUS stop_codon 1494060 1494062 . - 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_3 AUGUSTUS CDS 1494060 1494747 0.34 - 1 transcript_id "g343.t1"; gene_id "g343"; Scaffold_3 AUGUSTUS CDS 1494830 1495152 0.16 - 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_3 AUGUSTUS start_codon 1495150 1495152 . - 0 transcript_id "g343.t1"; gene_id "g343"; # protein sequence = [MLRRFSIRKNAKSSNNVWFSRFRMVQTNNTLTVKLKYGSDKEEDNSETDSEEDESEDEDGEELTPAVDAAILRTLARI # KRKDPEIYNNKTGIFEGAHTYSSLTEITKNGKFQAYSEPPQARPITMRQVAMEAQLQGDSRSPSPEPLTHSEEQRRLRDETIAVFHQLGDDNSEGDDL # FVPREKTKDEQEQEEERVSFFFGTGSGWDLKTLVSVEENTWKEETPPSIESKQKKKKNKKGKDVKKVEDDDQEFLIKYVFRVFHHPRRLNLGIQVTSL # TVGGLIVQRTVCQHTKRSLPPRKVRARLQRKRGAWRMQIPLISKKTYTQQLTLTLMRRNSKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g343 ### # start gene g344 Scaffold_3 AUGUSTUS gene 1499265 1499792 0.55 + . g344 Scaffold_3 AUGUSTUS transcript 1499265 1499792 0.55 + . g344.t1 Scaffold_3 AUGUSTUS start_codon 1499265 1499267 . + 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_3 AUGUSTUS CDS 1499265 1499792 0.55 + 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_3 AUGUSTUS stop_codon 1499790 1499792 . + 0 transcript_id "g344.t1"; gene_id "g344"; # protein sequence = [MHALLAEQQSVIDDTLAVIGTFRQEMDEVVHHVDAARIKACDPSRDLSSNFINHSSLENEMKTLLKDLQAVRPSDMPP # LVLLNQNDILAELKALKEKEKSLDDQEERFGSLIPIMLNSLLAYLCALGHVALTVLILILQHGPAWSRLGCYVCALSRELFSTLPTFSLGGNAAVQC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g344 ### # start gene g345 Scaffold_3 AUGUSTUS gene 1512469 1513614 0.98 + . g345 Scaffold_3 AUGUSTUS transcript 1512469 1513614 0.98 + . g345.t1 Scaffold_3 AUGUSTUS start_codon 1512469 1512471 . + 0 transcript_id "g345.t1"; gene_id "g345"; Scaffold_3 AUGUSTUS CDS 1512469 1513614 0.98 + 0 transcript_id "g345.t1"; gene_id "g345"; Scaffold_3 AUGUSTUS stop_codon 1513612 1513614 . + 0 transcript_id "g345.t1"; gene_id "g345"; # protein sequence = [MECPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALR # VFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLET # VVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIK # LESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPKVRMELSGHV # SCASRQIIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g345 ### # start gene g346 Scaffold_3 AUGUSTUS gene 1513709 1513978 0.94 + . g346 Scaffold_3 AUGUSTUS transcript 1513709 1513978 0.94 + . g346.t1 Scaffold_3 AUGUSTUS start_codon 1513709 1513711 . + 0 transcript_id "g346.t1"; gene_id "g346"; Scaffold_3 AUGUSTUS CDS 1513709 1513978 0.94 + 0 transcript_id "g346.t1"; gene_id "g346"; Scaffold_3 AUGUSTUS stop_codon 1513976 1513978 . + 0 transcript_id "g346.t1"; gene_id "g346"; # protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR # VFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g346 ### # start gene g347 Scaffold_3 AUGUSTUS gene 1514162 1516053 0.87 + . g347 Scaffold_3 AUGUSTUS transcript 1514162 1516053 0.87 + . g347.t1 Scaffold_3 AUGUSTUS start_codon 1514162 1514164 . + 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_3 AUGUSTUS CDS 1514162 1514732 0.87 + 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_3 AUGUSTUS CDS 1514783 1516053 0.87 + 2 transcript_id "g347.t1"; gene_id "g347"; Scaffold_3 AUGUSTUS stop_codon 1516051 1516053 . + 0 transcript_id "g347.t1"; gene_id "g347"; # protein sequence = [MENQKTVRFEAPKSIDRPLKKPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPR # DQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMID # TCIRIEDLWQDQRILQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGL # GITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKG # RNIQINTSRYNEPKNVTPDNEKSTGENDFKGKFSFLDELSSDQGEDEYAISFHFDEKQNIVLDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAE # EIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILKILVWGRIAINLNPQKPHRINVITKI # PLKRSEMIIGINLKTLKELGREWFDMKYSKEELNHSKDLNRVLRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g347 ### # start gene g348 Scaffold_3 AUGUSTUS gene 1517418 1517669 0.86 + . g348 Scaffold_3 AUGUSTUS transcript 1517418 1517669 0.86 + . g348.t1 Scaffold_3 AUGUSTUS start_codon 1517418 1517420 . + 0 transcript_id "g348.t1"; gene_id "g348"; Scaffold_3 AUGUSTUS CDS 1517418 1517669 0.86 + 0 transcript_id "g348.t1"; gene_id "g348"; Scaffold_3 AUGUSTUS stop_codon 1517667 1517669 . + 0 transcript_id "g348.t1"; gene_id "g348"; # protein sequence = [MFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTERK # KXSFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g348 ### # start gene g349 Scaffold_3 AUGUSTUS gene 1517719 1517949 0.69 + . g349 Scaffold_3 AUGUSTUS transcript 1517719 1517949 0.69 + . g349.t1 Scaffold_3 AUGUSTUS start_codon 1517719 1517721 . + 0 transcript_id "g349.t1"; gene_id "g349"; Scaffold_3 AUGUSTUS CDS 1517719 1517949 0.69 + 0 transcript_id "g349.t1"; gene_id "g349"; Scaffold_3 AUGUSTUS stop_codon 1517947 1517949 . + 0 transcript_id "g349.t1"; gene_id "g349"; # protein sequence = [MDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g349 ### # start gene g350 Scaffold_3 AUGUSTUS gene 1518138 1519994 0.63 + . g350 Scaffold_3 AUGUSTUS transcript 1518138 1519994 0.63 + . g350.t1 Scaffold_3 AUGUSTUS start_codon 1518138 1518140 . + 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_3 AUGUSTUS CDS 1518138 1519994 0.63 + 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_3 AUGUSTUS stop_codon 1519992 1519994 . + 0 transcript_id "g350.t1"; gene_id "g350"; # protein sequence = [MDSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEAL # DEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIEKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGR # LYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIM # SIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQ # ALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVA # ELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELID # LTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDENSVRERINN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g350 ### # start gene g351 Scaffold_3 AUGUSTUS gene 1520248 1520768 0.37 - . g351 Scaffold_3 AUGUSTUS transcript 1520248 1520768 0.37 - . g351.t1 Scaffold_3 AUGUSTUS stop_codon 1520248 1520250 . - 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_3 AUGUSTUS CDS 1520248 1520672 1 - 2 transcript_id "g351.t1"; gene_id "g351"; Scaffold_3 AUGUSTUS CDS 1520750 1520768 0.37 - 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_3 AUGUSTUS start_codon 1520766 1520768 . - 0 transcript_id "g351.t1"; gene_id "g351"; # protein sequence = [MFLLTVLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSI # LKSRQDSGSDSSASDASFATAQSIPTGSEDTVVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g351 ### # start gene g352 Scaffold_3 AUGUSTUS gene 1523925 1524636 0.5 - . g352 Scaffold_3 AUGUSTUS transcript 1523925 1524636 0.5 - . g352.t1 Scaffold_3 AUGUSTUS stop_codon 1523925 1523927 . - 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_3 AUGUSTUS CDS 1523925 1524361 0.86 - 2 transcript_id "g352.t1"; gene_id "g352"; Scaffold_3 AUGUSTUS CDS 1524423 1524636 0.5 - 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_3 AUGUSTUS start_codon 1524634 1524636 . - 0 transcript_id "g352.t1"; gene_id "g352"; # protein sequence = [MMRSVPSKDLDAFASLRGKGSLAGASKRNPLAPPLEIKSSTSIPKAPVAPPRLIRRNRELENLKADASSFVIASPRST # RSRDSDNELLSGFPLVDAAPRASSPTKVPVSRKEPKSKTAVKVVEDSKASDPPTSALVYKRVRLPPRSRKIAPAASKGKARQTIVTEADSASSEVESE # DEDEEEDSAPLQNASKRHLPFLVKVYSSFTSFYFINLMGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g352 ### # start gene g353 Scaffold_3 AUGUSTUS gene 1531004 1531243 0.56 - . g353 Scaffold_3 AUGUSTUS transcript 1531004 1531243 0.56 - . g353.t1 Scaffold_3 AUGUSTUS stop_codon 1531004 1531006 . - 0 transcript_id "g353.t1"; gene_id "g353"; Scaffold_3 AUGUSTUS CDS 1531004 1531243 0.56 - 0 transcript_id "g353.t1"; gene_id "g353"; Scaffold_3 AUGUSTUS start_codon 1531241 1531243 . - 0 transcript_id "g353.t1"; gene_id "g353"; # protein sequence = [MAEVYDSARVYECYKCFSGANLNMNTGHTTDPHWNRNTPSSTNISTSSMFPSTAAPTATTSTHSPMDLDAFATAPASN # N] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g353 ### # start gene g354 Scaffold_3 AUGUSTUS gene 1533549 1535917 0.41 + . g354 Scaffold_3 AUGUSTUS transcript 1533549 1535917 0.41 + . g354.t1 Scaffold_3 AUGUSTUS start_codon 1533549 1533551 . + 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_3 AUGUSTUS CDS 1533549 1534478 0.54 + 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_3 AUGUSTUS CDS 1534781 1535917 0.71 + 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_3 AUGUSTUS stop_codon 1535915 1535917 . + 0 transcript_id "g354.t1"; gene_id "g354"; # protein sequence = [MTISLSPADTNDTAYPNDNIHALYHGSLLHHQQCLSGDLAQQCEEENHLSPASIQPQNDNAHSIGTPHRNSTGGNEIP # PRPASRLDFVLGSSSTQLANAQDEVETQAQVRSHKRTPSATFRWTREILKKMRLTDATSTSDFEPPPCPEISATIEPSKAATFLYNGSFADDKGMSIT # IDIASSPELDSSASNSSLLSSSSSGSYPALESITISLSSSSDFDGSLEDSDTDSDSDSLKEIDLGDGLTGEGNECVAPVKEEQTYVHTYSPIPVSPSM # VQAPCTPYPANPHTESILESFGDGDLDQYARIYPGNDKTCTPAVQGWQPEPECSPVLQGWQPELKEQDRFKLFPSLFSSSRDSGPNNSRQQQTETSGS # ILEDFARSSLPPLTIHPRWGDIVRLNFATTYSSAVACTETWCMHTDRYLLVGMGLGLWTIRKVLWLSELNRICAIPRPREEEEEEEAEGEKTFVVDDE # SKDPISGSCAENCSISDDNDSLSEENDDSEEGEVMYSSVVSLASLISTTTSSDDSDVTLVESDSDSEAPLNASSMSDFVAQAEPQLGGRSVDFDKTCS # SSGILADEDEEEDFEEVDLGLGCGSSNAACSSSLSGSSNTSVDICCPERESLALLRTLYFDSHAVSSSMVTKDYAMSNAQGKCKLNTQHPQLEIASLA # KRSWYEQCELLLQLTGARETRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g354 ### # start gene g355 Scaffold_3 AUGUSTUS gene 1542226 1544829 0.37 + . g355 Scaffold_3 AUGUSTUS transcript 1542226 1544829 0.37 + . g355.t1 Scaffold_3 AUGUSTUS start_codon 1542226 1542228 . + 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_3 AUGUSTUS CDS 1542226 1544097 0.37 + 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_3 AUGUSTUS CDS 1544275 1544829 1 + 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_3 AUGUSTUS stop_codon 1544827 1544829 . + 0 transcript_id "g355.t1"; gene_id "g355"; # protein sequence = [MNADTAPENDSADTMIDELRTEAATKTRSPTARSRLPSQEMISDSSPQFKSPTLEQSVSEVPSSPLVIPSDPAATSSH # SPVVVTPRDPVITTPRDPVANPPPQDEVHFRPRDIPDYKVGDIPNISEAPTVRDAVRVAIMRRLLADRQTRKERVEPVLISNHALIEIDFENPLQKTS # LHALMTEKTHPEGDQVKIRLETHNQLQQSLAEKFQERQDALRNKVQRLSEEYVALHDKWKIHCAILDRQAKARSDARAADNRVTSATVAAPPLTGRTT # RRSAATLGDAVRSDLEMEQIIASIGSNEATDPNQLCLRNVAVIPDMISVIKCKVDYVYDDNNLRVDDPISYYAPQTDDWTEEEKQVFVEKFAIFPKQF # GAISRFLPNKTTAQCVDFYYLHKNMDIDFKIIVSKHAPGRRGGRRRTAKRKANALLTDIRKHDAEVSSSASTNGRSGRGRPRRAAPATAGTEASAIFA # PTLPPELRKPSSRKVIVQLEGTPTTATPTPEPEARPKRRRVPTSRASLGGSQKEPSEEVQVPVIESRVSFSYVILMGNFASLQEVETEPELELESEPR # PAKKPKRGGRRVKSAAMVSDEETSPPPVINHEVSDPAYIARQRVSSEWSEAEKGESCSDYYQAHEVPLGFRKIAENAVKKTPNEVPDPNGTEKRQARS # KNATSGLNPSYPAFGTPPFPDVGAYFTHPGFSRYASGVSPYGAPAQSPVPMTSLYAGQVYPATTFGYPAPPPASATPGATGLTTYAANAAAYAGRPYI # HYPFSYQTGYPPIAVANHPPTAAGTKATPGANATAAQPFYPGFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g355 ### # start gene g356 Scaffold_3 AUGUSTUS gene 1549051 1549440 0.78 - . g356 Scaffold_3 AUGUSTUS transcript 1549051 1549440 0.78 - . g356.t1 Scaffold_3 AUGUSTUS stop_codon 1549051 1549053 . - 0 transcript_id "g356.t1"; gene_id "g356"; Scaffold_3 AUGUSTUS CDS 1549051 1549440 0.78 - 0 transcript_id "g356.t1"; gene_id "g356"; Scaffold_3 AUGUSTUS start_codon 1549438 1549440 . - 0 transcript_id "g356.t1"; gene_id "g356"; # protein sequence = [MTKTLGSFKLTVEAGSFTDSEIIVMLGENGTGKTTFVRLLAGDTPDIETDKQTLSVSLKPQTISPKFPGTVRMLLLKR # IKQAFMHPQFQTDVLKPMNLEAIMDQDVKTLSGGELQRVAIVLALGMCIIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g356 ### # start gene g357 Scaffold_3 AUGUSTUS gene 1551162 1552292 0.9 - . g357 Scaffold_3 AUGUSTUS transcript 1551162 1552292 0.9 - . g357.t1 Scaffold_3 AUGUSTUS stop_codon 1551162 1551164 . - 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_3 AUGUSTUS CDS 1551162 1552292 0.9 - 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_3 AUGUSTUS start_codon 1552290 1552292 . - 0 transcript_id "g357.t1"; gene_id "g357"; # protein sequence = [MITPRTGKPSKPSSHRRDGGNHTISIRRDHNADTRPQSDVVVSTLYVSHHLTFSQLCLQGDGESILFEPAYPIFAPSI # IPTQQNHRRSIEAGGRGSVVRVVGSQLVTVLRDDRKTIRRSTLSAITQKFAEKRSAWLDDVDINAEDEGGEDLAKQREHRAKAEKVLALLQLEQEALE # REELEEGAQYERCSPMPREDARLDDAESARRERVKAKIRLELDNLAAAENYDESSEGEQEDEWQFDQESITSSRWAWDGISNQGHCYREEMRILVSKF # KEADAEVWRQIIRRHKHNSWSSASSDTVIDDSDQGQQPFAALTNSQLRGGAYEILRLQAKRQHQLKECIGIQNQWRCAGSYMFDAVTNENWQESRGYT # ETWI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g357 ### # start gene g358 Scaffold_3 AUGUSTUS gene 1566808 1567420 0.74 + . g358 Scaffold_3 AUGUSTUS transcript 1566808 1567420 0.74 + . g358.t1 Scaffold_3 AUGUSTUS start_codon 1566808 1566810 . + 0 transcript_id "g358.t1"; gene_id "g358"; Scaffold_3 AUGUSTUS CDS 1566808 1566864 0.74 + 0 transcript_id "g358.t1"; gene_id "g358"; Scaffold_3 AUGUSTUS CDS 1566926 1567420 1 + 0 transcript_id "g358.t1"; gene_id "g358"; Scaffold_3 AUGUSTUS stop_codon 1567418 1567420 . + 0 transcript_id "g358.t1"; gene_id "g358"; # protein sequence = [MDPVKLAKLQAQAAANRLGVERELCDEKLSGKQKPSGAQDDKKLQGALKKLNVQPIAGVEEVNMFKEDGTVLHFQAPK # GASNSFLELQIISDLCFSPPVHAAVSANTFAIYGTGQSKELTELVPGILNQLGPDSLASLRKLAESYQAIQQGQRTTNPAAEDDDDDVPDLVENFDEA # DKTAGLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g358 ### # start gene g359 Scaffold_3 AUGUSTUS gene 1586318 1586779 0.65 - . g359 Scaffold_3 AUGUSTUS transcript 1586318 1586779 0.65 - . g359.t1 Scaffold_3 AUGUSTUS stop_codon 1586318 1586320 . - 0 transcript_id "g359.t1"; gene_id "g359"; Scaffold_3 AUGUSTUS CDS 1586318 1586779 0.65 - 0 transcript_id "g359.t1"; gene_id "g359"; Scaffold_3 AUGUSTUS start_codon 1586777 1586779 . - 0 transcript_id "g359.t1"; gene_id "g359"; # protein sequence = [MISGIRSLSATHEQIIVGWTGDIEGSEDEKKEVGQVTEDDRTQLNELLSKGGEEDDVHEAHDKGHHHTGYAAVWMSSP # VAHGYYDGYCKQILWPLFHYLLWQDVATEYASADSHYPHYEAANAAFARRIAELYRPGDLIWVHDYHPTSTPQFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g359 ### # start gene g360 Scaffold_3 AUGUSTUS gene 1587957 1588866 0.21 - . g360 Scaffold_3 AUGUSTUS transcript 1587957 1588866 0.21 - . g360.t1 Scaffold_3 AUGUSTUS stop_codon 1587957 1587959 . - 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_3 AUGUSTUS CDS 1587957 1588574 0.47 - 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_3 AUGUSTUS CDS 1588663 1588866 0.3 - 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_3 AUGUSTUS start_codon 1588864 1588866 . - 0 transcript_id "g360.t1"; gene_id "g360"; # protein sequence = [MILPSSTTVVAMLVAFNLCLGSSASIVPSPLEISNVSFQGRQLASPFDTSSSGCAVSTAMVPNQRGELFLESIKDFGL # ILVHSGRSVGAVAELYDVSCEYLTADLSNVSAEAYRLWVAAPTYYTESTLIDVLHAYRGTPSVPTILGQHYFVPNPTGSGLSPKWDFTSESFAGNNAA # YVIGRAVGDIPSPDGSANIDWLYLTNVQGGLAQEVYRTNTTGGQPPTEASGSFKRRAQGADEGTLNGIECTPGSTVAVKYTSLYCKFCSLKYHPLLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g360 ### # start gene g361 Scaffold_3 AUGUSTUS gene 1592753 1593971 0.79 + . g361 Scaffold_3 AUGUSTUS transcript 1592753 1593971 0.79 + . g361.t1 Scaffold_3 AUGUSTUS start_codon 1592753 1592755 . + 0 transcript_id "g361.t1"; gene_id "g361"; Scaffold_3 AUGUSTUS CDS 1592753 1593020 0.93 + 0 transcript_id "g361.t1"; gene_id "g361"; Scaffold_3 AUGUSTUS CDS 1593427 1593971 1 + 2 transcript_id "g361.t1"; gene_id "g361"; Scaffold_3 AUGUSTUS stop_codon 1593969 1593971 . + 0 transcript_id "g361.t1"; gene_id "g361"; # protein sequence = [MTTEQSKTASPPTSEHPFPATATNSASASIPPQFPHFAGAYPPTLPPGYPPFFAYPPPNDGQQGEGNPAPLPYPLLYP # PPGMVYAFPPPTQSPSEGGEWPQGSPPPPNTATTSGTLHSVAQFPPVPEGLYPIYLPPGYTLPEPQPNVDGSAPSGPTLVPFYIGSFAPYGLPPGAVF # QLPPQGTHPPPPPASQSMTVEAGTVSTAAKRSAEQVSDSTTASVPTATTISEDAGDENVHDHTKAGNNNNNSNNEAFCEGDATIMDLDRSSIGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g361 ### # start gene g362 Scaffold_3 AUGUSTUS gene 1604834 1610961 0.37 - . g362 Scaffold_3 AUGUSTUS transcript 1604834 1610961 0.37 - . g362.t1 Scaffold_3 AUGUSTUS stop_codon 1604834 1604836 . - 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_3 AUGUSTUS CDS 1604834 1605771 0.41 - 2 transcript_id "g362.t1"; gene_id "g362"; Scaffold_3 AUGUSTUS CDS 1605888 1610961 0.39 - 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_3 AUGUSTUS start_codon 1610959 1610961 . - 0 transcript_id "g362.t1"; gene_id "g362"; # protein sequence = [MLIARVRHTKCFVRVQKGSTNYSKLVSNVIAFENPIPKIYDTLPPPREEIEEVLAVMFSGSTKPTQDDYARALLLVRR # NVVAKALQVLILNHFDYNDVVFSSANLNSYADNVPIVAVEYFQKGSNRNAEGVSVHDDLNDDGTEEGTCVFTVHGIVGPSIKNMTRDQMIGIAAMHLD # NEGKFMRTSHAENPESLWNNPQLYPKMFPWLFPFGLGGIGTSNIKSFSESSHLNFLLLYHDKRFQLDPNFPLIAFSHQQVKASSSQSYLLAESNKFDE # VSNRFLSIDKSVLQNIATRMANGEHVKPANDSEIQCFKLLGDLSHAGAKTQGSISSKKNMQSEIWSLINHIGGPSWYITVSPCDFKHPICIYYADTKE # KFDVPLRTSSECRLLISNNPVAGARFFHLLVNLFLKHVVDIESSEGGLFGPTSGYYCTVEQQGRLALHLHGLIFNRKILSPQEIRDKILDPASSFQSQ # LISFLESVRIGEFLTGSHAYVKETVALQSKSNINYISPERTLPTPPPPYCDCGITDCHKCSTFQHWFEEFKCTVDDLLLKSNVHDCFRGISPDGSVLN # QDKFETSCLNNAHKKCKARFPRECFQQTSVDPDNGHIDLKKLEEWLNDISPGLTYLVRGNTDVTSILSGTAIKSAVIYIADYITKTGLKTHVVFDSIK # TIFDKSTEIIDGSFSTKEKSRRLISRIVNLLSTKLELGSPMISLYLLKNPDHYTSHNFIPFYWKTYVSTARSFFGENDSTSEPKLILTKRWDKIVGLS # SSLDYTHRPVQHVNYNLYNWVCSFYKVAKRKSKDEVLSDHETELKSSKSVKSTKGLPFLVGHPLVETHVISTRRNSSMTVPNFIGALPRPNKDDREYY # CCTMLTLFCPWRTGEDLKKKDQSWHEAFEAYDFCEQSQLYMKNMNIRFECLDARDDFRAQLKSGKLDVTKLPSSIPIQLHADLVNKLDGSHSDMNSSD # IEDIGHNYDQYTEDKKGNFFLRRESAMRAMKDMLFNIGWVIPLTGSVQSKSITTCSPILLPKEKPQHWDLILKGMRDQVLATRDKDRGLPPSNNNENI # NDPGKYRPNIVEICDKHYFDKLGIDYGSIKELTLNIIKCHNLNNEQERAFRIIAQHSAGLVSEPLYMYIGGMGGTGKSQVIKAVLQFFADRNSSFAIV # TSAPTGNAAALLGGSTYHFLLGLNNKVEEVGRGTMAQVCARLEHVQYMILDEVSMLSCSDLYRISVQLCGAKNKHDIAFGGMNMIFAGDFAQLPPVGG # ESVSLYSYRRPTDANKYNGQCAAMGKSLWHNVTHVVILRKNMRNTGSSKADISFRLALDNMRYKSCTKEDIGFLNTLVSSKSPGRPFVGKSPWRDAAI # IVGENKHKDEINRLGCLRFASDTNQILTHFYSDDLASSNTDQPMYVKSKKKKQIKSSISKELQHHLWELPTCAHETHAPPVLSLCIGLPIIIRHNIAT # ELSITKGQRGTVYAWHESTGAFDQCVLDVLFVLLDNPPTPIHVPGLPPNVVPLTRRKTKGIVTLRNDVKISVTRNQVDILPGFSMTAYASQGQGLNPN # ATDLNTLNDHHAIYTALSRSRTAASTVILQGFDSRLITGGASGPLRKEYRELEMLDEITCLRYEGALDPSVVGITRNLLIESFLAWKGTTYVPSQVHS # AVSWSDKDPYVQQSEEPLSWSKIHKKAMQKLMKQNKKSNTGDDTTTVKKQNTSQRIMSLGNKLRRSSAGRQALLKRSQKNIVNSDFANPTQLASLPIS # LLWSNNSCAFDSVVTIFVYIWMETNITGDEYTNLPQLIKDFTEYRQGKHTLESVRDSLRSSLNSKRPREFSLTGFCSSTTILEELLKMKSSFMTTKLQ # CEQGHLSKRRPHNLKHSLLEDHRLDLPSSTNEWISVNSPASSNLLCDTCKGSLKKFFHIECAPNVLAFACDGRPHLSIDNVVHLRYNNEDFVYVLKGV # IYYIPMREHFVSRIVSSENVIYIYDGMTNNGVPVLEYTNVNEIDWAQCQSGSASAAIYSRSNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g362 ### # start gene g363 Scaffold_3 AUGUSTUS gene 1614604 1615470 0.74 - . g363 Scaffold_3 AUGUSTUS transcript 1614604 1615470 0.74 - . g363.t1 Scaffold_3 AUGUSTUS stop_codon 1614604 1614606 . - 0 transcript_id "g363.t1"; gene_id "g363"; Scaffold_3 AUGUSTUS CDS 1614604 1615470 0.74 - 0 transcript_id "g363.t1"; gene_id "g363"; Scaffold_3 AUGUSTUS start_codon 1615468 1615470 . - 0 transcript_id "g363.t1"; gene_id "g363"; # protein sequence = [MQESQRLFAFFGSLIGSSKFGCPVSEGIIDFRSNQRFDSDAWKDDPDNLSPLEPGQSSPIIIIRPFHVLFFALVTPGK # KRDISNVPKNIHCKNPLPFSRAGAYRSYFPYFVVLTSITVPIFDGRDSFVAAPAQLNQIGSRTYPLYKNSEEDPPTGCIVCVGYTAHTWQSSGSYKAP # PLSLSLGLQFVVVLALPPGYDGPDLPKPISSRPFPKPIYNTPTRTKDFPGPPRRKPPRSKPSSEDAAGSSRISRHAKVNSDDDSPYLHAGGLKEGFEY # HEDVMASKSNRNGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g363 ### # start gene g364 Scaffold_3 AUGUSTUS gene 1615865 1617136 0.63 - . g364 Scaffold_3 AUGUSTUS transcript 1615865 1617136 0.63 - . g364.t1 Scaffold_3 AUGUSTUS stop_codon 1615865 1615867 . - 0 transcript_id "g364.t1"; gene_id "g364"; Scaffold_3 AUGUSTUS CDS 1615865 1617136 0.63 - 0 transcript_id "g364.t1"; gene_id "g364"; Scaffold_3 AUGUSTUS start_codon 1617134 1617136 . - 0 transcript_id "g364.t1"; gene_id "g364"; # protein sequence = [MFSFFRQSPYVDIFSSSTVSQSDGLVSISPSPPKNLTSIVVNGQTYYASDDPTFTNLVLSPSSPLRGGAPARSVVTNP # VSSRMDSPSSRPSSFLPDVVGVDHQVDEDSFDLCYPPESPKNTMSPIPAPSSSHGLSIEDYDSMDIDLPANFRSIPALRTPSPDLPSNPLEGWIPTPR # SSSTLESRMRPVLPTTSSSKTKIFPSKLERGMSPLKIPYGASPSPPRSLLSSPSHSNSDTSTVNTSPSKSSATGSPSSRLKGKDHLRFHPFSNSKRTT # PSPLVTTPVKTPKPSAAGKKHRDAIIHRALTDALPSPSIPPSGFDNLASSSPPRKSRKELICDALSENDLMDSGDSAGFEEQYHEPQDVVPFIDNNLG # ENGVLNAEWIDPRFAASFRSVVDLPSVILLNPNLCFANIYRLVTAPSPSGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g364 ### # start gene g365 Scaffold_3 AUGUSTUS gene 1627433 1627890 0.06 + . g365 Scaffold_3 AUGUSTUS transcript 1627433 1627890 0.06 + . g365.t1 Scaffold_3 AUGUSTUS start_codon 1627433 1627435 . + 0 transcript_id "g365.t1"; gene_id "g365"; Scaffold_3 AUGUSTUS CDS 1627433 1627436 0.3 + 0 transcript_id "g365.t1"; gene_id "g365"; Scaffold_3 AUGUSTUS CDS 1627517 1627890 0.35 + 2 transcript_id "g365.t1"; gene_id "g365"; Scaffold_3 AUGUSTUS stop_codon 1627888 1627890 . + 0 transcript_id "g365.t1"; gene_id "g365"; # protein sequence = [MLLLITRYRFDVAAWVKANLAGGDDKNSDSPGAGLKIAGSDPNRPEDEGVGVVIASDKDEATRKMERDAQAELKRQQN # ALPSWHLKSTISGDLTALGIKESARAEAAVAMASVQLQMMRFCVGWV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g365 ### # start gene g366 Scaffold_3 AUGUSTUS gene 1633784 1634470 0.56 - . g366 Scaffold_3 AUGUSTUS transcript 1633784 1634470 0.56 - . g366.t1 Scaffold_3 AUGUSTUS stop_codon 1633784 1633786 . - 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_3 AUGUSTUS CDS 1633784 1634470 0.56 - 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_3 AUGUSTUS start_codon 1634468 1634470 . - 0 transcript_id "g366.t1"; gene_id "g366"; # protein sequence = [MHASRNHASNASVHSNGSGSGMDIDADADGDAEADLDDAEAEVEGDIAALVDQAAPSPLRPRPGSKPRNDEDVDIAAL # AGVDDDPDDYDSPATTHALRRQQAVRAAGGVTSAYGVSGLGKAAGEVSSGPSADAELDILEAVDAAEAKQCKQLYLEGRGFLTLLTDLIVQDYITQHN # LLYLFLLVEPTGLGSCTELSVLVFETAFCIFYLSSHSLYFSARYRILYRCLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g366 ### # start gene g367 Scaffold_3 AUGUSTUS gene 1635195 1637134 0.91 - . g367 Scaffold_3 AUGUSTUS transcript 1635195 1637134 0.91 - . g367.t1 Scaffold_3 AUGUSTUS stop_codon 1635195 1635197 . - 0 transcript_id "g367.t1"; gene_id "g367"; Scaffold_3 AUGUSTUS CDS 1635195 1636229 1 - 0 transcript_id "g367.t1"; gene_id "g367"; Scaffold_3 AUGUSTUS CDS 1636289 1636328 0.91 - 1 transcript_id "g367.t1"; gene_id "g367"; Scaffold_3 AUGUSTUS CDS 1636425 1637134 0.92 - 0 transcript_id "g367.t1"; gene_id "g367"; Scaffold_3 AUGUSTUS start_codon 1637132 1637134 . - 0 transcript_id "g367.t1"; gene_id "g367"; # protein sequence = [MDVDVLIQPVAQPRTSKSPVLLPVTSPANGKPKSPPADVEALPSPPTPNSTAHPASALASMLTDAFVQIESLKEMLKK # EKSRADHFEVLARDYKDLLGEGSRPDAERNQTENAKGDDKNDIPMDISRSKDQASQLTAAAEKIRQLRESLTAAEEVRDEEMARRILITDLWAQLNQY # IERLETTGKDARIGFDRIVKSGGGTIRDTNSIFKDIPQLAEGDLMRVDRNYNANGVLQPLALGPNSKRVRYQDEHPHHHPSGNVVSPTYYQPSPHSQH # PPPPGGSNHPLSPTSHIQQHQHTILQNMPYAQPPPLAAASSSSGSGSRHRDRRHTDPAATHASEQQSNVYPVPGPPGYDHAYRSQDHPRAYRDDRQRR # RRDRSRSYSRGRSPSHGSEGSMDLDEMLLATTGDEQHLQANGNGLPGPPQVLVAGRGKARPLSSHGGLIYDPRDGSQYVPQPSQYPLSPHAQHLSAHH # SSQHLGGPPPPPHVIQYGQNPQPGPPSGRQSPPFNTSSRPSSSRRVLRSEPTLRDDLDRREGPLSQSTAPGQVQYQTHVFAPVQTGAPVKKSKFNNAS # GNASTANVAEGKIFFFLFFSPNNEGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g367 ### # start gene g368 Scaffold_3 AUGUSTUS gene 1643997 1644743 0.52 + . g368 Scaffold_3 AUGUSTUS transcript 1643997 1644743 0.52 + . g368.t1 Scaffold_3 AUGUSTUS start_codon 1643997 1643999 . + 0 transcript_id "g368.t1"; gene_id "g368"; Scaffold_3 AUGUSTUS CDS 1643997 1644743 0.52 + 0 transcript_id "g368.t1"; gene_id "g368"; Scaffold_3 AUGUSTUS stop_codon 1644741 1644743 . + 0 transcript_id "g368.t1"; gene_id "g368"; # protein sequence = [MHSLPPPPLPVTKSKRARQQERITRWQRDEVARRQIFDDAAFDAESSSFNSDSFSPPHPPDIYLPPAHMSGHPHVKTP # SLSSSEWVNSMVKAADPPETQKLIPIPWDIFVPPTPWTSQPLPDLDQPPSRPLQSVPIPPVNLPAKPVHAAMPTPSTNINASAESPKKPPPTNTIGMP # YARDPDGKRGGFKLSSTTVFESKSHLTFPHKADPSRSLIMDQLPKLSRTPQWLKSWAIDALRNRTGFYRYRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g368 ### # start gene g369 Scaffold_3 AUGUSTUS gene 1653515 1655351 0.55 + . g369 Scaffold_3 AUGUSTUS transcript 1653515 1655351 0.55 + . g369.t1 Scaffold_3 AUGUSTUS start_codon 1653515 1653517 . + 0 transcript_id "g369.t1"; gene_id "g369"; Scaffold_3 AUGUSTUS CDS 1653515 1653992 0.65 + 0 transcript_id "g369.t1"; gene_id "g369"; Scaffold_3 AUGUSTUS CDS 1654123 1655351 0.72 + 2 transcript_id "g369.t1"; gene_id "g369"; Scaffold_3 AUGUSTUS stop_codon 1655349 1655351 . + 0 transcript_id "g369.t1"; gene_id "g369"; # protein sequence = [MARFRAFSDGESSSASSSDSDSEEQLVKPARHVSYKDQKLPIAEEEEEDGAEEEEEEEDGEEEEDEDEDDEGEDDEEE # EEEEEEETDSELSSEMQEDELQLTKDRNLAPRAQIAGVDSQRMHVMQTSLFRMPEEAAALKAMNQIADSSFRKLTPTLRKHAVGAEDALADAGLSFGR # SFRVGWGPGGVLVRPSSGTIVLKSKIPMPASDSLSPKLLQHQLSHSPISPDDGGVPFANPSPEVLLFSSFSSLFPATDASQEASMFRLGSALFDPLSL # HLSSQAATPDIRQRVSLLTRKAALSSWLQYAVAPAVQEYLQTHLAASAPAIAFAHLTGNQLERACDVAMDSGYPTLATLIAQAGGDSQYRNDLLEQLE # IWTNQKVDTLIDSDLRKIYALLAGDLTVDIVHGLDWKRIFGLYLWFVEPMHTPIAQVFNSFRESTDDGSEDLLFSLLRLYSDETCSLSDIFQPRTSAG # QLNYTIPWHLYIILSRCMRVRDFPDRGDVRHDGHVSIDDDQPEPEPEFEGHSPTADLLTSSYALQLEQQGMIQEAIFVLLHLEGSAGLVHLLNYTICF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g369 ### # start gene g370 Scaffold_3 AUGUSTUS gene 1668034 1668441 0.48 + . g370 Scaffold_3 AUGUSTUS transcript 1668034 1668441 0.48 + . g370.t1 Scaffold_3 AUGUSTUS start_codon 1668034 1668036 . + 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_3 AUGUSTUS CDS 1668034 1668441 0.48 + 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_3 AUGUSTUS stop_codon 1668439 1668441 . + 0 transcript_id "g370.t1"; gene_id "g370"; # protein sequence = [MGANGWPFASVDPFPGADVDPLYDSQHVKDLYLSVAPDYSGRFTVPVLWDKKDKTIVNNESSEIIRIFNTAFNHLLPE # KFAQVDLYPASLKAKIDELNEWIYPNINSEFLASRRLDGVLIDTYPGRRCLPHGFCD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g370 ### # start gene g371 Scaffold_3 AUGUSTUS gene 1669110 1670195 0.35 - . g371 Scaffold_3 AUGUSTUS transcript 1669110 1670195 0.35 - . g371.t1 Scaffold_3 AUGUSTUS stop_codon 1669110 1669112 . - 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_3 AUGUSTUS CDS 1669110 1669267 0.78 - 2 transcript_id "g371.t1"; gene_id "g371"; Scaffold_3 AUGUSTUS CDS 1669401 1669695 0.64 - 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_3 AUGUSTUS CDS 1669771 1670109 0.65 - 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_3 AUGUSTUS CDS 1670178 1670195 0.54 - 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_3 AUGUSTUS start_codon 1670193 1670195 . - 0 transcript_id "g371.t1"; gene_id "g371"; # protein sequence = [MSSEYVRSPPDSSDSEYLPGPSSSEDSSEGEDANVLECGGLFFPFRRHSLELKVVCKNPLHRTRRRTPASRIHFHGFC # AALDVLVALSGMGKDAYLTDIKTKINQKTNLYNIPKDTNAAKNHITAKFKAGNGASNAATAPFDPENVIQWGRVKTYLNTPYVSSNAATLVKSIDTKA # TALLEKAELDAKGCQASQNTIDSAKVRDTHNHPKMIYVPLPLLTKSSEITRNTIVKTKSETDSISIRLSALALSFERYNKHDKCCKFLLQEIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g371 ### # start gene g372 Scaffold_3 AUGUSTUS gene 1672899 1673894 0.96 + . g372 Scaffold_3 AUGUSTUS transcript 1672899 1673894 0.96 + . g372.t1 Scaffold_3 AUGUSTUS start_codon 1672899 1672901 . + 0 transcript_id "g372.t1"; gene_id "g372"; Scaffold_3 AUGUSTUS CDS 1672899 1673894 0.96 + 0 transcript_id "g372.t1"; gene_id "g372"; Scaffold_3 AUGUSTUS stop_codon 1673892 1673894 . + 0 transcript_id "g372.t1"; gene_id "g372"; # protein sequence = [MLPSASTATMVDTQSQGHQSKTPSIIIDDSFTRESSPSPPPPLAKPFDKDATLRARPDLTKSHLHKSSYFYRSFPNSP # NQSKVSLPDIEDTEVEEGRGLVEEDRARNAEVVTRQPNVRQSSICSTQSRHSHVLEQPTALQKYLLHPMSIFWHGFTDFMTVPLYAAFLSIIVALLPT # IQHTLEVHLYPIKGALESSGSCSIPVTLVVLGAYFYKEKDGFGDGMSVIPTRMEGVQEAGAISGGSNGVDNRSKLPGGPSQPSAVQHCRDLFSKLNPK # RKRRPAFLRSDNGDMPLPGETKTVVIAILSRMVLTPLALMPLVTFAAKEDWHSVFEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g372 ### # start gene g373 Scaffold_3 AUGUSTUS gene 1678508 1680904 0.07 + . g373 Scaffold_3 AUGUSTUS transcript 1678508 1680904 0.07 + . g373.t1 Scaffold_3 AUGUSTUS start_codon 1678508 1678510 . + 0 transcript_id "g373.t1"; gene_id "g373"; Scaffold_3 AUGUSTUS CDS 1678508 1679099 0.52 + 0 transcript_id "g373.t1"; gene_id "g373"; Scaffold_3 AUGUSTUS CDS 1679843 1679855 0.39 + 2 transcript_id "g373.t1"; gene_id "g373"; Scaffold_3 AUGUSTUS CDS 1680221 1680614 0.25 + 1 transcript_id "g373.t1"; gene_id "g373"; Scaffold_3 AUGUSTUS CDS 1680665 1680904 0.56 + 0 transcript_id "g373.t1"; gene_id "g373"; Scaffold_3 AUGUSTUS stop_codon 1680902 1680904 . + 0 transcript_id "g373.t1"; gene_id "g373"; # protein sequence = [MTSSFDLADALERLTSSASEFEIPNERDVSREEAEQLLEGQFSLTLARETLTRKSLAAVEAVAESSDSITDPQVFDLY # CSLLKHSEFVPGSVMNKLLDSITSGLSTQLDSARKDIQNEDQQVYRTHKAPLEMYAFLLQWFVQAAEKVKGIAEPSTPVPKSRRGRGAKSVGARAPAR # TKKSEEWTWFDHVAVTLGLIAPVLTRTEDDMEVDDEDEEPTDDEDENEDEGENTSMAVDEEGQLPSSTKKNKLKPRKSQLNLEAFNDDEAIRKLTSVD # TEKLRLQKKYFADGLEFIRQMEGAILLLVQMLGSKSKAEVLEAMEFFRVAHEYQLSTAETGIRKMLHLIWNKDNNATSEDGKQLKGVRARLLECYQEL # YFNPVPDISPKEQVNRIAKNMIQCVFCVNCYCCCSFNPLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g373 ### # start gene g374 Scaffold_3 AUGUSTUS gene 1681425 1681859 0.39 + . g374 Scaffold_3 AUGUSTUS transcript 1681425 1681859 0.39 + . g374.t1 Scaffold_3 AUGUSTUS start_codon 1681425 1681427 . + 0 transcript_id "g374.t1"; gene_id "g374"; Scaffold_3 AUGUSTUS CDS 1681425 1681859 0.39 + 0 transcript_id "g374.t1"; gene_id "g374"; Scaffold_3 AUGUSTUS stop_codon 1681857 1681859 . + 0 transcript_id "g374.t1"; gene_id "g374"; # protein sequence = [MDSPIFRKMRDVIERPCRSKDWFGLAEQAINTIYALGQQPDDLCSDIIKKMTIRIFTPKTQAEIPQKDLDAMDEDENP # SQANGNPSQTDEDKGDAFELAQLLFVVGHVAIKQIAYLEVVEREMKKQKESQKSGKRSILAPILTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g374 ### # start gene g375 Scaffold_3 AUGUSTUS gene 1684997 1685745 0.14 + . g375 Scaffold_3 AUGUSTUS transcript 1684997 1685745 0.14 + . g375.t1 Scaffold_3 AUGUSTUS start_codon 1684997 1684999 . + 0 transcript_id "g375.t1"; gene_id "g375"; Scaffold_3 AUGUSTUS CDS 1684997 1685157 0.23 + 0 transcript_id "g375.t1"; gene_id "g375"; Scaffold_3 AUGUSTUS CDS 1685232 1685745 0.19 + 1 transcript_id "g375.t1"; gene_id "g375"; Scaffold_3 AUGUSTUS stop_codon 1685743 1685745 . + 0 transcript_id "g375.t1"; gene_id "g375"; # protein sequence = [MPGGNPQFQQNPQLQQNAQFQQGFSVPTGGILPQRTGFPAGIQPQQPGFSGGLHNWLSRYDARAATTSGASSSGSTYP # QPISAAELHANLSFQPPQNRSFLSPSPGMGSARPLLPQATGYIDPKLQMMSNTFMPVNTSMPYSATGAPQLPSNLQGGLNLQQSFQQQNQGSAPKIPW # ALSRSEKKSYDQIFRAWDAQSTGFITGQNALEVFGQSGLSKDDLARIW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g375 ### # start gene g376 Scaffold_3 AUGUSTUS gene 1686286 1688655 0.17 + . g376 Scaffold_3 AUGUSTUS transcript 1686286 1688655 0.17 + . g376.t1 Scaffold_3 AUGUSTUS start_codon 1686286 1686288 . + 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_3 AUGUSTUS CDS 1686286 1688655 0.17 + 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_3 AUGUSTUS stop_codon 1688653 1688655 . + 0 transcript_id "g376.t1"; gene_id "g376"; # protein sequence = [MVDKTSQENASRSAEDEALDAERDDLKYRIKRLTEDLDYVSRGPRTASKEEDKRRFERELLSLRHEKLPELERKLKAR # DERREREKRQWQRDRDRANERTGRYRDDRDDRYSSPRDYDDRDRPYSRGGYDDDRDRYRERSRSRDRRDYDRDYRDRGLDRDRDPEYYRDRERNQDRD # YDRPRSSARTRSPPAPPPVAPPSSIRDPPPAPKPAPSPGPSTKNMTPAERQAYAQARAQRLIEERKAKLGLVATPSPLRLTHPSKIDLSRKRRKLRRK # SVLLKNKAEERENLRKERLDQERALKENSTPKTAPTPPAPKAAPPPPVSKRAPPPPKPRTIRVAVPTPPAPSIPVVVSPAAPTEPEINAEDEAIRKRQ # EVLRKEREARAARLKALEEMEKEAEQARIEEELYQARLKALSERPSVSLVPPSIPAAASPVVPPPVAPSPSVSAPPPPPPPAPPVASPPVSTPDKSST # NPFSRLMNQGAGAGAVTSSPPAVASTNPWAKPAAAIASPAPTPSVAARAPSTPTPISSGPKLYHTAPQDDDDDWDMVKEKDDDEDSSDDEISSSRAVR # NDIANRLFGNLLPRPQSGAGSSPSSPAPGASHTPKPESPSMGIPPPPPAPPMTSTAPTAPPPPPMVGGGAPPAAPGDRGALLSSIQSGLRLKPTKTVD # KSGPQLSGKVLGESSPPGHITAAARPPSPPSPPPMAAPEPPVMNVKDNRQSVDWYAGLAADVGKTSVPVVPATIGEDAEYEPESEQYHAPIPDIQVDV # ADPASDLMADINKSISESSFPRAGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g376 ### # start gene g377 Scaffold_3 AUGUSTUS gene 1689346 1689990 0.85 + . g377 Scaffold_3 AUGUSTUS transcript 1689346 1689990 0.85 + . g377.t1 Scaffold_3 AUGUSTUS start_codon 1689346 1689348 . + 0 transcript_id "g377.t1"; gene_id "g377"; Scaffold_3 AUGUSTUS CDS 1689346 1689990 0.85 + 0 transcript_id "g377.t1"; gene_id "g377"; Scaffold_3 AUGUSTUS stop_codon 1689988 1689990 . + 0 transcript_id "g377.t1"; gene_id "g377"; # protein sequence = [MLTVNPTEVGSLDHLNVVDGFIQNIEQVEHEDDAAASDASDSDTDYHSFEDSDGDENSEETHEEREARREHERQMVLE # AAGLIVKKDVKPPPRPPKRKRRPPPIAPRTQSVSSISSKDLPKIPESMQGPEPTPLDDAFERYEAFRLTQSGAGNNRLSAASFDTALSSPTTSVTMST # SPSKDGETRSHSGIFHFLGRSKTPVDSDRRTLTFPLPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g377 ### # start gene g378 Scaffold_3 AUGUSTUS gene 1693201 1694250 0.88 - . g378 Scaffold_3 AUGUSTUS transcript 1693201 1694250 0.88 - . g378.t1 Scaffold_3 AUGUSTUS stop_codon 1693201 1693203 . - 0 transcript_id "g378.t1"; gene_id "g378"; Scaffold_3 AUGUSTUS CDS 1693201 1694250 0.88 - 0 transcript_id "g378.t1"; gene_id "g378"; Scaffold_3 AUGUSTUS start_codon 1694248 1694250 . - 0 transcript_id "g378.t1"; gene_id "g378"; # protein sequence = [MKQVSNLKETRFDNLYSMEDGDSQDKSEPLPDPGPTTETWRPRISSSPPRSRLKTLVDANVDIIDLTLDEETPIPPVS # ILPNTSNPDSSPGIGSKENVVVENEDVHRSDYKPPLLVRLGSGRTPNVDPSRPVTGRTRSPFLRDIPPYLKPRKSSTVVSDSGYECVTKSSSELSGLA # TPLDSNLIKLEPQSTSLVQSQPIVPSAVQRVHDDCFISPPSAQSLSAGAKPHTDSRLEGTEVSQAICVPSCDADDSGDVEEEMQVRDELGLDLHDVEV # RLDSEDDMDNSRPLEQSSESVVEFPKSTKRGSSQVAREDARDFGFSSANGRIERLVVDRDEKVKMEQLTLDFLRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g378 ### # start gene g379 Scaffold_3 AUGUSTUS gene 1694511 1696487 0.18 - . g379 Scaffold_3 AUGUSTUS transcript 1694511 1696487 0.18 - . g379.t1 Scaffold_3 AUGUSTUS stop_codon 1694511 1694513 . - 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_3 AUGUSTUS CDS 1694511 1695640 0.97 - 2 transcript_id "g379.t1"; gene_id "g379"; Scaffold_3 AUGUSTUS CDS 1696043 1696145 0.48 - 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_3 AUGUSTUS CDS 1696195 1696354 0.42 - 1 transcript_id "g379.t1"; gene_id "g379"; Scaffold_3 AUGUSTUS CDS 1696483 1696487 0.36 - 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_3 AUGUSTUS start_codon 1696485 1696487 . - 0 transcript_id "g379.t1"; gene_id "g379"; # protein sequence = [MAEETVYPATSTTVSTSTNPSKYYQTENRIQDSGHGGWSGSISEDAGFNTSRGGIVDFSQSYPTERVFPSNVNEAINP # SKFKQWQPSTSIHPPKKPSAQVRKGVPHAEDLQPNEGFTGVKTTVAPGVPKVLSTSGKVSKNGNTFRGGWIPKRGNWTSKRGRWGDQTGKQGSGRNPN # LPMRPAQPSITSSDLSSSSSLDPGISTPHRLPPTALSKALNNHHIIPQKRKISPNSDPAASISSSSLMSISTSSSGSGAPSGSTGPKDFSHLLPAGPW # KNVKRRKIQEQELRQEDEVPQTRETLKEELANTGEILVADGQTVGERTVNLSDHDPMELNAGEIKVESIDNSFQLVYPPSSPAPSRPSPSNVLPATSI # THSNSQKASTQSSSGTTIVKATPISTTNIKDEPLDVALTETTKPNNPTSGTKRYHPIPSSCLKFFSVPAVNTSFPNTSYPLLQAPSRNVRVIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g379 ### # start gene g380 Scaffold_3 AUGUSTUS gene 1702307 1703794 0.19 - . g380 Scaffold_3 AUGUSTUS transcript 1702307 1703794 0.19 - . g380.t1 Scaffold_3 AUGUSTUS stop_codon 1702307 1702309 . - 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_3 AUGUSTUS CDS 1702307 1703114 0.5 - 1 transcript_id "g380.t1"; gene_id "g380"; Scaffold_3 AUGUSTUS CDS 1703205 1703396 0.3 - 1 transcript_id "g380.t1"; gene_id "g380"; Scaffold_3 AUGUSTUS CDS 1703733 1703794 0.32 - 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_3 AUGUSTUS start_codon 1703792 1703794 . - 0 transcript_id "g380.t1"; gene_id "g380"; # protein sequence = [MPSISWSSDYLTQNRVPPEIVESLYYSLREILFDQINDEDWTIREHAAIALCTFHRVDDPEELEAKGLTSSSDVLLDS # LSNDTKQEDTIDYILDRTRDTVVEVRKEVYSLLEKNVLIGDEDDKDDLEMGRMHPKILSNAHRDLIIKNGLGDRDPSVRDSAVKLLTKWVDSITIGDV # WQDRPQGSMQETNLFKLLTLFNLRANDTLSEAIIKVFETNPRICNDVLFCNTDWLSLTPETAFLERVYFQYCVKNKCITQLAEVHPVVMDFAFYMQEY # FNGMVDVIQRYQEEASNTNLDDVARAILQAQVDDQELITSEVLKIAIHLDYGDEIGRRKMEQLVRKFLFFLILLQPRQC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g380 ### # start gene g381 Scaffold_3 AUGUSTUS gene 1705073 1705462 0.85 + . g381 Scaffold_3 AUGUSTUS transcript 1705073 1705462 0.85 + . g381.t1 Scaffold_3 AUGUSTUS start_codon 1705073 1705075 . + 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_3 AUGUSTUS CDS 1705073 1705462 0.85 + 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_3 AUGUSTUS stop_codon 1705460 1705462 . + 0 transcript_id "g381.t1"; gene_id "g381"; # protein sequence = [MLGLSSTNRAAPRPGQPMPPQAFGASRFLLPVQQCEFQLTGILESLTRDPWPVANDKRALRCTGGALSVAIGLLETTY # PNTGARIMLFTGGPATEGPGMVVSNELKEPIRSHHDIDRDSAKHYKRAMKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g381 ### # start gene g382 Scaffold_3 AUGUSTUS gene 1705598 1706699 0.57 + . g382 Scaffold_3 AUGUSTUS transcript 1705598 1706699 0.57 + . g382.t1 Scaffold_3 AUGUSTUS start_codon 1705598 1705600 . + 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_3 AUGUSTUS CDS 1705598 1705747 0.59 + 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_3 AUGUSTUS CDS 1705803 1706699 0.8 + 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_3 AUGUSTUS stop_codon 1706697 1706699 . + 0 transcript_id "g382.t1"; gene_id "g382"; # protein sequence = [MKSLPNSTNGVIVLSDSFATSIFKQSFLRIFNKDEQGQLQMGFNATFDVQTTKELKVSGMIGHAISAGKKSGCVGETE # IGIGQTSAWKINTLTPRTSAGVYFEVVTPAGQPLQPGSRGLIQFVTHYQHASGQQRLRVTTIARNFAEAGSPNIAASFDQETAAVLMARVAVFKAEVD # ESPDVLRWVDRMLIRLCQKFADYRKEDPTSFRLTDNFSIYPQFMFHLRRSQFLQVFNNSPDETAFYRYADNKSVTLSRLTVLRHVLNEEDVNNSLIMI # QPTLMSYTFDTPPQPVLLDSVSIKPDVVLLLDTFFHILIWHGEVVAQWRKQGYQDQEGYENFKSYWRLPSKMLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g382 ### # start gene g383 Scaffold_3 AUGUSTUS gene 1707804 1708760 0.96 - . g383 Scaffold_3 AUGUSTUS transcript 1707804 1708760 0.96 - . g383.t1 Scaffold_3 AUGUSTUS stop_codon 1707804 1707806 . - 0 transcript_id "g383.t1"; gene_id "g383"; Scaffold_3 AUGUSTUS CDS 1707804 1708760 0.96 - 0 transcript_id "g383.t1"; gene_id "g383"; Scaffold_3 AUGUSTUS start_codon 1708758 1708760 . - 0 transcript_id "g383.t1"; gene_id "g383"; # protein sequence = [MQRRFPNEISSIVVDYLVDDPPALQNVALLCHDFASLAQSRIFEQVSLEDGSKLASGYMPWSRWSRYQRHDYVPLMYR # FNALLSNPQTGFLGKFVRRLDLDPCLGPLRNMEHTEVDVTISSIFQQLPALTELRINHGRGEHFGAVETYLSQQLKELWIGHTTIHEQKCFEYFQNML # TSLTALTRLSINNCSLSHPPDVGSNPIRALIFPSSLKAACITGTDERTFRALGLGLECPQAPVLSSFLSDFRNEVEDRSILWKGLGTNSSIILDVGNM # MYWPGGLTMWNRADPITSYLPGEHSTIMFTSKFPFIFHSYDLRH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g383 ### # start gene g384 Scaffold_3 AUGUSTUS gene 1713052 1713930 1 + . g384 Scaffold_3 AUGUSTUS transcript 1713052 1713930 1 + . g384.t1 Scaffold_3 AUGUSTUS start_codon 1713052 1713054 . + 0 transcript_id "g384.t1"; gene_id "g384"; Scaffold_3 AUGUSTUS CDS 1713052 1713930 1 + 0 transcript_id "g384.t1"; gene_id "g384"; Scaffold_3 AUGUSTUS stop_codon 1713928 1713930 . + 0 transcript_id "g384.t1"; gene_id "g384"; # protein sequence = [MPSEVRRAALINLPVTPETLPVIITRTRDTDTLTRKLAYSSVLEPKLGHPRHLTIAQREDITKVGLGDREATVRVAAG # NMITKWLDIAISEQDPPGQPPETWVGDDGGVMKGFINFLTFFDVVGPGEVIAVDAMLSVFTTKPALLDAFVFNGEAHLLIHVRIADACFVDDFWANLI # PESAVLARVFVDQCLESKSENRLEDAAIPVVTAFAFHIQEAYNALLSLMQEMDFLQIGEPDDEESEAREEELAKKELILGELLRIALNLDYMDEIGRR # KVFSVVSEFPARFRFETN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g384 ### # start gene g385 Scaffold_3 AUGUSTUS gene 1715625 1716934 0.22 + . g385 Scaffold_3 AUGUSTUS transcript 1715625 1716934 0.22 + . g385.t1 Scaffold_3 AUGUSTUS start_codon 1715625 1715627 . + 0 transcript_id "g385.t1"; gene_id "g385"; Scaffold_3 AUGUSTUS CDS 1715625 1716235 0.57 + 0 transcript_id "g385.t1"; gene_id "g385"; Scaffold_3 AUGUSTUS CDS 1716295 1716934 0.35 + 1 transcript_id "g385.t1"; gene_id "g385"; Scaffold_3 AUGUSTUS stop_codon 1716932 1716934 . + 0 transcript_id "g385.t1"; gene_id "g385"; # protein sequence = [MEVPEATGEPINEELLHEEPTIDSVANAIEVSDVEEEDEEYVKEYVEEEDTTDTVAEDLDKAKEAEETFEITEKEEEE # QSTEDEDAVETGEQQLEKDDDEEEDQTQPSKTQSKLKGVSAGAKSKSRSTRSSKSSNGHPDEEDEEDVQIAKAPARRGRSRRTGKMDTEQNTDARQKR # RSAEAKESPPAAKTFVCGHDIPDEEGGKRTRASQRESQAGPSTEPVSPIRKKRAGGRSRSRREAEQEQEPERDASPSPKPKTRSKPRVTPKRGRGSRA # VAASWSGDAPEEEEVAGDELAEREDNDDEEQEDEQKEEEEEAQRQPSPSPIPRAKSTRSSRASTRSRASGQVSTKANEKVSKQSRPEGKENGASTAKA # KLKERAKEGASAESSKPPATRTRTRSSRRKQEKEMEVDGFDSDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g385 ### # start gene g386 Scaffold_3 AUGUSTUS gene 1717763 1718461 0.65 - . g386 Scaffold_3 AUGUSTUS transcript 1717763 1718461 0.65 - . g386.t1 Scaffold_3 AUGUSTUS stop_codon 1717763 1717765 . - 0 transcript_id "g386.t1"; gene_id "g386"; Scaffold_3 AUGUSTUS CDS 1717763 1718461 0.65 - 0 transcript_id "g386.t1"; gene_id "g386"; Scaffold_3 AUGUSTUS start_codon 1718459 1718461 . - 0 transcript_id "g386.t1"; gene_id "g386"; # protein sequence = [MAWTSSGSSNAELIDNMLRNGILGKVVGDVVDGNKSEAECASDRIARAMKKVDRANYVRDKRDAYEDSPQYANEKYVY # TIHSRAEALSPPGLLGMAQQSALLIWCVVAVNDLLPLHFTSNSNRQHAYAASHLLPYLPPGGRVLDVGSGSGYLSAVLYHLIEDPHGHKPSSSDSDAK # SKPLIIGIEHVSELTDWSISNLKRDGLGEALEKGQIEMVTGDGRLGSLCSYVQNSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g386 ### # start gene g387 Scaffold_3 AUGUSTUS gene 1725201 1725918 0.44 - . g387 Scaffold_3 AUGUSTUS transcript 1725201 1725918 0.44 - . g387.t1 Scaffold_3 AUGUSTUS stop_codon 1725201 1725203 . - 0 transcript_id "g387.t1"; gene_id "g387"; Scaffold_3 AUGUSTUS CDS 1725201 1725406 0.69 - 2 transcript_id "g387.t1"; gene_id "g387"; Scaffold_3 AUGUSTUS CDS 1725478 1725830 0.69 - 1 transcript_id "g387.t1"; gene_id "g387"; Scaffold_3 AUGUSTUS CDS 1725899 1725918 0.45 - 0 transcript_id "g387.t1"; gene_id "g387"; Scaffold_3 AUGUSTUS start_codon 1725916 1725918 . - 0 transcript_id "g387.t1"; gene_id "g387"; # protein sequence = [MANIAVRIGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINPVVAKVAVPLPEPSPSVSPTILETPPGDSPR # SRSRSRSRTLRAKPLSSKFPLNPSTYPTVSQFAAQLETPEVDIALVKVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKI # DLEEALRRLSAVFTFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g387 ### # start gene g388 Scaffold_3 AUGUSTUS gene 1727302 1727737 0.32 - . g388 Scaffold_3 AUGUSTUS transcript 1727302 1727737 0.32 - . g388.t1 Scaffold_3 AUGUSTUS stop_codon 1727302 1727304 . - 0 transcript_id "g388.t1"; gene_id "g388"; Scaffold_3 AUGUSTUS CDS 1727302 1727587 0.66 - 1 transcript_id "g388.t1"; gene_id "g388"; Scaffold_3 AUGUSTUS CDS 1727715 1727737 0.32 - 0 transcript_id "g388.t1"; gene_id "g388"; Scaffold_3 AUGUSTUS start_codon 1727735 1727737 . - 0 transcript_id "g388.t1"; gene_id "g388"; # protein sequence = [MEEEQQFDHSPPYGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSG # PGGPGGPGGPGGPGGPGGPRSPIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g388 ### # start gene g389 Scaffold_3 AUGUSTUS gene 1731521 1731946 0.92 - . g389 Scaffold_3 AUGUSTUS transcript 1731521 1731946 0.92 - . g389.t1 Scaffold_3 AUGUSTUS stop_codon 1731521 1731523 . - 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_3 AUGUSTUS CDS 1731521 1731946 0.92 - 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_3 AUGUSTUS start_codon 1731944 1731946 . - 0 transcript_id "g389.t1"; gene_id "g389"; # protein sequence = [MYSDSENVDDTEAVPKKAKRLSRAISWMVTDSDDGPTYTLDVDLEEGQRSGRSSKSGSPVRSFFNSLAASASATSLLL # NLSHKERRLSTSSSSIESGTFTVDGPATSGTGSTPIPDTHSPAPALVSHQHPPTSINSFPPSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g389 ### # start gene g390 Scaffold_3 AUGUSTUS gene 1732262 1733311 0.52 - . g390 Scaffold_3 AUGUSTUS transcript 1732262 1733311 0.52 - . g390.t1 Scaffold_3 AUGUSTUS stop_codon 1732262 1732264 . - 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_3 AUGUSTUS CDS 1732262 1733311 0.52 - 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_3 AUGUSTUS start_codon 1733309 1733311 . - 0 transcript_id "g390.t1"; gene_id "g390"; # protein sequence = [MPLLSAVSLHSQTVAQSLRERGGSEPSSPHLDVVHLQNKVEDGWKQSVNESVDAREDDGELSAVESRQTHTTAVVPSV # ALDTVHSKPSLARTATAPAISSLHYSGALKRMYSFIPPGAALPVSPHLPNAYSTFPRHSVLLMSPTSLPQHQQNFTASTEARPQSDIDSENGGEDHRE # ADDDMKDTDTEDEGMFYFILNDCMNSLCIYERTMLGTYERHVHLFKSQSQRCNSAFLQVSSPLLGSPHSSISGSGTVTTSLIFSDETEILPSQVEPEV # SVEVVSLSDSISIILDPPQPRTSLLLGPEGSESTPPESPSTPTGSQIQPDITERQKIASTFDSDNLASMFKAQCT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g390 ### # start gene g391 Scaffold_3 AUGUSTUS gene 1738595 1739296 0.98 - . g391 Scaffold_3 AUGUSTUS transcript 1738595 1739296 0.98 - . g391.t1 Scaffold_3 AUGUSTUS stop_codon 1738595 1738597 . - 0 transcript_id "g391.t1"; gene_id "g391"; Scaffold_3 AUGUSTUS CDS 1738595 1739296 0.98 - 0 transcript_id "g391.t1"; gene_id "g391"; Scaffold_3 AUGUSTUS start_codon 1739294 1739296 . - 0 transcript_id "g391.t1"; gene_id "g391"; # protein sequence = [MIASWLSVTGLLLYTAISLLSDIEDIVLLLTAFIQLQQIDASFYTPSDPDTKQRNWDDWGESTSYFKSICKPVLVTLT # WAEPVHVDRFFAELEDVVDRLDDFDVNHRQMQSETETLKNKIHNIMNSASHAVHHSLLSLRHELSNPESSLSGLLKPNSGGSLRTTGAEITIEGASEV # VQHIREAIEAILHALQEKVDREVSGEIDKELSGWFKVKGDGSGSGKGSKGKGYDIIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g391 ### # start gene g392 Scaffold_3 AUGUSTUS gene 1740874 1741158 0.63 - . g392 Scaffold_3 AUGUSTUS transcript 1740874 1741158 0.63 - . g392.t1 Scaffold_3 AUGUSTUS stop_codon 1740874 1740876 . - 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_3 AUGUSTUS CDS 1740874 1741158 0.63 - 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_3 AUGUSTUS start_codon 1741156 1741158 . - 0 transcript_id "g392.t1"; gene_id "g392"; # protein sequence = [MERSTTYRKCRLEEIKLPLLEGNLKNVPMEEVSMSFCRFGKHHQKINYCNLRDEVAMDVDDDEDGTQRPKPVQNYGIE # VDFADIDDEEKCVSII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g392 ### # start gene g393 Scaffold_3 AUGUSTUS gene 1741211 1741540 0.64 - . g393 Scaffold_3 AUGUSTUS transcript 1741211 1741540 0.64 - . g393.t1 Scaffold_3 AUGUSTUS stop_codon 1741211 1741213 . - 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_3 AUGUSTUS CDS 1741211 1741540 0.64 - 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_3 AUGUSTUS start_codon 1741538 1741540 . - 0 transcript_id "g393.t1"; gene_id "g393"; # protein sequence = [MIAFTRLEYETEALRSSRERLSHLEELVKTEEVNLAKLQERKKTVEQELADLQEGISAHKEELTELQEVLDEKSKTVE # QAKRTALRSSRILEQTLKEISANVRNPTIIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g393 ### # start gene g394 Scaffold_3 AUGUSTUS gene 1750303 1751430 0.84 - . g394 Scaffold_3 AUGUSTUS transcript 1750303 1751430 0.84 - . g394.t1 Scaffold_3 AUGUSTUS stop_codon 1750303 1750305 . - 0 transcript_id "g394.t1"; gene_id "g394"; Scaffold_3 AUGUSTUS CDS 1750303 1751430 0.84 - 0 transcript_id "g394.t1"; gene_id "g394"; Scaffold_3 AUGUSTUS start_codon 1751428 1751430 . - 0 transcript_id "g394.t1"; gene_id "g394"; # protein sequence = [MSSQVIDTRMTQQYGFQPKFEKENLHRRPEFSTDMNKAAPSPATNNTSKPATSGSTATKVDTTASAVKSEPAPSKPIS # SIPHHVREQVRLSLQESSSSRTTPNPPKPNISATQSDISSNVTTPTTGPSNRGSAIRHAAIIHGLNTPITTPAALQPIPRILPPQQAQDTPNHRQVMF # ADSPLANKVTAVANTLPAPPGESSDDLGAGDDSFALGSEDDAFFASVDLGNADMGRSIGFTEGPGNGGNQERGQHHLSTSASHQKNIQSTHLNPASSS # SSATSSPAMTHNSSKVLPPLHPRKDGHRNQILPHQAQRPAPTSKGSDTPDRQTHPDAISSNTARDPTKVVATSTPAPRRMGGFSFPPDLASFDQSRII # VFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g394 ### # start gene g395 Scaffold_3 AUGUSTUS gene 1751533 1752273 0.73 - . g395 Scaffold_3 AUGUSTUS transcript 1751533 1752273 0.73 - . g395.t1 Scaffold_3 AUGUSTUS stop_codon 1751533 1751535 . - 0 transcript_id "g395.t1"; gene_id "g395"; Scaffold_3 AUGUSTUS CDS 1751533 1752273 0.73 - 0 transcript_id "g395.t1"; gene_id "g395"; Scaffold_3 AUGUSTUS start_codon 1752271 1752273 . - 0 transcript_id "g395.t1"; gene_id "g395"; # protein sequence = [MSLCRFVLNVKTLDIHFACLWMAGALSGHILDSYYTLKSSQFSGPFGAVMHPTFNNIVSNPSPSDSSRIVTNGAMSFD # PDMHGNAQPMKLVSDLPEDDNSFMNLSKATSIKIASLQAKLNQQLGPEYISTRPGPGGGPKLVYAEGWKIINLANEVFGFNGWSSNLVSLTTDFIDYN # EETRRYSVGVTAILRVTLRDGVFHEDIGYGILENSKTKGPALDKVRLSCAISYIYAESDSRCLVQERGRH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g395 ### # start gene g396 Scaffold_3 AUGUSTUS gene 1764920 1765924 0.45 - . g396 Scaffold_3 AUGUSTUS transcript 1764920 1765924 0.45 - . g396.t1 Scaffold_3 AUGUSTUS stop_codon 1764920 1764922 . - 0 transcript_id "g396.t1"; gene_id "g396"; Scaffold_3 AUGUSTUS CDS 1764920 1765924 0.45 - 0 transcript_id "g396.t1"; gene_id "g396"; Scaffold_3 AUGUSTUS start_codon 1765922 1765924 . - 0 transcript_id "g396.t1"; gene_id "g396"; # protein sequence = [MCQFITRLLDAADLRHAPEVYDLSSRSLMQPPVPFEVDTLTSRNGCYFLIQAKDAKDDEEYVIAFRSAATIMEIARRG # WGPRTEDIIKCLIEEGISFNTLMASHPPRRSLSMPFRKPAVLGFRPVGFVPTLQDYCSYELVRNDFLRSARGHSALLAGGIIARLARGIVDVNDVYDG # PTGHALNEGEQALCVWEAGQACAFWDDKLTDEEMDLICGSYEVATGSYSFPSNLILIQKSMHLGFISREGKQQTAIKSWWPRSGSWRSCGLNCGYWSS # DAEDWFRNRLDQILKSTVPMALMTSQEWHGRLKFQRAHTLSNQNDGFAAEYLKTKCNLPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g396 ### # start gene g397 Scaffold_3 AUGUSTUS gene 1765987 1767147 0.45 - . g397 Scaffold_3 AUGUSTUS transcript 1765987 1767147 0.45 - . g397.t1 Scaffold_3 AUGUSTUS stop_codon 1765987 1765989 . - 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_3 AUGUSTUS CDS 1765987 1767147 0.45 - 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_3 AUGUSTUS start_codon 1767145 1767147 . - 0 transcript_id "g397.t1"; gene_id "g397"; # protein sequence = [MRSRLAFIPLIACTSFFLHLLYHLESDWVDLVISALEHNARLPSISPFLSKRQQEYEKLRRGPFPTKWEWKEKLQQQT # SISSEWLEYFHQILDLPMVGAFVDVHTSGCLPWIPVFLKAKIPLMLYWGSINNWSIPTTLDHLICTPNSSIINTLISEQRPYPPPPLPTEGHIPREVP # TNKPRLRLPRIDGGSLPRPNESLFDFIQRREVYRLKVIASESPTERQSRLQREENARKDRPPGRKGARVYYWDLVEGTRVRTAVGRSNYEDIWERYGS # HQRRYDSVADEWEVCTDFDPNDAPDDYGPDSDDDSDCFITVRAHIDEETHHNDGAVSSQAYLARLQSPNKLTHSSIEFHEAIEDVAYHRFGFLKQRRK # IVTLYSNRKSGKRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g397 ### # start gene g398 Scaffold_3 AUGUSTUS gene 1789761 1790831 0.95 + . g398 Scaffold_3 AUGUSTUS transcript 1789761 1790831 0.95 + . g398.t1 Scaffold_3 AUGUSTUS start_codon 1789761 1789763 . + 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_3 AUGUSTUS CDS 1789761 1790831 0.95 + 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_3 AUGUSTUS stop_codon 1790829 1790831 . + 0 transcript_id "g398.t1"; gene_id "g398"; # protein sequence = [MNCRRTLVTAISEGALNNTLNNAWSTGDVAASTVMPYSQTPVDSDSASPTQALVSPIQYGGVHRGPLDPMSAHRQSSH # NQQSPRQHHSSLELAVNLQITTSTLRDSFSQGIDASSLASMIQSFVMLNPSTTPLTPVITSLFQAVTAELSFSRDPRACLRRFLDASTLFPPSIIHAG # VSGPLAGPRALQMQIRKNSIWFPSPSAPCFSVSSSYSISDEMQRLANDRQRKKDHIQWARIHAAALELGMLNMEHSGHADDSGYSYAMSRAFSEMTAR # DAVWEEDEVEWVAGIYVLRAVIRTAMQGDQRKRDEYGELLATYESRLKEIRDENRQTMVAVSPVLLSQWFIFELLLVIRRPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g398 ### # start gene g399 Scaffold_3 AUGUSTUS gene 1792216 1793550 0.67 - . g399 Scaffold_3 AUGUSTUS transcript 1792216 1793550 0.67 - . g399.t1 Scaffold_3 AUGUSTUS stop_codon 1792216 1792218 . - 0 transcript_id "g399.t1"; gene_id "g399"; Scaffold_3 AUGUSTUS CDS 1792216 1793550 0.67 - 0 transcript_id "g399.t1"; gene_id "g399"; Scaffold_3 AUGUSTUS start_codon 1793548 1793550 . - 0 transcript_id "g399.t1"; gene_id "g399"; # protein sequence = [MTSEIWLADTDIAGSARRLTDGLFNDRAAVFHPDGNSVIFVSDRTQSGKAKDLYQLFLSDTEDARDPRFLNLGRSVQE # FEISPDGQYIAYSSIRHSFAESTACDAKVYGFQKQPLGLWIYSFVTAESRLVDGIDGVCHIESFTWSPDGFELLYRLRKGKEAEYSEQEILVQRISVK # PESRPVTLGTYPRSPSGSNIWLGSGHIVGLQSYEPCNSLDARALFIHDISSGKPKATKRLYGDFEDAVRIVDMQSKYYSNRHGGSGMIAVEVCSDVDT # HIDAVYLHRNNSTPKDNYLFAVLPLFRTQGDAIWFGAWDAKYAYDSATDKTTVVVAAVLSSGILNEPPNVWSVRIDENMETRGTPPSRAVTSDDRLEY # DVPNWYYPSLTSVRYKLSSHLDWLKNSAPLRTEVIHWQAEDGTRLSGVVRSSMSAVNRPLPTVLFIHGGPYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g399 ### # start gene g400 Scaffold_3 AUGUSTUS gene 1802966 1804414 0.19 - . g400 Scaffold_3 AUGUSTUS transcript 1802966 1804414 0.19 - . g400.t1 Scaffold_3 AUGUSTUS stop_codon 1802966 1802968 . - 0 transcript_id "g400.t1"; gene_id "g400"; Scaffold_3 AUGUSTUS CDS 1802966 1804072 0.77 - 0 transcript_id "g400.t1"; gene_id "g400"; Scaffold_3 AUGUSTUS CDS 1804124 1804414 0.19 - 0 transcript_id "g400.t1"; gene_id "g400"; Scaffold_3 AUGUSTUS start_codon 1804412 1804414 . - 0 transcript_id "g400.t1"; gene_id "g400"; # protein sequence = [MNGITLGSKQVVVRLHEPKQLRQEKLAARFGGGGNGHPRTASGATSPTASEGGDSYGAGWGSPSPRNRTLGLGNLGGS # PGYGTERDRGRRGSGSYYNAALTGTLNLPMRYDDLAALSPVVRKEVLTGELSRRVKSLGSVAPADVASIVDGLVNVSLSEIVQAIDDPEKLANQVDKL # RISRNLSASTSPSPNSNSQSPARSATASQDSRLLDPNALAATASAPEHPSTPISVNASLSTPPRTSSPSGSLPPTSERDRIAAAVAKFENSPSEKQEQ # LTELLMSLPKRERALCLFNMEVFRAKLADARLVLESMEEEEEETNATSVATAAAVPPSTPQNKKTSSYSTMERSPQTPDLSSRGPSATSSPLPATPAA # GTPTGAGNTYTIAALAKLPAKEVLKIVRSSSVILPVDMSKADPLVVQATDEFVDGLMDKAPQMQKQLLGEKLFRVVKSFGIKGAVSFFFRYDH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g400 ### # start gene g401 Scaffold_3 AUGUSTUS gene 1806261 1806552 0.48 - . g401 Scaffold_3 AUGUSTUS transcript 1806261 1806552 0.48 - . g401.t1 Scaffold_3 AUGUSTUS stop_codon 1806261 1806263 . - 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_3 AUGUSTUS CDS 1806261 1806392 0.66 - 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_3 AUGUSTUS CDS 1806451 1806552 0.52 - 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_3 AUGUSTUS start_codon 1806550 1806552 . - 0 transcript_id "g401.t1"; gene_id "g401"; # protein sequence = [MTSHSEYTKTEQVVGRPRTTSHNMMDDYVKDPPDNLSPESLKNAEEAIRDSEAYEDRLNNDKHERQYRAETKVGIIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g401 ### # start gene g402 Scaffold_3 AUGUSTUS gene 1807611 1808417 0.52 - . g402 Scaffold_3 AUGUSTUS transcript 1807611 1808417 0.52 - . g402.t1 Scaffold_3 AUGUSTUS stop_codon 1807611 1807613 . - 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_3 AUGUSTUS CDS 1807611 1808417 0.52 - 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_3 AUGUSTUS start_codon 1808415 1808417 . - 0 transcript_id "g402.t1"; gene_id "g402"; # protein sequence = [MSAVQALKKFRLHELKGLQSHISRFGPLPASESSSGVPLPNPFLPHKNPQTGRWAPPKYSLRRQAELIKKAKASNNLE # LLPPGPKLSVPAASIWSQRLDATVGSSQKLAVLDETLAFPVDWIGEFKLKVADGTDLGARLYTGKKRMFKGHKWERVRERRAAHHTMLLKDMDKRVRR # YKKVSSDVLSSKCDSDQSFFPATSEEETKSSQGFSKDIYKITVLVAYVLLSIIVVIQSIPAFTRSITAVVSLHHIGKETDPRSRSSMPDYIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g402 ### # start gene g403 Scaffold_3 AUGUSTUS gene 1809645 1810682 0.96 - . g403 Scaffold_3 AUGUSTUS transcript 1809645 1810682 0.96 - . g403.t1 Scaffold_3 AUGUSTUS stop_codon 1809645 1809647 . - 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_3 AUGUSTUS CDS 1809645 1810682 0.96 - 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_3 AUGUSTUS start_codon 1810680 1810682 . - 0 transcript_id "g403.t1"; gene_id "g403"; # protein sequence = [MSTPIPAIAEHANGPASVLRLSRTLQTSTEAFLRWHDAEVALALKDIEATREYERFLRVDLQNQLILSEQNLRACERH # LELVQKKVNPDLRKINMDSARLQQVETDVKSIIDALKRIGIRLCKDTNDVLWLVCDVDADARWTQVQQPSEDNHRSSQDVLDSPLCSPTSQKATIQKQ # PLNAIVAIDTLLDAHNKHMAEKRILSARCNTAESVAEQLKKEMEVKDSRIAELEAKIASMWVEEPCSTTGVTNVTCISPSQLFKNPKFSPFLSESSSS # SNPFQPGVGVASNNSEYDSSSSDPSDGSTDPQSFLNASVSQIRQLKSLPPSSSDKAGCSGTRIRYHQYADP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g403 ### # start gene g404 Scaffold_3 AUGUSTUS gene 1811466 1811756 0.59 - . g404 Scaffold_3 AUGUSTUS transcript 1811466 1811756 0.59 - . g404.t1 Scaffold_3 AUGUSTUS stop_codon 1811466 1811468 . - 0 transcript_id "g404.t1"; gene_id "g404"; Scaffold_3 AUGUSTUS CDS 1811466 1811756 0.59 - 0 transcript_id "g404.t1"; gene_id "g404"; Scaffold_3 AUGUSTUS start_codon 1811754 1811756 . - 0 transcript_id "g404.t1"; gene_id "g404"; # protein sequence = [MALQLSEDRISLTERRNQIIAGLHSMPAQIKKVLDLDSVIQQFAQSVADYKSLLLMGRGFQYATCLEGALKIKEISYM # HSEGKPTSSLFSHPSFID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g404 ### # start gene g405 Scaffold_3 AUGUSTUS gene 1811791 1813452 0.33 - . g405 Scaffold_3 AUGUSTUS transcript 1811791 1813452 0.33 - . g405.t1 Scaffold_3 AUGUSTUS stop_codon 1811791 1811793 . - 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_3 AUGUSTUS CDS 1811791 1812635 1 - 2 transcript_id "g405.t1"; gene_id "g405"; Scaffold_3 AUGUSTUS CDS 1812688 1812907 0.95 - 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_3 AUGUSTUS CDS 1813003 1813338 0.89 - 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_3 AUGUSTUS CDS 1813426 1813452 0.36 - 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_3 AUGUSTUS start_codon 1813450 1813452 . - 0 transcript_id "g405.t1"; gene_id "g405"; # protein sequence = [MSTLGTNTLSRKEVLEVLCQGLARQEYRGYDSAGLGVDGDKPGEVIFFKEVGKVAGLRKQIASSNVDVNKTFVSQVSI # AHTRWATHGVPSVANCHPLRSDPTAEFCVVHNGIVTNSAALRLKNLTFTDLVKAVLKELEGSFAFVFKSTHFPNEIVTARRGSPLLIGVKTDKKLKVD # FVDVEFAGQDSKDVKADTLHPTSPSALLAPPSANPKVLRTQSRAFMSEDGLPQPIEFFVASDASAVVEHTKRVLYLEDNDIAHIADGELHIHRLRRQD # DRDQTPAQIASTRTIETLEIEIAAIMKGKFHHFMQKEIYEQPESVVNTMRGRVNFDTNQITLGGLRAYLPIMRRGRRIVFIACGTSYHSCIATRAIFE # ELTEIPVSVELASDFLDRKTPIFRDDVCVFLSQSGETADTILALRYCLERGALCVGVVNTVGSTISRETHCGVHINAGPEIGVASTKVCLLTFFCEDL # SFDCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g405 ### # start gene g406 Scaffold_3 AUGUSTUS gene 1815725 1818099 0.62 - . g406 Scaffold_3 AUGUSTUS transcript 1815725 1818099 0.62 - . g406.t1 Scaffold_3 AUGUSTUS stop_codon 1815725 1815727 . - 0 transcript_id "g406.t1"; gene_id "g406"; Scaffold_3 AUGUSTUS CDS 1815725 1816917 0.99 - 2 transcript_id "g406.t1"; gene_id "g406"; Scaffold_3 AUGUSTUS CDS 1817022 1818099 0.62 - 0 transcript_id "g406.t1"; gene_id "g406"; Scaffold_3 AUGUSTUS start_codon 1818097 1818099 . - 0 transcript_id "g406.t1"; gene_id "g406"; # protein sequence = [MALLNSGTTSLDSQARDQTQRRFHGLPTPGSSTEIRPSQPIPVEFVSPMLLNFNDIDSSSIMSLDFPGQNPYPRNNAA # SHTPVFPSRDPVGLDMNVSSYAAVHPQFGAGGSTVTGNNFASSPPFHATSNTGGGGHARAHDHYIAHRGTASAPAHIAFGNPYHSSQNGMNMHGGINT # MNMSSEPSSPLHSELDFDISPLTSPWLGAKMTGNSNGNGRIQAYGHPQNQSQTHRNQNQMHSHLNTHAGLKRAASPSTPDIDVDVVFSGASDEIGRSR # KRQASISLSPNTMRPSASNSTSSSRSSRVSSSGSRSMNSTPLLRGINPNSNTRARRGSIKSNSPMTMAMTGGAGISSVTGFSNMPSNGDNSNIGFGVV # GDSPSPVDLSLSMPPPAAPASAFTPSTSTRGTTLPEPLVPVTPASIMNLGNSFVGLGGGLGSVSQNHNSGISAGVDGAASSSTPGASGNFPASTSAAA # GGAAKPATKGAGRGAKNDKNDPGSGTGTRKSGRRGGGGAATGDSTGLKHILPGAFINPSSSILRKYLNLLISATNPSPPSSSLRPSSNLNSTSVAATS # STTTIVPVKERKTSHKAAEQKRRDSLKTTFDDLRGLLPPIPLPTDGDSKSGGTAAVDDEIGFIALAKASLLPGALPPRGPPKVGEGPNKGVSKLQLLI # CGNEYIRVLKGRVERRDEEVERLRREVRRLRSKLIGGEAEEDSGSSGENENEGQEGFVIKMGECWIWIEIWMLWKFWSRWGLRLLVFLRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g406 ### # start gene g407 Scaffold_3 AUGUSTUS gene 1818136 1818561 0.97 - . g407 Scaffold_3 AUGUSTUS transcript 1818136 1818561 0.97 - . g407.t1 Scaffold_3 AUGUSTUS stop_codon 1818136 1818138 . - 0 transcript_id "g407.t1"; gene_id "g407"; Scaffold_3 AUGUSTUS CDS 1818136 1818561 0.97 - 0 transcript_id "g407.t1"; gene_id "g407"; Scaffold_3 AUGUSTUS start_codon 1818559 1818561 . - 0 transcript_id "g407.t1"; gene_id "g407"; # protein sequence = [MDSMDSLEQDHQLSSSADLFFPGDHQHHMGSPTDQAQQKDTLDGAPSGSNSLNLNPSFLNEAGGNSMGMVMAALQSLG # SNTRASNPSDGEQQPAAHNEDPGAGQGQGQLREQIILEQFKLAQLKQLQEIQQQIFQQQVCQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g407 ### # start gene g408 Scaffold_3 AUGUSTUS gene 1829110 1829718 0.51 + . g408 Scaffold_3 AUGUSTUS transcript 1829110 1829718 0.51 + . g408.t1 Scaffold_3 AUGUSTUS start_codon 1829110 1829112 . + 0 transcript_id "g408.t1"; gene_id "g408"; Scaffold_3 AUGUSTUS CDS 1829110 1829718 0.51 + 0 transcript_id "g408.t1"; gene_id "g408"; Scaffold_3 AUGUSTUS stop_codon 1829716 1829718 . + 0 transcript_id "g408.t1"; gene_id "g408"; # protein sequence = [MFASIYIISFYSLSLEASVMSTEDVFSSSSTTMVDCDVLEAAKENIQPLATGRRVTSLSSVLATPHAQRESKLVATRH # RLRINIEMALEDDDDDPLEAYCTLVNWTLENYPQGHSAESGLLELLEEATRVLKDDRDGKWRGEMKYLKLWMLYASFVEKPSIIYRFLLANDIGTDFA # ILYEEFAAILERDGRCVQVQFLSTIH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g408 ### # start gene g409 Scaffold_3 AUGUSTUS gene 1841463 1842743 0.78 + . g409 Scaffold_3 AUGUSTUS transcript 1841463 1842743 0.78 + . g409.t1 Scaffold_3 AUGUSTUS start_codon 1841463 1841465 . + 0 transcript_id "g409.t1"; gene_id "g409"; Scaffold_3 AUGUSTUS CDS 1841463 1842743 0.78 + 0 transcript_id "g409.t1"; gene_id "g409"; Scaffold_3 AUGUSTUS stop_codon 1842741 1842743 . + 0 transcript_id "g409.t1"; gene_id "g409"; # protein sequence = [MLECSSGLYLAIHLRKLPSFAVVAQATSLLTQLSSGKDFLLPLYPEVSSQVLVENRSGERSNWCIRKNSGSGNTEEGA # GTLIIVKNYTGDVLNFGLAKEALGSYPAYANSVRFLTVADDVAVPRSRITLVGRRGLAGTVLTYKIIGELAARGASLDEVEKVGQYVAENLASIGVAT # GHSHVPGTERGQDVLGEDEIEIGMGIHNEPGVLRLHGSSGLPPPLSEIMPRLVNLLTVSQEEDPERGWVSFAPSADVVLMVNNLGGLSPLELSAVSVE # ATKVISDKGLKIKRVLCGTYMTSLNMPGFSLTLLQLPSAGQEPSQDLLLSLLDSPAEASGWGWVSSRAPIPLSDQIVSTPSSSTSVSTTKTTSSNDEG # ARQVVEVIRRACNALIHVEPELTRMDTVAGDGDCGLTLKVGFSCLLCRVLKIYP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g409 ### # start gene g410 Scaffold_3 AUGUSTUS gene 1847468 1848379 0.92 + . g410 Scaffold_3 AUGUSTUS transcript 1847468 1848379 0.92 + . g410.t1 Scaffold_3 AUGUSTUS start_codon 1847468 1847470 . + 0 transcript_id "g410.t1"; gene_id "g410"; Scaffold_3 AUGUSTUS CDS 1847468 1848379 0.92 + 0 transcript_id "g410.t1"; gene_id "g410"; Scaffold_3 AUGUSTUS stop_codon 1848377 1848379 . + 0 transcript_id "g410.t1"; gene_id "g410"; # protein sequence = [MLSIGGLKARHVQLIAISIFVLYMYYTYVAFNRSNQFANSQSKWIDYPASSKSPSHFSQVPNNLSFSAQVGTVRETSP # FAHKEHSRTLGTGGLFVISLKRVENRHKQMESLARALDVDFSFFDATDYKSSGVYGLERLERILDRIRWQRDRLDEEDVNDDTVVAGNHPKPSDTNPN # MILDAFPFQWSKDALENLADPLANELGISGADYWTLELERLYAGEDLDEAKVWEEQHPMPSFWQDETWRKSREAWVNPSFVRNSLETTQHLTLAEIAC # TDSHMRAIREIVRRSKCVFVKATGFTKFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g410 ### # start gene g411 Scaffold_3 AUGUSTUS gene 1849127 1852537 0.7 - . g411 Scaffold_3 AUGUSTUS transcript 1849127 1852537 0.7 - . g411.t1 Scaffold_3 AUGUSTUS stop_codon 1849127 1849129 . - 0 transcript_id "g411.t1"; gene_id "g411"; Scaffold_3 AUGUSTUS CDS 1849127 1851578 1 - 1 transcript_id "g411.t1"; gene_id "g411"; Scaffold_3 AUGUSTUS CDS 1851681 1852537 0.7 - 0 transcript_id "g411.t1"; gene_id "g411"; Scaffold_3 AUGUSTUS start_codon 1852535 1852537 . - 0 transcript_id "g411.t1"; gene_id "g411"; # protein sequence = [MASIIESADNDQPSQSPSTELTQPDDVDYPAITATTPMSLSSVTAIHSRRSSIDDPQTELISTLRGQIQDLFTQVTQL # NSKLVQSYDRVSDLEDDLHVNQSNLRQSTLKISQLELERTQHLSALNTGTLVERSNVVEELTRLMERATQEAAQRSSAESAKRNIETELEELAKDLFE # GANGMVAEARYERFLSQQRAEESERRARDVEERLVAMQQEMRQLDKGKWVPRAGDLVKERKLMSSHVPYQEFLGFVGHLRGLHGQQGQAVPAMTTLLS # LPFLARIATEDSDPTLRLDLAPSFNWLSRRSVLAAIHNGCLVIESVSSADFLHQLSQRQQRQGSTGFNLNNLSITVGAGGAGGNGTNHNTVACALCGV # NIFPGPDAASPSTHSQPANQPTGTWPTSISLFRKGSSASLNTTQSSQGSQGITPPPSPPLPSKAKTILGVGSNEIAQGQIMPEQVYVFRITSNSASST # SASTSNSTQSSSMNSTASHAPTLPPHPPAHPPVTQSVPTRRGRSGTVSQSPFGSPTKVSRPSSSFQPSFAPSFSSQSSSTQPSTSTATGAGFNGSASA # AGTNTNTGTNTGSIYPLCTSTWCLTRLRATCEIWAFVRSGVVKKVWEEDVPVSNTLSGLPLPSTNPNIGSSSTMPDPPPTHPSQAPHIHTSNTSTSGP # APPIPPRKRGLWGTLESLSERAASWGGGSQSGSRPSTPIAEEKEKKLPVLPPPQPLVHPSVASVQQDPPSEDGAGVSTGSGTSTTSAPPPLPKRSEGR # GRQSSAPTALKPVAEVTSQVDTEPPAHTSEANADLPEEGQEDPIHTVVFSASAHNSPIHSPTPAVAQEPFKLPLPDSRPSTPVIGGLSTGSRPGTPSN # TNKPPSRPSTPSNATGLVSSRPGTPSNRTDGVPPPLPRRAVTRGPRPMSTRKPSTSPGPPAIDMSRTEVIKEEGEIDAVETKVVEKVEKEEQEEVSNG # TNGVTEVPQPEGTVELKPSNAGVEGQIQREENIGAEMDIGNTSTGSTKPEVEGTGGAEVADAGRMTAITTDKIETDHHAAKRVEETSAIAEENGTDTS # LESEKPFLPYTSVGHSTWEERTWREIVRLKEVMFWARVGGVESS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g411 ### # start gene g412 Scaffold_3 AUGUSTUS gene 1853292 1853864 0.42 - . g412 Scaffold_3 AUGUSTUS transcript 1853292 1853864 0.42 - . g412.t1 Scaffold_3 AUGUSTUS stop_codon 1853292 1853294 . - 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_3 AUGUSTUS CDS 1853292 1853864 0.42 - 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_3 AUGUSTUS start_codon 1853862 1853864 . - 0 transcript_id "g412.t1"; gene_id "g412"; # protein sequence = [MDVLAKALDLDFTYINATDAQSSGAYGLQRAERIINRVRWQRDRLDEKDLEDGSVEADFHPRPSENHPNYVFDAFPFK # WSNDAMDNFVDPLANELGISGSDFWTLELDRFDSGEGLDEAMAWEAANPMPAHWLHESWKQSSEALVNHASVRNNLQMSDHLSLGGVACADSHIRAIR # EIIRRSKPLSSIHI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g412 ### # start gene g413 Scaffold_3 AUGUSTUS gene 1855089 1856443 0.18 - . g413 Scaffold_3 AUGUSTUS transcript 1855089 1856443 0.18 - . g413.t1 Scaffold_3 AUGUSTUS stop_codon 1855089 1855091 . - 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_3 AUGUSTUS CDS 1855089 1855778 0.99 - 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_3 AUGUSTUS CDS 1855862 1856443 0.18 - 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_3 AUGUSTUS start_codon 1856441 1856443 . - 0 transcript_id "g413.t1"; gene_id "g413"; # protein sequence = [MDRSFGACWATTSKKYQFKSFYRLGYFDSPEVQPYRQLNWNDVNTPAAQNLAYTAAIEGITLLKNDGTLPLSSSIISV # ALIGPWANATTQMQSNYNGVAPFLISPLDAFRTAGFNVTFASGTTISGTDTSGFSAALAAAHSADLVVFVGGIDDTIEAEQMDRLEISWPGNQLQLIG # ELASVGKPFVVLQMGGGQINALLWGGYPGQSGGAALVDILTGKQAPAGRLPTTQYPANYVNEVPMTDMTLRPSSTNPGRTYKWYTGEAVFPFGFGLHY # TNFSLEWSEPPKRSYNIQSLMSAAKSGGAPVDLALLDTPFELTVRNTGSITSDYSALLFSNTTAGPTPAPLKQLVGYTRVKSIAAGQSATAHLNVTLG # SLARVEEDGDSALYPGTYNVWVDTDLNGLGVAATSFELVGSREVITEWPQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g413 ### # start gene g414 Scaffold_3 AUGUSTUS gene 1864018 1864713 0.99 - . g414 Scaffold_3 AUGUSTUS transcript 1864018 1864713 0.99 - . g414.t1 Scaffold_3 AUGUSTUS stop_codon 1864018 1864020 . - 0 transcript_id "g414.t1"; gene_id "g414"; Scaffold_3 AUGUSTUS CDS 1864018 1864713 0.99 - 0 transcript_id "g414.t1"; gene_id "g414"; Scaffold_3 AUGUSTUS start_codon 1864711 1864713 . - 0 transcript_id "g414.t1"; gene_id "g414"; # protein sequence = [MEGHDVPRALEVDEIKLLIQSYVRAASNAINKAGFDGVEIHMANGYLLNQFLEDVSNNRTDEYGGSIENRARLGLEII # EAVTKEVGQEKVGVRFSPWSTFQGKSCLIFPVAPRFNVLLSDMRMQDPIPTYSYIVKNIKKLYPNFAYVSVCEPRVEGSTTRDTPITSTDSNDFIRDI # WTPKPLIVAGGFDRATAIARADSTGDLIAFGRRYISNVCMFPVRFEIVANNDSEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g414 ### # start gene g415 Scaffold_3 AUGUSTUS gene 1868146 1868610 0.76 - . g415 Scaffold_3 AUGUSTUS transcript 1868146 1868610 0.76 - . g415.t1 Scaffold_3 AUGUSTUS stop_codon 1868146 1868148 . - 0 transcript_id "g415.t1"; gene_id "g415"; Scaffold_3 AUGUSTUS CDS 1868146 1868610 0.76 - 0 transcript_id "g415.t1"; gene_id "g415"; Scaffold_3 AUGUSTUS start_codon 1868608 1868610 . - 0 transcript_id "g415.t1"; gene_id "g415"; # protein sequence = [MATGTGATGGPNNNLMAGGRAYAADSNDPSAGGRGHHHQGMHDQQQDYPIANDVRLPPSFVSSSSQHNPCLQYGNPGM # NNRSGMGGTGNDCYNDYGGNQGNIPPSSNLNASGGAGHSTAGKVEKALGAAVGSNALKAKGMQKEMLVIHQSAGRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g415 ### # start gene g416 Scaffold_3 AUGUSTUS gene 1874421 1875575 0.58 - . g416 Scaffold_3 AUGUSTUS transcript 1874421 1875575 0.58 - . g416.t1 Scaffold_3 AUGUSTUS stop_codon 1874421 1874423 . - 0 transcript_id "g416.t1"; gene_id "g416"; Scaffold_3 AUGUSTUS CDS 1874421 1875575 0.58 - 0 transcript_id "g416.t1"; gene_id "g416"; Scaffold_3 AUGUSTUS start_codon 1875573 1875575 . - 0 transcript_id "g416.t1"; gene_id "g416"; # protein sequence = [MVPLSEAGYNVVALDQRGYGRTVMLGSSGAPSGPINFSNDLAPFRMFNLVTDIVSFVSVIGYQSVAAVVGHDFGSMVA # GYCALIRPDLFRSLVVMSAPFPGAPPFRSSLSSKAGSSLVGPAASLFTKQLAELNPSRKHYTMYFSTPNANPDMLQPPQGLRNFLSDYFYAKSADWPK # NNPHPLPSASASNLATVPHYYIMLLEHTMPMAVMGAASEGTRPLQEWLPDEDLSFYVSEYSRTGFQGGLNWYRCMTDAKWTADMQAFTGKRVTVPAMF # LSGDKDWGVYQSPGSLERMKDYVCENMDKEDVVLLPDTGHWAQQEQSEAVVNHLLRFLAKVSLHYIFTTLCVTDLSSPFTGQNDYKSDLTNLYTVYRY # SSIYCNIEYSKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g416 ### # start gene g417 Scaffold_3 AUGUSTUS gene 1885671 1886368 0.25 + . g417 Scaffold_3 AUGUSTUS transcript 1885671 1886368 0.25 + . g417.t1 Scaffold_3 AUGUSTUS start_codon 1885671 1885673 . + 0 transcript_id "g417.t1"; gene_id "g417"; Scaffold_3 AUGUSTUS CDS 1885671 1885983 0.44 + 0 transcript_id "g417.t1"; gene_id "g417"; Scaffold_3 AUGUSTUS CDS 1886037 1886368 0.48 + 2 transcript_id "g417.t1"; gene_id "g417"; Scaffold_3 AUGUSTUS stop_codon 1886366 1886368 . + 0 transcript_id "g417.t1"; gene_id "g417"; # protein sequence = [MTRIFDLQTKVQKYQYKSSVQDSNYIFGILGNTDTEHLATLYFAHLDIINAEKPYSGADSTDALLLALILTIADIHAI # QFKHKVGPFTPGPGSERVGNALNLCITDGGVQMVVSRWRDAKEGYPRSLYLSLTAGEKLNRKYFPELPAPTESEDVDNTDVKIDSVRELVARYEPTQQ # GLYIVCTMYKLITHLNGILSGRHVIVGSEPCSKHIMTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g417 ### # start gene g418 Scaffold_3 AUGUSTUS gene 1886935 1887693 0.47 - . g418 Scaffold_3 AUGUSTUS transcript 1886935 1887693 0.47 - . g418.t1 Scaffold_3 AUGUSTUS stop_codon 1886935 1886937 . - 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_3 AUGUSTUS CDS 1886935 1887693 0.47 - 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_3 AUGUSTUS start_codon 1887691 1887693 . - 0 transcript_id "g418.t1"; gene_id "g418"; # protein sequence = [MFVVLVHVDSLLTNTPFRIFQGSSSSSSFGFANRKSTSSSLNAASIAGVVLGSLAFLIMIVIAVILFLRWRRRRKLKS # MPRVTPFQYGSRSPSTNSFSLEASELIPRPQPPTSPPNWLPHYLLAPTGSGVVNDNSEALAAANRSSKRSAATTPDAQVFNVVNLPVATPTRSTYRSS # TQSHLTHNLASQGVRSPGLFIRVSPPFQSGLYSVIQQQGELEGDRALLSSNPSVNSLPPYRQTDPDPDARGRIYID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g418 ### # start gene g419 Scaffold_3 AUGUSTUS gene 1887872 1888654 0.36 - . g419 Scaffold_3 AUGUSTUS transcript 1887872 1888654 0.36 - . g419.t1 Scaffold_3 AUGUSTUS stop_codon 1887872 1887874 . - 0 transcript_id "g419.t1"; gene_id "g419"; Scaffold_3 AUGUSTUS CDS 1887872 1888352 0.79 - 1 transcript_id "g419.t1"; gene_id "g419"; Scaffold_3 AUGUSTUS CDS 1888404 1888440 0.6 - 2 transcript_id "g419.t1"; gene_id "g419"; Scaffold_3 AUGUSTUS CDS 1888534 1888654 0.39 - 0 transcript_id "g419.t1"; gene_id "g419"; Scaffold_3 AUGUSTUS start_codon 1888652 1888654 . - 0 transcript_id "g419.t1"; gene_id "g419"; # protein sequence = [MGTSVQNVSVLDSGVAGPVMNQTCNLHLQNGSSWSWTDQSYISGVLGIGTNSREGSFNETPMAFWLANNPTQTNFSYG # LALNSPNDASSSSNDAGALHWLAPDENSYEGDITWKTLIASNSSSTVNADSFVEMDSWNFQGDNVNISAYTGLLTVVDPLFNDLVFPQNEARTICGPV # SSLHFLEPNFLPGRWCHSGLLAAGHNIRDYCVHIAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g419 ### # start gene g420 Scaffold_3 AUGUSTUS gene 1890161 1891311 0.24 - . g420 Scaffold_3 AUGUSTUS transcript 1890161 1891311 0.24 - . g420.t1 Scaffold_3 AUGUSTUS stop_codon 1890161 1890163 . - 0 transcript_id "g420.t1"; gene_id "g420"; Scaffold_3 AUGUSTUS CDS 1890161 1890830 0.24 - 1 transcript_id "g420.t1"; gene_id "g420"; Scaffold_3 AUGUSTUS CDS 1890932 1891311 0.44 - 0 transcript_id "g420.t1"; gene_id "g420"; Scaffold_3 AUGUSTUS start_codon 1891309 1891311 . - 0 transcript_id "g420.t1"; gene_id "g420"; # protein sequence = [MKARIYAKEGEFDLVRSSLDAYTSSLSSQGRTIDSTATELLRSIDEAEKLLAKARKEKKAQLWTACADSCSSIIRDTA # SHSIEVRVMRAECQLAAGDVEGSVGDLTRLAVLLPPSASMELQVRIWRFLSSSASTSEGTGKIICQVGRSFAERGLARCSQSIDRVWKRKGERSLGRY # EQAMKDHTSREQLLGKDAYESSLKSKEPPIPLPDPFTHSPRRQILLRALCKSYTAIGTVTALRNADQWCSMLLTMDGCSEDTDAFLGRAEYLLSTEDD # VDTSGAGSSSSGDGNWDEAIRLLEKAFEASGRSNRDIHSKLNQAKKKVKQRRRKDYYKVLGVDRNADDRTIKKAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g420 ### # start gene g421 Scaffold_3 AUGUSTUS gene 1892339 1893532 0.39 + . g421 Scaffold_3 AUGUSTUS transcript 1892339 1893532 0.39 + . g421.t1 Scaffold_3 AUGUSTUS start_codon 1892339 1892341 . + 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_3 AUGUSTUS CDS 1892339 1892553 0.39 + 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_3 AUGUSTUS CDS 1892610 1892801 0.99 + 1 transcript_id "g421.t1"; gene_id "g421"; Scaffold_3 AUGUSTUS CDS 1892857 1893532 1 + 1 transcript_id "g421.t1"; gene_id "g421"; Scaffold_3 AUGUSTUS stop_codon 1893530 1893532 . + 0 transcript_id "g421.t1"; gene_id "g421"; # protein sequence = [MQTSNSYLIAGEDPIDEDDIDEYNVAYTPAARFTERLLDKLLFKGFGSKEKVTRYRTVQLCSELVFNLGEIENRIYYE # LRSRLLGRISDKEHNIRSQAAIALCKFYGIDDPEELKENQLEPLSEVLFESLAYDPQAEVRRAILVNLPVNKITIPPILERSRDVDVTTRKLVYTVLE # RNVTIGDEEELTIGFAHPRALSMELRESIVRNGLGDRNENVRAAAAKLMERWVETSDMTDNGKAPGDESGLVGLLKMFDLRTDKIIGDAIIRIFESNP # HILNGITFNDTYWTSLTPEKAFLARTCVEFCESRKDDARLEAILPVVTSFAFRLQEHFNELIDSIRSLDQDACNLDDEARPSGRAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g421 ### # start gene g422 Scaffold_3 AUGUSTUS gene 1905700 1905966 0.63 + . g422 Scaffold_3 AUGUSTUS transcript 1905700 1905966 0.63 + . g422.t1 Scaffold_3 AUGUSTUS start_codon 1905700 1905702 . + 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_3 AUGUSTUS CDS 1905700 1905966 0.63 + 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_3 AUGUSTUS stop_codon 1905964 1905966 . + 0 transcript_id "g422.t1"; gene_id "g422"; # protein sequence = [MFDGRMSMILLNELVGSLNDQIFKAMPVALESIKWGEETARLASTGSVLTGLDMDSVPELASTQTEEFVSDAKLIVVS # SGLNSPFDTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g422 ### # start gene g423 Scaffold_3 AUGUSTUS gene 1907563 1907898 0.93 + . g423 Scaffold_3 AUGUSTUS transcript 1907563 1907898 0.93 + . g423.t1 Scaffold_3 AUGUSTUS start_codon 1907563 1907565 . + 0 transcript_id "g423.t1"; gene_id "g423"; Scaffold_3 AUGUSTUS CDS 1907563 1907898 0.93 + 0 transcript_id "g423.t1"; gene_id "g423"; Scaffold_3 AUGUSTUS stop_codon 1907896 1907898 . + 0 transcript_id "g423.t1"; gene_id "g423"; # protein sequence = [MSTSAFIVPIDPKAPSTAIPNVDIAKTWATVPRGEKVDVGTTSIFYDTPATKITAASSLGDNFSAKKGEVKRELVRKS # VGSAVKALKVLNGLKEVTVDASADPHAAGEYME] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g423 ### # start gene g424 Scaffold_3 AUGUSTUS gene 1912914 1913282 0.66 - . g424 Scaffold_3 AUGUSTUS transcript 1912914 1913282 0.66 - . g424.t1 Scaffold_3 AUGUSTUS stop_codon 1912914 1912916 . - 0 transcript_id "g424.t1"; gene_id "g424"; Scaffold_3 AUGUSTUS CDS 1912914 1913282 0.66 - 0 transcript_id "g424.t1"; gene_id "g424"; Scaffold_3 AUGUSTUS start_codon 1913280 1913282 . - 0 transcript_id "g424.t1"; gene_id "g424"; # protein sequence = [MATAHSLGSMPFFATLFALCVTTFPTLAGGLSPSPFIVPVQRLVNTPTTGHSLVRVGQARLQAFSKAHSQVNGIPGDH # AALAPPAASLTDQIVTFTINPVVNGKNCEQRRVLNHSFLDPPIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g424 ### # start gene g425 Scaffold_3 AUGUSTUS gene 1916219 1916744 0.43 + . g425 Scaffold_3 AUGUSTUS transcript 1916219 1916744 0.43 + . g425.t1 Scaffold_3 AUGUSTUS start_codon 1916219 1916221 . + 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_3 AUGUSTUS CDS 1916219 1916275 0.43 + 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_3 AUGUSTUS CDS 1916385 1916744 1 + 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_3 AUGUSTUS stop_codon 1916742 1916744 . + 0 transcript_id "g425.t1"; gene_id "g425"; # protein sequence = [MRFPPFGSNIKACLVFILGEPNLLSRSQLVKIKISFPGGTKQFLEGEAVTNVARAIRNTLEEYTPTGHEIEVIFPIPL # RIPAFNKVNEIDFRITLGNGATGAGLVEAFGEEPNYEEGPFLVRQDVLAQLIAGMVKAKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g425 ### # start gene g426 Scaffold_3 AUGUSTUS gene 1922651 1923028 0.19 - . g426 Scaffold_3 AUGUSTUS transcript 1922651 1923028 0.19 - . g426.t1 Scaffold_3 AUGUSTUS stop_codon 1922651 1922653 . - 0 transcript_id "g426.t1"; gene_id "g426"; Scaffold_3 AUGUSTUS CDS 1922651 1923028 0.19 - 0 transcript_id "g426.t1"; gene_id "g426"; Scaffold_3 AUGUSTUS start_codon 1923026 1923028 . - 0 transcript_id "g426.t1"; gene_id "g426"; # protein sequence = [MSMISASDTVNLFNTPVISEEQYEDADDVHGLLRQASIGDWKITRFERSPLMSTYLVAFANGQFEYLESSFKSPISGK # TRPIRVYGMWHYVAHHNKHSLNVNSESFFDPSSKIYTWSDSKSPSGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g426 ### # start gene g427 Scaffold_3 AUGUSTUS gene 1923138 1923545 0.49 - . g427 Scaffold_3 AUGUSTUS transcript 1923138 1923545 0.49 - . g427.t1 Scaffold_3 AUGUSTUS stop_codon 1923138 1923140 . - 0 transcript_id "g427.t1"; gene_id "g427"; Scaffold_3 AUGUSTUS CDS 1923138 1923545 0.49 - 0 transcript_id "g427.t1"; gene_id "g427"; Scaffold_3 AUGUSTUS start_codon 1923543 1923545 . - 0 transcript_id "g427.t1"; gene_id "g427"; # protein sequence = [MNYRLPTDVSPTHYDLTLLTDLTLHKFRGTVEVALKVVTDTSKIVLNVAELHLSDASVTVAGEEEAFVPVSQSIDSID # QRATFVYPCTFTAGSSLKLFIAFEGKLNESLIGYYEGTWEDGGQKKFYTVTQFEVWL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g427 ### # start gene g428 Scaffold_3 AUGUSTUS gene 1927348 1927752 0.74 + . g428 Scaffold_3 AUGUSTUS transcript 1927348 1927752 0.74 + . g428.t1 Scaffold_3 AUGUSTUS start_codon 1927348 1927350 . + 0 transcript_id "g428.t1"; gene_id "g428"; Scaffold_3 AUGUSTUS CDS 1927348 1927752 0.74 + 0 transcript_id "g428.t1"; gene_id "g428"; Scaffold_3 AUGUSTUS stop_codon 1927750 1927752 . + 0 transcript_id "g428.t1"; gene_id "g428"; # protein sequence = [MFWGSVSAKEQDSTKNEAYPNPDNTNPSSRNTMHISEAPVAISSNDRGNELGYTERTHESERRTFHKEESMRTSHENQ # SLRDNSNLQVNDGVELFIVRIDGRSEQSDPELVLEEVGLQDDNDKDNTMRCHIRRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g428 ### # start gene g429 Scaffold_3 AUGUSTUS gene 1927825 1930337 0.11 - . g429 Scaffold_3 AUGUSTUS transcript 1927825 1930337 0.11 - . g429.t1 Scaffold_3 AUGUSTUS stop_codon 1927825 1927827 . - 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_3 AUGUSTUS CDS 1927825 1928460 0.96 - 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_3 AUGUSTUS CDS 1928607 1929358 0.84 - 2 transcript_id "g429.t1"; gene_id "g429"; Scaffold_3 AUGUSTUS CDS 1929427 1929736 0.15 - 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_3 AUGUSTUS CDS 1929843 1930025 0.6 - 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_3 AUGUSTUS CDS 1930206 1930337 0.9 - 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_3 AUGUSTUS start_codon 1930335 1930337 . - 0 transcript_id "g429.t1"; gene_id "g429"; # protein sequence = [MASNVEKEPGPQEPTATSAPSTPEEPEKKKREYKDFGHEEEVLLVDLETIVMDDAFKLLQCDENGLTKEEATRRLEIF # GPNKLESEEQNAFLQVRFSSLFPSVPVPPDWQDFVGIVLLLFINSAIGFYEERNAGNAVKALMDSLAPKAKVKRNGSWSEIDSAELVPGDMVSFKIGD # IVPADCRLTESINVSIDQAALTGESLPQSKKVVAPRVSKVKQRVVISTGANTFFGRAASLVGQDDDTTGHLQKILAQIGSFCLVSIGIFVILEIVVLY # PRFHYTYRRGLNDILVLLIGGIPIAMPTVLSVTLAVGAQQLAKHKAIVTRITAIEELAGVTILCSDKTGTLTTNKLTIDRNTIKTYGPFSADEVILFA # AYASRTENQDAIDASVVAALGDVSKARAGIKLLDFKPFNPVDKRTEITYREESSGKLKRVTKGMTGIIIELCSRNKTEELENKLEADTIDDALALGVK # VKMVTGDQLAIAKETGRRLGLGDHMYPAKVLKDGPAPGGKHATLDEMIMDADGFAGVFPEHKYEIVKRLQGLGHLCAMTGDGANDAPALSRANVGIAV # EGATDAARGAADIVLTEPGLSTIVHAIRGSRIIFQRMRNYSIYACAVTIRIVVCFAILAWVYQFRFPSVHGPYHRSSQRRYYHDLVRRPCLAFEHSGQ # LGFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g429 ### # start gene g430 Scaffold_3 AUGUSTUS gene 1934535 1935050 0.64 - . g430 Scaffold_3 AUGUSTUS transcript 1934535 1935050 0.64 - . g430.t1 Scaffold_3 AUGUSTUS stop_codon 1934535 1934537 . - 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_3 AUGUSTUS CDS 1934535 1935050 0.64 - 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_3 AUGUSTUS start_codon 1935048 1935050 . - 0 transcript_id "g430.t1"; gene_id "g430"; # protein sequence = [MDVPSSWLVRPREAMYDLDNIQLGSLAPEDFSVDTIFDLDYIVVEGHARDTTTQSPPRGVQIQLVSGSMPIDDTQVVA # NLGYFQFKTKPGVFKLEIREGRGRDIFVTESVGNEGWNSPSVDEVGNEITVTSFEGQTLYPRFSRLPGMEREDVLAEEEEEESSSVFESMFAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g430 ### # start gene g431 Scaffold_3 AUGUSTUS gene 1937551 1938306 0.14 - . g431 Scaffold_3 AUGUSTUS transcript 1937551 1938306 0.14 - . g431.t1 Scaffold_3 AUGUSTUS stop_codon 1937551 1937553 . - 0 transcript_id "g431.t1"; gene_id "g431"; Scaffold_3 AUGUSTUS CDS 1937551 1938306 0.14 - 0 transcript_id "g431.t1"; gene_id "g431"; Scaffold_3 AUGUSTUS start_codon 1938304 1938306 . - 0 transcript_id "g431.t1"; gene_id "g431"; # protein sequence = [MRLTSHAEHRIEYILRHVPPENLDTSKRSYLSGYSVALDLKKMDYLALDDRHLGTQRDDPSLSDDQDVEAPVVDPIFS # LLDGYPENSTAPDANTPPTEDELHTIGFQASQLIMDSSNPLLTLMHLSQNFPKYVTTLARRVSVNEDLAQEVHENQLRVQGGANAMWINGVSVAEKDL # NAFGLSRLLKKERGIMMQLTGLDLERGEAIELLTHPILSAAQDSKDVLDGLVDASDRAEGGDVIIWWNDLEKDKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g431 ### # start gene g432 Scaffold_3 AUGUSTUS gene 1940078 1941171 0.9 + . g432 Scaffold_3 AUGUSTUS transcript 1940078 1941171 0.9 + . g432.t1 Scaffold_3 AUGUSTUS start_codon 1940078 1940080 . + 0 transcript_id "g432.t1"; gene_id "g432"; Scaffold_3 AUGUSTUS CDS 1940078 1940101 0.9 + 0 transcript_id "g432.t1"; gene_id "g432"; Scaffold_3 AUGUSTUS CDS 1940377 1941171 1 + 0 transcript_id "g432.t1"; gene_id "g432"; Scaffold_3 AUGUSTUS stop_codon 1941169 1941171 . + 0 transcript_id "g432.t1"; gene_id "g432"; # protein sequence = [MVEFLTGVTCEITSAIYWRNEFNSLATVTDLVEFTVLDVEADGRSRGKFVLADAQVALAGAFRSGAGQDEDSMDYESA # GYTNQIYHTRTHLGGILQPGDTALGYFLTNSNYNSDDFASLPAERIPDIMLVKKTYPNRRKKNKSRGWKLRSIGKEAGEEGETGSGRGVVGRLGGRDQ # KKVEEDYEHFLRDLEEDPEMRSAVNLYKSTDVNMKTETKRGPKKPQFAMDIDETPRQIEEEEEEEADFPEIQLDELLEGFDEMTLGEGREEVVEAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g432 ### # start gene g433 Scaffold_3 AUGUSTUS gene 1942985 1943683 0.26 - . g433 Scaffold_3 AUGUSTUS transcript 1942985 1943683 0.26 - . g433.t1 Scaffold_3 AUGUSTUS stop_codon 1942985 1942987 . - 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_3 AUGUSTUS CDS 1942985 1943277 0.93 - 2 transcript_id "g433.t1"; gene_id "g433"; Scaffold_3 AUGUSTUS CDS 1943438 1943558 0.98 - 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_3 AUGUSTUS CDS 1943627 1943683 0.5 - 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_3 AUGUSTUS start_codon 1943681 1943683 . - 0 transcript_id "g433.t1"; gene_id "g433"; # protein sequence = [MVLSIGPVALTDGTILGDLAPVTTVPTVSDNLFSEGVISTEVVGISFVPTTGAEDEPEENLDTHCILFRPKETDYWGI # TQSISYNGIEIMASAVGVVDTGTTLNYMPTDAFNAYINSTGGIFDEATGLYEITEEQYDALNDLVFTIGGVSFVACED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g433 ### # start gene g434 Scaffold_3 AUGUSTUS gene 1948944 1949414 0.71 - . g434 Scaffold_3 AUGUSTUS transcript 1948944 1949414 0.71 - . g434.t1 Scaffold_3 AUGUSTUS stop_codon 1948944 1948946 . - 0 transcript_id "g434.t1"; gene_id "g434"; Scaffold_3 AUGUSTUS CDS 1948944 1949414 0.71 - 0 transcript_id "g434.t1"; gene_id "g434"; Scaffold_3 AUGUSTUS start_codon 1949412 1949414 . - 0 transcript_id "g434.t1"; gene_id "g434"; # protein sequence = [MTRSQIKFNHRVAKKVGSKFLVTWMIGIYDSDDYLVLLKRTCIEAGMSRSDAAKVSLSCLPVPRVSGTNTQKSWSVDG # MQWKSDSFLCPERVDGFESFCGGPEAYDMNEEECCMNDDRRSNPTSERMHTISLLDIARPAKSKGDYLQFSSIRESRC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g434 ### # start gene g435 Scaffold_3 AUGUSTUS gene 1953688 1954059 0.29 - . g435 Scaffold_3 AUGUSTUS transcript 1953688 1954059 0.29 - . g435.t1 Scaffold_3 AUGUSTUS stop_codon 1953688 1953690 . - 0 transcript_id "g435.t1"; gene_id "g435"; Scaffold_3 AUGUSTUS CDS 1953688 1954059 0.29 - 0 transcript_id "g435.t1"; gene_id "g435"; Scaffold_3 AUGUSTUS start_codon 1954057 1954059 . - 0 transcript_id "g435.t1"; gene_id "g435"; # protein sequence = [MPGIKLGNRLETLGQIATAGNGSHLNNEHRMTQKAKDGPHQAAADLLAAEGMCMCVCKSPEIDIDQGLLNERIINVFR # TSEVTRLDLGPSLSEEGGLNIGGRTVWNGKYDLFFGAALLIHILL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g435 ### # start gene g436 Scaffold_3 AUGUSTUS gene 1954182 1955223 0.6 - . g436 Scaffold_3 AUGUSTUS transcript 1954182 1955223 0.6 - . g436.t1 Scaffold_3 AUGUSTUS stop_codon 1954182 1954184 . - 0 transcript_id "g436.t1"; gene_id "g436"; Scaffold_3 AUGUSTUS CDS 1954182 1954735 0.61 - 2 transcript_id "g436.t1"; gene_id "g436"; Scaffold_3 AUGUSTUS CDS 1954815 1955223 0.6 - 0 transcript_id "g436.t1"; gene_id "g436"; Scaffold_3 AUGUSTUS start_codon 1955221 1955223 . - 0 transcript_id "g436.t1"; gene_id "g436"; # protein sequence = [MTSIVSEIPAQPMIDIENPLYCPAESASKYLKSITTGGGVRKLRKKEKSIKIKGMKEKKIIVSSFSKMLAQVAIVMQK # EKENQGFRETSSLSLSKVSTSDCLRLWYSCTTTGSQTRKDRAAQSLLEAKLVTPVSRRASTLSLPFTDVSSETSLNETPSPITPPLPPGLGYQIKSEP # TEQVEDNIRKPQSNFNAHFQQVKIEAPVLKKTKRSLEEAFPELLKNPFTSTRSFTSDFTKIGVHSPRSFSPNSNTNTDSECNENSTSDRSLDLEPEDL # KGIERGRKLNYRVGNSPDKGTRVDFKTKEDNMDAAQMKRRLQELEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g436 ### # start gene g437 Scaffold_3 AUGUSTUS gene 1955873 1956670 0.41 - . g437 Scaffold_3 AUGUSTUS transcript 1955873 1956670 0.41 - . g437.t1 Scaffold_3 AUGUSTUS stop_codon 1955873 1955875 . - 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_3 AUGUSTUS CDS 1955873 1956459 1 - 2 transcript_id "g437.t1"; gene_id "g437"; Scaffold_3 AUGUSTUS CDS 1956628 1956670 0.41 - 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_3 AUGUSTUS start_codon 1956668 1956670 . - 0 transcript_id "g437.t1"; gene_id "g437"; # protein sequence = [MFGLFRRISNSVLPPTSNAPKVGRKRRLSSTERDLAEDKEEQSRSKKHRGDTPQTPLELPTVATSVEEETGNTSQVDL # EGVKEVTEGVKEVDLEDKQTAEHSDEAEVATTSDDSNDETVVAPETVPLPEEVSGELDDTSSTASTPPAHTVDENADDASKQASLSSETPVAEMKQRT # RVDQDTVDEATLLPAESDAKHSTTDGLKDEASA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g437 ### # start gene g438 Scaffold_3 AUGUSTUS gene 1957568 1958371 0.65 - . g438 Scaffold_3 AUGUSTUS transcript 1957568 1958371 0.65 - . g438.t1 Scaffold_3 AUGUSTUS stop_codon 1957568 1957570 . - 0 transcript_id "g438.t1"; gene_id "g438"; Scaffold_3 AUGUSTUS CDS 1957568 1958371 0.65 - 0 transcript_id "g438.t1"; gene_id "g438"; Scaffold_3 AUGUSTUS start_codon 1958369 1958371 . - 0 transcript_id "g438.t1"; gene_id "g438"; # protein sequence = [MNSWFAEPLNVAETLDPLWSMISEVAERGKIDALETYNISRGWVCHHNTGIWRDSAPIDAAFYGFWPYAPAWLLQHMY # EHYAFNPDPQSSFLKNTAYPLMKGLSEFYMDFLVEAPLDVEPNGYIVPNPSMSPEHGIGNYNDTNVSLTYGQSVFLTVTRYLTHFQLLKWIGSTIDNS # WVLLISLLNVPPIDNLFFCSLLRDLFNHTVEFATILGVDSEFAANLSTLKDRLIPFRIGSLGQIQEWARDYDSNGFVLHTYCAKYHSMASE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g438 ### # start gene g439 Scaffold_3 AUGUSTUS gene 1958793 1959113 0.81 - . g439 Scaffold_3 AUGUSTUS transcript 1958793 1959113 0.81 - . g439.t1 Scaffold_3 AUGUSTUS stop_codon 1958793 1958795 . - 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_3 AUGUSTUS CDS 1958793 1959113 0.81 - 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_3 AUGUSTUS start_codon 1959111 1959113 . - 0 transcript_id "g439.t1"; gene_id "g439"; # protein sequence = [MYGLPGSINFMVKAEFTVSGTMAEVHATSDVKPALSISNADEALIVIAIDTNYVRYDDLSADPNEKVTQTLANVQGKT # FDAMLKAHVEDHSALFGRVNISLGIKLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g439 ### # start gene g440 Scaffold_3 AUGUSTUS gene 1962206 1963006 1 + . g440 Scaffold_3 AUGUSTUS transcript 1962206 1963006 1 + . g440.t1 Scaffold_3 AUGUSTUS start_codon 1962206 1962208 . + 0 transcript_id "g440.t1"; gene_id "g440"; Scaffold_3 AUGUSTUS CDS 1962206 1963006 1 + 0 transcript_id "g440.t1"; gene_id "g440"; Scaffold_3 AUGUSTUS stop_codon 1963004 1963006 . + 0 transcript_id "g440.t1"; gene_id "g440"; # protein sequence = [MVSSSKVPAQKRYSRISIAPATSKALPQCTPYLMPFHIDYTGPAPVSTYFRVEDAKTHVGSPEFSKDDSRTETAEASA # GSSGSGLDVAQSPHEHNGIDTISSVEQRMRSPETSTSNPVPDGHPRYISTFRGRTVQGLEVDLPEGYTGIVFRSGDEAGEAKNTGKGKGVANGKGKVA # AVQQNQRRTTRRSTRSRVADDDEVMDTDAEDEAEEASESALDLFASSQFKSFLLWHPDIPVDTGKDEYMSSIGEWIKIASVVRFCAIVTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g440 ### # start gene g441 Scaffold_3 AUGUSTUS gene 1967743 1968072 0.25 - . g441 Scaffold_3 AUGUSTUS transcript 1967743 1968072 0.25 - . g441.t1 Scaffold_3 AUGUSTUS stop_codon 1967743 1967745 . - 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_3 AUGUSTUS CDS 1967743 1968072 0.25 - 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_3 AUGUSTUS start_codon 1968070 1968072 . - 0 transcript_id "g441.t1"; gene_id "g441"; # protein sequence = [MTVMMGGPNPITPSHTDLDAVLKQLSVHLTAPDDFLKVLPDPIYTRTHRHVDCIPTPTPGHLERMEELKVTLAKGVWS # GRLEVIGAGVRGVSLGDCVESGKRVGENWIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g441 ### # start gene g442 Scaffold_3 AUGUSTUS gene 1971443 1972333 0.37 - . g442 Scaffold_3 AUGUSTUS transcript 1971443 1972333 0.37 - . g442.t1 Scaffold_3 AUGUSTUS stop_codon 1971443 1971445 . - 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_3 AUGUSTUS CDS 1971443 1972333 0.37 - 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_3 AUGUSTUS start_codon 1972331 1972333 . - 0 transcript_id "g442.t1"; gene_id "g442"; # protein sequence = [MTIQPPWVKRTINLVLIGETGVGKTAMLDLLANVCAGIKLEDFKATHQSRSERGGSSSGSQTNVPEFYTIPCANGNEV # NILDTPGLADTRGIDMDNEHKAAIANAVKKHFEVIDAVIILANGTLARLGAATEYALTTISGMFPNSIVDNIAFIFTMVSDPTSFNFERKSLPEELRK # AKIWSINNPFAQWTKYQEKLAQDPPTVDEEILQEMDEGVHRSYTKALKMLGQVFQFLDKCKVQPTNSIYDLYIMSTDIEAAISNVIARMDQTEITRNG # LKKLQSDKAAQEQVRNFATFGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g442 ### # start gene g443 Scaffold_3 AUGUSTUS gene 1974100 1976145 0.5 + . g443 Scaffold_3 AUGUSTUS transcript 1974100 1976145 0.5 + . g443.t1 Scaffold_3 AUGUSTUS start_codon 1974100 1974102 . + 0 transcript_id "g443.t1"; gene_id "g443"; Scaffold_3 AUGUSTUS CDS 1974100 1976145 0.5 + 0 transcript_id "g443.t1"; gene_id "g443"; Scaffold_3 AUGUSTUS stop_codon 1976143 1976145 . + 0 transcript_id "g443.t1"; gene_id "g443"; # protein sequence = [MDLPALGRPAFLGQLYNATSERLMNEQLFAEDVVKRVQVVPNPSNSLKFKDIKTISDRANALDITAELSVSILSGMID # LKGSGQYLDTSKSNVSSREVSMICTTRKNLKRLDLKGSDRITIDTYNRAVEHQATHVVTGIIYGGTLVTNVVEKASSSESQTKIHGEFSASLMKNMAS # KFSAEGKASVDSDKTCKDVLESRDFDFYGDYSASDRPNAITIGDLFELAKQWPTIIGDGVPCQITVTPLSNFVDGSIEAKIIHELESDELAAILTAYD # EIYRLAGRRTRIQAALEAGNGGLGACCSTFAAACKKRKLVTDGILGRSRQALAKYLIAFRRGGAEEVGKTTIEFVDAAKVGLDDHLKECQQDESVLGL # LQSIQDLAAAHGAPLETLNGLRHRMTRANRGTLGVVLIPPSPNLDGAINTYEVLVANIKRWRADEDKKDTDEDGKPKETVFISFYCDPTLLPEFRNLE # GKKGVLTKALVEFEKSQSPRFIHYGVLPTGLTSIQKQIDWSLLNDEGWAFIHNDQESYDYIGEVSGGKRHGRGTATYANKSTYSGDWWHGRRHGEGEL # VEKTRKLTGVFINDQYWADGVVVDITILSHHVAFGAARIPLRKGDAGTSHVRMIGTMLEWKEGEEHNLVVEGKEGQKLEMITVGKLIRHDQDEMFNKN # WPLEEGVEIKVEKRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g443 ### # start gene g444 Scaffold_3 AUGUSTUS gene 1978985 1979272 0.68 - . g444 Scaffold_3 AUGUSTUS transcript 1978985 1979272 0.68 - . g444.t1 Scaffold_3 AUGUSTUS stop_codon 1978985 1978987 . - 0 transcript_id "g444.t1"; gene_id "g444"; Scaffold_3 AUGUSTUS CDS 1978985 1979272 0.68 - 0 transcript_id "g444.t1"; gene_id "g444"; Scaffold_3 AUGUSTUS start_codon 1979270 1979272 . - 0 transcript_id "g444.t1"; gene_id "g444"; # protein sequence = [MFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLHDPNPNSPANAEAAQLYRENMKEYVRRVKATVEESWLDPG # ETENVDTEMATGPSAAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g444 ### # start gene g445 Scaffold_3 AUGUSTUS gene 1984311 1984724 0.53 + . g445 Scaffold_3 AUGUSTUS transcript 1984311 1984724 0.53 + . g445.t1 Scaffold_3 AUGUSTUS start_codon 1984311 1984313 . + 0 transcript_id "g445.t1"; gene_id "g445"; Scaffold_3 AUGUSTUS CDS 1984311 1984724 0.53 + 0 transcript_id "g445.t1"; gene_id "g445"; Scaffold_3 AUGUSTUS stop_codon 1984722 1984724 . + 0 transcript_id "g445.t1"; gene_id "g445"; # protein sequence = [MPLTVIASSTIKSLTWNGENVSLELTTNESMIRTGKLSSTKISIQVPDLEALEWKFNNSLPEVHTNFDDSNWAIANHT # TTNIPFPMYYGDGRILYGCDYGLYVGILLFFLPVANSVLAAKMSSFGEATSTQVGRRRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g445 ### # start gene g446 Scaffold_3 AUGUSTUS gene 1991381 1992917 0.71 + . g446 Scaffold_3 AUGUSTUS transcript 1991381 1992917 0.71 + . g446.t1 Scaffold_3 AUGUSTUS start_codon 1991381 1991383 . + 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_3 AUGUSTUS CDS 1991381 1991432 0.86 + 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_3 AUGUSTUS CDS 1991521 1991549 0.85 + 2 transcript_id "g446.t1"; gene_id "g446"; Scaffold_3 AUGUSTUS CDS 1991708 1991885 0.83 + 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_3 AUGUSTUS CDS 1992100 1992917 0.84 + 2 transcript_id "g446.t1"; gene_id "g446"; Scaffold_3 AUGUSTUS stop_codon 1992915 1992917 . + 0 transcript_id "g446.t1"; gene_id "g446"; # protein sequence = [MQGGNEVLVDNKENEDEVIPILSPSKSVIHRDLKLGNIFLDGKMNIKVGDFGLAALIENPGERKKTICGTPNYIAPEV # LFDTANGHTTYSINSCSQATRAACSSRRSSRRFLHQRSIPPHIPTSAHDVVPDFRAITRSASEANFRRVRRAALLDPDQITSIAVPYVSEDLAISSAA # SDAPTRSVTAAIAQQEKEFQKAVQPGSPISALLSSAKRPLLRSTGPPGAPGNGVTKESPLFRKLQAVSTSNPPNPSPLRQSSATGSSRPVAAHTVNRG # LEHIAEEDDRNDELGRKRKNQTKELEAQKARIVAQMAPVREEERYEAGAQDRYEDPQPERKEIKRSSVREVKENRFPGQMSRCD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g446 ### # start gene g447 Scaffold_3 AUGUSTUS gene 1997009 1997590 0.79 + . g447 Scaffold_3 AUGUSTUS transcript 1997009 1997590 0.79 + . g447.t1 Scaffold_3 AUGUSTUS start_codon 1997009 1997011 . + 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_3 AUGUSTUS CDS 1997009 1997590 0.79 + 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_3 AUGUSTUS stop_codon 1997588 1997590 . + 0 transcript_id "g447.t1"; gene_id "g447"; # protein sequence = [MEKLTHVVEALKGQGSTAVDSSSTSPDPTQSSSPGKRSFSDGKESRSIKEKLSNALAALKGQTPSSGDSSTSTVSEPS # DTSSPSPTRRSLSRRLMLAVAVTVSEGEALTPFVSPSQIAVRDVIRELLEAAAPSLALGTHWRLDWENIPSPKADAKSRIEFSMTGPEKCGGTCTAWV # EEKKHEIKDHSGKVIYP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g447 ### # start gene g448 Scaffold_3 AUGUSTUS gene 2002174 2002878 0.98 - . g448 Scaffold_3 AUGUSTUS transcript 2002174 2002878 0.98 - . g448.t1 Scaffold_3 AUGUSTUS stop_codon 2002174 2002176 . - 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_3 AUGUSTUS CDS 2002174 2002878 0.98 - 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_3 AUGUSTUS start_codon 2002876 2002878 . - 0 transcript_id "g448.t1"; gene_id "g448"; # protein sequence = [MSIVIEDQPTTGAFVQQTQSLQKCASVTMVDICDIRAYDTSGDNKIMNMDMESQNTPSTGPTHAPVFSPPPAQAAFPG # HWIYQSAPVQAFAHAPASSPAYQPAAPIQHQYQSTFPVPQQQPHPSVVMENISRAFTDPPDISSAIPRPLNKMDPSPPLPPSQTEPTMFKPLPRQDTF # WNEVERTTLKVSQTKYRSPPNRGGQKRSWEMQDTGHRWIRMPAKVIGGGGLIHIRERN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g448 ### # start gene g449 Scaffold_3 AUGUSTUS gene 2002941 2004333 0.46 - . g449 Scaffold_3 AUGUSTUS transcript 2002941 2004333 0.46 - . g449.t1 Scaffold_3 AUGUSTUS stop_codon 2002941 2002943 . - 0 transcript_id "g449.t1"; gene_id "g449"; Scaffold_3 AUGUSTUS CDS 2002941 2004159 1 - 1 transcript_id "g449.t1"; gene_id "g449"; Scaffold_3 AUGUSTUS CDS 2004248 2004333 0.46 - 0 transcript_id "g449.t1"; gene_id "g449"; Scaffold_3 AUGUSTUS start_codon 2004331 2004333 . - 0 transcript_id "g449.t1"; gene_id "g449"; # protein sequence = [MSNPSNLKNKTSSSISDIAGLFNNLIVAPLRRAGSGIPPAAKSEEDKEEEEDEEETEKEEEEKEEEENDDDLEEVQII # LNPSESEGNASLIVGNIASPKSHNGVRSQPRILRSDNQSIAKAALVSSTSEVVPSRRNESSSSSTSVQVKTKAPSQFLLTPVTDELENPPTELTLAQR # HGAREERLPGQTVRAHTSTASQPRSDFPRPVTARGHRGRRDSLDPTLQSEKVELANLRKKRRNRNFNRKTRYDIEEDSTSHYSQRGISSGQRSLASRI # APKFVSGSSRAAQATKGTETLVHRRHIRDFSSRYSNSPYQIGVRRTRPGRSDAFPDERILANATSSADPSSSGASGAPYNVSTSQRSNTPNDIANTIR # SFPRSTPDDGNLADYEDESPVVQPVEPTFVHKPLAKSASAMSVDDVVLPALKYGGPLVRLIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g449 ### # start gene g450 Scaffold_3 AUGUSTUS gene 2004824 2005449 0.53 - . g450 Scaffold_3 AUGUSTUS transcript 2004824 2005449 0.53 - . g450.t1 Scaffold_3 AUGUSTUS stop_codon 2004824 2004826 . - 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_3 AUGUSTUS CDS 2004824 2005189 0.64 - 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_3 AUGUSTUS CDS 2005279 2005449 0.53 - 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_3 AUGUSTUS start_codon 2005447 2005449 . - 0 transcript_id "g450.t1"; gene_id "g450"; # protein sequence = [MLVCRWRDAKEGFPPSLYLSLTAGEKLNRKYFPVLPSPKISEDINNTDVKIDSVRELGDMSSLAPNLAVSIHPTLRIL # PSLLTNCLIAEYVDDWGLFDQNQCVIVDENHKLKIINLAKFFREGREHEFKRYHFDNVFDQISNSESNAPTPVIGVPTQPIDLPDSKCEAFEAELDLK # KV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g450 ### # start gene g451 Scaffold_3 AUGUSTUS gene 2008177 2008542 0.35 + . g451 Scaffold_3 AUGUSTUS transcript 2008177 2008542 0.35 + . g451.t1 Scaffold_3 AUGUSTUS start_codon 2008177 2008179 . + 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_3 AUGUSTUS CDS 2008177 2008542 0.35 + 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_3 AUGUSTUS stop_codon 2008540 2008542 . + 0 transcript_id "g451.t1"; gene_id "g451"; # protein sequence = [MHVKRVVQTVLDASQLGVVRGYSQPQPHFSSNDFADDDTWSSSSSSSSIKSSPATIASAGKEWTVIVVDDRKIVNAAA # TPGAVIVFTGILPICKDEQGLAAVLSHGMCLIPKWFEISQSFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g451 ### # start gene g452 Scaffold_3 AUGUSTUS gene 2009962 2010450 0.54 - . g452 Scaffold_3 AUGUSTUS transcript 2009962 2010450 0.54 - . g452.t1 Scaffold_3 AUGUSTUS stop_codon 2009962 2009964 . - 0 transcript_id "g452.t1"; gene_id "g452"; Scaffold_3 AUGUSTUS CDS 2009962 2010450 0.54 - 0 transcript_id "g452.t1"; gene_id "g452"; Scaffold_3 AUGUSTUS start_codon 2010448 2010450 . - 0 transcript_id "g452.t1"; gene_id "g452"; # protein sequence = [MHEVLATFPLLGDTTSNQALLFSPPFDPPIFIDPSYPNYTLPGPSLASPSPPDSSPNFTLLIAPTSSQTLTSLPQTAC # MMASQSSSGNIANESLWLRDEDGWRTQWLMAGLSPQTNYTAYVIQDSQKLSGPMYFVTKSGNRQSFYVHLIHLTTLEQPYSLVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g452 ### # start gene g453 Scaffold_3 AUGUSTUS gene 2011908 2012894 1 + . g453 Scaffold_3 AUGUSTUS transcript 2011908 2012894 1 + . g453.t1 Scaffold_3 AUGUSTUS start_codon 2011908 2011910 . + 0 transcript_id "g453.t1"; gene_id "g453"; Scaffold_3 AUGUSTUS CDS 2011908 2012894 1 + 0 transcript_id "g453.t1"; gene_id "g453"; Scaffold_3 AUGUSTUS stop_codon 2012892 2012894 . + 0 transcript_id "g453.t1"; gene_id "g453"; # protein sequence = [MKRLRRDSTSSTTSDKGFSKIGSAGPSLQIKVIPPKGNPLTLAGSSKYLGLSSCEEESEEDEDAIDENEETESLILSL # GSSKTLNDEGPHREPSPESGLRRRRRGRIRRRVFTGYACDSGDEIEEEEKWISESASETASEAEAEADVMLKEAGEYGSDSPNPNPSSEWSPWPWFNH # VAPILGVLGMAQPNPGILPSYRDSLEDDHKHQAEVEMVEMEAHQTDVDTSLIDEEEIWEWEWWERLLCLFTIYRELRIAEYEETRLGNSSLVELGSNT # SPRLSGASLSSLSAGLGDAEGSYLSLKFSMYDKIYQRLQVEWTYIGTLLLGLAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g453 ### # start gene g454 Scaffold_3 AUGUSTUS gene 2030653 2031118 0.63 - . g454 Scaffold_3 AUGUSTUS transcript 2030653 2031118 0.63 - . g454.t1 Scaffold_3 AUGUSTUS stop_codon 2030653 2030655 . - 0 transcript_id "g454.t1"; gene_id "g454"; Scaffold_3 AUGUSTUS CDS 2030653 2030874 0.66 - 0 transcript_id "g454.t1"; gene_id "g454"; Scaffold_3 AUGUSTUS CDS 2030942 2031118 0.7 - 0 transcript_id "g454.t1"; gene_id "g454"; Scaffold_3 AUGUSTUS start_codon 2031116 2031118 . - 0 transcript_id "g454.t1"; gene_id "g454"; # protein sequence = [MAGKTKHTVFEEPSAFHLRTARGDIVDIAFSMVAFGKGSELKARLLLRNITLLDATHTQVKAQSLNIRIQPTLKRRLE # FEDDEEDARKRMKGMDLENDENEIEDSEENARMRMKGMDIENDENGNEREGTCE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g454 ### # start gene g455 Scaffold_3 AUGUSTUS gene 2033250 2034521 0.79 + . g455 Scaffold_3 AUGUSTUS transcript 2033250 2034521 0.79 + . g455.t1 Scaffold_3 AUGUSTUS start_codon 2033250 2033252 . + 0 transcript_id "g455.t1"; gene_id "g455"; Scaffold_3 AUGUSTUS CDS 2033250 2034521 0.79 + 0 transcript_id "g455.t1"; gene_id "g455"; Scaffold_3 AUGUSTUS stop_codon 2034519 2034521 . + 0 transcript_id "g455.t1"; gene_id "g455"; # protein sequence = [MFSFFRQSPYVDIFSSSTVSQSDGLVSISPSPPKNLTSIVVNGQTYYASDDPTFTNLVLSPSSPLRGGAPARSVVTNP # VSSRMDSPSSRPSSFLPDVVGVDHQVDEDSFDLCYPPESPKNTMSPIPAPSSSHGLSIEDYDSMDIDLPANFRSIPALRTPSPDLPSNPLEGWIPTPR # SSSTLESRMRPVLPTTSSSKTKIFPSKLERGMSPLKIPYGASPSPPRSLLSSPSHSNSDTSTVNTSPSKSSATGSPSSRLKGKDHLRFHPFSNSKRTT # PSPLVTTPVKTPKPSAAGKKHRDAIIHRALTDALPSPSIPPSGFDNLASSSPPRKSRKELICDALSENDLMDSGDSAGFEEQYHEPQDVVPFIDNNLG # ENGVLNAEWIDPRFAASFRSVVDLPSVILLNPNLCFANIYRLVTAPSPSGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g455 ### # start gene g456 Scaffold_3 AUGUSTUS gene 2034916 2035782 0.81 + . g456 Scaffold_3 AUGUSTUS transcript 2034916 2035782 0.81 + . g456.t1 Scaffold_3 AUGUSTUS start_codon 2034916 2034918 . + 0 transcript_id "g456.t1"; gene_id "g456"; Scaffold_3 AUGUSTUS CDS 2034916 2035782 0.81 + 0 transcript_id "g456.t1"; gene_id "g456"; Scaffold_3 AUGUSTUS stop_codon 2035780 2035782 . + 0 transcript_id "g456.t1"; gene_id "g456"; # protein sequence = [MQESQRLFAFFGSLIGSSKFGCPVSEGIIDFRSNQRFDSDAWKDDPDNLSPLEPGQSSPIIIIRPFHVLFFALVTPGK # KRDISNVPKNIHCKNPLPFSRAGAYRSYFPYFVVLTSITVPIFDGRDSFVAAPAQLNQIGSRTYPLYKNSEEDPPTGCIVCVGYTAHTWQSSGSYKAP # PLSLSLGLQFVVVLALPPGYDGPDLPKPISSRPFPKPIYNTPTRTKDFPGPPRRKPPRSKPSSEDAAGSSRISRHAKVNSDDDSPYLHAGGLKEGFEY # HEDVMASKSNRNGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g456 ### # start gene g457 Scaffold_3 AUGUSTUS gene 2038880 2044466 0.44 + . g457 Scaffold_3 AUGUSTUS transcript 2038880 2044466 0.44 + . g457.t1 Scaffold_3 AUGUSTUS start_codon 2038880 2038882 . + 0 transcript_id "g457.t1"; gene_id "g457"; Scaffold_3 AUGUSTUS CDS 2038880 2041529 0.44 + 0 transcript_id "g457.t1"; gene_id "g457"; Scaffold_3 AUGUSTUS CDS 2041624 2044466 1 + 2 transcript_id "g457.t1"; gene_id "g457"; Scaffold_3 AUGUSTUS stop_codon 2044464 2044466 . + 0 transcript_id "g457.t1"; gene_id "g457"; # protein sequence = [MQRNFGGGRPPNKLKGVLAPTLFIEPFTFTCPIQKTNTAPPKMIENLTFKFPPPPISRSHMAGVIDKWCKASTAVHFE # EAGCAVCGQLTLCTNLSALKNMKNYLHLLEAQSVTRAFRDSPNVPFSDIKGPVLDKSAGDRICNNCRSSLRSGTVPKLALCKGLWLGDIPDELKNLTF # YEKMLIARVRHTKCFVRVQKGSTNYSKLVSNVIAFENPIPKIYDTLPPPREEIEEVLAVMFSGSTKPTQDDYARALLLVRRNVVAKALQVLILNHFDY # NDVVFSSANLNSYADNVPIVAVEYFQKGSNRNAEGVSVHDDLNDDGTEEGTCVFTVHGIVGPSIKNMTRDQMIGIAAMHLDNEGKFMRTSHAENPESL # WNNPQLYPKMFPWLFPFGLGGIGTSNIKSFSESSHLNFLLLYHDKRFQLDPNFPLIAFSHQQVKASSSQSYLLAESNKFDEVSNRFLSIDKSVLQNIA # TRMANGEHVKPANDSEIQCFKLLGDLSHAGAKTQGSISSKKNMQSEIWSLINHIGGPSWYITVSPCDFKHPICIYYADTKEKFDVPLRTSSECRLLIS # NNPVAGARFFHLLVNLFLKHVVDIESSEGGLFGPTSGYYCTVEQQGRLALHLHGLIFNRKILSPQEIRDKILDPASSFQSQLISFLESVRIGEFLTGS # HAYVKETVALQSKSNINYISPERTLPTPPPPYCDCGITDCHKCSTFQHWFEEFKCTVDDLLLKSNVHDCFRGISPDGSVLNQDKFETSCLNNAHKKCK # ARFPRECFQQTSVDPDNGHIDLKKLEEWLNDISPGLTYLVRGNTDVTSILSGTAIKSAVIYIADYITKTGLKTHVVFDSIKTIFDKSTEIIDGSFSTK # EKSRRLISRIVNLLSTKLELGTRSFFGENDSTSEPKLILTKRWDKIVGLSSSLDYTHRPVQHVNYNLYNWVCSFYKVAKRKSKDEVLSDHETELKSSK # SVKSTKGLPFLVGHPLVETHVISTRRNSSMTVPNFIGALPRPNKDDREYYCCTMLTLFCPWRTGEDLKKKDQSWHEAFEAYDFCEQSQLYMKNMNIRF # ECLDARDDFRAQLKSGKLDVTKLPSSIPIQLHADLVNKLDGSHSDMNSSDIEDIGHNYDQYTEDKKGNFFLRRESAMRAMKDMLFNIGWVIPLTGSVQ # SKSITTCSPILLPKEKPQHWDLILKGMRDQVLATRDKDRGLPPSNNNENINDPGKYRPNIVEICDKHYFDKLGIDYGSIKELTLNIIKCHNLNNEQER # AFRIIAQHSAGLVSEPLYMYIGGMGGTGKSQVIKAVLQFFADRNSSFAIVTSAPTGNAAALLGGSTYHFLLGLNNKVEEVGRGTMAQVCARLEHVQYM # ILDEVSMLSCSDLYRISVQLCGAKNKHDIAFGGMNMIFAGDFAQLPPVGGESVSLYSYRRPTDANKYNGQCAAMGKSLWHNVTHVVILRKNMRNTGSS # KADISFRLALDNMRYKSCTKEDIGFLNTLVSSKSPGRPFVGKSPWRDAAIIVGENKHKDEINRLGCLRFASDTNQILTHFYSDDLASSNTDQPMYVKS # KKKKQIKSSISKELQHHLWELPTCAHETHAPPVLSLCIGLPIIIRHNIATELSITKGQRGTVYAWHESTGAFDQCVLDVLFVLLDNPPTPIHVPGLPP # NVVPLTRRKTKGIVTLRNDVKISVTRNQVDILPGFSMTAYASQGQGLNPNATDLNTLNDHHAIYTALSRSRTAASTVILQGFDSRLITGGASGPLRKE # YRELEMLDEITCLRYEGALDPSVVGITRNLLIESFLAWKGTTYVPSQVHSAVSWSDKDPYVQQSEEPLSWSKIHKKAMQKLRKKKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g457 ### # start gene g458 Scaffold_3 AUGUSTUS gene 2044636 2045541 0.98 + . g458 Scaffold_3 AUGUSTUS transcript 2044636 2045541 0.98 + . g458.t1 Scaffold_3 AUGUSTUS start_codon 2044636 2044638 . + 0 transcript_id "g458.t1"; gene_id "g458"; Scaffold_3 AUGUSTUS CDS 2044636 2045541 0.98 + 0 transcript_id "g458.t1"; gene_id "g458"; Scaffold_3 AUGUSTUS stop_codon 2045539 2045541 . + 0 transcript_id "g458.t1"; gene_id "g458"; # protein sequence = [MSLGNKLRRSSAGRQALLKRSQKNIVNSDFANPTQLASLPISLLWSNNSCAFDSVVTIFVYIWMETNITGDEYTNLPQ # LIKDFTEYRQGKHTLESVRDSLRSSLNSKRPREFSLTGFCSSTTILEELLKMKSSFMTTKLQCEQGHLSKRRPHNLKHSLLEDHRLDLPSSTNEWISV # NSPASSNLLCDTCKGSLKKFFHIECAPNVLAFACDGRPHLSIDNVVHLRYNNEDFVYVLKGVIYYIPMREHFVSRIVSSENVIYIYDGMTNNGVPVLE # YTNVNEIDWAQCQSGSASAAIYSRSNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g458 ### # start gene g459 Scaffold_3 AUGUSTUS gene 2050249 2050974 0.98 - . g459 Scaffold_3 AUGUSTUS transcript 2050249 2050974 0.98 - . g459.t1 Scaffold_3 AUGUSTUS stop_codon 2050249 2050251 . - 0 transcript_id "g459.t1"; gene_id "g459"; Scaffold_3 AUGUSTUS CDS 2050249 2050974 0.98 - 0 transcript_id "g459.t1"; gene_id "g459"; Scaffold_3 AUGUSTUS start_codon 2050972 2050974 . - 0 transcript_id "g459.t1"; gene_id "g459"; # protein sequence = [MDVERGQYANSTYDDEHNDAGAEHEALLPTFNPNNNNNNNDDKAAIDPTPSKRFPTLTQPKFTILHLLVAFTVGISGC # VLAQYVLCGPSCFGMKESTSTSGTDAFALANPDAGSTQIHAFPPPSPTNAFPSLFPTNVGYAGGTPTGAEPALIATAPQYPIHTGAAQLVKPETLGDK # GNDKKKEKGDSWDLFKHWGNLAPWYSNERGTFGLDSGPGTPDTCRVTGLHFLHRHGARYPTAWGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g459 ### # start gene g460 Scaffold_3 AUGUSTUS gene 2051514 2052020 0.32 - . g460 Scaffold_3 AUGUSTUS transcript 2051514 2052020 0.32 - . g460.t1 Scaffold_3 AUGUSTUS stop_codon 2051514 2051516 . - 0 transcript_id "g460.t1"; gene_id "g460"; Scaffold_3 AUGUSTUS CDS 2051514 2052020 0.32 - 0 transcript_id "g460.t1"; gene_id "g460"; Scaffold_3 AUGUSTUS start_codon 2052018 2052020 . - 0 transcript_id "g460.t1"; gene_id "g460"; # protein sequence = [MDGVGSVAGSMRSFSSRHSVMSGDSRIPLIRSDFRDGSHRKGQEMQLVAYAYQPDALLDGEDDGEDDDWLHDPKVSFY # ASPQSKAGIGENKGKDSEILPSLRTGKTGYVEDSISMRGLGNYFTLWLLLVGLVALFIFYPVVTEAGRNDLSDSIVNNPNINSTGQATAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g460 ### # start gene g461 Scaffold_3 AUGUSTUS gene 2060062 2060621 0.39 + . g461 Scaffold_3 AUGUSTUS transcript 2060062 2060621 0.39 + . g461.t1 Scaffold_3 AUGUSTUS start_codon 2060062 2060064 . + 0 transcript_id "g461.t1"; gene_id "g461"; Scaffold_3 AUGUSTUS CDS 2060062 2060197 0.5 + 0 transcript_id "g461.t1"; gene_id "g461"; Scaffold_3 AUGUSTUS CDS 2060263 2060621 0.79 + 2 transcript_id "g461.t1"; gene_id "g461"; Scaffold_3 AUGUSTUS stop_codon 2060619 2060621 . + 0 transcript_id "g461.t1"; gene_id "g461"; # protein sequence = [MSAIDSNVASQVASVLKQFTDEGVEVWLRFAHEVNYYITSGTYHGDVDSYQTAWVNIAAAVKDNSKIKMFWCPNWADA # SSLAEWFPKDSSTVDIVGMDAYPKSQQTFDQVYGSFYTAFAEKYNKPFAIGETGPGIGDDTLKEYWLKQIAEVDVQKYPLYIAGCW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g461 ### # start gene g462 Scaffold_3 AUGUSTUS gene 2061170 2061529 0.6 - . g462 Scaffold_3 AUGUSTUS transcript 2061170 2061529 0.6 - . g462.t1 Scaffold_3 AUGUSTUS stop_codon 2061170 2061172 . - 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_3 AUGUSTUS CDS 2061170 2061529 0.6 - 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_3 AUGUSTUS start_codon 2061527 2061529 . - 0 transcript_id "g462.t1"; gene_id "g462"; # protein sequence = [MNAQLLSAYDPHETGGVCPPLVFLRSELGYAAEGIQVADIPSWLVDRSDPSTTIAGWSELSSSVKVWDVPGHHFQAFD # NANVGCPYHAIDRVHSIFTIDCLRFCQTLASLRIFRNPLTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g462 ### # start gene g463 Scaffold_3 AUGUSTUS gene 2061853 2063357 0.46 - . g463 Scaffold_3 AUGUSTUS transcript 2061853 2063357 0.46 - . g463.t1 Scaffold_3 AUGUSTUS stop_codon 2061853 2061855 . - 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_3 AUGUSTUS CDS 2061853 2062649 0.5 - 2 transcript_id "g463.t1"; gene_id "g463"; Scaffold_3 AUGUSTUS CDS 2062748 2063357 0.47 - 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_3 AUGUSTUS start_codon 2063355 2063357 . - 0 transcript_id "g463.t1"; gene_id "g463"; # protein sequence = [MLPSVTGCINRLKDPSTKAEVFLSRTTYEVVFPRVVHYAKEYHTIKSLFVSPTDLQGSASIRLPSGHYRGTFTAHPVF # LDTLLQVPGFIANLQGKRQPAESSDVNLGIHVGDVFICSEITSCSISTTSLDDNATYSIYCTGVWLDNRTLSFDVYAVKDGDSLQVIAFVKGVVFRQM # ALETLRKALSLAAVLGQPQGSQSSPALTETCGVTREQITASTALDSLGIDSLMLIELSTKLQFLSSKIDLELQSLYSCKTVADIIRKSCSVLGLGNAP # VLTIAPPSTTCVESEPSSPSTLVADDRLSDTVFSRADVYLDVRNVINAALGTTVAFGDETDLETVGLDSLASIEVLHALQTHYGHQVPNDFLRKYRTI # SAIQEYLGPSKFNLPHRRLFIPQSPPKEAVQARLIGILRLGTNPVRVQDCNKMNPPIFFIHDGSGLVNYYDKVESLHRDVWAIYNPKFLFALPGPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g463 ### # start gene g464 Scaffold_3 AUGUSTUS gene 2064654 2065919 0.79 - . g464 Scaffold_3 AUGUSTUS transcript 2064654 2065919 0.79 - . g464.t1 Scaffold_3 AUGUSTUS stop_codon 2064654 2064656 . - 0 transcript_id "g464.t1"; gene_id "g464"; Scaffold_3 AUGUSTUS CDS 2064654 2065919 0.79 - 0 transcript_id "g464.t1"; gene_id "g464"; Scaffold_3 AUGUSTUS start_codon 2065917 2065919 . - 0 transcript_id "g464.t1"; gene_id "g464"; # protein sequence = [MFLGLDRGHFLSPTGQCRAFDAAADGYSRGEGCGLFVLKRLSDALAENDNIYGTIRGIEVNQSGLAHSITHPHAPTQV # ALFERVLRNAAIHPSRVNVVEAHGTGTQAGDINEIASIRQVFSANRTSQNPLHVTSIKGNIGHLEAASGAAGLAKLLLMLKHQTIPPQISFNKLNPSI # EPLENDNTMILRRSGPWKPSYNGSSRMAFLNNFGAAGSNAALVLEEHIHSPSQAFDHPLVFVLSAKDEHALNKLRSDYIQWLQSPESKTVPMVDIAYS # MTARRQLYSYRLAVVASERTRLVESLHKAAIVSSSAQPIRRVVFVFSGQSSQYPEMGQVFYSTSPLFKHHVDECHAILISLGFNGVLSIFTGNEVVLS # DFEKIEAYQAAIFTLEYALGKLWMFWGIVPTAVIGHRYLIHLCVPFHFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g464 ### # start gene g465 Scaffold_3 AUGUSTUS gene 2066204 2067940 0.36 - . g465 Scaffold_3 AUGUSTUS transcript 2066204 2067940 0.36 - . g465.t1 Scaffold_3 AUGUSTUS stop_codon 2066204 2066206 . - 0 transcript_id "g465.t1"; gene_id "g465"; Scaffold_3 AUGUSTUS CDS 2066204 2066539 0.97 - 0 transcript_id "g465.t1"; gene_id "g465"; Scaffold_3 AUGUSTUS CDS 2066630 2067940 0.36 - 0 transcript_id "g465.t1"; gene_id "g465"; Scaffold_3 AUGUSTUS start_codon 2067938 2067940 . - 0 transcript_id "g465.t1"; gene_id "g465"; # protein sequence = [MSSLSRPRLLVPIFAGQGSTPSTHSSYINSTIRRSQHGLCATLLTICHEAFIDELSSLSALELTQAGVDPNDFRSPET # LLTMWMSRFPHNALISSSALVLMQLLQYLSFVERFGAENGSLRPFADLLIGHSKSSVGILGFSSGIVSACVVASSNSAKSYLSFALEAYRLALWIGIR # CQLYRFGTSNADTTLPWSVVFLGISTEEAQEAISNFGSVSVVSRCSLRMLMQSLIQRGNSPESEDPSKLYITAVMDDHCVTVSGCPPILAEFTASVRR # TLPSVLAHQTTVDTLYHSPVHLRKVRDQILVDVADRNIRFPELSHLRAPVRSTSTGVLLSPSVESVSPLVQLVVDMLIIEPVRWDLVTDQVSQSIPEA # EVLLNNFGPGIGVARTLEKICPHGRVQLRDLCSEFHETRSQQEPIAIVGMAVNMPGSSNISKLWEIPEHRFNIRDYEGTKNPNRQMKARTGNFIQGAD # EFDNRFFKISPREAKSMDPQQRVLLHTAYEALEDSGYVPGTTSSSQPDTFGCYIGAATHDYVQNLRGDIDVYYSTGEC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g465 ### # start gene g466 Scaffold_3 AUGUSTUS gene 2074135 2074990 0.46 + . g466 Scaffold_3 AUGUSTUS transcript 2074135 2074990 0.46 + . g466.t1 Scaffold_3 AUGUSTUS start_codon 2074135 2074137 . + 0 transcript_id "g466.t1"; gene_id "g466"; Scaffold_3 AUGUSTUS CDS 2074135 2074645 0.48 + 0 transcript_id "g466.t1"; gene_id "g466"; Scaffold_3 AUGUSTUS CDS 2074761 2074990 0.92 + 2 transcript_id "g466.t1"; gene_id "g466"; Scaffold_3 AUGUSTUS stop_codon 2074988 2074990 . + 0 transcript_id "g466.t1"; gene_id "g466"; # protein sequence = [MCGNNYARDFTQFLTQQAAAAAEFFSNTKFDTIYASPLLRANTTAQAIHGRQQAPFPSFIVTPNIREQHFGVAEGTTF # AYIPTEHDTLDELFAQGIYPVLYHRDEKFPGAESLNDLALRAEKAIMECVIPHLQSEEVAHIAMVSHGLCISELVAALLRLDPDSRRDTSYKEGLPPL # DVQVTHVNVAGHLDGITVSAPHPFDKSLAQPYDVKPFTSDSTSENSEARKFFGGGGALAEVALSDERPKM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g466 ### # start gene g467 Scaffold_3 AUGUSTUS gene 2080549 2081968 0.37 - . g467 Scaffold_3 AUGUSTUS transcript 2080549 2081968 0.37 - . g467.t1 Scaffold_3 AUGUSTUS stop_codon 2080549 2080551 . - 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_3 AUGUSTUS CDS 2080549 2080847 0.61 - 2 transcript_id "g467.t1"; gene_id "g467"; Scaffold_3 AUGUSTUS CDS 2080921 2081968 0.37 - 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_3 AUGUSTUS start_codon 2081966 2081968 . - 0 transcript_id "g467.t1"; gene_id "g467"; # protein sequence = [MSTKLSKLLVFESVVDGGFGKILKMEEGAVLELGRFDMTHEEKDQSADVNVGTSHSNSDASVPTTGAQATASGGVNAP # NPRRKRLTHIFAKRHNNRNMSVSGPALAIVDASANAHTVDTEKSKKVEAEEGIKVTIRLAALDEHGTELASLNEQITYLSVERFGIKAHPVHVESNGD # ESKTEATAGEVKLGDEEDTRPWVVKVVKREATIGPHTFHLHEIYGLTSSSSSNHTHAPTAPLPSSHTYPPATGTPVAENNDSNDDSPSECLLCLSSPR # EVVLLPCRHLVACKDCALNMVEFGAGGNITQPADEIAAGDGGADGGEGGAPGTGATDATTTPAATRRKRKAKGWFSYTSLLRITTNPPPEPGSSDKPE # TTASAGQYESDEEHDEAAENDIADAGLPLPVTAEPPAQSLNTGDANSSSLFPRPGFLRGITGRGNATPRGDVESQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g467 ### # start gene g468 Scaffold_3 AUGUSTUS gene 2082117 2082485 0.57 - . g468 Scaffold_3 AUGUSTUS transcript 2082117 2082485 0.57 - . g468.t1 Scaffold_3 AUGUSTUS stop_codon 2082117 2082119 . - 0 transcript_id "g468.t1"; gene_id "g468"; Scaffold_3 AUGUSTUS CDS 2082117 2082485 0.57 - 0 transcript_id "g468.t1"; gene_id "g468"; Scaffold_3 AUGUSTUS start_codon 2082483 2082485 . - 0 transcript_id "g468.t1"; gene_id "g468"; # protein sequence = [MAQATNGDVLGNINGLGSSGPPAKDNSKEKKGPDTLFGPNIGVISGGPAWTNGTEKKVLKDELTVDVVKSWVEKSKEV # LSLIFGTLCVAHQIVIVAISTYNHPPGPGQSQTADYPSFSPYSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g468 ### # start gene g469 Scaffold_3 AUGUSTUS gene 2085823 2086764 0.99 + . g469 Scaffold_3 AUGUSTUS transcript 2085823 2086764 0.99 + . g469.t1 Scaffold_3 AUGUSTUS start_codon 2085823 2085825 . + 0 transcript_id "g469.t1"; gene_id "g469"; Scaffold_3 AUGUSTUS CDS 2085823 2086764 0.99 + 0 transcript_id "g469.t1"; gene_id "g469"; Scaffold_3 AUGUSTUS stop_codon 2086762 2086764 . + 0 transcript_id "g469.t1"; gene_id "g469"; # protein sequence = [MPSNNDGALPSPPRAPTVKYSAPHGTRWDKEKAAAGGARAFDLPSDPKVLGPWIIGECVGKGASGRVKIAKHRYTNQL # AAVKILPRAPLDSSRNSIATQEAKSKKHSLGIEREITMMKLMNHPNILRIYDVYEGPKELFLVLEYVEGGELFDYLVNRGRLPEPDAICFFKQIIYGL # NYAHTFSIIHRDLKPENILISSLSPPKIKIVDWGMAAFAPPTLQLETSCGSPHYASPEIVNGFKYTGNATDIWSCGVILYALLTGRLPFDDKDVKLLL # GKVKLGKYDMPSYIDRSAQDLLSKMLVINVEERITVRFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g469 ### # start gene g470 Scaffold_3 AUGUSTUS gene 2086870 2088669 0.95 + . g470 Scaffold_3 AUGUSTUS transcript 2086870 2088669 0.95 + . g470.t1 Scaffold_3 AUGUSTUS start_codon 2086870 2086872 . + 0 transcript_id "g470.t1"; gene_id "g470"; Scaffold_3 AUGUSTUS CDS 2086870 2088669 0.95 + 0 transcript_id "g470.t1"; gene_id "g470"; Scaffold_3 AUGUSTUS stop_codon 2088667 2088669 . + 0 transcript_id "g470.t1"; gene_id "g470"; # protein sequence = [MSLASSFENDSPLEPVLPPSPSTLARPITDPSSIDSDILFSLKVIWGRHADLAAIVKDLGSPAGNGVYTKAFYWLLLR # HHEEAERLSGSDETNDENTSATGMGPGSVTFNLGWELDTSGLGGATVKFSSAARAIEVGRVLGPERRGYTDTSLQAADGLLSPLMTRDVSSTSSSHAS # RSRPNTPGGPRLPTVPRPTYERNSSQYTGPHSGIRSASGRSSSLPKSSFAMGNGGGSGIRASSVVNGTQGGPRPQPPKRGHTYSHPRPDKPSAMTTRS # NKSPDAISVSTVQFPPTPIHPLQYTQSHRSVSRSSRTRSVTTVDVTTEASRPHLQARSRSHTSQVRGGYIGGTSLKRDTSSVHSGTNSSSGSSTTCSI # TSTATVHAPIPMKPVSGVFEVPMEVDDNSSMQIASTPPPLLPPLVYPLPLLVAPKTNDPALQMELDEVAEHMNRLSLQNAVAETTVCQDIQTQSREYH # SHTHQLQPQSRQAAYQQQRFQSPKRNRRRTVSTVERGARCADKENKENASINDESWSYVVPDEGLSIVSGKKNALFADTGNHKRSLGANDGKGKRDKD # KKPRRKSSPFTLCLSNGCFLLPLQRSDHHLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g470 ### # start gene g471 Scaffold_3 AUGUSTUS gene 2095250 2095951 0.28 + . g471 Scaffold_3 AUGUSTUS transcript 2095250 2095951 0.28 + . g471.t1 Scaffold_3 AUGUSTUS start_codon 2095250 2095252 . + 0 transcript_id "g471.t1"; gene_id "g471"; Scaffold_3 AUGUSTUS CDS 2095250 2095951 0.28 + 0 transcript_id "g471.t1"; gene_id "g471"; Scaffold_3 AUGUSTUS stop_codon 2095949 2095951 . + 0 transcript_id "g471.t1"; gene_id "g471"; # protein sequence = [MHLGSIYPLLIPLHFSAGIKEGLYDMDTLASYLLYRLNVLDPICKIHIPVHPSQTLPRSILAPAYLTLLPEGTQPIID # LDVFLSKIAQRMGMIKRGAELDLSRAATYFVRWWREEGGLLAASSNLQTLSRPLFVTNEKGAITNEENFSVAHGWGFDFEWRISPNDFHDVNQKVVES # DVASFVQLKMEECIGNYLVQSEREDRDETNISATQRKKQLTMEEKARRRTKYARTSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g471 ### # start gene g472 Scaffold_3 AUGUSTUS gene 2104042 2104614 0.68 + . g472 Scaffold_3 AUGUSTUS transcript 2104042 2104614 0.68 + . g472.t1 Scaffold_3 AUGUSTUS start_codon 2104042 2104044 . + 0 transcript_id "g472.t1"; gene_id "g472"; Scaffold_3 AUGUSTUS CDS 2104042 2104614 0.68 + 0 transcript_id "g472.t1"; gene_id "g472"; Scaffold_3 AUGUSTUS stop_codon 2104612 2104614 . + 0 transcript_id "g472.t1"; gene_id "g472"; # protein sequence = [MSKSPLSDGSGTRILTEPLLLWLHLTGTNIVDSAVQSGYTDDVSYSLCKLLAALGDHSASHLAANIASSASVTLLPSS # IPGGVSPVDLNRTKGQLCQTFLRLLLAYTGFPGFYGVDEDVSEMTLGFWYMLQEALWNNDFYFPDGGETQASQQSEMGDQSGVAKALYVQLVQVLKRK # ITWPSSGHNWSKGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g472 ### # start gene g473 Scaffold_3 AUGUSTUS gene 2114269 2115345 0.89 + . g473 Scaffold_3 AUGUSTUS transcript 2114269 2115345 0.89 + . g473.t1 Scaffold_3 AUGUSTUS start_codon 2114269 2114271 . + 0 transcript_id "g473.t1"; gene_id "g473"; Scaffold_3 AUGUSTUS CDS 2114269 2115345 0.89 + 0 transcript_id "g473.t1"; gene_id "g473"; Scaffold_3 AUGUSTUS stop_codon 2115343 2115345 . + 0 transcript_id "g473.t1"; gene_id "g473"; # protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFNAENPP # FGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAI # SVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPHRETTCRYCGRRGHLEAVCQDKFMGL # GRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g473 ### # start gene g474 Scaffold_3 AUGUSTUS gene 2115396 2118701 0.93 + . g474 Scaffold_3 AUGUSTUS transcript 2115396 2118701 0.93 + . g474.t1 Scaffold_3 AUGUSTUS start_codon 2115396 2115398 . + 0 transcript_id "g474.t1"; gene_id "g474"; Scaffold_3 AUGUSTUS CDS 2115396 2118701 0.93 + 0 transcript_id "g474.t1"; gene_id "g474"; Scaffold_3 AUGUSTUS stop_codon 2118699 2118701 . + 0 transcript_id "g474.t1"; gene_id "g474"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGCQVHAACLHSAARYSEDLLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g474 ### # start gene g475 Scaffold_3 AUGUSTUS gene 2124605 2125369 0.97 + . g475 Scaffold_3 AUGUSTUS transcript 2124605 2125369 0.97 + . g475.t1 Scaffold_3 AUGUSTUS start_codon 2124605 2124607 . + 0 transcript_id "g475.t1"; gene_id "g475"; Scaffold_3 AUGUSTUS CDS 2124605 2125369 0.97 + 0 transcript_id "g475.t1"; gene_id "g475"; Scaffold_3 AUGUSTUS stop_codon 2125367 2125369 . + 0 transcript_id "g475.t1"; gene_id "g475"; # protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTENNSKWLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g475 ### # start gene g476 Scaffold_3 AUGUSTUS gene 2125451 2125957 0.57 + . g476 Scaffold_3 AUGUSTUS transcript 2125451 2125957 0.57 + . g476.t1 Scaffold_3 AUGUSTUS start_codon 2125451 2125453 . + 0 transcript_id "g476.t1"; gene_id "g476"; Scaffold_3 AUGUSTUS CDS 2125451 2125957 0.57 + 0 transcript_id "g476.t1"; gene_id "g476"; Scaffold_3 AUGUSTUS stop_codon 2125955 2125957 . + 0 transcript_id "g476.t1"; gene_id "g476"; # protein sequence = [MTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMP # EGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEATPRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g476 ### # start gene g477 Scaffold_3 AUGUSTUS gene 2126010 2126702 0.86 + . g477 Scaffold_3 AUGUSTUS transcript 2126010 2126702 0.86 + . g477.t1 Scaffold_3 AUGUSTUS start_codon 2126010 2126012 . + 0 transcript_id "g477.t1"; gene_id "g477"; Scaffold_3 AUGUSTUS CDS 2126010 2126702 0.86 + 0 transcript_id "g477.t1"; gene_id "g477"; Scaffold_3 AUGUSTUS stop_codon 2126700 2126702 . + 0 transcript_id "g477.t1"; gene_id "g477"; # protein sequence = [MKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLK # KPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD # LSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDILGYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g477 ### # start gene g478 Scaffold_3 AUGUSTUS gene 2128120 2128878 0.7 + . g478 Scaffold_3 AUGUSTUS transcript 2128120 2128878 0.7 + . g478.t1 Scaffold_3 AUGUSTUS start_codon 2128120 2128122 . + 0 transcript_id "g478.t1"; gene_id "g478"; Scaffold_3 AUGUSTUS CDS 2128120 2128878 0.7 + 0 transcript_id "g478.t1"; gene_id "g478"; Scaffold_3 AUGUSTUS stop_codon 2128876 2128878 . + 0 transcript_id "g478.t1"; gene_id "g478"; # protein sequence = [MKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLK # KPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD # LSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEIFGRIRRICLKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g478 ### # start gene g479 Scaffold_3 AUGUSTUS gene 2129198 2129575 0.79 + . g479 Scaffold_3 AUGUSTUS transcript 2129198 2129575 0.79 + . g479.t1 Scaffold_3 AUGUSTUS start_codon 2129198 2129200 . + 0 transcript_id "g479.t1"; gene_id "g479"; Scaffold_3 AUGUSTUS CDS 2129198 2129575 0.79 + 0 transcript_id "g479.t1"; gene_id "g479"; Scaffold_3 AUGUSTUS stop_codon 2129573 2129575 . + 0 transcript_id "g479.t1"; gene_id "g479"; # protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV # GTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g479 ### # start gene g480 Scaffold_3 AUGUSTUS gene 2129645 2131339 0.98 + . g480 Scaffold_3 AUGUSTUS transcript 2129645 2131339 0.98 + . g480.t1 Scaffold_3 AUGUSTUS start_codon 2129645 2129647 . + 0 transcript_id "g480.t1"; gene_id "g480"; Scaffold_3 AUGUSTUS CDS 2129645 2131339 0.98 + 0 transcript_id "g480.t1"; gene_id "g480"; Scaffold_3 AUGUSTUS stop_codon 2131337 2131339 . + 0 transcript_id "g480.t1"; gene_id "g480"; # protein sequence = [MDTNDVNKKRSLRRSFLKHMFLHLGNIWKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNEQFNLNP # IKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPS # FEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKAT # LPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEP # WVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDE # RELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKDHQLDMNYQKEVTKLFQKILELDDLFGNISKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g480 ### # start gene g481 Scaffold_3 AUGUSTUS gene 2131453 2132694 0.87 + . g481 Scaffold_3 AUGUSTUS transcript 2131453 2132694 0.87 + . g481.t1 Scaffold_3 AUGUSTUS start_codon 2131453 2131455 . + 0 transcript_id "g481.t1"; gene_id "g481"; Scaffold_3 AUGUSTUS CDS 2131453 2132694 0.87 + 0 transcript_id "g481.t1"; gene_id "g481"; Scaffold_3 AUGUSTUS stop_codon 2132692 2132694 . + 0 transcript_id "g481.t1"; gene_id "g481"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIEKYLSNPSDESLGEMSKDERIKFIRLIK # KFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSEAWIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g481 ### # start gene g482 Scaffold_3 AUGUSTUS gene 2132889 2133922 0.19 + . g482 Scaffold_3 AUGUSTUS transcript 2132889 2133922 0.19 + . g482.t1 Scaffold_3 AUGUSTUS start_codon 2132889 2132891 . + 0 transcript_id "g482.t1"; gene_id "g482"; Scaffold_3 AUGUSTUS CDS 2132889 2133548 0.27 + 0 transcript_id "g482.t1"; gene_id "g482"; Scaffold_3 AUGUSTUS CDS 2133632 2133922 0.55 + 0 transcript_id "g482.t1"; gene_id "g482"; Scaffold_3 AUGUSTUS stop_codon 2133920 2133922 . + 0 transcript_id "g482.t1"; gene_id "g482"; # protein sequence = [MSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIR # ISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQA # LSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLTTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLD # LMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g482 ### # start gene g483 Scaffold_3 AUGUSTUS gene 2134211 2135626 0.84 - . g483 Scaffold_3 AUGUSTUS transcript 2134211 2135626 0.84 - . g483.t1 Scaffold_3 AUGUSTUS stop_codon 2134211 2134213 . - 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_3 AUGUSTUS CDS 2134211 2134608 1 - 2 transcript_id "g483.t1"; gene_id "g483"; Scaffold_3 AUGUSTUS CDS 2134689 2134821 0.9 - 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_3 AUGUSTUS CDS 2135459 2135626 0.88 - 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_3 AUGUSTUS start_codon 2135624 2135626 . - 0 transcript_id "g483.t1"; gene_id "g483"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTGSNKGSNKDEKSA # VNEVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSR # QDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMLFQSLRPSNELLLHSLVVLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g483 ### # start gene g484 Scaffold_3 AUGUSTUS gene 2137962 2138620 0.66 - . g484 Scaffold_3 AUGUSTUS transcript 2137962 2138620 0.66 - . g484.t1 Scaffold_3 AUGUSTUS stop_codon 2137962 2137964 . - 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_3 AUGUSTUS CDS 2137962 2138344 0.97 - 2 transcript_id "g484.t1"; gene_id "g484"; Scaffold_3 AUGUSTUS CDS 2138410 2138620 0.66 - 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_3 AUGUSTUS start_codon 2138618 2138620 . - 0 transcript_id "g484.t1"; gene_id "g484"; # protein sequence = [MMRSVPSKDLDAFASLRGKGSLAGASKRNPLAPPLEIKSSTSIPKAPVAPPRLIRRNRELENLKADASSFLASPRSTR # SRDSDNELLSGFPLVDAAPRASSPTKVPVSRKEPKSKTAVKVVEDSKASDPPTSALVYKRVRLPPRSRKIAPAASKGKARQTIVTEADSASSEVESED # EDEEEDSAPPPKASNDIFHFW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g484 ### # start gene g485 Scaffold_3 AUGUSTUS gene 2141752 2145678 0.17 + . g485 Scaffold_3 AUGUSTUS transcript 2141752 2145678 0.17 + . g485.t1 Scaffold_3 AUGUSTUS start_codon 2141752 2141754 . + 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_3 AUGUSTUS CDS 2141752 2142270 0.21 + 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_3 AUGUSTUS CDS 2142376 2145678 0.39 + 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_3 AUGUSTUS stop_codon 2145676 2145678 . + 0 transcript_id "g485.t1"; gene_id "g485"; # protein sequence = [MSSALFTAVTTTLKGDNYDTWASEMEAFLQATGLESAITTDQPSEPSPLVAANAASVEAWKNYEVVFKAWKEIDTKAI # GNIRLRISPSIRILAKEYSDTAKKLWNYLAKTYNVKSLGAVFNDFAAAMAIKIPYKQNPLSSMMEIGMYFTRMDEAGIGLADHLEALILYLSSHHTHW # QLPTAEREQVFERSSQGNDPKFSQQQHGNGSNQQQKGQNGNDDNKKKRKRGSGKNKKAKKNANAAQADADSMDFSPIGSTVDFGPVRTDLTPSVQDVR # KHSIHPPYNPPPNATSLHLHKKTRMAIKRARDIGVRATAEVIRTLEPAGHISELDSDDELDPPTKRTRAMSPVDDVENGSKAPTPPPPSPPMDFEVPG # TASFDPDELMNFDLDREILAITGFMDTMGSVPSSDLDHMGYTNAPSSVAVAKTCKSAFEPDLLSRLYNYRIDAKYISNEHFCVHDVSYSVCKKCKGKQ # RNQPKWWMNDSGCSEHTTFDLSDFIEYEDLEEKVLIATATTTAYITGVGTVLINFKDVRGRMHSARIAPVFYMKELSHRLIAQGRFLQDGKTVRGNAD # KVDFWDKDGLFLSFEPRTHSDTIYILKDYSPQPMAVNLVIHSVDYTTMHRRMGHPSREALTQLRKHAEGVPTFSIPHEEDLCEGCAKGKMTLRPFPPT # NRRASRPFEIIHSDLKEWPTISYHKYKYTIFFIDDYTSHGFYCHLKKKSGALPVIKQFIATVKNLYETNVKEWMSDGGGEFRSNALDEFFKNEGIKAQ # WSSPHIHQQNGRAERFIRTIIEKSEPQRFQACIPDSWWEFSVAHAVHVYNRTPMRRHKWKTPYEILYNKVPRIDHLRVFGCGAYVYLHEEIRTNKQSP # RSELMTYLGVSDGGHGNIYMRSNNAMFTATHAVFDEKLFPRCKSSERHRSTRLPDRNPDPKDPIPPPGDDDVPIFHQPTTPQMRQDPEQDVAPPVPAE # QPARDPSPPPQPRNEQPPAQEQLRRSGRVRRPPTRLTGDPRSSTKLPTEQQVERPKRDIQRRAPQPGSSSAEQERPEPEQVPGPSTEHPTPENGEQPS # VTPGDEANTLIRLCREGGAELIYFLMAKAVPFEGELKSSENVREWTYKDITRLPKAEREEWLKACQEELEALKRRGTFELMDRPADRKVIKNRWVFDI # KSDGRKKARLVVKGFSQIEGLDYDQVFSPVVRFETVRLLLALTALNNWYLTGLDVRNAYLYGVLHETIYMEQPEGFRIKGKEDKVLLLRKALYGLKQA # GLVWWRTLDSYMKTLGFKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g485 ### # start gene g486 Scaffold_3 AUGUSTUS gene 2147393 2147713 0.69 + . g486 Scaffold_3 AUGUSTUS transcript 2147393 2147713 0.69 + . g486.t1 Scaffold_3 AUGUSTUS start_codon 2147393 2147395 . + 0 transcript_id "g486.t1"; gene_id "g486"; Scaffold_3 AUGUSTUS CDS 2147393 2147713 0.69 + 0 transcript_id "g486.t1"; gene_id "g486"; Scaffold_3 AUGUSTUS stop_codon 2147711 2147713 . + 0 transcript_id "g486.t1"; gene_id "g486"; # protein sequence = [MDSRVNETYSPTFTAVPLACLRIIDIASAFDERVFHHNNPICICLPKRLQSVQLPGLNSSSKLRSLNDTLLVAFSDST # VHAAQYDEDIGPGYEYLVDFDFLLSFSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g486 ### # start gene g487 Scaffold_3 AUGUSTUS gene 2156599 2156955 0.76 - . g487 Scaffold_3 AUGUSTUS transcript 2156599 2156955 0.76 - . g487.t1 Scaffold_3 AUGUSTUS stop_codon 2156599 2156601 . - 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_3 AUGUSTUS CDS 2156599 2156955 0.76 - 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_3 AUGUSTUS start_codon 2156953 2156955 . - 0 transcript_id "g487.t1"; gene_id "g487"; # protein sequence = [MFPTRLLRSSTVNANEIAHFSRLSAEWWNERGEFTFLHKMNPVRMQFIREKLIETAYDEQPEEAVDAKKVEVLAGLDV # LDVGCGGGLLSEVRINLFCLLLLKLIVHRAWLALVLELPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g487 ### # start gene g488 Scaffold_3 AUGUSTUS gene 2158106 2158933 0.84 - . g488 Scaffold_3 AUGUSTUS transcript 2158106 2158933 0.84 - . g488.t1 Scaffold_3 AUGUSTUS stop_codon 2158106 2158108 . - 0 transcript_id "g488.t1"; gene_id "g488"; Scaffold_3 AUGUSTUS CDS 2158106 2158933 0.84 - 0 transcript_id "g488.t1"; gene_id "g488"; Scaffold_3 AUGUSTUS start_codon 2158931 2158933 . - 0 transcript_id "g488.t1"; gene_id "g488"; # protein sequence = [MASGRFDMVVTRAGKDTALAQIVKLVEDAQTSKAPIQAFADKVAGYFVPTVISLGVITFIAWVAISGLSSEDSLPAMF # HRHGSSKLAVCLQMCISVIVVACPCALGLSTPTAIMVGTGMGAKNGILIKGGRALEASKNVKRVVMDKTGTVTVGKLSVVGLCWVPADGAENTELYGG # DPDLNGLCADGVTTRKSIIAMVSATEARSEHPLAKAIAVYGKDLLKEDGSEPDVGIESFESVTGAGVKALITCCGQKYVILIGNTASSPNPPTALLIP # P] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g488 ### # start gene g489 Scaffold_3 AUGUSTUS gene 2161776 2162027 0.59 + . g489 Scaffold_3 AUGUSTUS transcript 2161776 2162027 0.59 + . g489.t1 Scaffold_3 AUGUSTUS start_codon 2161776 2161778 . + 0 transcript_id "g489.t1"; gene_id "g489"; Scaffold_3 AUGUSTUS CDS 2161776 2162027 0.59 + 0 transcript_id "g489.t1"; gene_id "g489"; Scaffold_3 AUGUSTUS stop_codon 2162025 2162027 . + 0 transcript_id "g489.t1"; gene_id "g489"; # protein sequence = [MVHSRTVYTTLFAIAGSASSVLAVPISSSSSSSAPTSSTLAAIATATTSGIGIAPASTSGLVVPFGSVPNSRRSEAVD # VSLTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g489 ### # start gene g490 Scaffold_3 AUGUSTUS gene 2167997 2169163 0.8 - . g490 Scaffold_3 AUGUSTUS transcript 2167997 2169163 0.8 - . g490.t1 Scaffold_3 AUGUSTUS stop_codon 2167997 2167999 . - 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_3 AUGUSTUS CDS 2167997 2169163 0.8 - 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_3 AUGUSTUS start_codon 2169161 2169163 . - 0 transcript_id "g490.t1"; gene_id "g490"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g490 ### # start gene g491 Scaffold_3 AUGUSTUS gene 2182390 2184036 0.46 - . g491 Scaffold_3 AUGUSTUS transcript 2182390 2184036 0.46 - . g491.t1 Scaffold_3 AUGUSTUS stop_codon 2182390 2182392 . - 0 transcript_id "g491.t1"; gene_id "g491"; Scaffold_3 AUGUSTUS CDS 2182390 2184036 0.46 - 0 transcript_id "g491.t1"; gene_id "g491"; Scaffold_3 AUGUSTUS start_codon 2184034 2184036 . - 0 transcript_id "g491.t1"; gene_id "g491"; # protein sequence = [MVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPP # RVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGA # PFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTAGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSW # QATEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLS # QGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNE # GRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRLPSMLGKRTSALPQLVISLVQHSPTSTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g491 ### # start gene g492 Scaffold_3 AUGUSTUS gene 2184856 2185644 0.69 - . g492 Scaffold_3 AUGUSTUS transcript 2184856 2185644 0.69 - . g492.t1 Scaffold_3 AUGUSTUS stop_codon 2184856 2184858 . - 0 transcript_id "g492.t1"; gene_id "g492"; Scaffold_3 AUGUSTUS CDS 2184856 2185644 0.69 - 0 transcript_id "g492.t1"; gene_id "g492"; Scaffold_3 AUGUSTUS start_codon 2185642 2185644 . - 0 transcript_id "g492.t1"; gene_id "g492"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGMKPPVTSGPQRDVNRRFR # GPLQGPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRV # SPAVSEQSRASSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g492 ### # start gene g493 Scaffold_3 AUGUSTUS gene 2187563 2187979 0.79 + . g493 Scaffold_3 AUGUSTUS transcript 2187563 2187979 0.79 + . g493.t1 Scaffold_3 AUGUSTUS start_codon 2187563 2187565 . + 0 transcript_id "g493.t1"; gene_id "g493"; Scaffold_3 AUGUSTUS CDS 2187563 2187979 0.79 + 0 transcript_id "g493.t1"; gene_id "g493"; Scaffold_3 AUGUSTUS stop_codon 2187977 2187979 . + 0 transcript_id "g493.t1"; gene_id "g493"; # protein sequence = [MELHYTSGYHPEANGQTERVDQTLEQYIRIYCSYQQDDWSHILPVAEFTYNNAPNASTGITPFFANKGYHPNITVQPE # VDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSKVFVLAKHI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g493 ### # start gene g494 Scaffold_3 AUGUSTUS gene 2190820 2191152 0.93 - . g494 Scaffold_3 AUGUSTUS transcript 2190820 2191152 0.93 - . g494.t1 Scaffold_3 AUGUSTUS stop_codon 2190820 2190822 . - 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_3 AUGUSTUS CDS 2190820 2191152 0.93 - 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_3 AUGUSTUS start_codon 2191150 2191152 . - 0 transcript_id "g494.t1"; gene_id "g494"; # protein sequence = [MPPRTQAQFRANSEENTFFTTAQSFAPFSESISALGQPRHRNRGSGPATVPTMSIVPEAMEEEEQFEYSTLYTGDGQP # VQVLTPRCGQPPWLLRLGPGLLLELILPFSKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g494 ### # start gene g495 Scaffold_3 AUGUSTUS gene 2197626 2198218 0.49 + . g495 Scaffold_3 AUGUSTUS transcript 2197626 2198218 0.49 + . g495.t1 Scaffold_3 AUGUSTUS start_codon 2197626 2197628 . + 0 transcript_id "g495.t1"; gene_id "g495"; Scaffold_3 AUGUSTUS CDS 2197626 2197674 0.49 + 0 transcript_id "g495.t1"; gene_id "g495"; Scaffold_3 AUGUSTUS CDS 2197737 2198218 0.65 + 2 transcript_id "g495.t1"; gene_id "g495"; Scaffold_3 AUGUSTUS stop_codon 2198216 2198218 . + 0 transcript_id "g495.t1"; gene_id "g495"; # protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTARELFLRSILDLQNAGEDPIVVLEALKSAEPNRRAIT # LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGASSPVGDQFLWSWISL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g495 ### # start gene g496 Scaffold_3 AUGUSTUS gene 2201668 2202777 0.6 - . g496 Scaffold_3 AUGUSTUS transcript 2201668 2202777 0.6 - . g496.t1 Scaffold_3 AUGUSTUS stop_codon 2201668 2201670 . - 0 transcript_id "g496.t1"; gene_id "g496"; Scaffold_3 AUGUSTUS CDS 2201668 2202777 0.6 - 0 transcript_id "g496.t1"; gene_id "g496"; Scaffold_3 AUGUSTUS start_codon 2202775 2202777 . - 0 transcript_id "g496.t1"; gene_id "g496"; # protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE # VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDI # VESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIR # RTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g496 ### # start gene g497 Scaffold_3 AUGUSTUS gene 2202948 2204933 0.77 - . g497 Scaffold_3 AUGUSTUS transcript 2202948 2204933 0.77 - . g497.t1 Scaffold_3 AUGUSTUS stop_codon 2202948 2202950 . - 0 transcript_id "g497.t1"; gene_id "g497"; Scaffold_3 AUGUSTUS CDS 2202948 2204933 0.77 - 0 transcript_id "g497.t1"; gene_id "g497"; Scaffold_3 AUGUSTUS start_codon 2204931 2204933 . - 0 transcript_id "g497.t1"; gene_id "g497"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY # ILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIA # QVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQI # DPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHG # PDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKD # ATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRILINLINHN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g497 ### # start gene g498 Scaffold_3 AUGUSTUS gene 2205237 2205676 0.51 - . g498 Scaffold_3 AUGUSTUS transcript 2205237 2205676 0.51 - . g498.t1 Scaffold_3 AUGUSTUS stop_codon 2205237 2205239 . - 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_3 AUGUSTUS CDS 2205237 2205597 0.54 - 1 transcript_id "g498.t1"; gene_id "g498"; Scaffold_3 AUGUSTUS CDS 2205654 2205676 0.76 - 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_3 AUGUSTUS start_codon 2205674 2205676 . - 0 transcript_id "g498.t1"; gene_id "g498"; # protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY # ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSIFNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g498 ### # start gene g499 Scaffold_3 AUGUSTUS gene 2206002 2207458 0.49 - . g499 Scaffold_3 AUGUSTUS transcript 2206002 2207458 0.49 - . g499.t1 Scaffold_3 AUGUSTUS stop_codon 2206002 2206004 . - 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_3 AUGUSTUS CDS 2206002 2206662 0.53 - 1 transcript_id "g499.t1"; gene_id "g499"; Scaffold_3 AUGUSTUS CDS 2206772 2206806 0.53 - 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_3 AUGUSTUS CDS 2206856 2207458 0.53 - 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_3 AUGUSTUS start_codon 2207456 2207458 . - 0 transcript_id "g499.t1"; gene_id "g499"; # protein sequence = [MKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVYIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLK # KPSVTIEDVDESDDEDAIKLIPSSRPTNQMNSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD # LSTEELAALSPAIRKIIMRKIRNRRMEKLKFWTNLLGAKRHCGKFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEE # IESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEI # TISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGKDDSKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g499 ### # start gene g500 Scaffold_3 AUGUSTUS gene 2208268 2208909 0.58 - . g500 Scaffold_3 AUGUSTUS transcript 2208268 2208909 0.58 - . g500.t1 Scaffold_3 AUGUSTUS stop_codon 2208268 2208270 . - 0 transcript_id "g500.t1"; gene_id "g500"; Scaffold_3 AUGUSTUS CDS 2208268 2208909 0.58 - 0 transcript_id "g500.t1"; gene_id "g500"; Scaffold_3 AUGUSTUS start_codon 2208907 2208909 . - 0 transcript_id "g500.t1"; gene_id "g500"; # protein sequence = [MSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLAWLSAED # INLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDKPEYEVEEILDSRVRWKKLEYLVK # WKGYDAGHNSWEPAANLSQAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g500 ### # start gene g501 Scaffold_3 AUGUSTUS gene 2211142 2212440 0.94 - . g501 Scaffold_3 AUGUSTUS transcript 2211142 2212440 0.94 - . g501.t1 Scaffold_3 AUGUSTUS stop_codon 2211142 2211144 . - 0 transcript_id "g501.t1"; gene_id "g501"; Scaffold_3 AUGUSTUS CDS 2211142 2212440 0.94 - 0 transcript_id "g501.t1"; gene_id "g501"; Scaffold_3 AUGUSTUS start_codon 2212438 2212440 . - 0 transcript_id "g501.t1"; gene_id "g501"; # protein sequence = [MPPRTRAQSRGNSEENTFFTTAQSFAPFSESISAIGQPHCHNRSFSPATVPTMSTLPETMEEDQQFKYSTLYTGDGQP # VQVLTPRRGQPPVVAPAQGRSITRIDFPILQAIARHTGKQPQRCATSQSPHDPPPHFDLDAGDHDNQDPPVEPEDPGADNNNPDNNNLDDDSGGLPCG # EPGGPGGPHSPISPDIPNEQRAMLELLLGFKGSIETLGSVLATLGQPSDSSESKSKVKEPEVFDGSDPQKLKTFFVNLALVFNDCPKYFTDQRKVNYT # LSYLSGSAKEWFIPDILDPDLNSLLPWMSSFKALVKELQDNFGVYNAQGKAEDSLGNLKMKETKNIGKYNIRFNTLAASTNWDSAALKWAYGRGLAEH # IKDEMACLPELATLANYHQEVLRIDNRYWKRKETKKREEGRETSALHGTSADTPKFWLDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g501 ### # start gene g502 Scaffold_3 AUGUSTUS gene 2215273 2215662 0.92 + . g502 Scaffold_3 AUGUSTUS transcript 2215273 2215662 0.92 + . g502.t1 Scaffold_3 AUGUSTUS start_codon 2215273 2215275 . + 0 transcript_id "g502.t1"; gene_id "g502"; Scaffold_3 AUGUSTUS CDS 2215273 2215662 0.92 + 0 transcript_id "g502.t1"; gene_id "g502"; Scaffold_3 AUGUSTUS stop_codon 2215660 2215662 . + 0 transcript_id "g502.t1"; gene_id "g502"; # protein sequence = [MSIQQLLDQRTEARPFKPFPPSPARISIRPPSTDLQAKRHAALKSLFDFSEALSIEIPDQTLTEEEALSFLQQLDQAE # EDVIPSPTNISPGPYFFPVCWNCKLTLFVSDSAEIPSGALDESSISTLNGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g502 ### # start gene g503 Scaffold_3 AUGUSTUS gene 2223495 2225060 0.25 - . g503 Scaffold_3 AUGUSTUS transcript 2223495 2225060 0.25 - . g503.t1 Scaffold_3 AUGUSTUS stop_codon 2223495 2223497 . - 0 transcript_id "g503.t1"; gene_id "g503"; Scaffold_3 AUGUSTUS CDS 2223495 2224304 0.6 - 0 transcript_id "g503.t1"; gene_id "g503"; Scaffold_3 AUGUSTUS CDS 2224398 2225060 0.25 - 0 transcript_id "g503.t1"; gene_id "g503"; Scaffold_3 AUGUSTUS start_codon 2225058 2225060 . - 0 transcript_id "g503.t1"; gene_id "g503"; # protein sequence = [MSIPEITFDLFKRAVLPVVEDYSVEEAHQKLRGRGFLIDEGWKEINFGVGEQEQEQEQEVEELKVKMEIEVEDVDVEK # EKKESLFYAPLFEGLNSIMGADSAVKFSDNPGKHLLSEDDHSHYKADINGLLTKTTAVPPITEGAEYECDVLMTGELNKKSTPDTVDDVGKNHSVRAS # DMLISCRITRKFYLMRHILWVLIPHVDYVWLNDRWVQCSTMVLLPDAKNLIYFALSLSGACPEELGYDPTVRRVHGKDGTGPRYIFTIDSKQYITTEA # ITVRKAKFLLGCASRLFKVQQVLDDEGDLDSEVKVIKDYWLPEDSCTELETRLAIEANIQKVNAVPNLDRSAFDRYFVKIEACEKVPVPSTTEKGLTP # DSTSNFLRGQTLPSDVKRFTVSAQSSTYQRVMSVSISDSIMMESGPERERRQETVLREATAVHLARLDRRIYAPKVHCRQLSEFAGEPLDQMTNWDIV # LKALESLIIGEPCSSSSGST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g503 ### # start gene g504 Scaffold_3 AUGUSTUS gene 2231569 2232105 0.52 - . g504 Scaffold_3 AUGUSTUS transcript 2231569 2232105 0.52 - . g504.t1 Scaffold_3 AUGUSTUS stop_codon 2231569 2231571 . - 0 transcript_id "g504.t1"; gene_id "g504"; Scaffold_3 AUGUSTUS CDS 2231569 2232105 0.52 - 0 transcript_id "g504.t1"; gene_id "g504"; Scaffold_3 AUGUSTUS start_codon 2232103 2232105 . - 0 transcript_id "g504.t1"; gene_id "g504"; # protein sequence = [MFGAGDEHHGASRDWYATEDDSQVQLPTKVEGLSKEALDGDSVVQISGGEHHSLFLTQSGKVFAVGRCNAGQIGLADD # DPALEDRADPDFVADPVQVKFPDDDDPIVRISVGTHNNLAVSKDGALYCWGQGTQGELGVSDVEVRTPRMIVRREGGSWAAIKVACGGQHTLGLFRKN # RR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g504 ### # start gene g505 Scaffold_3 AUGUSTUS gene 2233093 2233383 0.44 - . g505 Scaffold_3 AUGUSTUS transcript 2233093 2233383 0.44 - . g505.t1 Scaffold_3 AUGUSTUS stop_codon 2233093 2233095 . - 0 transcript_id "g505.t1"; gene_id "g505"; Scaffold_3 AUGUSTUS CDS 2233093 2233383 0.44 - 0 transcript_id "g505.t1"; gene_id "g505"; Scaffold_3 AUGUSTUS start_codon 2233381 2233383 . - 0 transcript_id "g505.t1"; gene_id "g505"; # protein sequence = [MEPRRSSRAASAKPASKVAPKPAPKKATSEKPPSRPSRTAASKKRAASPERDPSPPPKRAKGEEQNMLPLKRNPTPKL # QENLPLRTQNDLAQNSLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g505 ### # start gene g506 Scaffold_3 AUGUSTUS gene 2236705 2236932 0.46 - . g506 Scaffold_3 AUGUSTUS transcript 2236705 2236932 0.46 - . g506.t1 Scaffold_3 AUGUSTUS stop_codon 2236705 2236707 . - 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_3 AUGUSTUS CDS 2236705 2236932 0.46 - 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_3 AUGUSTUS start_codon 2236930 2236932 . - 0 transcript_id "g506.t1"; gene_id "g506"; # protein sequence = [MYESQLAQLAQQTFNMESAALTTENMRNTMATVDALQASNKEIKKQYGKINIDKIEVRERLYPLNLRLIVANFRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g506 ### # start gene g507 Scaffold_3 AUGUSTUS gene 2238517 2239167 0.57 - . g507 Scaffold_3 AUGUSTUS transcript 2238517 2239167 0.57 - . g507.t1 Scaffold_3 AUGUSTUS stop_codon 2238517 2238519 . - 0 transcript_id "g507.t1"; gene_id "g507"; Scaffold_3 AUGUSTUS CDS 2238517 2239167 0.57 - 0 transcript_id "g507.t1"; gene_id "g507"; Scaffold_3 AUGUSTUS start_codon 2239165 2239167 . - 0 transcript_id "g507.t1"; gene_id "g507"; # protein sequence = [MAVNPIPSSTSSTDSAESGPEPPYARPNPKSYHVYHDPAPLQLTYSSQLPSFDVAYETWGKLSPKKDNAILLHTGLSA # SSHAASTALNSAPGWWEKFIGPGKALDTNQFFIICTNVIGGCYGSTGPSSIDPTSGTHYATNFPILSIFDMVRAQFRLLDHLEIDKLYASVGSSMGGM # QSLAAGWLHPERVGKIVSISGTARSSPSAVAMRYAQRSGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g507 ### # start gene g508 Scaffold_3 AUGUSTUS gene 2248372 2248887 0.62 - . g508 Scaffold_3 AUGUSTUS transcript 2248372 2248887 0.62 - . g508.t1 Scaffold_3 AUGUSTUS stop_codon 2248372 2248374 . - 0 transcript_id "g508.t1"; gene_id "g508"; Scaffold_3 AUGUSTUS CDS 2248372 2248887 0.62 - 0 transcript_id "g508.t1"; gene_id "g508"; Scaffold_3 AUGUSTUS start_codon 2248885 2248887 . - 0 transcript_id "g508.t1"; gene_id "g508"; # protein sequence = [MSKFPYVTYASEVPRTPKGPLEGPQRVCKQRATEANPSIRLRELEDFVRLHQAAFKVALAELFHIDDPDDPIDWSKEL # AVFEFDSTSDPNPARRFRLKDAFLTPDMPVGTRDGDRIATYRRTTYASHTEVPMPEGYINYVLCLCEIPLHEGPTHVLIGVCQVIAQTANVSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g508 ### # start gene g509 Scaffold_3 AUGUSTUS gene 2251117 2251473 0.43 - . g509 Scaffold_3 AUGUSTUS transcript 2251117 2251473 0.43 - . g509.t1 Scaffold_3 AUGUSTUS stop_codon 2251117 2251119 . - 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_3 AUGUSTUS CDS 2251117 2251473 0.43 - 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_3 AUGUSTUS start_codon 2251471 2251473 . - 0 transcript_id "g509.t1"; gene_id "g509"; # protein sequence = [MVTPSGQRIERLPTWIKRVTQDLSVSPVYDARFWNPPESQKYKFKNTRPPKPKDAKIYEAHVGISTSESRVGTYKEFT # QNILPRIQKLGYNIIQMMAVMEHAYYACEAVRSPVVALKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g509 ### # start gene g510 Scaffold_3 AUGUSTUS gene 2260445 2260971 0.37 + . g510 Scaffold_3 AUGUSTUS transcript 2260445 2260971 0.37 + . g510.t1 Scaffold_3 AUGUSTUS start_codon 2260445 2260447 . + 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_3 AUGUSTUS CDS 2260445 2260596 0.54 + 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_3 AUGUSTUS CDS 2260653 2260971 0.37 + 1 transcript_id "g510.t1"; gene_id "g510"; Scaffold_3 AUGUSTUS stop_codon 2260969 2260971 . + 0 transcript_id "g510.t1"; gene_id "g510"; # protein sequence = [MSLYFYEPSYNWDRLFDEAFSSRASRGGQSQGQSQALTQNSDTTQRFFKPKMDLHEDKEKNLVTASFEFPGVKKEDVQ # VDVHNGRLTVAAETKLSDDREQDGYAVRERSFGKYSRTLQLPKGVKVGDQFFEFLEHGLCTDFRYRKRKSKPQWRMVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g510 ### # start gene g511 Scaffold_3 AUGUSTUS gene 2265405 2266034 0.84 + . g511 Scaffold_3 AUGUSTUS transcript 2265405 2266034 0.84 + . g511.t1 Scaffold_3 AUGUSTUS start_codon 2265405 2265407 . + 0 transcript_id "g511.t1"; gene_id "g511"; Scaffold_3 AUGUSTUS CDS 2265405 2266034 0.84 + 0 transcript_id "g511.t1"; gene_id "g511"; Scaffold_3 AUGUSTUS stop_codon 2266032 2266034 . + 0 transcript_id "g511.t1"; gene_id "g511"; # protein sequence = [MLRELDKLGRLNVQNFPGLEYFLRYTIEWTEWAKDELVNHLHLRSDILPHLGVCKAIAYRLFKDQTVEDHTLHLARIR # EWVQWLEPRATEEDHDYAGTKGWVQDWLIQEWPSLLLGVNPWYLAGEDDNSLLKDPRLDLALEWDSFSIYRQENPLVPPKGLSWEFKDWSKEDRDAHR # DGTVFEIPSSGDGDGNGSDKESMGWGMEHSFWQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g511 ### # start gene g512 Scaffold_3 AUGUSTUS gene 2267917 2268387 0.48 - . g512 Scaffold_3 AUGUSTUS transcript 2267917 2268387 0.48 - . g512.t1 Scaffold_3 AUGUSTUS stop_codon 2267917 2267919 . - 0 transcript_id "g512.t1"; gene_id "g512"; Scaffold_3 AUGUSTUS CDS 2267917 2268387 0.48 - 0 transcript_id "g512.t1"; gene_id "g512"; Scaffold_3 AUGUSTUS start_codon 2268385 2268387 . - 0 transcript_id "g512.t1"; gene_id "g512"; # protein sequence = [MLTNNAVSAAVGLIPFAGDVVLAAFKANSRNAALLEEFLRIRGEEFMKLGVAGSAAAADKNQTKGKGKMVAHGVSKTD # AEQVKPGAGIEAGAIPGGTTVIVSDSKQAPTRTPGSGKSGKSVGRKGFGSFFAKSGKLPAPGEKGRFVENVDGGQHQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g512 ### # start gene g513 Scaffold_3 AUGUSTUS gene 2283341 2283955 0.48 + . g513 Scaffold_3 AUGUSTUS transcript 2283341 2283955 0.48 + . g513.t1 Scaffold_3 AUGUSTUS start_codon 2283341 2283343 . + 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_3 AUGUSTUS CDS 2283341 2283955 0.48 + 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_3 AUGUSTUS stop_codon 2283953 2283955 . + 0 transcript_id "g513.t1"; gene_id "g513"; # protein sequence = [MDDDLTFGASVWGADVPSPFPPTKLKPPTLSLEDDFISTPNGDDGFDDFEDFGPTETVAGDDDDFGDFGDAIEDIAVT # PADFPETPVAGPSKSQISTQWEPLRLDPFPDRQQLERDIDEILEPVWDDEEAQEQVFTKDGIREIEGVNQILVTNERYVKTLFQSFLSRDLGSAVENC # TKCFSERPQQPNLRTGHDLEYEGNILSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g513 ### # start gene g514 Scaffold_3 AUGUSTUS gene 2284039 2284500 0.45 + . g514 Scaffold_3 AUGUSTUS transcript 2284039 2284500 0.45 + . g514.t1 Scaffold_3 AUGUSTUS start_codon 2284039 2284041 . + 0 transcript_id "g514.t1"; gene_id "g514"; Scaffold_3 AUGUSTUS CDS 2284039 2284500 0.45 + 0 transcript_id "g514.t1"; gene_id "g514"; Scaffold_3 AUGUSTUS stop_codon 2284498 2284500 . + 0 transcript_id "g514.t1"; gene_id "g514"; # protein sequence = [MSAPPGPRNVPVSAVIPSSASHSRAGSRAPSRTGSPHPSNSARPNQSHFGPRPVLDETKISELLDLDMGKTAFDLNLE # IEANERSRGSDTGAARSSRATARRIPHPDGHYEYTAHFLTANAGRSAARFRDIQWPHCGACWGSAEDKIREEITS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g514 ### # start gene g515 Scaffold_3 AUGUSTUS gene 2286203 2289500 0.13 + . g515 Scaffold_3 AUGUSTUS transcript 2286203 2289500 0.13 + . g515.t1 Scaffold_3 AUGUSTUS start_codon 2286203 2286205 . + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_3 AUGUSTUS CDS 2286203 2286898 0.48 + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_3 AUGUSTUS CDS 2286951 2287176 0.55 + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_3 AUGUSTUS CDS 2287257 2287488 0.63 + 2 transcript_id "g515.t1"; gene_id "g515"; Scaffold_3 AUGUSTUS CDS 2287695 2288049 0.42 + 1 transcript_id "g515.t1"; gene_id "g515"; Scaffold_3 AUGUSTUS CDS 2288214 2289500 0.67 + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_3 AUGUSTUS stop_codon 2289498 2289500 . + 0 transcript_id "g515.t1"; gene_id "g515"; # protein sequence = [MDNEDAEMSDAPDSEGEGDSLDEEDEEDENEDAVNEDQPKDSDGKPLPRAANGKIKTKRGRNERVVAPEECRAHLRRL # FRNERVICALLYGKHGCYAKLTSEELSEASADMFFLDVITVAPTRFRPPAKMNEVLFEHPQNDLLARVLNTSYRLRDFNDDLRAASQKGADYDEKKRQ # KVMEQLLATLIQLQVDVNSFMDSSKNPQVVRQGKLPPAGVKQGLEKKEGLFRKHMMGKRVNYAARSVISPDVNIEPNEIGVPPVFAKKLTFPEPVTPA # NFHEMRARVINGPRGYPGATMVEYEDGTQISLVPIANQLLKPQEDKGATLGGRRGLYTRTPAINKKVYRHLRDGDILILNRQPTLHKPSMMAHKARVL # QGEKTIRMHYANXDEHTLSFVSLFYLFQPIALAEPFSTENQVARAEAEMIANTDNQYLVPTSGNPLRGLIQDHVVAGVWMTSQGALFSREEYFQLLYG # ALKPEEEGVDGHRLVTLPPAIWKPKPLWTGKQIVVFMDGELLCGVLDKAAFGASDFGIVHSVYELYGADIAGKLLGILSRLFTKFLQHRAFTCRMDDL # MLTPEGDQKRTEILQEGKNLGTKGAIENFPSLDNLPPHEVPQALKVLLQEVLRDDNKMAGLDMTVKSGLSKLTTSIEKAVMPSGLLRRFPHNHMQAMT # LSGAKGSAVNARQISCALGQQELEGRRVPVMVSGKTLPSFKPFETKAMAGGYVASRFLTGVKPQEFYFHCMAGREGLIDTAVKTSRSGYLQRCLIKHL # EGIRVHYDNTVRGSDSSVYQFQYGGDSLDVTKQKHIRQFEFIARNEKSFVNKLRPKSILPFVAGDDGTVYMKSVIKRKPAKRYGMDPCLALYSPSRYL # GSTSEAFADALKHYTKKNPDRLIKGDFEEMWSTRKTPLSAGTFRMLMHVKYMRSLVEPGEAVGLLASQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g515 ### # start gene g516 Scaffold_3 AUGUSTUS gene 2289637 2290704 0.38 + . g516 Scaffold_3 AUGUSTUS transcript 2289637 2290704 0.38 + . g516.t1 Scaffold_3 AUGUSTUS start_codon 2289637 2289639 . + 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_3 AUGUSTUS CDS 2289637 2290704 0.38 + 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_3 AUGUSTUS stop_codon 2290702 2290704 . + 0 transcript_id "g516.t1"; gene_id "g516"; # protein sequence = [MELMELKIGHGAANVTLGIPRLREIVMTASQKPKTPSMNMRIRTGIPQEDIDVFCKRASKLTLSQLVENVTVTEQLQA # EGDSRRMQYTVCINLFPREEYEAVHDVEPDEILNAFAVKYPLMLKKEMTAEMKKLDDDLKSQIAQLGKGKKERGDRGEPADTGDGDEEGASGTKRRND # DEESEIGDGDADDEKRARQKKEQATYEDDSEDEDEEMGAYDDDELEAELADGEENEGLQQDPTDVKRVSQSFKNRVKLVGDSFQRNFTQAVSFAFNET # QCTFQLDVSHANICWAVQKFNKCFQCQLASDMPKLLFVGIIERTCRSTVIREIPGITDCFQNKEEGKKGEESVVKVSLISR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g516 ### # start gene g517 Scaffold_3 AUGUSTUS gene 2292117 2292599 0.68 + . g517 Scaffold_3 AUGUSTUS transcript 2292117 2292599 0.68 + . g517.t1 Scaffold_3 AUGUSTUS start_codon 2292117 2292119 . + 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_3 AUGUSTUS CDS 2292117 2292599 0.68 + 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_3 AUGUSTUS stop_codon 2292597 2292599 . + 0 transcript_id "g517.t1"; gene_id "g517"; # protein sequence = [MSSAPAPFTLLSRELPPPSDPQSIHYPGFVVHQDAHITVLNPTAVESLMKDCKERDEWKENLAPRKKMKKVVIDSVDS # KPMLMTPEAKKLEMEQLIKAKSTPATPRKTAAKEWQEDTSPTPRRTGLRFQAGTPAISEEEKRQRRRMLKDEVEADRMDEDM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g517 ### # start gene g518 Scaffold_3 AUGUSTUS gene 2296661 2296999 0.97 + . g518 Scaffold_3 AUGUSTUS transcript 2296661 2296999 0.97 + . g518.t1 Scaffold_3 AUGUSTUS start_codon 2296661 2296663 . + 0 transcript_id "g518.t1"; gene_id "g518"; Scaffold_3 AUGUSTUS CDS 2296661 2296999 0.97 + 0 transcript_id "g518.t1"; gene_id "g518"; Scaffold_3 AUGUSTUS stop_codon 2296997 2296999 . + 0 transcript_id "g518.t1"; gene_id "g518"; # protein sequence = [MFISPQSSYVILAFIQPADFNSTGPELVNASTSRNNFNLTTFGEAVNLGAPIAGTYFLTGPSSNSSASSTSPASSTSS # AATSSGVGRSLKARGIGLKATWGLTLGLVMYALS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g518 ### # start gene g519 Scaffold_3 AUGUSTUS gene 2302919 2303227 0.66 + . g519 Scaffold_3 AUGUSTUS transcript 2302919 2303227 0.66 + . g519.t1 Scaffold_3 AUGUSTUS start_codon 2302919 2302921 . + 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_3 AUGUSTUS CDS 2302919 2303227 0.66 + 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_3 AUGUSTUS stop_codon 2303225 2303227 . + 0 transcript_id "g519.t1"; gene_id "g519"; # protein sequence = [MTRMLEQEINSLSTPPNQQNNLEEFYSRLSKIREHHSKYPDSVTGGFELELASLLEEPTQDDDDYEDEDRTLDNCSTV # SMTLNVLLQLFLYYFLRRGLWKVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g519 ### # start gene g520 Scaffold_3 AUGUSTUS gene 2309323 2310176 0.16 - . g520 Scaffold_3 AUGUSTUS transcript 2309323 2310176 0.16 - . g520.t1 Scaffold_3 AUGUSTUS stop_codon 2309323 2309325 . - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_3 AUGUSTUS CDS 2309323 2309619 0.45 - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_3 AUGUSTUS CDS 2309798 2309955 0.68 - 2 transcript_id "g520.t1"; gene_id "g520"; Scaffold_3 AUGUSTUS CDS 2310092 2310176 0.33 - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_3 AUGUSTUS start_codon 2310174 2310176 . - 0 transcript_id "g520.t1"; gene_id "g520"; # protein sequence = [MIPQEASQILVPWNFEILIGFEQPTLISVEDPQSDSSTDNITVTLDEKSSVQAITLDTVVEPEGANLSVGQRALLSIA # RALGFSYKSLQRYPVDMSFAFKDRLQTIISYDRILVMDQGTVAVSIFSFAATSSCVTVFDYAQEFDTPLSLFQKTDGIFRSLCEKGGISLDDIVRSDR # NAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g520 ### # start gene g521 Scaffold_3 AUGUSTUS gene 2325900 2327087 0.7 + . g521 Scaffold_3 AUGUSTUS transcript 2325900 2327087 0.7 + . g521.t1 Scaffold_3 AUGUSTUS start_codon 2325900 2325902 . + 0 transcript_id "g521.t1"; gene_id "g521"; Scaffold_3 AUGUSTUS CDS 2325900 2327087 0.7 + 0 transcript_id "g521.t1"; gene_id "g521"; Scaffold_3 AUGUSTUS stop_codon 2327085 2327087 . + 0 transcript_id "g521.t1"; gene_id "g521"; # protein sequence = [MDMVDEERDSREVDVKGKGKETDDLIRSRTSSKGKESDHSSASGHKSSSANHHHRQHSTRHQTVKPKTSSITNIRSVK # HGSFDFERPGWGLGASTVTRSLSGTSGNSGVTGFSRGRYSNRSGESVESASRSNNQELEKKKTTDLKSKSSSKREEYKSQKRNAPAIDDPAPPYSPTP # ASTDPGSGRGLSSSLGRSAGKRTGIARLIGLGGYTAHGAFSFEPPVPSPISPTFSHASQESNADSGRREEKEREKEQRRVKEEEKEKERVKNNHRYSE # QDTLGVSSFSGASRNPGRKGRSLDLGIGLSWAPTRVREDVLLPGGRFANGRGLNGRISESTSSRNGLRADRARAVDEFGVEERSKVGRDVAEMFKKAL # DPEGYRAFKKCEPSLYLAAAFFC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g521 ### # start gene g522 Scaffold_3 AUGUSTUS gene 2327972 2328247 0.63 - . g522 Scaffold_3 AUGUSTUS transcript 2327972 2328247 0.63 - . g522.t1 Scaffold_3 AUGUSTUS stop_codon 2327972 2327974 . - 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_3 AUGUSTUS CDS 2327972 2328247 0.63 - 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_3 AUGUSTUS start_codon 2328245 2328247 . - 0 transcript_id "g522.t1"; gene_id "g522"; # protein sequence = [MDKFESQFADLDVQTSYMEDTMSATTATSTPQDQIDQLLKQTAEEANIELQHDLAAKDLDNVPDLAAPKDKIGEEDDK # LAERLRALRPATQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g522 ### # start gene g523 Scaffold_3 AUGUSTUS gene 2331416 2332905 0.35 + . g523 Scaffold_3 AUGUSTUS transcript 2331416 2332905 0.35 + . g523.t1 Scaffold_3 AUGUSTUS start_codon 2331416 2331418 . + 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_3 AUGUSTUS CDS 2331416 2332108 0.4 + 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_3 AUGUSTUS CDS 2332219 2332905 0.87 + 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_3 AUGUSTUS stop_codon 2332903 2332905 . + 0 transcript_id "g523.t1"; gene_id "g523"; # protein sequence = [MDEHNVPSQSRSSTPELPTRPSTPVEPDQMYGCSMVLISCLSQLMSSRSFPSTPVRLHSSLTRSRPLLQVTRTHSGSY # IANGRPTPDPPEPADRDIHHGLSLIMGNALSDNECHSPIINRPSGLVTPGLTPARTVSSHGSIYSQTVSSAILPDPSKLIVVLKYIDGQRVCSYHGRE # KHLRAVEATQASDIDNLNSQIQSLREMNIDNKERVTTLLAETSTLQAALAQSTQRDTNTTLEARTQDLNSAQLVAAKLENDLAAMISQLDNREVELTS # QLVAVKRSMEDTSSTLQQKITELSNLHEDLRKAQKSITAYQEELEAHTAAHVAEIGECSATIDSFASLSSADTTTVDLRSKIDLLTETCTQLQSKLEQ # AASDRSRLGEELQLNVFTLQLLKGNLIELSWIHEFSKRTRNGRESLRSEDAATIMKLRNTIERIIHCFRWNSGRELLKRYVIFFSVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g523 ### # start gene g524 Scaffold_3 AUGUSTUS gene 2341164 2341649 1 + . g524 Scaffold_3 AUGUSTUS transcript 2341164 2341649 1 + . g524.t1 Scaffold_3 AUGUSTUS start_codon 2341164 2341166 . + 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_3 AUGUSTUS CDS 2341164 2341649 1 + 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_3 AUGUSTUS stop_codon 2341647 2341649 . + 0 transcript_id "g524.t1"; gene_id "g524"; # protein sequence = [MSSLPSARGAVTDPIERDRKEQDVERKLRLYTTVNALRESKLPANKQLDGWLDVLQQNLGSDGHSKFSDLSSLSVLTI # HSGQKLSRQGQKLTTDLRDILDTVRLMLKNKNGDELLQDVIWNTRDIESPNSIKGEDLANDSHVLGVNKNKAQEDAQQGASYK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g524 ### # start gene g525 Scaffold_3 AUGUSTUS gene 2342780 2344468 0.1 + . g525 Scaffold_3 AUGUSTUS transcript 2342780 2344468 0.1 + . g525.t1 Scaffold_3 AUGUSTUS start_codon 2342780 2342782 . + 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_3 AUGUSTUS CDS 2342780 2342902 0.37 + 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_3 AUGUSTUS CDS 2343145 2343354 0.61 + 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_3 AUGUSTUS CDS 2343429 2343709 0.66 + 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_3 AUGUSTUS CDS 2343863 2344232 0.48 + 1 transcript_id "g525.t1"; gene_id "g525"; Scaffold_3 AUGUSTUS CDS 2344292 2344468 0.91 + 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_3 AUGUSTUS stop_codon 2344466 2344468 . + 0 transcript_id "g525.t1"; gene_id "g525"; # protein sequence = [MFIGRSMEEDIWDPINALIDDAQRDQEFKQWWNEVDEWLEKAGTTDFHSTAANSGSSYVPYQVGDVNATAAGPTSTAQ # PTSTNQRSANTQPATRGKYREHFDNVFEGIGKFQIPCRFGTDIQRLTKDLLFDSEGKLTFKAELWNDVRNTIVPGLIQRVCIIIVSHALSSITFRFQI # GLVPIPRIEYTDDSLDLVLENLTLSAQNLHSLHLHLSHIQTDMRDVAFYFRKKSGLPKLKDSGLADVLLGGDGLSVRSLNDVLLKFGLTIKFSQATIH # LESSSDPTTLYDIKNITVKVDTLKFAIRDSKHDLLYKTLKPLATGLIKKQIQKAVADGMRTGLEWLGEELIAVKDRMHEAREGANEEEEVGRFKAMQE # VRNDVDAIREVSCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g525 ### # start gene g526 Scaffold_3 AUGUSTUS gene 2347422 2347793 0.99 + . g526 Scaffold_3 AUGUSTUS transcript 2347422 2347793 0.99 + . g526.t1 Scaffold_3 AUGUSTUS start_codon 2347422 2347424 . + 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_3 AUGUSTUS CDS 2347422 2347793 0.99 + 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_3 AUGUSTUS stop_codon 2347791 2347793 . + 0 transcript_id "g526.t1"; gene_id "g526"; # protein sequence = [MTRTARATYPRAALKDRSQSRSGMDKSLKKDGAGRGNWGKLGEAGYDDDDEYDEESYEAETANLDASETGSEGSIFIA # TFSSPNSRACLRSASSTLEPKHSVSDQKEVEAARAFRKRALSGTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g526 ### # start gene g527 Scaffold_3 AUGUSTUS gene 2356232 2356618 0.56 + . g527 Scaffold_3 AUGUSTUS transcript 2356232 2356618 0.56 + . g527.t1 Scaffold_3 AUGUSTUS start_codon 2356232 2356234 . + 0 transcript_id "g527.t1"; gene_id "g527"; Scaffold_3 AUGUSTUS CDS 2356232 2356618 0.56 + 0 transcript_id "g527.t1"; gene_id "g527"; Scaffold_3 AUGUSTUS stop_codon 2356616 2356618 . + 0 transcript_id "g527.t1"; gene_id "g527"; # protein sequence = [MPAPDDSELEHDQSAGNLEPEVPTDGPTSQQHADQEGKETQIPGSSDSLPPPTTSGFSQPPQPRRSTRIRTPSCVAIE # NRALEEREHGAQANREDWATNSPPTGQTLALIAANPWAFASAMMTCINFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g527 ### # start gene g528 Scaffold_3 AUGUSTUS gene 2371783 2373762 0.34 + . g528 Scaffold_3 AUGUSTUS transcript 2371783 2373762 0.34 + . g528.t1 Scaffold_3 AUGUSTUS start_codon 2371783 2371785 . + 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_3 AUGUSTUS CDS 2371783 2371902 0.99 + 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_3 AUGUSTUS CDS 2372265 2372403 0.46 + 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_3 AUGUSTUS CDS 2372572 2372612 0.39 + 2 transcript_id "g528.t1"; gene_id "g528"; Scaffold_3 AUGUSTUS CDS 2372701 2373762 1 + 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_3 AUGUSTUS stop_codon 2373760 2373762 . + 0 transcript_id "g528.t1"; gene_id "g528"; # protein sequence = [MFLISRLEIEVAYPAAGDNEFQFVRDLIENNEIPDDVAIQTEPEFAVELGNRVLMEWGKASPEDKVYFNLAATVECAP # SNHYADMVSTGVAATELALLAGGVSPGLDFSNLPEIVQVVCRCNESAVPVRYPYAGTLVFSAFAGTHQDAIKKGLDSQAARWEKVDRTGEGIKYWAMP # YIPIDPKDIGYGYENLIRVSSQSGKAGTAYVIKQTLQLDLPRRMQVSFYGVVQSECENSGKEMSTALITNAFKQKYCLSSKPIGRLHLQSLNITPLSP # LSESSSLESDGTSTPPEQGTNLIRFEGHISVDGRIRKIMGDGKGVLSALLDGLRSDLELEINIGEIVSQHLEGDSTKAVTYLEVSTPGSPASKSGVGS # VWGVGISSDSATSQCRAIISGINGLVGDRRFPRPKMVFTPRRDQSAQRSESWLRDFTFRAGHSVLQTPEHERSELIAASPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g528 ### # start gene g529 Scaffold_3 AUGUSTUS gene 2374096 2374634 0.36 - . g529 Scaffold_3 AUGUSTUS transcript 2374096 2374634 0.36 - . g529.t1 Scaffold_3 AUGUSTUS stop_codon 2374096 2374098 . - 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_3 AUGUSTUS CDS 2374096 2374299 0.94 - 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_3 AUGUSTUS CDS 2374415 2374451 0.91 - 1 transcript_id "g529.t1"; gene_id "g529"; Scaffold_3 AUGUSTUS CDS 2374522 2374634 0.41 - 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_3 AUGUSTUS start_codon 2374632 2374634 . - 0 transcript_id "g529.t1"; gene_id "g529"; # protein sequence = [MVLTLRRTSRGVRFDLYRGNVVTNMFHFVPGLLDNFEWADGYVTRFGLTYWFKEHQEESSSSPSGIYKRGTSSLSESS # TKVPGTPEAADAIKIATSKPSKDPSRLKKIKQAVWKLIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g529 ### # start gene g530 Scaffold_3 AUGUSTUS gene 2376283 2376753 0.4 - . g530 Scaffold_3 AUGUSTUS transcript 2376283 2376753 0.4 - . g530.t1 Scaffold_3 AUGUSTUS stop_codon 2376283 2376285 . - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_3 AUGUSTUS CDS 2376283 2376753 0.4 - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_3 AUGUSTUS start_codon 2376751 2376753 . - 0 transcript_id "g530.t1"; gene_id "g530"; # protein sequence = [MASDSLTKLLPKDFIWGFATGKLIFYYLSTYRSQYTLASFQIEGSTDVDGRGKSFWDDFSRTPGKTLDGRNGDVATDS # YKLWKEDVELLAQYGVKSYRFSIAWSRIIPLGGRDDPVNPKGIEFYSKLIDALLEKNIIPFVVRLDFPFHILQLRSLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g530 ### # start gene g531 Scaffold_3 AUGUSTUS gene 2378007 2378387 0.87 + . g531 Scaffold_3 AUGUSTUS transcript 2378007 2378387 0.87 + . g531.t1 Scaffold_3 AUGUSTUS start_codon 2378007 2378009 . + 0 transcript_id "g531.t1"; gene_id "g531"; Scaffold_3 AUGUSTUS CDS 2378007 2378387 0.87 + 0 transcript_id "g531.t1"; gene_id "g531"; Scaffold_3 AUGUSTUS stop_codon 2378385 2378387 . + 0 transcript_id "g531.t1"; gene_id "g531"; # protein sequence = [MTFASPTKSIPAAENLVIAGSKGWLACNSTSEGFKIVVKVVEEKENEKTGEEAEYEEREEIISFPRKGVETELAAFFD # AIGRQGTGESALDIGNPREALKDVAFIQAALNSEGNLIDLLELIQASS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g531 ### # start gene g532 Scaffold_3 AUGUSTUS gene 2381885 2382817 0.69 - . g532 Scaffold_3 AUGUSTUS transcript 2381885 2382817 0.69 - . g532.t1 Scaffold_3 AUGUSTUS stop_codon 2381885 2381887 . - 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_3 AUGUSTUS CDS 2381885 2382529 0.86 - 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_3 AUGUSTUS CDS 2382665 2382817 0.69 - 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_3 AUGUSTUS start_codon 2382815 2382817 . - 0 transcript_id "g532.t1"; gene_id "g532"; # protein sequence = [MSTNVKSSRNPFRNRTITDDTQTQSSSTNEVSSSSVSTRPVTPPASASAPSQTVEYGPRRPFQNAPPPISPSHPQHPL # TANSTGWSTIQNNVIPPPPSQPQSLWQQITGHLADQLTGLSTGSQYDNRHGPYSIPHHSGYSHPSPSPSQSPWTSQQASSSVEPPPLPPRRNASQMSP # TSEFAQEFYAAGTGSPSDNVTEAIRYQPPLGPPPSGSPRTPDDDGRPTKTPVPGHPLLNHGRLLVYPPGFQCEKCASFLPIHTYSLLIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g532 ### # start gene g533 Scaffold_3 AUGUSTUS gene 2383885 2384720 0.3 - . g533 Scaffold_3 AUGUSTUS transcript 2383885 2384720 0.3 - . g533.t1 Scaffold_3 AUGUSTUS stop_codon 2383885 2383887 . - 0 transcript_id "g533.t1"; gene_id "g533"; Scaffold_3 AUGUSTUS CDS 2383885 2384242 0.4 - 1 transcript_id "g533.t1"; gene_id "g533"; Scaffold_3 AUGUSTUS CDS 2384317 2384720 0.73 - 0 transcript_id "g533.t1"; gene_id "g533"; Scaffold_3 AUGUSTUS start_codon 2384718 2384720 . - 0 transcript_id "g533.t1"; gene_id "g533"; # protein sequence = [MVLEKVLKGERPERPLGTNAMTDELWNLINACWKHDRASRPKSGLVVDHLKHILRRSATDPAVLPFVDPLPPPTAYSY # TSPSTARYFTPFSHTLTMYRAPTRTRPLEEQAAVLRSLKRIRRHADPGRMYHELKLTSPLKNYAARIKDTNSRVAIKQLEISELDSNTLTRLADEFND # MRFLHHPNVINYIDLFQHENHVWVVLEDLSNPLYLKKVIVANLNRDAGMKESFITTVLRNYSRSSLPSSTSNKSWEY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g533 ### # start gene g534 Scaffold_3 AUGUSTUS gene 2387841 2388239 0.95 - . g534 Scaffold_3 AUGUSTUS transcript 2387841 2388239 0.95 - . g534.t1 Scaffold_3 AUGUSTUS stop_codon 2387841 2387843 . - 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_3 AUGUSTUS CDS 2387841 2388239 0.95 - 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_3 AUGUSTUS start_codon 2388237 2388239 . - 0 transcript_id "g534.t1"; gene_id "g534"; # protein sequence = [MAWSEKEARIRLSSDSNFPINREEESQTHTPIPKDPISESKVALDPRSTMLSAPETFKSDDAARPALFQPSLMVYEGS # RTSFDRPGSVLMNDRQSTTSRLTVPASIATHESSNAASSNYSYSQKALALYNCK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g534 ### # start gene g535 Scaffold_3 AUGUSTUS gene 2389565 2390802 0.77 + . g535 Scaffold_3 AUGUSTUS transcript 2389565 2390802 0.77 + . g535.t1 Scaffold_3 AUGUSTUS start_codon 2389565 2389567 . + 0 transcript_id "g535.t1"; gene_id "g535"; Scaffold_3 AUGUSTUS CDS 2389565 2389726 0.99 + 0 transcript_id "g535.t1"; gene_id "g535"; Scaffold_3 AUGUSTUS CDS 2390290 2390802 0.78 + 0 transcript_id "g535.t1"; gene_id "g535"; Scaffold_3 AUGUSTUS stop_codon 2390800 2390802 . + 0 transcript_id "g535.t1"; gene_id "g535"; # protein sequence = [MEEAPDAATKLFNAHSPDEIVFGLAQPLTSRIWLEDWIATYRLEMNSFLLLNTKPGGPGYELVYGTTGVLPYLLSLTP # SNDLKASFNAIAAHEQKLLQPLLAFLTAPEQIERGVRIVGEESPGTNRVPTISFVVVGEKATKSSDIVKVFDKQGGVRSESFRTTTKLTSVAQIGIRF # GHFYAYSLIDQLQPKIDVDDGVVRISLVHYNTVKEVERVVEILKKALA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g535 ### # start gene g536 Scaffold_3 AUGUSTUS gene 2397517 2398464 0.23 - . g536 Scaffold_3 AUGUSTUS transcript 2397517 2398464 0.23 - . g536.t1 Scaffold_3 AUGUSTUS stop_codon 2397517 2397519 . - 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_3 AUGUSTUS CDS 2397517 2398464 0.23 - 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_3 AUGUSTUS start_codon 2398462 2398464 . - 0 transcript_id "g536.t1"; gene_id "g536"; # protein sequence = [MDRLCNRRKGKASDDIRMKRMTPLRMDSSASVTSATSAKSVCAACSENLMSPSTMSSGISRSGSWLSFMSSSSVSSVS # TVLTTPSASTSGSSPPIQPLIRTGSVFSTWLKGVASQSSPTPTDQCTCEHLSVSRMYTASRGIECRLIPVGKDESPLPLDLLDVTVSPSPTLTNTESS # AAIKQFNMASGKPTHSMASPTGSKSLLRSVTNFLDVAKSFQSAYMHAAMFATLATVPNVSLYGSDWDREYEHKQGRKQSNAVGEHGGSKVKRRLQPVG # CRVGTNEVSLFTSAIKKSSQQPIDADAGQPVTGEVLFKADL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g536 ### # start gene g537 Scaffold_3 AUGUSTUS gene 2419961 2420302 0.6 + . g537 Scaffold_3 AUGUSTUS transcript 2419961 2420302 0.6 + . g537.t1 Scaffold_3 AUGUSTUS start_codon 2419961 2419963 . + 0 transcript_id "g537.t1"; gene_id "g537"; Scaffold_3 AUGUSTUS CDS 2419961 2420302 0.6 + 0 transcript_id "g537.t1"; gene_id "g537"; Scaffold_3 AUGUSTUS stop_codon 2420300 2420302 . + 0 transcript_id "g537.t1"; gene_id "g537"; # protein sequence = [MVQMSNSDLGNGGFCHSSVRKVMEQFVGSPEPIPVHAGEPSTLGFQDDHDDTDELSETLKKLQFSQSPERYSASNRLM # LIKSGIAANQGNGMDTNHDVFKRPVFWTIQPVRDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g537 ### # start gene g538 Scaffold_3 AUGUSTUS gene 2431483 2434317 0.64 + . g538 Scaffold_3 AUGUSTUS transcript 2431483 2434317 0.64 + . g538.t1 Scaffold_3 AUGUSTUS start_codon 2431483 2431485 . + 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_3 AUGUSTUS CDS 2431483 2431921 0.84 + 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_3 AUGUSTUS CDS 2432568 2432728 0.68 + 2 transcript_id "g538.t1"; gene_id "g538"; Scaffold_3 AUGUSTUS CDS 2432797 2434317 1 + 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_3 AUGUSTUS stop_codon 2434315 2434317 . + 0 transcript_id "g538.t1"; gene_id "g538"; # protein sequence = [MGRLHTAVISNSPTPIGSGSTLSLCGFGSGGRLGVTQHTQYALRPLSWAANAQAPSTPAKALTQFKVKVIAVALGQDH # TLALTENGEIYSWGLNRFSQLGYSIDDGSSAAHVFSLDDPSIFITQSTTRTDSTISSNGEQIQLIPRREGGEVFTFGVPGVPPLGVLGSGSGSPDADG # NAGSGLALAKIIKPQRVWALRRGLDVAIGGDGSLIVCTDSGHVYVRARSSDTIFGGSKSSSGGGKSKFVRIPYLQRIVGVCASSTGAFGALRVDADIR # PINWPTVDEELLTKKVGRGLKKAVDALKGWDLVHDLKSIRPWMWKKSVDSPLDVEWLEDSCDVNPNPPSISVPPQTGAMSPVHQTKPDDDADEYDDDG # DLSIKQDIKLLYELCAFVTRQDTNIRSSGKLPYGADLIVYINSEPSVAGTKKSRSKTKASSLPQQLTVPLHAVLLGARSNAMASALLSPSESVFKCQV # DARTVALSKTISVSSIHGNAIARRSITFTNFHSLAVLILLHYIYTDELICIWDRRVSTGIPSLSSSEALEVTPTLATQVKSELQNLARIFVLPEMLKA # MESVVKRPVTETLRTDLATVWNLNNSSSPLPTLHTSSALAPDIVIQLAEGRELVAHSTILRARSVYFEDFLSEEDWTKKRKGHEGVLKVDLRHVKSNV # MEYVMRWLCCGQTEGLFGSLGEAFRPHACLPYLIDHSRIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g538 ### # start gene g539 Scaffold_3 AUGUSTUS gene 2434711 2435713 0.24 + . g539 Scaffold_3 AUGUSTUS transcript 2434711 2435713 0.24 + . g539.t1 Scaffold_3 AUGUSTUS start_codon 2434711 2434713 . + 0 transcript_id "g539.t1"; gene_id "g539"; Scaffold_3 AUGUSTUS CDS 2434711 2435099 0.29 + 0 transcript_id "g539.t1"; gene_id "g539"; Scaffold_3 AUGUSTUS CDS 2435158 2435713 0.26 + 1 transcript_id "g539.t1"; gene_id "g539"; Scaffold_3 AUGUSTUS stop_codon 2435711 2435713 . + 0 transcript_id "g539.t1"; gene_id "g539"; # protein sequence = [MSKWQEWLENEDIPTVFVPSTGSLRRQRERKLSQVATFTSPPSTSPVLSTSFGHQKDLSKNMPPSPISRPRTTASPGL # KPHAPIPESDDLFDMDDVDISFPSVDLVESRVPTAQSSSGPSPAWKSSSVPRVDMRSVMAEAAGVSESQPPRSTQIYMAAQGRDSPNDGSSPYSVRLR # RAGSTFDLPSTPSPSPRPSGSSRKVTTGSAPGSGSATPNAFPTLGGSLTPVSKSRDPAASLNGRLPSQATSSGSNTGPILGPIFSPSRQPAPKAPATA # PRRVSYVHILYCFTSAHILMSTQKHQRQVHSQGLGFYTCA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g539 ### # start gene g540 Scaffold_3 AUGUSTUS gene 2440254 2441613 0.24 - . g540 Scaffold_3 AUGUSTUS transcript 2440254 2441613 0.24 - . g540.t1 Scaffold_3 AUGUSTUS stop_codon 2440254 2440256 . - 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_3 AUGUSTUS CDS 2440254 2440745 0.99 - 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_3 AUGUSTUS CDS 2441017 2441613 0.24 - 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_3 AUGUSTUS start_codon 2441611 2441613 . - 0 transcript_id "g540.t1"; gene_id "g540"; # protein sequence = [MPTQDLAAWVRGGTTTARIESSNDFLPAVKAISPLSLGEVVKDPFDSQRDGEGAVSFVLSYTNPHSCLATRSNVKSTS # AFSTTSYSSTASTSALRDPSTASTFSVAQPNHTAFTPLSSTVTSNAPVTSSISSSDPSETFVPDIPESPEVPTIPISKNSNPTGSEPDFDILVLGFEE # LDLSTEALLYSTSTAREDAWTVAGNKGGTAVRLTFSPPTSSLEDLDSALNDASSIEHFQHGIENPGPTVLTFVVSHLAAFDEMVAKRNTDFHELSKRL # VFDSSILATSASAGSVSTTNSSQRNNVGPVSSQAVEDTSSAMPGGLAVSQGLISVPEKFGVFESDILFWIVSSRSPIKLLIDDIVLSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g540 ### # start gene g541 Scaffold_3 AUGUSTUS gene 2455870 2457425 0.24 - . g541 Scaffold_3 AUGUSTUS transcript 2455870 2457425 0.24 - . g541.t1 Scaffold_3 AUGUSTUS stop_codon 2455870 2455872 . - 0 transcript_id "g541.t1"; gene_id "g541"; Scaffold_3 AUGUSTUS CDS 2455870 2457287 0.99 - 2 transcript_id "g541.t1"; gene_id "g541"; Scaffold_3 AUGUSTUS CDS 2457413 2457425 0.24 - 0 transcript_id "g541.t1"; gene_id "g541"; Scaffold_3 AUGUSTUS start_codon 2457423 2457425 . - 0 transcript_id "g541.t1"; gene_id "g541"; # protein sequence = [MDLPRVSVSEYEKSPYYNGITGDVDHPNLVYRSDFLTTPFPKPFGRHASLLIKSLRGVFDTPLNDVWDSVGPQIIDLL # NARQIDWTSVDPVRFFTHAPLGEDPKGSPGPVVIWVGVIPDSTSADTAHEVSQQILTLLQKNGVNNAVVEWREAVLQMLAGLPLMCHVDVSDATHHVR # RFLTPLLGTPLTTEGMEEGTLTLWFHEIKDNDGNPSNKVYGVSNCHVLRKNTASDYEYTDGAPLHYVRVCGMRRFQRGLDEITKAISNHSFSADFWTL # DIAKLQAKAKEKTDAANEREIKARQRQLVNDTKATIDLQALHEDATKYWSDLKLYRNIGHVQYAEAISVDVEGGTRYTSDWAAFVADEAKVKDEFEGN # VVDLGAFLFAFDTSALKLNIYTGSKYSPYVLTHMFNPPGGGSTTFKFPYDRKLRIEGCATKEDLSHPAESDSEGQHCLMVGKNGNTTDLTIGRYETLC # RSSFVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g541 ### # start gene g542 Scaffold_3 AUGUSTUS gene 2460259 2461810 0.59 - . g542 Scaffold_3 AUGUSTUS transcript 2460259 2461810 0.59 - . g542.t1 Scaffold_3 AUGUSTUS stop_codon 2460259 2460261 . - 0 transcript_id "g542.t1"; gene_id "g542"; Scaffold_3 AUGUSTUS CDS 2460259 2461663 1 - 1 transcript_id "g542.t1"; gene_id "g542"; Scaffold_3 AUGUSTUS CDS 2461755 2461810 0.59 - 0 transcript_id "g542.t1"; gene_id "g542"; Scaffold_3 AUGUSTUS start_codon 2461808 2461810 . - 0 transcript_id "g542.t1"; gene_id "g542"; # protein sequence = [MGLASHFEFKCNHAYQLSNGKTTDTAISSQTFSTTTSSPGLSATSTHGHGISETQSSSSNGHTRSTKGSASASVTLTT # SATSSVASQHSKGHNDGETTSFGSGGLGIGLSVPGLGLSITVGKSGIGAGASLGVQGHSKFTASTTGSPRSSDSTHSQTDGVPSTTSSDNFPTRTPNQ # TLPPPTFPDPIRSIVTQVVSALNPHTTRSSNENHTPPQNPQSATQSSNGDGSHHSSSSQAGSPPPTGEPHRNSHTATAATSTQSSGSSNGNGNGNGNG # SSNSNDGSPTATNPATSSSTPSSGSGNNNNGNGNGNGNGNSNDGSPTVTNPVTSSTHSSGSGSNNNGNVNGKGNNTGNNDVGSTTSTQSDLASPTHSS # GSGDDNGNGDSSSGDGSPTVTKSSGINDSSDKNPSPTVSSQTGGRLPDSGTPSLTPSQSPSDSIAQDRPGQTVVLTRTTNALSTAATESKAALGGTAS # GNGQLFLGFANTQSSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g542 ### # start gene g543 Scaffold_3 AUGUSTUS gene 2471093 2474081 0.29 - . g543 Scaffold_3 AUGUSTUS transcript 2471093 2474081 0.29 - . g543.t1 Scaffold_3 AUGUSTUS stop_codon 2471093 2471095 . - 0 transcript_id "g543.t1"; gene_id "g543"; Scaffold_3 AUGUSTUS CDS 2471093 2472758 0.48 - 1 transcript_id "g543.t1"; gene_id "g543"; Scaffold_3 AUGUSTUS CDS 2472868 2474081 0.51 - 0 transcript_id "g543.t1"; gene_id "g543"; Scaffold_3 AUGUSTUS start_codon 2474079 2474081 . - 0 transcript_id "g543.t1"; gene_id "g543"; # protein sequence = [MPDNGKLKSCVQKVALFPVRRRHRGFTYSSSHSDIMDAYTPPTPVSPNSRSVTANSSPFTTYTRHHRKRISALRLSSD # TTSTLPEYIPTNPNIPSVAHWQTVPEATEIDDAPPGYSSDSAQEADEDTDLSDEDRRRQIQRSVFATVGINSAPATATTFTSSPSLRPSRPKRELSHR # RKRSNPTLSLDPIQSNSDLYLDSLLERSVHALEMSNVLLQSSMSTKTSLSGILHQETDEDEPMVPSSAIRPSTSRSLAGSGMNSLERSARGLSARIMG # GGYVHETWIEDLEQIGKDVDQLFSEEAQKERRQRNRTRRNASQSGSSQGSISSSLPVVSSTPLQSYNKFDRDRIAHSSGTSPQQHSNHVNRRTLVDLR # SHSQTRSFSNPNRPEHLESLKRHDAMAGVPHLSFQHHQHHRRNSSRGLNGDGNDNNSDNGWQEGPIGKETELRKNDEDEPIVLPSTLGLRSLGTHSTI # RRNKQLLSRSRSPSPERSVSRFVHHHDDQLSTPVTISTPTIVLDPSSSLPSHSSLPTRAPNAYNMLSSFVYPASSSSSNLTPKRSDSSSSNSRPKGKT # SPFASPWASRRSSINSTVAERPSFGATSGTNGHEHFARRRHSTSPAASMMSNRTTSTTRSGGSGSSSTVTAGSGSRSRSQTPKPLESGPIVTSSGRRH # MTPPLEVSSNSGSGGEGNCSERREGSEGSSDSCPTKQTILSLRKILDTHSPPEKLSSDDWTLISKPPLLLQQSSKAGVPVEAGTSNATASISKLFTRG # VHSHEGSVTRRFDEQRQSSFKGKGKATSTDSAASSAPSTPITTSRVPTLTPNKMSFDNIPKLLGTSVALALGASSPLSSTPSSGASTPATPSHLKRIS # FAELPEGTQGTGSNRKSRKRKGKQKASGSRLSNGGASYTKQSGSDDEGDEPRGWLRWLINAAGADSGRPDKIDERLGKGWGSASRGPGYGGMDEWGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g543 ### # start gene g544 Scaffold_3 AUGUSTUS gene 2491259 2491567 0.5 + . g544 Scaffold_3 AUGUSTUS transcript 2491259 2491567 0.5 + . g544.t1 Scaffold_3 AUGUSTUS start_codon 2491259 2491261 . + 0 transcript_id "g544.t1"; gene_id "g544"; Scaffold_3 AUGUSTUS CDS 2491259 2491567 0.5 + 0 transcript_id "g544.t1"; gene_id "g544"; Scaffold_3 AUGUSTUS stop_codon 2491565 2491567 . + 0 transcript_id "g544.t1"; gene_id "g544"; # protein sequence = [MSQPDTVRRKGKGREDSMIAQRLVELDENAHRNPDTGTESGDSEKEELWDPAMALYAVKHSTADPRSSTRTHGSVRQW # LWEKAGKRWEEENPADVVRALRSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g544 ### # start gene g545 Scaffold_3 AUGUSTUS gene 2496102 2496632 0.46 + . g545 Scaffold_3 AUGUSTUS transcript 2496102 2496632 0.46 + . g545.t1 Scaffold_3 AUGUSTUS start_codon 2496102 2496104 . + 0 transcript_id "g545.t1"; gene_id "g545"; Scaffold_3 AUGUSTUS CDS 2496102 2496632 0.46 + 0 transcript_id "g545.t1"; gene_id "g545"; Scaffold_3 AUGUSTUS stop_codon 2496630 2496632 . + 0 transcript_id "g545.t1"; gene_id "g545"; # protein sequence = [MASAFTVLSPGLETTVQDLPGRLVGMGIPVSGPMDPTAFRLANILVGNDQNTEAMETVIVAGMDLILHFHAKAVIAVT # GKDVIVEVNDAIHDTWTAIEVAQDTILRLQTKEAATTGFRNYIACRGGFPQIPKYLGSKSTSIKFGGYQVRLTFTELEHRTPHISDLLLYIINRADNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g545 ### # start gene g546 Scaffold_3 AUGUSTUS gene 2499517 2499843 0.8 - . g546 Scaffold_3 AUGUSTUS transcript 2499517 2499843 0.8 - . g546.t1 Scaffold_3 AUGUSTUS stop_codon 2499517 2499519 . - 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_3 AUGUSTUS CDS 2499517 2499843 0.8 - 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_3 AUGUSTUS start_codon 2499841 2499843 . - 0 transcript_id "g546.t1"; gene_id "g546"; # protein sequence = [MISNLPPGASPGPAGPGTPSSAYAYPGATGTHGRRYSAGTSASSGDRQPLYAAAATGSASSSTGGGSVQNSGRFAVAN # PDDGTYAGGFNEDARRAYITGGPSGESCLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g546 ### # start gene g547 Scaffold_3 AUGUSTUS gene 2500762 2501223 1 - . g547 Scaffold_3 AUGUSTUS transcript 2500762 2501223 1 - . g547.t1 Scaffold_3 AUGUSTUS stop_codon 2500762 2500764 . - 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_3 AUGUSTUS CDS 2500762 2501223 1 - 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_3 AUGUSTUS start_codon 2501221 2501223 . - 0 transcript_id "g547.t1"; gene_id "g547"; # protein sequence = [MASLSPSGNSTSSASPTVSDTGSSSFTSSPSSSLVSGSSSPSTTSSESIHPSSNSSVSYFRCVLTLSKSSSSPASDTS # TSDTSSTTSTPDTSSPPTSSSTSTSSPSSTDSTSSTTLPPTSSTTTSTSNVPTSAAPSSTSDTDSSTSTSPVHLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g547 ### # start gene g548 Scaffold_3 AUGUSTUS gene 2506976 2507875 0.44 - . g548 Scaffold_3 AUGUSTUS transcript 2506976 2507875 0.44 - . g548.t1 Scaffold_3 AUGUSTUS stop_codon 2506976 2506978 . - 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_3 AUGUSTUS CDS 2506976 2507110 0.96 - 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_3 AUGUSTUS CDS 2507173 2507427 0.53 - 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_3 AUGUSTUS CDS 2507513 2507875 0.86 - 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_3 AUGUSTUS start_codon 2507873 2507875 . - 0 transcript_id "g548.t1"; gene_id "g548"; # protein sequence = [MVKTLEICSVVTLIFAYANAQSTASQYGQVMLKDLNHNPDTDMLFLQCGGIGWTGATLCPSGWSCNVVNDYYSQCLPG # AATGTVTVSASSASTSGGSTSTSATAPVATSTLLPGNSFIRSVSITPGNATAAIMGVYTSAAQFQVTGGQLIQESTPPLYAIVEDRANSTVMKLGVSW # SETPATSGTFDFSGDTIEWSIPTIDRPQVNAWLVCPDDEENNLLFVNLGYYDYETPTGCADETIHFYTGATAVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g548 ### # start gene g549 Scaffold_3 AUGUSTUS gene 2511498 2515134 0.18 + . g549 Scaffold_3 AUGUSTUS transcript 2511498 2515134 0.18 + . g549.t1 Scaffold_3 AUGUSTUS start_codon 2511498 2511500 . + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_3 AUGUSTUS CDS 2511498 2512883 0.3 + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_3 AUGUSTUS CDS 2512978 2513140 1 + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_3 AUGUSTUS CDS 2513200 2513362 0.69 + 2 transcript_id "g549.t1"; gene_id "g549"; Scaffold_3 AUGUSTUS CDS 2513484 2515134 0.7 + 1 transcript_id "g549.t1"; gene_id "g549"; Scaffold_3 AUGUSTUS stop_codon 2515132 2515134 . + 0 transcript_id "g549.t1"; gene_id "g549"; # protein sequence = [MFPASSSSTLKNRKSSQHMLYDTHNGLKSRRYSDTEEFHPHEISHLSPLPSSPMLSPAIYPHGLQQHSRSPHSGHSST # YPSPNPGYSRRSSYAQQPSSPSTASSSPPPVTSPLIAFTRLNDDHHYAYASRVQIVGRDTNESDLVRDGQYDEDVRYFSQNDENDLRPKLPSFKSLFG # KSERYDSLVQRPEEEDLRIRTYSSPISSPSFEATLPPLKNFSVIRPKPDVTSSYTLQPITKTSIPSTPQHIKGYTEIDVNKPQDNCTRNRTSSRTNAA # FGHVSLDLESTIPIQTISSHIIHQTPTRRKNLFSDTDTPSTSKDTEIIFYSPSKVSPFPRRTYFQESSERERCTPEPVNVRYRFNQLVEIADMANPDF # SEAKVDVLQQSTDQTEEALYIDSATSPLSSPSAYLSSLPPSSPPTSEAQLSPLMHGNDLSVTTATPLTDVMNLTAEPRVDVDCLGLQGIELEDNSSPT # SALTQDLIVTNFAVEADDDDDHPFSPAGAIDLESNKVAATLVTEESAPELNQNTESQHSPSQVIDDCGPYKSSSNKDEPPPASIFSESKLLSISADSV # QGIKNKTKMKSTSSAPSISSSAPRVTVTVVKRMRPVPKIHHIVNEASVKKGTSMSIKGKEKGSSKTKPLDSHSSSSKRGRTSQTASKGKVLDDPPRKK # LKLITEEDQTNTASNSLPSSLAEAICTSFDTSNTSITDSLSIVPAKRKASHEIPSPEISNSSAHSPTISSKHSPAFPSHSSNPQKRLRTVPVEVPVPS # KDKSSSPTDNNTWVDENWVDAVAAAYGSPHHSPQTLRRKTAAKTMPEIGSIEDEDEDDNERRSLKVKFPRSPHKRIVIESESESEDGEVEKRLPLRQS # SRQMVDSDSEPEQDVEIERRSKSHTSHPALSNDVESSESELTDSDESEAVDEEEKEKREEEGGEEEEQEEEEEEEEEEEEEEEEEEEEEEEEEEEEEV # PTKEKNALGSNHQKPRSSLSSISPFDRELVGIIVETMSLSRSSSHLAFSLYKTVRETRNSVFAQLMKANWAHLDVVTRELRSKGLCGHVPGNQDDLPR # RGRPKRNTSMNEEGGTAGMSETDIMWVSEFERVMTESADRYGMFGMVESSFRNVRLLSLAST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g549 ### # start gene g550 Scaffold_3 AUGUSTUS gene 2515581 2516090 0.96 - . g550 Scaffold_3 AUGUSTUS transcript 2515581 2516090 0.96 - . g550.t1 Scaffold_3 AUGUSTUS stop_codon 2515581 2515583 . - 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_3 AUGUSTUS CDS 2515581 2516090 0.96 - 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_3 AUGUSTUS start_codon 2516088 2516090 . - 0 transcript_id "g550.t1"; gene_id "g550"; # protein sequence = [MRTTKFIALSYPKFASHAIGGIVGNILTALFAQASVAGFDGFTVIPGGWLDRHWIQLAWHVADSCAGVSYSFTMTVSL # SGFNFGKYSHRFIQTIILWIMHYIPGLRIRVPEGVEIVGIDESDMGEFAYDYVAMEPELKGVSYVSSVVRRESDPESLMKERHSTASGSNH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g550 ### # start gene g551 Scaffold_3 AUGUSTUS gene 2519526 2520113 0.98 + . g551 Scaffold_3 AUGUSTUS transcript 2519526 2520113 0.98 + . g551.t1 Scaffold_3 AUGUSTUS start_codon 2519526 2519528 . + 0 transcript_id "g551.t1"; gene_id "g551"; Scaffold_3 AUGUSTUS CDS 2519526 2520113 0.98 + 0 transcript_id "g551.t1"; gene_id "g551"; Scaffold_3 AUGUSTUS stop_codon 2520111 2520113 . + 0 transcript_id "g551.t1"; gene_id "g551"; # protein sequence = [MSSRTAAGRKRLQQPKQQKTSSFKSAFKKNFTSDAKSPPSSSSLPSSLSNLTVHQTTFRQPYNLSDTSDHEDFTLAVP # STSRIPSSETQWHPQISSGSGALHSHGPSEIRHKATRAPPSSYATGPTHPRTFDLYPSPPGSAEDIDFRGTSSDSSMRPFSLERIPSPSPLLKQPEFA # VGTCSDALWLCANINAFGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g551 ### # start gene g552 Scaffold_3 AUGUSTUS gene 2520243 2520434 0.93 - . g552 Scaffold_3 AUGUSTUS transcript 2520243 2520434 0.93 - . g552.t1 Scaffold_3 AUGUSTUS stop_codon 2520243 2520245 . - 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_3 AUGUSTUS CDS 2520243 2520434 0.93 - 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_3 AUGUSTUS start_codon 2520432 2520434 . - 0 transcript_id "g552.t1"; gene_id "g552"; # protein sequence = [MKPGEVLLGDEEDGRSNSALESEDEEKMDAGAFTAKDVDDLIPPDLVEAESEEDSEIKLGKVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g552 ### # start gene g553 Scaffold_3 AUGUSTUS gene 2520703 2521407 0.96 + . g553 Scaffold_3 AUGUSTUS transcript 2520703 2521407 0.96 + . g553.t1 Scaffold_3 AUGUSTUS start_codon 2520703 2520705 . + 0 transcript_id "g553.t1"; gene_id "g553"; Scaffold_3 AUGUSTUS CDS 2520703 2521407 0.96 + 0 transcript_id "g553.t1"; gene_id "g553"; Scaffold_3 AUGUSTUS stop_codon 2521405 2521407 . + 0 transcript_id "g553.t1"; gene_id "g553"; # protein sequence = [MKSSDPGFVFPTTRSRAHPNVGPRKFRKKKVLDQYENEGDKAAQKFMGISLNRKKKSSSRNQFPAIPEIPQSNDTISH # VDPDTPTPTAAEFGEVYTAAHSGEAAVRIPSKLGTYPLDPYDSTLLDRSVFLDLILQAFKLLNVFLISSDKSTYTLLRRLNSTDTPSFCHFGNDPPSS # VLDLGSGQGHWILEAAIHWKGYGTHFTGVDIADTMKVLRPLAIKHGVAENIKFVRSNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g553 ### # start gene g554 Scaffold_3 AUGUSTUS gene 2521666 2522583 1 + . g554 Scaffold_3 AUGUSTUS transcript 2521666 2522583 1 + . g554.t1 Scaffold_3 AUGUSTUS start_codon 2521666 2521668 . + 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_3 AUGUSTUS CDS 2521666 2522583 1 + 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_3 AUGUSTUS stop_codon 2522581 2522583 . + 0 transcript_id "g554.t1"; gene_id "g554"; # protein sequence = [MNSEAHRRNRPSSQERHDPDLFGVGADDEGDASDTATLNGNRAGPRPHRNARSPPLGVTTPAATSAFVSVPNVEFQYW # AEQVDASQELEALFEQMMNIRFGIHLCPSEFIQEMLSEIFGHSREVRTMHLTTALHDARPITPTNTFPADSKESFPAQRTRASSSHAPDIDVEPADPN # EHNPLEISPGLVLWPSTLLPMSNTELQAHAMKHPRILLSSKAALSDHASETLDIDTEDDTFMEAMWEYERYALIFVELVIILISKKYKLPELTVEPTT # TNDFEHLISAFFNILYLGGYRTWLQTGKSAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g554 ### # start gene g555 Scaffold_3 AUGUSTUS gene 2523210 2523719 0.89 - . g555 Scaffold_3 AUGUSTUS transcript 2523210 2523719 0.89 - . g555.t1 Scaffold_3 AUGUSTUS stop_codon 2523210 2523212 . - 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_3 AUGUSTUS CDS 2523210 2523719 0.89 - 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_3 AUGUSTUS start_codon 2523717 2523719 . - 0 transcript_id "g555.t1"; gene_id "g555"; # protein sequence = [MLIHPRFPPLLRPLPKLDSFALFRSEESAEEAEERQHLGLNVPLAQSKSVSAAIQDIDMDNSLKSAGLSIVPAPLSTG # LSITSQISTAFPVERRPDVGAPSLSMTTTAEFQRNLTSSLPSVTPRESAASFTQPSQASGSTEETNATTSEDLDLDEDMPSINLESDSDSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g555 ### # start gene g556 Scaffold_3 AUGUSTUS gene 2527579 2528055 0.17 + . g556 Scaffold_3 AUGUSTUS transcript 2527579 2528055 0.17 + . g556.t1 Scaffold_3 AUGUSTUS start_codon 2527579 2527581 . + 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_3 AUGUSTUS CDS 2527579 2527707 0.17 + 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_3 AUGUSTUS CDS 2527771 2528055 1 + 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_3 AUGUSTUS stop_codon 2528053 2528055 . + 0 transcript_id "g556.t1"; gene_id "g556"; # protein sequence = [MLETAMEELFVPYTEGQRYLERESQSLGALYAGILVNFTRYHQAKAPKGKSSIFDRVVNQLSNTAATTSSGGVQTTSA # QAANAILRFGGLNAEKNVVDEEPVREEDGQLSVDVAEKMLKWHAEAIGRCVELSAPNDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g556 ### # start gene g557 Scaffold_3 AUGUSTUS gene 2530940 2531407 0.95 - . g557 Scaffold_3 AUGUSTUS transcript 2530940 2531407 0.95 - . g557.t1 Scaffold_3 AUGUSTUS stop_codon 2530940 2530942 . - 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_3 AUGUSTUS CDS 2530940 2531407 0.95 - 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_3 AUGUSTUS start_codon 2531405 2531407 . - 0 transcript_id "g557.t1"; gene_id "g557"; # protein sequence = [MDFADTRPYSTPSEPASHDLSHEPMDAYANRDPAFYLTHDPFVANAHNMPYAGSASLPEITYSYAQDVNNQYPYYGNE # VNNVVPPSVGMRSTPALPTHDPRNPFESVNITPPRNAAIPQELERISSNPFEEPAFRASYQPSVDSFYGASIDGRPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g557 ### # start gene g558 Scaffold_3 AUGUSTUS gene 2532009 2532296 0.93 + . g558 Scaffold_3 AUGUSTUS transcript 2532009 2532296 0.93 + . g558.t1 Scaffold_3 AUGUSTUS start_codon 2532009 2532011 . + 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_3 AUGUSTUS CDS 2532009 2532296 0.93 + 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_3 AUGUSTUS stop_codon 2532294 2532296 . + 0 transcript_id "g558.t1"; gene_id "g558"; # protein sequence = [MTHVVKVASVEVAIDVADEDVVLGKICVAEIEVTTSLKVEELEDVVEVETSSVEVEEVVAKLVLAPLLGLNEGEVKGT # EEGVDDVAEKGTNENGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g558 ### # start gene g559 Scaffold_3 AUGUSTUS gene 2556974 2557570 1 - . g559 Scaffold_3 AUGUSTUS transcript 2556974 2557570 1 - . g559.t1 Scaffold_3 AUGUSTUS stop_codon 2556974 2556976 . - 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_3 AUGUSTUS CDS 2556974 2557570 1 - 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_3 AUGUSTUS start_codon 2557568 2557570 . - 0 transcript_id "g559.t1"; gene_id "g559"; # protein sequence = [MKSKEPLQGAELEQYLQKEQAAREKEAASQAALARQQRILEADEDDSDSDSDSDEDEEDEVRRVLGQTDDPDERPLKP # RKGDNSDGNDWNHIDDEGLTKQLLSFDIYLKGNVSKATSFFKHVGGQTHRFRMFPYVEKKRRVDEYGETVDVGMWLRKSKILEDEAESDDIKDYRRRQ # AEEELKVQSFYDLHNLNTEVRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g559 ### # start gene g560 Scaffold_3 AUGUSTUS gene 2561013 2562508 0.13 + . g560 Scaffold_3 AUGUSTUS transcript 2561013 2562508 0.13 + . g560.t1 Scaffold_3 AUGUSTUS start_codon 2561013 2561015 . + 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_3 AUGUSTUS CDS 2561013 2561191 0.26 + 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_3 AUGUSTUS CDS 2561261 2561502 0.95 + 1 transcript_id "g560.t1"; gene_id "g560"; Scaffold_3 AUGUSTUS CDS 2561604 2562004 0.51 + 2 transcript_id "g560.t1"; gene_id "g560"; Scaffold_3 AUGUSTUS CDS 2562056 2562508 0.86 + 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_3 AUGUSTUS stop_codon 2562506 2562508 . + 0 transcript_id "g560.t1"; gene_id "g560"; # protein sequence = [MLQQSPKHASHSESRASGKSKALDTDMGDCDIDLWEPKPPKVLMKDPDAVPLELRSQIQQQLTHPLVSPIVQGSLGNL # PPLYIIAGDGEVLRDEIIHLAHRAAHPEDYRVRSGLLREGNRQKENATKFTTPTKVHLQVFDVIPNYNAAELTYTNARQAKYAYRSIAEFVKHATNDD # PGLEPFPELQRPPSRASVDSEALGEHMAKRSPFTIFSRKTSPKAKNVLRQQSTGVKLYNQEVAAVANQIQNLEQENLSSSQSTTVFKGDRLETSNGRK # DGFFVMVRERVDIRGVTRDMEPREEMACLQINSSQIGLIKEAPTVRWHEGQKKWDIMFAHEARRVLKHRKKIERKIQDLLRSAREQGLLLVGETDSAD # HPQMRDASTERSTSMNPIDGTIRSDRRWGPLDLDDEHPPPSAIAKRRDTVYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g560 ### # start gene g561 Scaffold_3 AUGUSTUS gene 2564811 2565325 0.98 + . g561 Scaffold_3 AUGUSTUS transcript 2564811 2565325 0.98 + . g561.t1 Scaffold_3 AUGUSTUS start_codon 2564811 2564813 . + 0 transcript_id "g561.t1"; gene_id "g561"; Scaffold_3 AUGUSTUS CDS 2564811 2564835 0.98 + 0 transcript_id "g561.t1"; gene_id "g561"; Scaffold_3 AUGUSTUS CDS 2564916 2565325 1 + 2 transcript_id "g561.t1"; gene_id "g561"; Scaffold_3 AUGUSTUS stop_codon 2565323 2565325 . + 0 transcript_id "g561.t1"; gene_id "g561"; # protein sequence = [MFRAWKSNVACALLYRGDVVPKDVNAAVSIIKTKRTIQFVDWCPTGFKLGICNEPPAHVPGGDLAKVSRSMCMLSNTT # AISSAWSRLDHKFDLLYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSADIEESGEY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g561 ### # start gene g562 Scaffold_3 AUGUSTUS gene 2567269 2567475 0.69 + . g562 Scaffold_3 AUGUSTUS transcript 2567269 2567475 0.69 + . g562.t1 Scaffold_3 AUGUSTUS start_codon 2567269 2567271 . + 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_3 AUGUSTUS CDS 2567269 2567475 0.69 + 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_3 AUGUSTUS stop_codon 2567473 2567475 . + 0 transcript_id "g562.t1"; gene_id "g562"; # protein sequence = [MTSNLGPYAVADYKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDSGDAEDDGEY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g562 ### # start gene g563 Scaffold_3 AUGUSTUS gene 2568073 2568444 0.75 - . g563 Scaffold_3 AUGUSTUS transcript 2568073 2568444 0.75 - . g563.t1 Scaffold_3 AUGUSTUS stop_codon 2568073 2568075 . - 0 transcript_id "g563.t1"; gene_id "g563"; Scaffold_3 AUGUSTUS CDS 2568073 2568444 0.75 - 0 transcript_id "g563.t1"; gene_id "g563"; Scaffold_3 AUGUSTUS start_codon 2568442 2568444 . - 0 transcript_id "g563.t1"; gene_id "g563"; # protein sequence = [MADSKTSAITISAHLLRKDSAQVYTKGQKYVQILPQEMTQFVPSYAGADGFIFTVKNHLDRLFMKEDSIAQYHILVPV # NVGSDDLEYFGIYRLHAMTLQEFNSQTQDVCNVISKLGTRVNCQY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g563 ### # start gene g564 Scaffold_3 AUGUSTUS gene 2571855 2572217 0.98 + . g564 Scaffold_3 AUGUSTUS transcript 2571855 2572217 0.98 + . g564.t1 Scaffold_3 AUGUSTUS start_codon 2571855 2571857 . + 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_3 AUGUSTUS CDS 2571855 2572217 0.98 + 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_3 AUGUSTUS stop_codon 2572215 2572217 . + 0 transcript_id "g564.t1"; gene_id "g564"; # protein sequence = [MSNPTKGPKLEDSSITLFKSIGLTQAKAAEASKSPKCAALLKKLIEDNSLVSRKLDEKQAGLIAAFASQLAKSNGVDA # RSEKYVLDTILDGKLKSVDQVAGVFMIYIQTEILTVRLLKRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g564 ### # start gene g565 Scaffold_3 AUGUSTUS gene 2573576 2574544 0.99 + . g565 Scaffold_3 AUGUSTUS transcript 2573576 2574544 0.99 + . g565.t1 Scaffold_3 AUGUSTUS start_codon 2573576 2573578 . + 0 transcript_id "g565.t1"; gene_id "g565"; Scaffold_3 AUGUSTUS CDS 2573576 2574544 0.99 + 0 transcript_id "g565.t1"; gene_id "g565"; Scaffold_3 AUGUSTUS stop_codon 2574542 2574544 . + 0 transcript_id "g565.t1"; gene_id "g565"; # protein sequence = [MSKRKILTLVDEGFVNGWDDPRLYTLIALRRRGVPPGAILSFVSSLGVSTASSNIEINRFEQAVRQYLEGSVARLLMV # MQPLKVTIENLSEDYLEWIEKPFHPKVAALGNTRIPFTRTIYIDSEDFRLEDSEDYFRLAPGKTVGLFQAPHPVTCTSYKLHPTSGKVTELFCRLENG # GNVKKPKAFIQWVAEHTPSGSPVRIEETRVFHRLFKSDNPPSDFRSDINSDSLETIEGAMMEIGFWDLARRSIAGAREESKARAELVGKECVRFQGLR # TAYFALDKDSRVRCLEDETGNAPPARMQGDYLVLNRIVSLKEDAGKAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g565 ### # start gene g566 Scaffold_3 AUGUSTUS gene 2578172 2579851 0.87 - . g566 Scaffold_3 AUGUSTUS transcript 2578172 2579851 0.87 - . g566.t1 Scaffold_3 AUGUSTUS stop_codon 2578172 2578174 . - 0 transcript_id "g566.t1"; gene_id "g566"; Scaffold_3 AUGUSTUS CDS 2578172 2579851 0.87 - 0 transcript_id "g566.t1"; gene_id "g566"; Scaffold_3 AUGUSTUS start_codon 2579849 2579851 . - 0 transcript_id "g566.t1"; gene_id "g566"; # protein sequence = [MPVPPDKIASYLFQSRIEGPVWLEAEEIALLRARRSEAESEAASLSDHSSALKDAYEKSLRREDAKLSEIALIQNILS # PIRRLPLEILSQIFEHVCLPKYHERPDEDVINTTFALCQVCIAWRMAAYTTPAIWSQICIELDKKPETFSGNVTWVKEWLTRSKGLPLDIYLFLIDVW # DVVTQDVKDRVNECLDFILNFHSQIRTLDLSGYPPFFIPLFRLPRASMPLLESVSIRVTDYDNDDDSIQNLIQQHPFVEVLLGAPRLQTLKIQECGCQ # MSILQGLALPVEQLTSLEIRADKKSVFDPIAYLNMLRQCTNLRSLKIRFPKRTSRHLSLFGSHNSFPILLPSLKSLDILDGHYGGEFLSCFSAPLLKD # LTLRMFGEANISDLPTALSGLQSRSMTILSSLALQVILNLNMNSVSRNLVAILAIFPTLDEFRLSAISIVSKFDLGPILRALTFVKGHPVLLPKLTVI # ELELTAIRMDRSRDEYPSDLIPMVLSRWWPDNSESQVHNGNHEEISEHPDVSQLRQVILHGVCYKEADVAPILALSGLELTLKECLELK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g566 ### # start gene g567 Scaffold_3 AUGUSTUS gene 2580308 2581677 0.31 + . g567 Scaffold_3 AUGUSTUS transcript 2580308 2581677 0.31 + . g567.t1 Scaffold_3 AUGUSTUS start_codon 2580308 2580310 . + 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_3 AUGUSTUS CDS 2580308 2580464 0.33 + 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_3 AUGUSTUS CDS 2580826 2581152 0.66 + 2 transcript_id "g567.t1"; gene_id "g567"; Scaffold_3 AUGUSTUS CDS 2581199 2581677 0.7 + 2 transcript_id "g567.t1"; gene_id "g567"; Scaffold_3 AUGUSTUS stop_codon 2581675 2581677 . + 0 transcript_id "g567.t1"; gene_id "g567"; # protein sequence = [MLVALQVIGIVMCSQSKIDYKFAKYNAQPTVYEWSQDEYSRHLEGTSLPFIEKREILRKKYVASLANRTPEQIQEEEA # LYIEIKRLDQNERQFKRDRENLLRTIAGVDSGLPDIIEDDASLIIADPKKKKLKGIDLDIPQTPVLTAPVMRRPPALNKNAVYDTTHCIIRNDPPSTT # PATKVAHTPAYFRSVRIPYPKAGIADKVNALLAEVGVTNSRLVMPTHANCQRLESVTDAATNLIELKRVLDKVNLDIEVLKNRLQLREDGGDSASVAD # AMEMDDRGDTAEPEGENGRSQSVLSARSTRSRKHVSSSLFWNLIRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g567 ### # start gene g568 Scaffold_3 AUGUSTUS gene 2586147 2589024 0.4 + . g568 Scaffold_3 AUGUSTUS transcript 2586147 2589024 0.4 + . g568.t1 Scaffold_3 AUGUSTUS start_codon 2586147 2586149 . + 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_3 AUGUSTUS CDS 2586147 2587304 0.44 + 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_3 AUGUSTUS CDS 2587933 2589024 0.93 + 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_3 AUGUSTUS stop_codon 2589022 2589024 . + 0 transcript_id "g568.t1"; gene_id "g568"; # protein sequence = [MKYQRIPSTTSLSGDDDDEIHSKSILPFDEGDSQANITVVPAQWSRPTAPSARRNDRVSPMSRLPPELLIHILKHIHS # ARDLVSSLQVCRTWCECSVELLWHKPNLNKYFTVEKMARLLAVPDQTFTYASFIRRLNFLAVAKELRDDIFCNFGKCDRLERLTLVNCHQLSEVAILQ # TLPCFPNLVAVDLTGVVHTSDEAIVGLASVARRLQGINLTGCKHVSDEGVMALALNCPLLRRVKLSGLEDLTDEPLQALTKSCPLLLEIELSNCKLVT # DIAIRDAWSRSTHMREMRLSQCSELSDTAFPAPIRRDSKSVSEPSVNPFASSTSESADLPPLIINRTFEHLRMLDLTACSKVTDDAIEGIVSHAPKIR # NLVLSKCGLLTDRSNGTDDTEYEDDDDIEEEDTPELEIDGDLEDEYISRTSMANNHHITVHRGHRQNNYGAVWPSRNSTEEHVLPTIPTDRPIPNSLL # ARLNAVMAAGPSSARSPSSSNSNRLAPASVGAFRNIAEALPIIEQSQSPPPSDVASNASGATNNSNGAGFFRSYQDGLIHSRANEVRTPDLNFAEIGH # GRGAVAAGGLPASVTNATPTNFQMRRAQVLTPHPRPPPIDLQHATASSSAQPVFSNSSQPESSIAWPYSEPASPPLTGYDAEQEEKELERDQRDHTSR # ELHESVRAALAGPSGSIPASGSGDARGRGVRKSLRKQSTLLSTTLAHSCLGGHPFRFGVRRHLMKVIRQALTLDMLPLEAAIE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g568 ### # start gene g569 Scaffold_3 AUGUSTUS gene 2590049 2590906 1 + . g569 Scaffold_3 AUGUSTUS transcript 2590049 2590906 1 + . g569.t1 Scaffold_3 AUGUSTUS start_codon 2590049 2590051 . + 0 transcript_id "g569.t1"; gene_id "g569"; Scaffold_3 AUGUSTUS CDS 2590049 2590906 1 + 0 transcript_id "g569.t1"; gene_id "g569"; Scaffold_3 AUGUSTUS stop_codon 2590904 2590906 . + 0 transcript_id "g569.t1"; gene_id "g569"; # protein sequence = [MSYKHHSARLSKVARQTSRPLSEDPVSIVRKVFVECGSEVDTEGGGARARLMNRQTARSFGGMEIVDEEEEEKEQSFS # EPCIQETSQDQSIISSYSTPDSTGPPTPASYCFSPVAEISARALEANNVEILVPSNTQLPYLRNQSSAPLQSLGITLPSADTLSDKLQDQTLPSRLSK # LYADHRVSVVTWSDLVSFSSYGLDMIDDHGQAEKGKFHDDSSIYYDESWNEDRSLEEFDGNEDLVTNSLEDSGIDLTAVLDSMSILVGQGLDARLLLS # PPRQFCSTFTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g569 ### # start gene g570 Scaffold_3 AUGUSTUS gene 2597457 2597825 1 + . g570 Scaffold_3 AUGUSTUS transcript 2597457 2597825 1 + . g570.t1 Scaffold_3 AUGUSTUS start_codon 2597457 2597459 . + 0 transcript_id "g570.t1"; gene_id "g570"; Scaffold_3 AUGUSTUS CDS 2597457 2597825 1 + 0 transcript_id "g570.t1"; gene_id "g570"; Scaffold_3 AUGUSTUS stop_codon 2597823 2597825 . + 0 transcript_id "g570.t1"; gene_id "g570"; # protein sequence = [MISPTSAGVDAARAYGTGCFKTHRTHDLRGLTEAELRVCDFLPLSRRKVTKSTQGVHHWKEFYANHAEYKKVGRVNHP # LINPASPIPEPCKPPKVKNDGKDGKAKEKDKSEAKESTMVHEEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g570 ### # start gene g571 Scaffold_3 AUGUSTUS gene 2600530 2601564 0.5 - . g571 Scaffold_3 AUGUSTUS transcript 2600530 2601564 0.5 - . g571.t1 Scaffold_3 AUGUSTUS stop_codon 2600530 2600532 . - 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_3 AUGUSTUS CDS 2600530 2600739 0.72 - 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_3 AUGUSTUS CDS 2600836 2600858 0.72 - 2 transcript_id "g571.t1"; gene_id "g571"; Scaffold_3 AUGUSTUS CDS 2600952 2601564 0.5 - 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_3 AUGUSTUS start_codon 2601562 2601564 . - 0 transcript_id "g571.t1"; gene_id "g571"; # protein sequence = [MFYEDLDHRDFMAQSTHILLSDALEPPSPGFASLDASTGSPRPGSIPPSPSFSDILASSTQKGLAKPQSPIPSRLLAH # TLSYDSSSSSNSCAIVEEQLTPDDDFLFDENRDRLSQSLPVAGEESDHSDFSQGVHELGASQMFPTQQPEETESQNSHQTRPPFLHVRVYKILHFHPQ # HLHSYLPLRLQGLRENNPGMGQQRDLGRVPAGQDALIPMMPIRVCQKSDTNMPAQRSSHDEDCDADVSQMQTETQLTMSPAIQQEPSYGMYDYAIQTQ # APYDSQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g571 ### # start gene g572 Scaffold_3 AUGUSTUS gene 2602222 2602845 0.33 + . g572 Scaffold_3 AUGUSTUS transcript 2602222 2602845 0.33 + . g572.t1 Scaffold_3 AUGUSTUS start_codon 2602222 2602224 . + 0 transcript_id "g572.t1"; gene_id "g572"; Scaffold_3 AUGUSTUS CDS 2602222 2602845 0.33 + 0 transcript_id "g572.t1"; gene_id "g572"; Scaffold_3 AUGUSTUS stop_codon 2602843 2602845 . + 0 transcript_id "g572.t1"; gene_id "g572"; # protein sequence = [MTSDQSFDMIPVLTYLGVEKDGSYSPSPSDQTIDFLIKHIHNLPPHLLLKFSSITSPKQRTVIHVIRNRRLKYIDTQP # AELSFTAARHTWPSVWPGRERRGVAEGHDEERWAQTDFMQGSTKHVKKLGSLLRDYEEEREAERVRNIRRTQSAAEESQFIPEEDEDSAEDEPVESGD # VEEATEADNRAEFERRIRERFIYGLLDVSMK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g572 ### # start gene g573 Scaffold_3 AUGUSTUS gene 2603141 2603872 1 + . g573 Scaffold_3 AUGUSTUS transcript 2603141 2603872 1 + . g573.t1 Scaffold_3 AUGUSTUS start_codon 2603141 2603143 . + 0 transcript_id "g573.t1"; gene_id "g573"; Scaffold_3 AUGUSTUS CDS 2603141 2603872 1 + 0 transcript_id "g573.t1"; gene_id "g573"; Scaffold_3 AUGUSTUS stop_codon 2603870 2603872 . + 0 transcript_id "g573.t1"; gene_id "g573"; # protein sequence = [MSSVPPSKPHVSSKAKGKRRQHSVDPDTLDAPVKPKGKRKANSGDEVANTLDQPSIETRPKKKKKEHNPQQPQLPVNT # LPLNDGEPQISPSDFLAAIIAAATATSSDQQSSTGPFTDDPTAQAADVLSGEVSTEAVLRVLQDVDFSNIAQVLKVWLDPQQDSAASLSGLTLPNGTL # NTDLISQLMLQAPPPVGQVPVSAGKILSTKPTETASGPTYEHEVIENYNTEEDALLLSTNGSAPPNC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g573 ### # start gene g574 Scaffold_3 AUGUSTUS gene 2605126 2605269 0.9 + . g574 Scaffold_3 AUGUSTUS transcript 2605126 2605269 0.9 + . g574.t1 Scaffold_3 AUGUSTUS start_codon 2605126 2605128 . + 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_3 AUGUSTUS CDS 2605126 2605269 0.9 + 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_3 AUGUSTUS stop_codon 2605267 2605269 . + 0 transcript_id "g574.t1"; gene_id "g574"; # protein sequence = [MEILKAKKTNFDPTPSKTKRKPSKKFPSAETVDSSDKDENDEEEEDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g574 ### # start gene g575 Scaffold_3 AUGUSTUS gene 2608686 2609684 0.88 + . g575 Scaffold_3 AUGUSTUS transcript 2608686 2609684 0.88 + . g575.t1 Scaffold_3 AUGUSTUS start_codon 2608686 2608688 . + 0 transcript_id "g575.t1"; gene_id "g575"; Scaffold_3 AUGUSTUS CDS 2608686 2609684 0.88 + 0 transcript_id "g575.t1"; gene_id "g575"; Scaffold_3 AUGUSTUS stop_codon 2609682 2609684 . + 0 transcript_id "g575.t1"; gene_id "g575"; # protein sequence = [MSVRTVQTSFTSHSASTAALSTMIATSNVLTAVDLNVAYPPGLESYRADKGLVIRGRSYSGSAARNSYSNQASGGPNL # SYSRSSNRAGSNKRYPHGMRLPSSSYNQTQNQTRRAGFSSSTKQENSLLGPSLYQRTERFDPFGDSKEPPLSTSPVFTSTGPSNVSQPLYTHYYYYDP # NTNRPTLAYADDKNSANAANLTASTNLLLDTLLNGRRSPSPPQPTMSDPSPVAVTADSPVQPQTRSPSPPHSLRPRAAAISRPSSTITPSPILSQPIA # SVSPPPPPIKVSKAQRDAIARIVANMLLNRADGISRRGRRCNNTGYVKSGLSRVVSVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g575 ### # start gene g576 Scaffold_3 AUGUSTUS gene 2611523 2611960 0.53 + . g576 Scaffold_3 AUGUSTUS transcript 2611523 2611960 0.53 + . g576.t1 Scaffold_3 AUGUSTUS start_codon 2611523 2611525 . + 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_3 AUGUSTUS CDS 2611523 2611960 0.53 + 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_3 AUGUSTUS stop_codon 2611958 2611960 . + 0 transcript_id "g576.t1"; gene_id "g576"; # protein sequence = [MSPWVGLSNPDQWGPTFRIKHYDVTNIRGPGEEYVDTIFIDFPDKHSQIVPYAESVSAPDDWFSDLQNSVVDRILVTA # GKEERLLDQIQVFFKRKIKPYHSDAVLLVQDGGIHDDMIMDFAVANAPLGNELTPVVLEWIAKGFRM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g576 ### # start gene g577 Scaffold_3 AUGUSTUS gene 2614420 2615681 0.46 + . g577 Scaffold_3 AUGUSTUS transcript 2614420 2615681 0.46 + . g577.t1 Scaffold_3 AUGUSTUS start_codon 2614420 2614422 . + 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_3 AUGUSTUS CDS 2614420 2615084 0.69 + 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_3 AUGUSTUS CDS 2615146 2615341 0.63 + 1 transcript_id "g577.t1"; gene_id "g577"; Scaffold_3 AUGUSTUS CDS 2615508 2615681 1 + 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_3 AUGUSTUS stop_codon 2615679 2615681 . + 0 transcript_id "g577.t1"; gene_id "g577"; # protein sequence = [MGVLQEGYDADVVMWDSHPLQIGATPVYVWIDGMKQIPLTKESGRSTYSTGTGPEEVVEPDKTRMEAPGQPSYEKERQ # DTVDWDGLPPLKGRGEGNRVVFRNVKEVWTRGRNSIDESFVADEDEFGIVVVEQGRIICAGSADDCIISGDERTVDVDLHGGSISPGLLTFGSPLGLE # EIASEPSTTDGRLFNSLAVDIPSVFHDVGGIVRAVDALMFDSRHARMAYRFGVTAATSSLAKPHRLYENDDCMIWGLSTTFSTNAAHGLEPEAIIQTE # TALHVRITRPRFDGVIPLVVEVHNADIMASLIMLRAEVDAKIGGQMRMVFVGATEAWLLAKELSEQQNFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g577 ### # start gene g578 Scaffold_3 AUGUSTUS gene 2620864 2622847 0.89 + . g578 Scaffold_3 AUGUSTUS transcript 2620864 2622847 0.89 + . g578.t1 Scaffold_3 AUGUSTUS start_codon 2620864 2620866 . + 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_3 AUGUSTUS CDS 2620864 2621569 0.91 + 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_3 AUGUSTUS CDS 2621622 2622847 0.96 + 2 transcript_id "g578.t1"; gene_id "g578"; Scaffold_3 AUGUSTUS stop_codon 2622845 2622847 . + 0 transcript_id "g578.t1"; gene_id "g578"; # protein sequence = [MLKSSDAVPVSISQLDSTSQSRRNSTATIDDAVRYVRSRSNSLVKDKDTSTPRNRSRLTFMDYLIKPVQRICKYPLLL # EQLKSSEPLYESKIRVPWLSDRNVVVESAAQAMRHVASTVDEARQRQDVAVRSALIASRILYSHVLQSPSPSPLQVLTPGFLSSLGPCHIAGSLDVIH # QRSIKQSTGTANINVKYLGAFLYRGGYFILAKVTKGRTYEPRHWFRLGDFKIIEAVESEAWLPCSFRLSCKGHEFEFAAACQQEREAWLTAIRESLAY # PTSSWINEPTASILLDGKGEIVPSMLDDPYEAIVPLPTINSVPELASDTGDQLTETLLDALATESQMLQATATSSPEVPSIPSRRSSSTSAQAFSTPT # SPEYETFVIRRNLPAARAQIDAGLSDVISDICLSARSQAATQEEELFQPPHIPRQSSSSHPAQNSKLNSRSSTSSSLSMAKNRLRKHESVRVPRRKSL # AQLVDDQSITKSSASRAQSFTTRKRPQKLNLTSKGPEEADPLLSHPPNSSRSYSSPTFPGGSANSNPVSSDPSSTLASPVLESHPAQMNGAPHSEPGC # NRSRPSSLVCNVRSLFAPRPPSLINTFTPVFTTSSPATFDFKHDKPSPKMFLDDGWAQFREVIGGPSVLPKIQTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g578 ### # start gene g579 Scaffold_3 AUGUSTUS gene 2623857 2625582 0.76 + . g579 Scaffold_3 AUGUSTUS transcript 2623857 2625582 0.76 + . g579.t1 Scaffold_3 AUGUSTUS start_codon 2623857 2623859 . + 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_3 AUGUSTUS CDS 2623857 2623866 0.83 + 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_3 AUGUSTUS CDS 2624327 2625582 0.8 + 2 transcript_id "g579.t1"; gene_id "g579"; Scaffold_3 AUGUSTUS stop_codon 2625580 2625582 . + 0 transcript_id "g579.t1"; gene_id "g579"; # protein sequence = [MLRYATKKAFRSFSLALSHVSKTDYYAGLFSSSPKVTLHLSIEDPASEEPSGFGSWECEVCAYRNPPGLSPSAARVCA # LCGVPRSLPAKSASSSASSEVPQLSIDSSFPTSASTSALPQRFRKPSSISCPACTFLNHPSMQTCEICSTPLPKASGDHTQAKSAPTTRPTTPGLNDD # DIESKMLKLSFRKGGDKVFYTALKRSLKGRAWEITPSNAGTNGARSGICENTFLVDVITSDSLCLAGIMQAVENNAQNRDADMSNALQDLEALMVKAK # DMVRLAAELNERLTASSTTTANDPYSSVLSSTLTEPEEATFIRSSLSQLGLQMENTPVTLDMMKDEREWMEQLARELANILQGSEKVSSSSSGGMMKK # RGIIALDEVWGGWNRARGVGEQTHFRFLFLFLLFINHIQLLYHPQRSSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g579 ### # start gene g580 Scaffold_3 AUGUSTUS gene 2627074 2628298 0.38 - . g580 Scaffold_3 AUGUSTUS transcript 2627074 2628298 0.38 - . g580.t1 Scaffold_3 AUGUSTUS stop_codon 2627074 2627076 . - 0 transcript_id "g580.t1"; gene_id "g580"; Scaffold_3 AUGUSTUS CDS 2627074 2627780 0.88 - 2 transcript_id "g580.t1"; gene_id "g580"; Scaffold_3 AUGUSTUS CDS 2627824 2628298 0.38 - 0 transcript_id "g580.t1"; gene_id "g580"; Scaffold_3 AUGUSTUS start_codon 2628296 2628298 . - 0 transcript_id "g580.t1"; gene_id "g580"; # protein sequence = [MGDFFAGSVSSRKRTKSTASRSSTYTQTTSTGESSITKFSSSRSNTMSTIATTVDDGSLASTRSRTKNDRGRSPGPSS # DADDSFSRSLSRSLSRSISRASKSRSVSRDRESDYTDTDDDAQIQILDRSDNDIDAQLALARRNSKSQNDRQVPVRSSQPNIFFIDWYPVEEFPHPAR # PASRASTARDSTSQCTITEDPRSPRSLSRHSSDRRPMGPRSPSPLPPPRSPRPPSPPLPELPSIDDELAAEISDIVQPTPTKSGIPRSKRQIFHPVNN # IDSTPKPHMNGMARASSSVEPLSIKKKTSVRNAIDSTDTPVTGRKSGRNSLSRTPARTVTSSPRRVSPQIRLGKVAGPSVSSPHMVHDLDKIVSLART # TKEDVSVTCFRPYLRSLPWTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g580 ### # start gene g581 Scaffold_3 AUGUSTUS gene 2633135 2633921 0.66 + . g581 Scaffold_3 AUGUSTUS transcript 2633135 2633921 0.66 + . g581.t1 Scaffold_3 AUGUSTUS start_codon 2633135 2633137 . + 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_3 AUGUSTUS CDS 2633135 2633567 0.71 + 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_3 AUGUSTUS CDS 2633626 2633921 0.72 + 2 transcript_id "g581.t1"; gene_id "g581"; Scaffold_3 AUGUSTUS stop_codon 2633919 2633921 . + 0 transcript_id "g581.t1"; gene_id "g581"; # protein sequence = [MWRASQTCSSSWAQVSSPRAEEIVKEFARVVHNQKSSSIPLSSSSSPLKVRKASSAKAFAGKVIFVNKTPPGAEWADV # IDYHVSGETDKWTQRVVEDWKRMFPGDWEVQQTLLSSGLFKAVKETHNEAQVVAKGNGKGTSKAAKESKKKSPLCASDDEEENVPPLPSHSDAMILST # PDAHRLLKLKPTNNITDMVISPAPVSPSKRARTQSQSHYSAAAQASLEASPSKRRVKPLPDSGVEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g581 ### # start gene g582 Scaffold_3 AUGUSTUS gene 2635556 2636254 0.94 + . g582 Scaffold_3 AUGUSTUS transcript 2635556 2636254 0.94 + . g582.t1 Scaffold_3 AUGUSTUS start_codon 2635556 2635558 . + 0 transcript_id "g582.t1"; gene_id "g582"; Scaffold_3 AUGUSTUS CDS 2635556 2636254 0.94 + 0 transcript_id "g582.t1"; gene_id "g582"; Scaffold_3 AUGUSTUS stop_codon 2636252 2636254 . + 0 transcript_id "g582.t1"; gene_id "g582"; # protein sequence = [MAPPIRISYRKKIPQVDGVWSDVYKDNILSVSAAPIYHSVPCIGYTITESPVPGKIDPKKYIPDIKRTNTPMSVMRLL # QAGESVRLSDGTVLQGPTPRNGRKLVILGDTHDPSPMIPIAQDADLLIHEATNAHLPGIVPNTRDDDTFESIQRTAMERGHSTPQMAGAFAKRIGAAS # LILNHFSARYPGNDNVDPEAKIIMDAIGNLAAMEYGKPVTCARDLMSIDIGFRAME] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g582 ### # start gene g583 Scaffold_3 AUGUSTUS gene 2636430 2636992 0.97 - . g583 Scaffold_3 AUGUSTUS transcript 2636430 2636992 0.97 - . g583.t1 Scaffold_3 AUGUSTUS stop_codon 2636430 2636432 . - 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_3 AUGUSTUS CDS 2636430 2636880 0.99 - 1 transcript_id "g583.t1"; gene_id "g583"; Scaffold_3 AUGUSTUS CDS 2636931 2636992 0.97 - 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_3 AUGUSTUS start_codon 2636990 2636992 . - 0 transcript_id "g583.t1"; gene_id "g583"; # protein sequence = [MEYDLIAEKVNTLPSREELEKTIEALENDMVAIRDEHETQSRTIQSQKVALDGIISDLGSLRFHGGDPTVSGVPSHRG # TPSFESRASEGLEELESIQASEVTLGLSKGDEREEGEEGEEKPPELEVNGDIEMGEVEEKTKNSRARKAREDLEEGEATDASSELSEPPDNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g583 ### # start gene g584 Scaffold_3 AUGUSTUS gene 2641554 2645020 0.17 - . g584 Scaffold_3 AUGUSTUS transcript 2641554 2645020 0.17 - . g584.t1 Scaffold_3 AUGUSTUS stop_codon 2641554 2641556 . - 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_3 AUGUSTUS CDS 2641554 2642432 1 - 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_3 AUGUSTUS CDS 2642733 2643062 0.96 - 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_3 AUGUSTUS CDS 2643115 2643646 0.93 - 1 transcript_id "g584.t1"; gene_id "g584"; Scaffold_3 AUGUSTUS CDS 2643727 2644211 0.32 - 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_3 AUGUSTUS CDS 2644511 2645020 0.24 - 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_3 AUGUSTUS start_codon 2645018 2645020 . - 0 transcript_id "g584.t1"; gene_id "g584"; # protein sequence = [MQRRLLDQLDDILQVAAEVSVPSLKEEEAKEPIERQRLLSPGSERKMSQIRNWCKPIAEDSALGQLAQDVERVMRQKM # DTVVRMQNTIRYSEKIWHEWEERVVAHLATYADDSSDSESSSDEEEGNMHGPSGTREDECDDHSSTKSEYAFSGEYSSSGPTPLAPSPAPMASSTKRG # HRRHSTINPITSPPGPGGGGPLSPRNPSVAPLSRTTPTSIKDFDIIKPISKGAFGSVFLARKKATGDYYAIKVLKKADMIAKNQITNVKAERMILMKQ # AESPFVAKLYFTFQSKENLYLVMEYLNGGDCAALIKTLGALPEEWTKQYIAEVVLGLDDLKPDNLLIDQHGHLKLTDFGLSRIGLLGRQTRESQIGRP # YTRYSSRSRPPSLDSAYLSSPLFNDLNGGGSYFSQRTQAVPRFGSSPYLSSTDDVGESSGSESVGYTTRRTGKAAESPLQSFATELTTDLRSHSHSQS # NSNSTGGTPPGEQKFVGTPDYLAPETILGLRGDDAAVDWWALGVITYEFLYGIPPFHDETPEKVFENILSGHIEWHEEWVDFSDEARDFMEKLLVTDP # SARLGANGAEEVKAHPFFATIEWDKVTTTEAAFIPQLNDPESTDYFDARGAEECFSSYQETSQCCDDDGAFITDLGYWTPFSRNVDVLNCFVTVSIKS # TSFHAWHREWYSCSQPSEYGAVERFKQSHLEGVERRNSMPSRLRTASVSSAGDGSGSETWNSSVGHGTINTPPSSVHSIDLRKGPDPNDRAVTCLLAE # DNPITAKIIETLLIRLGCRCVVVADGSEAISVAMGDISKFVFVSTFPSSNKANFVAEFDCILMDLHMPVLDGEGAARYIKSTNSKNTNAPIIAISAYS # AAGEQGDSNNLFAASLAKPLQKADLIGPFFSIWSIQINLYDIISAFFDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g584 ### # start gene g585 Scaffold_3 AUGUSTUS gene 2645219 2647239 0.04 - . g585 Scaffold_3 AUGUSTUS transcript 2645219 2647239 0.04 - . g585.t1 Scaffold_3 AUGUSTUS stop_codon 2645219 2645221 . - 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_3 AUGUSTUS CDS 2645219 2645741 0.99 - 1 transcript_id "g585.t1"; gene_id "g585"; Scaffold_3 AUGUSTUS CDS 2645795 2646228 0.24 - 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_3 AUGUSTUS CDS 2646365 2646867 0.28 - 2 transcript_id "g585.t1"; gene_id "g585"; Scaffold_3 AUGUSTUS CDS 2646945 2647239 0.19 - 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_3 AUGUSTUS start_codon 2647237 2647239 . - 0 transcript_id "g585.t1"; gene_id "g585"; # protein sequence = [MPFVRRHVTRRLKAAKAECDKELQRVTNNITTFFEERLKDHEYETERDRDRDSQLGDFDHLRDQFAFQPLDINRSALQ # TDESSSEGGYEAEHEYHSRHTSSTSASMSPNSHRSRQQQNIPWERPLSASMSSGVISSSPGSSTVMLPEAPLTRKQSSAAPTSWSSQNLPSRRLSRTI # HIPSRPPRSGQSSRSTSRSRSPLPPLQSHASFSEYPVSSSPSNRRSSRILIDDPVDPIMTTLYELIGVATDITDMSVTQITAQPKCCEALFWNFDDNQ # NELDEPLTFVMKPADEFAVPAPTPTRRTEPSELEDFRLNHDNDNKLRLHRPTSHNRKSRDEHPKTLSASTAHSQEHLEHEGRSASKSHDNAESARVLA # TERLRLQAETAQNQNIVLELSLDGEHLIWINYAWSVVVGSEPEDLFGSRVSQFLHPADTQVFDTATQRLLEDDSHTVEARFRLRVEPEGDREPPAGQA # LFQQMEGKGMLMIDREDGEPSHTMWVIKPIAPPRYELESPAITLVSAGDIEPDEIPASADVSYIDAGQDVPETPFPFPQPIITDPILCRICECHIPQW # YFEKHSETAWKHIDWK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g585 ### # start gene g586 Scaffold_3 AUGUSTUS gene 2650571 2651467 0.14 + . g586 Scaffold_3 AUGUSTUS transcript 2650571 2651467 0.14 + . g586.t1 Scaffold_3 AUGUSTUS start_codon 2650571 2650573 . + 0 transcript_id "g586.t1"; gene_id "g586"; Scaffold_3 AUGUSTUS CDS 2650571 2650689 0.14 + 0 transcript_id "g586.t1"; gene_id "g586"; Scaffold_3 AUGUSTUS CDS 2650870 2651467 0.27 + 1 transcript_id "g586.t1"; gene_id "g586"; Scaffold_3 AUGUSTUS stop_codon 2651465 2651467 . + 0 transcript_id "g586.t1"; gene_id "g586"; # protein sequence = [MGSSELSDALNPYFTQPRNTHSSNANYSEPLQPVMQPSQHQAQENERKRRQAWEQEQEERYSQRQAELERQMMEMQRE # IYSLRSAFTAGPSAPTSDLQHSSYQFGSPASRPATTRSHGQYYSPISPVPQISDPFSQGSSSSPIRQYNPSTTNYPMSASSQYSSPMSPAPSSSSSPL # DSPMIMPGSDSPIGISALSPKLPSDKGSNNDDWLEDPAHNGDHYQRKCRSIQVRVFALKIID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g586 ### # start gene g587 Scaffold_3 AUGUSTUS gene 2656037 2657035 0.81 - . g587 Scaffold_3 AUGUSTUS transcript 2656037 2657035 0.81 - . g587.t1 Scaffold_3 AUGUSTUS stop_codon 2656037 2656039 . - 0 transcript_id "g587.t1"; gene_id "g587"; Scaffold_3 AUGUSTUS CDS 2656037 2657035 0.81 - 0 transcript_id "g587.t1"; gene_id "g587"; Scaffold_3 AUGUSTUS start_codon 2657033 2657035 . - 0 transcript_id "g587.t1"; gene_id "g587"; # protein sequence = [MGLAGLISAADDGEHERHERPQSKASLSSDPDVKHDDHSEHRRSRRARVPPEIWQDTISLLLDADYAVRADYANALVF # YIVHEMPKHGDVTDAETKTRFRRVADGSQTAPMNSLLHSSDLGSKFLHAVYAFVYILSSSSLNLPSTSNSSPRLSTKDELEINIEPATPLPETRIFGD # MSSQHDRRPGAFHSRTRKIAAALSRLDKSQKLSSSTSATVSDYLLIQNILIAVHQQLPVRSLMVGVPVLLALDSLCQQSECDSSEVMARVHTIRYVLA # KVWLAIGKEWGSTELQAISEKVLFLPLSLSRALNLLSSHRLSHPYHHHYFHWTPKQQK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g587 ### # start gene g588 Scaffold_3 AUGUSTUS gene 2662839 2664743 0.56 - . g588 Scaffold_3 AUGUSTUS transcript 2662839 2664743 0.56 - . g588.t1 Scaffold_3 AUGUSTUS stop_codon 2662839 2662841 . - 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_3 AUGUSTUS CDS 2662839 2664743 0.56 - 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_3 AUGUSTUS start_codon 2664741 2664743 . - 0 transcript_id "g588.t1"; gene_id "g588"; # protein sequence = [MIAWLETSSHVLNKRNMSDLPQSKSHGEVDNSIIDISGTRLSFVVVSAHQTNTTDSSIELLQSAGTIPKSFAPKTAGP # AQLFVDLGDYNSELDNTLPELRLARYAHTSARPNKPKTNPSHSARAMSTSFGSSRSAIVKKITAQTLVQRLSDEFNADSISRLLMCVCCNLKWTTRKS # VSQKLTHFKTCAKKHGVQDDTLVDLIRKGIMVSPAVQPKGKGTSIVVDDASPKTFFDEVMHDAAPKKRTRRQEVKSTVKDIAEMRNAILLKARAIVAK # GDSDVRALREHGTGEHSDSDLSINFVLSSTPRFAKSSLASRSGLQAQYMFYNDGGTHESPPSSPNTSFSPFSPPIQQLPPSPPISSSGMGEVLQPLMD # IDVHNLHTLSNNKYPVRQPMLFIEKQTDNSQVPRNSYSHSQSPISTSSRPNQATLKISKTFGTPNSPPLTPSPQKVISLTSSASPPTYSPFKDRYYTS # DEDMRQYMDDAYLHYDPEDNTHSLSTTNQPLRRTPSQLSPAPLSPKSKSRSRSTTALRKKPAIKEKIVIDAAWAEDIRNKIMKDTTLHLRILRLEVGF # CRVEFLQRVTDVSDLLLQPIHFDVFLSKIEGQDQQPSAKLKHHLREFLDKQAINFYGAEPVGRQRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g588 ### # start gene g589 Scaffold_3 AUGUSTUS gene 2669414 2669803 0.36 - . g589 Scaffold_3 AUGUSTUS transcript 2669414 2669803 0.36 - . g589.t1 Scaffold_3 AUGUSTUS stop_codon 2669414 2669416 . - 0 transcript_id "g589.t1"; gene_id "g589"; Scaffold_3 AUGUSTUS CDS 2669414 2669803 0.36 - 0 transcript_id "g589.t1"; gene_id "g589"; Scaffold_3 AUGUSTUS start_codon 2669801 2669803 . - 0 transcript_id "g589.t1"; gene_id "g589"; # protein sequence = [MTEVSMTFSNATQLFSSEGVQEPETTPTHPINTPYITDCQHTYCYHCIAERMMRNADDTHDTQGWECLRCAQIIQSAE # RFVVDPSAGTAESEVNGSDYAFSSDLDFDVTDISESIGSYSESGLSDGYST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g589 ### # start gene g590 Scaffold_3 AUGUSTUS gene 2673804 2675932 0.63 + . g590 Scaffold_3 AUGUSTUS transcript 2673804 2675932 0.63 + . g590.t1 Scaffold_3 AUGUSTUS start_codon 2673804 2673806 . + 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_3 AUGUSTUS CDS 2673804 2674136 0.63 + 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_3 AUGUSTUS CDS 2674274 2675932 1 + 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_3 AUGUSTUS stop_codon 2675930 2675932 . + 0 transcript_id "g590.t1"; gene_id "g590"; # protein sequence = [MAMKSRVATLLSKTRSSKGSVKQATIDELRTEKEELEVKVDKLQDECNIYQKNAEDARTACRQAEEVAQKAKEMQLRA # EEEKQTAIEKMEEAQRIAAEHEEETKKQISAAEELGARLSEVVDTKDAAEAARDAALEEAERARAAREEAETVAREERQARDIANERCRDAELTAETK # VQEAYTANLQREDALILLADMEQAKLKAEDSASLEKLARENAENEMRQAEALSADLAEQVRKLAEEKEGLVASLREMEFSLSRAQDELVQTQISLSDA # KDNAELGLRESERRVEELTVLVQEWRERAEDARSMKEDFERALEKSRDAQYDAQKQAEDHRKAKEKAEVEKRNAERYSQKQEAQAKKDREAAISAIAA # KDEAERNARKALEAFDEAQRKWKDGVQPATSPSESQVDALRRSRQFREGAFHVGVAGLTGTGKSSLINALMGVITGTAEAVPTGTQSTKSVGRYIDAR # RNYPHIWYDVPGAGTLTAPSWNYFHDQGLFVFDAIMVVWDNRFTDVDIAVLENCVRLKIPAFIIRTKSDVHITNIEERMRDVVEADPTLTNKDRKSRF # TVIPFSARAEYISETRQGVELSLHNANLPSMKVYLVSNKTITKIVQGDKNMRNVRVIDEFDLLNDIWALRRATSRGGGSIIPRMHNVRANTTPVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g590 ### # start gene g591 Scaffold_3 AUGUSTUS gene 2677596 2678202 0.39 - . g591 Scaffold_3 AUGUSTUS transcript 2677596 2678202 0.39 - . g591.t1 Scaffold_3 AUGUSTUS stop_codon 2677596 2677598 . - 0 transcript_id "g591.t1"; gene_id "g591"; Scaffold_3 AUGUSTUS CDS 2677596 2677984 0.4 - 2 transcript_id "g591.t1"; gene_id "g591"; Scaffold_3 AUGUSTUS CDS 2678133 2678202 0.71 - 0 transcript_id "g591.t1"; gene_id "g591"; Scaffold_3 AUGUSTUS start_codon 2678200 2678202 . - 0 transcript_id "g591.t1"; gene_id "g591"; # protein sequence = [MKDHQLFIANHLNSGEYAKDIPTIVAAGAVDTPFPAVLVKVVTGLVALVLVLELLSEGTGLLVTEATEDERTLVTLPL # ALEVADEKVDGTMTGTEEVNEIGGDGVAESVNVAVTVTDEPPGRVVVRVITPGSDSVVVIAEEEADVVSENVPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g591 ### # start gene g592 Scaffold_3 AUGUSTUS gene 2679097 2680008 0.81 + . g592 Scaffold_3 AUGUSTUS transcript 2679097 2680008 0.81 + . g592.t1 Scaffold_3 AUGUSTUS start_codon 2679097 2679099 . + 0 transcript_id "g592.t1"; gene_id "g592"; Scaffold_3 AUGUSTUS CDS 2679097 2680008 0.81 + 0 transcript_id "g592.t1"; gene_id "g592"; Scaffold_3 AUGUSTUS stop_codon 2680006 2680008 . + 0 transcript_id "g592.t1"; gene_id "g592"; # protein sequence = [MSANGHSVNPGIARTMTGLLERTRSRRTFTKDSFTSATSTPSPPSKPKTPKVEDLLAEQSRLQSELEKAVQDCKVAEK # GKAEAELRSQDSLQLLAKERQASQDVKAERDEAVKDADTSKNALRAAEERAEKAEEESRAAREQMEEELREARRLAEEMEGKLVQAEKDLAEAEQAKL # AAMTEVEAKRQALEQALQLTDRYRVAAEQMATEKSELEQVSRQSLERARLEAQSSRAALGEVERRVSEEQEAREKAERELRRRNEEVPTPHTLFGYAM # STLRSRDHTNGNSTRGSSSSSWISGCVIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g592 ### # start gene g593 Scaffold_3 AUGUSTUS gene 2682089 2683129 0.88 - . g593 Scaffold_3 AUGUSTUS transcript 2682089 2683129 0.88 - . g593.t1 Scaffold_3 AUGUSTUS stop_codon 2682089 2682091 . - 0 transcript_id "g593.t1"; gene_id "g593"; Scaffold_3 AUGUSTUS CDS 2682089 2683129 0.88 - 0 transcript_id "g593.t1"; gene_id "g593"; Scaffold_3 AUGUSTUS start_codon 2683127 2683129 . - 0 transcript_id "g593.t1"; gene_id "g593"; # protein sequence = [MTFLKFQLELSSCLPRGLLLFQIRLQTTQILSNVVLNNSPFWCASQSLKAVNTSLDMSTEHRAHSKSPRNRDARRASN # YNTDHLAEPQNTYDSSAPRFRNPFSNDNTEEMFTAPRATLPYYGNSVAYDPNINPSRPISQVPLDPSNHTSRSSASNDSPGYFNDSDKYSFSSYQHPA # DINPPPNAYPGDDHSPPPNRPLRSSVRRSVSFAKGSALREYDPDEEYQDPEKNRALKNRGLPSQMLDLFELNREMKSQHSDDSNDYDYRPYRPDFRHN # DSMVSTYSQVMDPDDPRVTGVKAKYLEDPHDIEKNTLRQMDYRHRRKHLMRVKIEFNVTCKVFDYYGLHTPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g593 ### # start gene g594 Scaffold_3 AUGUSTUS gene 2683521 2683826 0.63 - . g594 Scaffold_3 AUGUSTUS transcript 2683521 2683826 0.63 - . g594.t1 Scaffold_3 AUGUSTUS stop_codon 2683521 2683523 . - 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_3 AUGUSTUS CDS 2683521 2683826 0.63 - 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_3 AUGUSTUS start_codon 2683824 2683826 . - 0 transcript_id "g594.t1"; gene_id "g594"; # protein sequence = [MSASTPFDMPITIRKALETDAPSLSRICLLTANAGSTAEALHDFGELPGLVYAVPYVKLPTTWGFVMVDDLRDDEVVG # YIVGSTDTRAFEAYAAENTGGPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g594 ### # start gene g595 Scaffold_3 AUGUSTUS gene 2684376 2685469 0.65 - . g595 Scaffold_3 AUGUSTUS transcript 2684376 2685469 0.65 - . g595.t1 Scaffold_3 AUGUSTUS stop_codon 2684376 2684378 . - 0 transcript_id "g595.t1"; gene_id "g595"; Scaffold_3 AUGUSTUS CDS 2684376 2684944 0.78 - 2 transcript_id "g595.t1"; gene_id "g595"; Scaffold_3 AUGUSTUS CDS 2685004 2685469 0.85 - 0 transcript_id "g595.t1"; gene_id "g595"; Scaffold_3 AUGUSTUS start_codon 2685467 2685469 . - 0 transcript_id "g595.t1"; gene_id "g595"; # protein sequence = [MHLSPINPRANQDAQYEMEAAFDDDSDDEEVSESHPLTRNTNPPPTNRTPGSYDFENVDYDYPPPGSPPATSRPIPSN # FGTSNGRITTFELHPSQTAPRRTWMSRVLSNVIPSRYGERFGYTQLPHTGVVGGGTGNDGVFANITAKPGRPVTLQEGDDTYVVPEDSRNEAPPTYQS # AQADAVPPYWETTVHAPFAPDSIGEMIIDSLPTGSLFSFLWNMLVSVSFQFVGFLLTYLLHTTHAARLGSRAGLGITLIQYGFALRSRLETDAVGEDN # TWADNWGFGNNEKFPTAAEASSNDYYKSYNASFVGNSTMPSLTEEQATMLVADATTEWLSFFLMTFGAYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g595 ### # start gene g596 Scaffold_3 AUGUSTUS gene 2686313 2686531 0.91 - . g596 Scaffold_3 AUGUSTUS transcript 2686313 2686531 0.91 - . g596.t1 Scaffold_3 AUGUSTUS stop_codon 2686313 2686315 . - 0 transcript_id "g596.t1"; gene_id "g596"; Scaffold_3 AUGUSTUS CDS 2686313 2686531 0.91 - 0 transcript_id "g596.t1"; gene_id "g596"; Scaffold_3 AUGUSTUS start_codon 2686529 2686531 . - 0 transcript_id "g596.t1"; gene_id "g596"; # protein sequence = [MPPTLNLDVPPLDPDEEDEDDDGGFGVSLAIVGDVAVRFDEKTIESKMKSAPFVREVITNEWFPLARSRLDW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g596 ### # start gene g597 Scaffold_3 AUGUSTUS gene 2688587 2689409 0.17 + . g597 Scaffold_3 AUGUSTUS transcript 2688587 2689409 0.17 + . g597.t1 Scaffold_3 AUGUSTUS start_codon 2688587 2688589 . + 0 transcript_id "g597.t1"; gene_id "g597"; Scaffold_3 AUGUSTUS CDS 2688587 2689027 0.26 + 0 transcript_id "g597.t1"; gene_id "g597"; Scaffold_3 AUGUSTUS CDS 2689233 2689409 0.39 + 0 transcript_id "g597.t1"; gene_id "g597"; Scaffold_3 AUGUSTUS stop_codon 2689407 2689409 . + 0 transcript_id "g597.t1"; gene_id "g597"; # protein sequence = [MVANKLSDLPKGTSIQVFGTLPAQVQDPASSYSLDDAPPVLFYATRFEGDEVEKFSLYQSNLGLARGNHSLVITSLTD # GPDFVLDSMVFSSNFIVPSTSFTASTEIPSSSSSPPLSSGGSGSDVGAVVGGIVVGALILVGALAAFLVHGNDCTFGSSSIIPYQFGQWDMILFACEN # LVKQSVCRIYIYIVWYVTVLSTFKTQTKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g597 ### # start gene g598 Scaffold_3 AUGUSTUS gene 2692954 2693661 0.75 + . g598 Scaffold_3 AUGUSTUS transcript 2692954 2693661 0.75 + . g598.t1 Scaffold_3 AUGUSTUS start_codon 2692954 2692956 . + 0 transcript_id "g598.t1"; gene_id "g598"; Scaffold_3 AUGUSTUS CDS 2692954 2693661 0.75 + 0 transcript_id "g598.t1"; gene_id "g598"; Scaffold_3 AUGUSTUS stop_codon 2693659 2693661 . + 0 transcript_id "g598.t1"; gene_id "g598"; # protein sequence = [MLLPPIATLVEDHPTPDSPESMNLDTQQMDEDIRPPLEGPTLGNSLGTLTTLFEFYHYERRWIHQQRNSLQDDPGLDP # VSRVQESSSTDEKSSSSLSLSSGESSKLKCEPEEICISDPSTARASSTLRFSRWPWSDRIRGPFEPESGTGANPHRGLSDPRLILPPAGRRTGSSADD # TGYSLAVSQTESSPDIVILDLFENMMEARLESCQRIDKLVRRALMGVRLISIVEASLAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g598 ### # start gene g599 Scaffold_3 AUGUSTUS gene 2694733 2696047 0.91 - . g599 Scaffold_3 AUGUSTUS transcript 2694733 2696047 0.91 - . g599.t1 Scaffold_3 AUGUSTUS stop_codon 2694733 2694735 . - 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_3 AUGUSTUS CDS 2694733 2695263 0.97 - 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_3 AUGUSTUS CDS 2695451 2696047 0.91 - 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_3 AUGUSTUS start_codon 2696045 2696047 . - 0 transcript_id "g599.t1"; gene_id "g599"; # protein sequence = [MTLFCRTDVETVIHSDNDFATVAYLRIKNARLEPKPTSDAHAQLTVPPILDEDFEAVRTSITEVEPHSFAVHLSESVP # HSLDFTTATKSNGKWVAVTNVQIECSADASIEDEITQCFHLLQGLNFMAYYQSNSSLIHLQSGLPPIIYHSPTAPLSTSSFHQWMISPALIRYMLHSL # VQALRPEPASRSTYPRVFAPGSIAGERLLISGQIGLLPSSIALPSPRSLATETALAIQHADRVVAALRNGWEGHTQMAIYWLSEVGYINAVRKAIDVY # DRDKVRGSSDVMLSSFRVTKYLSFLLEVSVKLLVAVKTLPKGALVEKQVMAHTGRAWIEEEDSDYDSDEKKELVLKTVQPIFEQGLSSFHVARFFIDK # GAH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g599 ### # start gene g600 Scaffold_3 AUGUSTUS gene 2699607 2700635 0.93 + . g600 Scaffold_3 AUGUSTUS transcript 2699607 2700635 0.93 + . g600.t1 Scaffold_3 AUGUSTUS start_codon 2699607 2699609 . + 0 transcript_id "g600.t1"; gene_id "g600"; Scaffold_3 AUGUSTUS CDS 2699607 2700635 0.93 + 0 transcript_id "g600.t1"; gene_id "g600"; Scaffold_3 AUGUSTUS stop_codon 2700633 2700635 . + 0 transcript_id "g600.t1"; gene_id "g600"; # protein sequence = [MPMLRWLSALIRLDSDSADSPDLADIQDEAAALLAICAGTASAGTVRRHFEFDSGRIQITLSDVPLSTNASNGDYFGS # VGAQTWGGACVLAEEIADNTVVFFPNPADVKDVSERIFRVLELGAGTGLVSLVAGKAAMLKIPECKMDIISTDYYPSVLDNLKANIEANFPVPSPSLT # ISSQFLDWSSFSSPSDISSGADTSSTVGLFDVIFGADIIYEPLHASWIRKVVQNTLRKPSSSEKDCPDRNNNNNNGQGGVFHLVIPLRPTFVAESNTI # EQEFRFAGPGLDKVKNDLVILSREIIVCDAEEEEEDDIDQYSVSDDVGNQAGEGNIVRYAYYIIGWAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g600 ### # start gene g601 Scaffold_3 AUGUSTUS gene 2712062 2713086 0.9 + . g601 Scaffold_3 AUGUSTUS transcript 2712062 2713086 0.9 + . g601.t1 Scaffold_3 AUGUSTUS start_codon 2712062 2712064 . + 0 transcript_id "g601.t1"; gene_id "g601"; Scaffold_3 AUGUSTUS CDS 2712062 2712195 0.9 + 0 transcript_id "g601.t1"; gene_id "g601"; Scaffold_3 AUGUSTUS CDS 2712261 2713086 0.96 + 1 transcript_id "g601.t1"; gene_id "g601"; Scaffold_3 AUGUSTUS stop_codon 2713084 2713086 . + 0 transcript_id "g601.t1"; gene_id "g601"; # protein sequence = [MKLINKYVDKHGAGHVTLRPEDDEDMWHLYNLIQKGDSVRAPAIRRVQKTSATGSIDSQRIRLNLTLEVTNVEFSSYS # AAAEQSSSTDPSGSNNSAALQIAGRVIVENPHVKLGAFHTLDIEANRDVRIEKADGWDSIALSRVQEAIVPGRGAEVGAIVCGEGTAAFCLLSEHMTL # VTHRISVPIPRKAASAGSSQHEKALTKFYGVLYDAFIRHIPFGNVGLKAIVFASPGWVRDAVYDYVMQEAGRRNDKVLQRALKEKGIKIHISSPHVHS # LVEVLKSPEVNSLSFVLNLVLTCGPQISAQLKETKFAREGLTLDK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g601 ### # start gene g602 Scaffold_3 AUGUSTUS gene 2716185 2716602 0.67 - . g602 Scaffold_3 AUGUSTUS transcript 2716185 2716602 0.67 - . g602.t1 Scaffold_3 AUGUSTUS stop_codon 2716185 2716187 . - 0 transcript_id "g602.t1"; gene_id "g602"; Scaffold_3 AUGUSTUS CDS 2716185 2716523 0.83 - 0 transcript_id "g602.t1"; gene_id "g602"; Scaffold_3 AUGUSTUS CDS 2716582 2716602 0.76 - 0 transcript_id "g602.t1"; gene_id "g602"; Scaffold_3 AUGUSTUS start_codon 2716600 2716602 . - 0 transcript_id "g602.t1"; gene_id "g602"; # protein sequence = [MLPTRENDYEDESTFYSQEALLRDHAYFTTPSNSGTRLGDTAVLQSRVTELESEVALLRGQLGQAKGVNDLMWGLSST # RSFMVKPRVQTTRMVNQQKMRDNGSGGESIQIWRYICNCYT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g602 ### # start gene g603 Scaffold_3 AUGUSTUS gene 2723973 2724581 0.77 - . g603 Scaffold_3 AUGUSTUS transcript 2723973 2724581 0.77 - . g603.t1 Scaffold_3 AUGUSTUS stop_codon 2723973 2723975 . - 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_3 AUGUSTUS CDS 2723973 2724581 0.77 - 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_3 AUGUSTUS start_codon 2724579 2724581 . - 0 transcript_id "g603.t1"; gene_id "g603"; # protein sequence = [MSGNVSPHTSVIISSSPSRLASSTPGPNAPLYDGCHNSTQPQASAASAVKQWGQAGFPLNKQVLGVPYYGYLSNSNAT # RLRTRASSPSVRLTADEGADQGSVTFRNLVKQGALVASPSSDGRRRTFTASSGFNRYWDECSATPFLRSQTSRQLVSYDDPESLHMKGQFVKKMGMLG # TNTWDMSGDTPQNDLVVALMDGLFSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g603 ### # start gene g604 Scaffold_3 AUGUSTUS gene 2726230 2727727 0.77 + . g604 Scaffold_3 AUGUSTUS transcript 2726230 2727727 0.77 + . g604.t1 Scaffold_3 AUGUSTUS start_codon 2726230 2726232 . + 0 transcript_id "g604.t1"; gene_id "g604"; Scaffold_3 AUGUSTUS CDS 2726230 2726252 0.92 + 0 transcript_id "g604.t1"; gene_id "g604"; Scaffold_3 AUGUSTUS CDS 2726336 2726471 0.93 + 1 transcript_id "g604.t1"; gene_id "g604"; Scaffold_3 AUGUSTUS CDS 2726854 2727011 1 + 0 transcript_id "g604.t1"; gene_id "g604"; Scaffold_3 AUGUSTUS CDS 2727058 2727727 0.85 + 1 transcript_id "g604.t1"; gene_id "g604"; Scaffold_3 AUGUSTUS stop_codon 2727725 2727727 . + 0 transcript_id "g604.t1"; gene_id "g604"; # protein sequence = [MCDQFAILHTDICKFAIFEDNKVMFDAQILQLLDERLIKVFNYVNVGLDLERRAAPTDVDDEAEIEIVEETPYILPPS # HSLLGVPPPTVIEGRAINFLETDVGISEGASSFNLTTTRTKFFFRFTDFLVNEVDLDGNVIHLKSLAMPESSKKNSAELSSIIAGNNQTDSNTIDGAK # EVPAAKSDERADAAPTISTSEPANSKPEVKMPKEPWPESFNTELAPYLSEAAILQLKEMFLQGPEPPRVPDSGWGGRTGKGSPEDVSSSAVEISSAEP # ESNDRGKRGRGRGRDRGRGGRGGGRGVAQRERTIAKSFPKFVRLITIICSRIYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g604 ### # start gene g605 Scaffold_3 AUGUSTUS gene 2729432 2729761 0.83 + . g605 Scaffold_3 AUGUSTUS transcript 2729432 2729761 0.83 + . g605.t1 Scaffold_3 AUGUSTUS start_codon 2729432 2729434 . + 0 transcript_id "g605.t1"; gene_id "g605"; Scaffold_3 AUGUSTUS CDS 2729432 2729761 0.83 + 0 transcript_id "g605.t1"; gene_id "g605"; Scaffold_3 AUGUSTUS stop_codon 2729759 2729761 . + 0 transcript_id "g605.t1"; gene_id "g605"; # protein sequence = [MTWSVMRYTDPDVPLAQADEDKLLGFDPPVIDEQGKFMALQINLTLGTASYATMALREITKTETSSHYQTSLTNAAED # QKYRGVADGDIEMDQGTAVVGDAEDAAVETV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g605 ### # start gene g606 Scaffold_3 AUGUSTUS gene 2732820 2733461 0.39 - . g606 Scaffold_3 AUGUSTUS transcript 2732820 2733461 0.39 - . g606.t1 Scaffold_3 AUGUSTUS stop_codon 2732820 2732822 . - 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_3 AUGUSTUS CDS 2732820 2733461 0.39 - 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_3 AUGUSTUS start_codon 2733459 2733461 . - 0 transcript_id "g606.t1"; gene_id "g606"; # protein sequence = [MCIAPLVCLDFHLTLRNISEYLLWTDDSSREFIAENYPWFLDTFNDYKYAIQRADAIRYFVLHHYGGVYLDLDVGCLR # PLDPLLVYPVILPKTIPVGVSNDLMFAEKGHPFLAQTIHNLVTFDHNWILNYPTVMFSTGPMFLSAQYGIYTSSHAGAQGDPVRILPKSLYGKNAKEG # EAPDSFFSHFYGSSWHADDAAFIGFLGHWARSCCGLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g606 ### # start gene g607 Scaffold_3 AUGUSTUS gene 2735741 2736208 0.26 - . g607 Scaffold_3 AUGUSTUS transcript 2735741 2736208 0.26 - . g607.t1 Scaffold_3 AUGUSTUS stop_codon 2735741 2735743 . - 0 transcript_id "g607.t1"; gene_id "g607"; Scaffold_3 AUGUSTUS CDS 2735741 2736208 0.26 - 0 transcript_id "g607.t1"; gene_id "g607"; Scaffold_3 AUGUSTUS start_codon 2736206 2736208 . - 0 transcript_id "g607.t1"; gene_id "g607"; # protein sequence = [MEQINVNKEAIRTCKITGGVEFEDLVEAATTIAFCPNPGMISVQAVGLSYKDNKRAGIESDDGDHIKPELLLEKVVSV # RGGVEKLVQGYKLSKVESGTVDMDDPGATKLIMEKNEYMDIVGKFKKALGKANLKLVEDAFQAHIGVLFDAFCNSQC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g607 ### # start gene g608 Scaffold_3 AUGUSTUS gene 2738354 2739456 0.41 + . g608 Scaffold_3 AUGUSTUS transcript 2738354 2739456 0.41 + . g608.t1 Scaffold_3 AUGUSTUS start_codon 2738354 2738356 . + 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_3 AUGUSTUS CDS 2738354 2738473 0.42 + 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_3 AUGUSTUS CDS 2738551 2739456 0.8 + 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_3 AUGUSTUS stop_codon 2739454 2739456 . + 0 transcript_id "g608.t1"; gene_id "g608"; # protein sequence = [MDGEPDVMTVENGVYELQVTVPLKNVTGDVEPGDVDAKATVRTVSKLHTSYSTSAVRPQYIDSYVSFPSVLLHMLTYS # ACDQINISGKENKLDEPLSDAIDKVKAWFGDHNNLNQIDYRLATVKSIKVDADPNGLLQPKSFIFAASGEKDDGVLSIFIQTVGSGSPSGNLAATFTS # TSATPIHPIPKDQDASIIISHETFSRGVYLKQLEAYRVDRKLGDDKKAKEETVAKGFKYTFYLESDWDVQLNDVPQRSLFGTSSHFESFHVKLQESPC # TMTIQDGQAKVQLAYSHDCDWYSIQHLNQYMGMGPSSKYTYGTVRVAVNVDQVNGYLQSNDTLTDAM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g608 ### # start gene g609 Scaffold_3 AUGUSTUS gene 2740484 2741266 0.74 + . g609 Scaffold_3 AUGUSTUS transcript 2740484 2741266 0.74 + . g609.t1 Scaffold_3 AUGUSTUS start_codon 2740484 2740486 . + 0 transcript_id "g609.t1"; gene_id "g609"; Scaffold_3 AUGUSTUS CDS 2740484 2741266 0.74 + 0 transcript_id "g609.t1"; gene_id "g609"; Scaffold_3 AUGUSTUS stop_codon 2741264 2741266 . + 0 transcript_id "g609.t1"; gene_id "g609"; # protein sequence = [MSQKKPNTGPIPSNPSDPGKVKVSPEDYSQGELAYEIVEHMYVQLQTEIDHRASLGIPYDPHLGAAFLAVSQTRADLR # ERIDDYKAYLEPDKVFDKVLENYPKDSMKKEGVWLGEGNDPFVNTAKGIFSDVNSFAQENFPAKEAAVTWLEDYRLQSGINEQLEKAGALNPAGNVGG # GQAPKIEELQNSRMRKDLEEERRAEERAERLWKAETGRLKDMNGKEIKPSEIDMTQAQRDRTRKRADKERKKLEDWEKHVKRNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g609 ### # start gene g610 Scaffold_3 AUGUSTUS gene 2743063 2743749 0.69 - . g610 Scaffold_3 AUGUSTUS transcript 2743063 2743749 0.69 - . g610.t1 Scaffold_3 AUGUSTUS stop_codon 2743063 2743065 . - 0 transcript_id "g610.t1"; gene_id "g610"; Scaffold_3 AUGUSTUS CDS 2743063 2743749 0.69 - 0 transcript_id "g610.t1"; gene_id "g610"; Scaffold_3 AUGUSTUS start_codon 2743747 2743749 . - 0 transcript_id "g610.t1"; gene_id "g610"; # protein sequence = [MNPHDHKNPRWSSRVLGTFLFGSQFEESIFQQWRPSYTEESIVIARSDDDMGMDMDVDTNDAQGSELYQSDARTLLHS # QVIDIFVALLRELVAADQRDLQTKAREGAAASIHAPSTLRSIHAPKRDVKVSDMAFEDILNYVAHPPGCRPINLREGNLSLTRFLSKPYQAYTGWRNG # NDWSRQDWLIALKKLKEIGEAWGKRGADIVNILKYDLLPHIQVVFCDDDIRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g610 ### # start gene g611 Scaffold_3 AUGUSTUS gene 2746181 2746627 0.68 + . g611 Scaffold_3 AUGUSTUS transcript 2746181 2746627 0.68 + . g611.t1 Scaffold_3 AUGUSTUS start_codon 2746181 2746183 . + 0 transcript_id "g611.t1"; gene_id "g611"; Scaffold_3 AUGUSTUS CDS 2746181 2746627 0.68 + 0 transcript_id "g611.t1"; gene_id "g611"; Scaffold_3 AUGUSTUS stop_codon 2746625 2746627 . + 0 transcript_id "g611.t1"; gene_id "g611"; # protein sequence = [MHSSSIATFWFQSSVPLTINPGQAAILSFADLLGKPKYAHMAPSNPKSLNDDRVRTWTVSDSSTHEFALTMREIPGGV # VTGALFNLARALAKSRPELLTNTSDLEIRLGLVGFSGSFCLPSPAKDSEVKLLWIAGGIGFTPFYACSKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g611 ### # start gene g612 Scaffold_3 AUGUSTUS gene 2752632 2753471 0.35 + . g612 Scaffold_3 AUGUSTUS transcript 2752632 2753471 0.35 + . g612.t1 Scaffold_3 AUGUSTUS start_codon 2752632 2752634 . + 0 transcript_id "g612.t1"; gene_id "g612"; Scaffold_3 AUGUSTUS CDS 2752632 2753471 0.35 + 0 transcript_id "g612.t1"; gene_id "g612"; Scaffold_3 AUGUSTUS stop_codon 2753469 2753471 . + 0 transcript_id "g612.t1"; gene_id "g612"; # protein sequence = [MQRMRSGSGTSRTTNTSDSGEYENGLAAPHSHSSLSSSPSSQPSASSHSHYHPPTLGHSASASATFPGQLNPPANPAS # ALSQLASRVRERDADAMEKYMRRNRSESSSTDNKSINGSYTSAGPSTNGDNFTSLGVFPSSGSTTPKRLRPSISASHLRSAEPPLSPTPEQPEIRTRS # GTGPSSSRPSPRPLPTLNRSSSTSNSPQPLSNQSRVHEEPGSFTGPPSQYAQFPEPPLPSEDNSTPTAGRRMAFHSLAKPLPGLDTLTAGHRRGMSAA # SFRGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g612 ### # start gene g613 Scaffold_3 AUGUSTUS gene 2763125 2765110 0.35 + . g613 Scaffold_3 AUGUSTUS transcript 2763125 2765110 0.35 + . g613.t1 Scaffold_3 AUGUSTUS start_codon 2763125 2763127 . + 0 transcript_id "g613.t1"; gene_id "g613"; Scaffold_3 AUGUSTUS CDS 2763125 2765110 0.35 + 0 transcript_id "g613.t1"; gene_id "g613"; Scaffold_3 AUGUSTUS stop_codon 2765108 2765110 . + 0 transcript_id "g613.t1"; gene_id "g613"; # protein sequence = [MNSPKCTPWSALHFSAHFDLASTCSEIIYQTPQKRHKKFLRSLFLSKLRSRGSGSNKDYILDIQDDYERTPLMIAASR # GNFDMVRMLLGHNVDVDARDLHARTPLSYAMGSRSKEVVELLLKQGVQDVNAKDIFGRTLLFDAVDSGSTDLVLLLLHYHDNVRLNAEDHSRRSALSH # VAQYGYSDVVKILLQDEGIDVNQRDGKGMVPLLYASMEGHALVTRILCDRKDISINASNDDGRCSLSLAAQRGYESVVKYLLASPEIDVNLADLKLRT # ALSFGAQHGRTEIVRALLSRKEVAVNRRDILGRSPLSYAADQTTKGEEVVSLLLAAGADEDSVDNFGLTPLKYALKRGNRGIVNILLSCPTLSLRTTA # GSRSILSYAAEYGWTDMIENMMEHPEIDLNEKDDQGMDVLAYATMKGHLEIVHLLLARYETDITSSDVHHKTPLHHAASFGSEPIVKLLISKLSSAYI # NQLDDLGRSPLSLASLNGHLDVVKTLLPLKDLHINSTDKSGLTPLFHAASSGHLEIVRLLLQQQDLEIWSLNYQGQSVLTEVAKQGHVDVLSLLLAHS # GASRMVDLKDGNFRTPLSYAAQHGRTEVVRRLLECPEVDPQSKDCLNTVFEYAAEMKYRRDVGVGSYINVMTMVSSATNQGPKAMRFDVQTFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g613 ### # start gene g614 Scaffold_3 AUGUSTUS gene 2765425 2766301 0.58 - . g614 Scaffold_3 AUGUSTUS transcript 2765425 2766301 0.58 - . g614.t1 Scaffold_3 AUGUSTUS stop_codon 2765425 2765427 . - 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_3 AUGUSTUS CDS 2765425 2765853 1 - 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_3 AUGUSTUS CDS 2765930 2766301 0.58 - 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_3 AUGUSTUS start_codon 2766299 2766301 . - 0 transcript_id "g614.t1"; gene_id "g614"; # protein sequence = [MVLPDGTTKISPDLSERTMLAHASYINSCTGLSLKSDQVANLLSKMSLFPNVSTTNADEIEVSMPPTRPDIFHECDIM # EDAAIAYGFNNLPHTFPPTTTVGQPSTINKLSDIVRLEWALAGWVECSHEENFAFLNHEDDNNTAVKIANPKTLEFQVVRTTLIPGLLKTIRENRSHS # LPLKIFETGDVVFKDIKRERQSRNERHAAAVWCNKTAGFEIVHGVFDRAMKMLEIPRISSSDSNAETGYYMKETSGTLLPVSKYPIFFSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g614 ### # start gene g615 Scaffold_3 AUGUSTUS gene 2768209 2768877 0.5 + . g615 Scaffold_3 AUGUSTUS transcript 2768209 2768877 0.5 + . g615.t1 Scaffold_3 AUGUSTUS start_codon 2768209 2768211 . + 0 transcript_id "g615.t1"; gene_id "g615"; Scaffold_3 AUGUSTUS CDS 2768209 2768877 0.5 + 0 transcript_id "g615.t1"; gene_id "g615"; Scaffold_3 AUGUSTUS stop_codon 2768875 2768877 . + 0 transcript_id "g615.t1"; gene_id "g615"; # protein sequence = [MKRKSKTGGVSQILRKKQKTKGKSRAIDDSESEEPLSEEYAEVNNTSGATPGIRLRQTAALDLDGDSHMREGDDENDD # DDDNDDDDYIPKPRKNEKARAKTIHFSLEIEDDEEEKPKPLLHLKYQGFKILGSCLCIVVEPWPPLHASSRAPSILRSTPRAPSIAPRDFVTANEAQR # HLSFFLTLMSGIEVRHRSQMLFMYAHFRCMIMRVWMRTWMMLTMEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g615 ### # start gene g616 Scaffold_3 AUGUSTUS gene 2768991 2770998 0.48 - . g616 Scaffold_3 AUGUSTUS transcript 2768991 2770998 0.48 - . g616.t1 Scaffold_3 AUGUSTUS stop_codon 2768991 2768993 . - 0 transcript_id "g616.t1"; gene_id "g616"; Scaffold_3 AUGUSTUS CDS 2768991 2770294 0.96 - 2 transcript_id "g616.t1"; gene_id "g616"; Scaffold_3 AUGUSTUS CDS 2770419 2770998 0.48 - 0 transcript_id "g616.t1"; gene_id "g616"; Scaffold_3 AUGUSTUS start_codon 2770996 2770998 . - 0 transcript_id "g616.t1"; gene_id "g616"; # protein sequence = [MFLNKQDRPGASFKLSIRSLLTHRLHPHPMVLTLPIASFDPQDYMHAEPGIQGLVDLLKWEIWRWNEAGESTCYPLPT # DVQALEELEFIPSHHPIIPQLAPARTQLLENLSMFSEDLMETLLALPSEPSSYLGIKYSDIIPHLRKSTLENKILPVVCGSAIKHIGTSIAMDYVGEL # FASPLDVPHDSAKNAPLRKLTRQSAVLNATRNQKEKVSKLLLMYASEPVEVDELPFGAVGVVLGLKFTRTGDTLVSPGAPPSARSVMQDIVPPKAVIS # ASVIPHSHSDLEPVQNALESLSRTDPSVRYDLQEGQILVHGLGALHLEIVEGRLRSEFQANFELGKRRVSYRESLGPNYDPPHYEKPLITNNDKADIA # GTSVVVALDIRPLQDDEEGSPLWDGNLVLNKAGVAIPSPESSSTANPELLIASGIATALSSSPHSSLPMSHLRIQIREWSTPSPLSLLTGASAIIMRN # RIRKAGMGSLMEPYSFFKVAATEDTLGKVVKDLTEHGAELQDLGDGISDGMDEVVGYPVEGNYIPPDMLSPSSSNLTGSGASPKLRRFVHALAPLSQM # LDYNSRLRALSGGHGQFDMVNAGFRVSSLNLEKWRYYVKSEEHKYFHYFLHLVLDITLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g616 ### # start gene g617 Scaffold_3 AUGUSTUS gene 2775005 2775664 0.75 + . g617 Scaffold_3 AUGUSTUS transcript 2775005 2775664 0.75 + . g617.t1 Scaffold_3 AUGUSTUS start_codon 2775005 2775007 . + 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_3 AUGUSTUS CDS 2775005 2775664 0.75 + 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_3 AUGUSTUS stop_codon 2775662 2775664 . + 0 transcript_id "g617.t1"; gene_id "g617"; # protein sequence = [MVEAGVSQNDLQQILNQLRTLMRSNVQASALPPPPPTHTQQWSSTSYPTIPASMPLPPPATAPVTFNTTPVYPLANFK # SETYVSANPSSGIAPTPVPTIAAAGSSTQTPDFAGLLSSLMKAGVVTANSTPTGAGATTHDDSTADMLEAVNQSRETARAYRKSVLSHSVQLTAAAIT # KYVLFLPWSNNININHYLELGRPSTICSTNNLELNVNNAAFDF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g617 ### # start gene g618 Scaffold_3 AUGUSTUS gene 2781098 2781463 0.77 - . g618 Scaffold_3 AUGUSTUS transcript 2781098 2781463 0.77 - . g618.t1 Scaffold_3 AUGUSTUS stop_codon 2781098 2781100 . - 0 transcript_id "g618.t1"; gene_id "g618"; Scaffold_3 AUGUSTUS CDS 2781098 2781463 0.77 - 0 transcript_id "g618.t1"; gene_id "g618"; Scaffold_3 AUGUSTUS start_codon 2781461 2781463 . - 0 transcript_id "g618.t1"; gene_id "g618"; # protein sequence = [MWGLNRFERPAWSTGILIPLGFLCGIGSAVVIALGSAKTKRTAEVEQRLKDALALYHGSEDHGSNTEIADTDVADNIP # RRSGSTSLRAIPEGSSHVGGQAMQEKSSIKEENGFVPQKELSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g618 ### # start gene g619 Scaffold_3 AUGUSTUS gene 2783454 2783945 0.47 - . g619 Scaffold_3 AUGUSTUS transcript 2783454 2783945 0.47 - . g619.t1 Scaffold_3 AUGUSTUS stop_codon 2783454 2783456 . - 0 transcript_id "g619.t1"; gene_id "g619"; Scaffold_3 AUGUSTUS CDS 2783454 2783945 0.47 - 0 transcript_id "g619.t1"; gene_id "g619"; Scaffold_3 AUGUSTUS start_codon 2783943 2783945 . - 0 transcript_id "g619.t1"; gene_id "g619"; # protein sequence = [MSWKGWVKMAFQQPLVPVLPVARELISKTKWIASKSTAAVIEHTSPPKSTQHKAIANVSHANNGTEEEKGHETLPSLP # SFLDAPPPPPPRHWKKTSHRKVEAATILGAGPLTVDPEPIDDEEFGAANVSRPPGRKRVLSLFSRSSSKSGKIETAINGVCHFKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g619 ### # start gene g620 Scaffold_3 AUGUSTUS gene 2785776 2786433 0.21 - . g620 Scaffold_3 AUGUSTUS transcript 2785776 2786433 0.21 - . g620.t1 Scaffold_3 AUGUSTUS stop_codon 2785776 2785778 . - 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_3 AUGUSTUS CDS 2785776 2786211 0.87 - 1 transcript_id "g620.t1"; gene_id "g620"; Scaffold_3 AUGUSTUS CDS 2786319 2786335 0.25 - 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_3 AUGUSTUS CDS 2786416 2786433 0.32 - 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_3 AUGUSTUS start_codon 2786431 2786433 . - 0 transcript_id "g620.t1"; gene_id "g620"; # protein sequence = [MYFRYIAADNEQAVKFIRDQAEAILATEATIDSDEQKTQNPAHVAASAIRKIVGDAFKSGSDNSKVHVTKAETSAHFN # PMDGWSESVSLRKSHCCLLLKPQIVLRNRGEVDETCVVAALQAKLQSFAIMDDANADDPVTGKIMTRLEDMWSPMLFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g620 ### # start gene g621 Scaffold_3 AUGUSTUS gene 2788283 2789185 0.72 - . g621 Scaffold_3 AUGUSTUS transcript 2788283 2789185 0.72 - . g621.t1 Scaffold_3 AUGUSTUS stop_codon 2788283 2788285 . - 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_3 AUGUSTUS CDS 2788283 2789185 0.72 - 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_3 AUGUSTUS start_codon 2789183 2789185 . - 0 transcript_id "g621.t1"; gene_id "g621"; # protein sequence = [MDREDAFAVKVNNILATQGAQTPERDADWEFSTHHSVSIQDARDRLDQVHVLDWVMRLERLKNEQKEVQAELFRQLHP # SPTSRGINIPTIIPCTPVKEDPPLIRTTITNLSMIISRPTFPPECTPDFLFEQGQLPKDTQYSLLIPLHLHYSVSSFQVTLRDYPLAMVDIPAHPDPT # LAALEFDTDLVIAEEMGTDLSIDWVECPIILPETEYLDVEPFYLMVPKTIMPVKTYANPEVKVTTADPTTFCWGVSYGPATQDLMRIVDTLSSSPRDP # SPPLGFWDKVYDLAALFMNSLTLRGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g621 ### # start gene g622 Scaffold_3 AUGUSTUS gene 2790281 2791357 0.75 - . g622 Scaffold_3 AUGUSTUS transcript 2790281 2791357 0.75 - . g622.t1 Scaffold_3 AUGUSTUS stop_codon 2790281 2790283 . - 0 transcript_id "g622.t1"; gene_id "g622"; Scaffold_3 AUGUSTUS CDS 2790281 2791357 0.75 - 0 transcript_id "g622.t1"; gene_id "g622"; Scaffold_3 AUGUSTUS start_codon 2791355 2791357 . - 0 transcript_id "g622.t1"; gene_id "g622"; # protein sequence = [MSFVSLSTSPDANLDSYRLIVEDINVNVGLSNFDRNLLHRKLAGRNDPKEAFDSDIYSLDMNVNGIQLTRTSGRDKLR # LVNVGPLGLNIVTTQWPSPLLVTSPFLGGDPNAPTVLFKLGVDSVSVTDRLDSLLELVEQIPHNEKSIPPAQPSFSLIPVPRIEIEVSCGPIQTQLLV # GSPESPHTIEMRTDGFLLLINSHFDNRYPLVASTLAEFDKLLLRMVFELSFIWKPTFIRIRSRQSKRASVVSDFAEDPALVSLDAIEAVGKGDILAEI # RDDTQNTPSIDLSTLVSDISFSSDALCLELWHPEVLDALVELLEVLPSAVKEGNSHKSLQARLPLGCSATVSLSRFVILLQPLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g622 ### # start gene g623 Scaffold_3 AUGUSTUS gene 2802591 2803360 0.34 - . g623 Scaffold_3 AUGUSTUS transcript 2802591 2803360 0.34 - . g623.t1 Scaffold_3 AUGUSTUS stop_codon 2802591 2802593 . - 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_3 AUGUSTUS CDS 2802591 2802944 0.42 - 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_3 AUGUSTUS CDS 2803037 2803360 0.34 - 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_3 AUGUSTUS start_codon 2803358 2803360 . - 0 transcript_id "g623.t1"; gene_id "g623"; # protein sequence = [MARSKELVPGVGRFSRSQVAAKRGLYKGLKKSEKPAVEPTPETVEKTIGGNNNGEKRIVPTSKAPRFYSAEDVRQPKK # SRKTAKPPQLRSSITPGTVLILLAGRFRGSAYVIATSTKVELEGIKVRLYVIQCLRLSLIILYQLSEELNDAYFAKPSSKGAKSAEEEFFEEGKPKEK # EAFPASKAALQKEVDSTLITAIKKTENLVKYLRSTWGLSKGQYPHQMAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g623 ### # start gene g624 Scaffold_3 AUGUSTUS gene 2813698 2815070 0.81 + . g624 Scaffold_3 AUGUSTUS transcript 2813698 2815070 0.81 + . g624.t1 Scaffold_3 AUGUSTUS start_codon 2813698 2813700 . + 0 transcript_id "g624.t1"; gene_id "g624"; Scaffold_3 AUGUSTUS CDS 2813698 2814175 0.81 + 0 transcript_id "g624.t1"; gene_id "g624"; Scaffold_3 AUGUSTUS CDS 2814682 2815070 0.98 + 2 transcript_id "g624.t1"; gene_id "g624"; Scaffold_3 AUGUSTUS stop_codon 2815068 2815070 . + 0 transcript_id "g624.t1"; gene_id "g624"; # protein sequence = [MVCKDLWALHLSLLQDPPPSEPFFDARPTRSFTPNLAKGKVQPDHQPSNIRSKTKSRLHSTETRPSSPLPSDSPSSSS # SEHDVPGDAKDSDDDDDQDSGVGGVGKKRSEEQEDSEDSEMAELMRENSESEDDDDSELNDADSKGQRRGEAGEKRRKRGHTTLYAMTKSLSHRLSLP # MVLHQSLAPRMQNLQARDPQTHNLDNAPVEASLLATVIVVLKMVYGLDGKRRQAISNSVVAGADFFFRSRSPKDSNDPAFALPCIEDYLALVRHMGDV # DPRKEAIFNSEKPM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g624 ### # start gene g625 Scaffold_3 AUGUSTUS gene 2815781 2817603 0.42 + . g625 Scaffold_3 AUGUSTUS transcript 2815781 2817603 0.42 + . g625.t1 Scaffold_3 AUGUSTUS start_codon 2815781 2815783 . + 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_3 AUGUSTUS CDS 2815781 2816886 0.51 + 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_3 AUGUSTUS CDS 2817012 2817603 0.68 + 1 transcript_id "g625.t1"; gene_id "g625"; Scaffold_3 AUGUSTUS stop_codon 2817601 2817603 . + 0 transcript_id "g625.t1"; gene_id "g625"; # protein sequence = [MRRFASVFISSKREKNEKTSKRSTLNVRTQPAPSDITTFDSSLSTPQLSAGGSEPAHSSASSAGSVNLQTPEDIPISL # VNSKKTWIPWRAKKSGTIKANGRHESNWTPLPPPLLHTPPPGTRAPIVTHNDPNSDSESDAYGEEDDPRPIKPVLAKPIITPASQSKAQAVLQALIQN # SLISRPSSAPFVVQPGAPPYPRSSNRSRSVPSTNSLARTVLKRRMLQRLQDANPSSSEAKEIIAFSTRDTPRLEAPIDIDMIDENALSTFDHTASFSI # GLRSWINRPPFEDRFSVWSVVDGNITCQRVSNTPGFALAALEFSEAIEAEADVFGDIPPFQSSAESHLNVRSAAISDAPSSSSSASSHISCECGPTSS # SDGPQKEPLIQVLSATLPASKNTTSASPASLTEMTETSSPASNHNAIKRGVRFVEEEKDENIPIGYVMRHKKQREEKARFLREQKEKREFEEERARVE # EERKKRDAERRKWEQERLVWEREKRLKDEERKRKQYAEEVTAARQRAESSRMGMRSSSSASLREPERNLLASKRSSRGSEGATDSAKTGFGIVFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g625 ### # start gene g626 Scaffold_3 AUGUSTUS gene 2823838 2824185 0.56 + . g626 Scaffold_3 AUGUSTUS transcript 2823838 2824185 0.56 + . g626.t1 Scaffold_3 AUGUSTUS start_codon 2823838 2823840 . + 0 transcript_id "g626.t1"; gene_id "g626"; Scaffold_3 AUGUSTUS CDS 2823838 2824185 0.56 + 0 transcript_id "g626.t1"; gene_id "g626"; Scaffold_3 AUGUSTUS stop_codon 2824183 2824185 . + 0 transcript_id "g626.t1"; gene_id "g626"; # protein sequence = [MAVTLGNSDYDGDKALCIYQPEIVDSFSNANPNYGDPRDDIKANCFSEHTETVAELLAGVPASSENSMKRLHALQEYL # IGGIRTASLVGQASNMHDFLIYTHGLRDEETIRLAHM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g626 ### # start gene g627 Scaffold_3 AUGUSTUS gene 2826853 2827503 0.36 + . g627 Scaffold_3 AUGUSTUS transcript 2826853 2827503 0.36 + . g627.t1 Scaffold_3 AUGUSTUS start_codon 2826853 2826855 . + 0 transcript_id "g627.t1"; gene_id "g627"; Scaffold_3 AUGUSTUS CDS 2826853 2827503 0.36 + 0 transcript_id "g627.t1"; gene_id "g627"; Scaffold_3 AUGUSTUS stop_codon 2827501 2827503 . + 0 transcript_id "g627.t1"; gene_id "g627"; # protein sequence = [MYGFHKIPHLQQGALRSSSEAEYSQFAHPDFHRGQEDRLILIERKKQTTMHPKEQGVVDFPSVAPQAVPQPQTTDHST # DQALDIHAIINGIAAIRRHQVNLSSELNELKSSNQLLWQESMEARSRHQKQQDTLNSIIKFLAGVFGHQAANSGAKEKERGGPSSHSVVRGSRLMIED # KKRDLATRVGIVEVQDEEAGSPASRAESPGVQIILLGTYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g627 ### # start gene g628 Scaffold_3 AUGUSTUS gene 2829883 2831886 0.65 - . g628 Scaffold_3 AUGUSTUS transcript 2829883 2831886 0.65 - . g628.t1 Scaffold_3 AUGUSTUS stop_codon 2829883 2829885 . - 0 transcript_id "g628.t1"; gene_id "g628"; Scaffold_3 AUGUSTUS CDS 2829883 2830662 1 - 0 transcript_id "g628.t1"; gene_id "g628"; Scaffold_3 AUGUSTUS CDS 2830977 2831139 1 - 1 transcript_id "g628.t1"; gene_id "g628"; Scaffold_3 AUGUSTUS CDS 2831300 2831886 0.66 - 0 transcript_id "g628.t1"; gene_id "g628"; Scaffold_3 AUGUSTUS start_codon 2831884 2831886 . - 0 transcript_id "g628.t1"; gene_id "g628"; # protein sequence = [MAQSSLTYPNQSIHRGFLRRRKSNVVSTQTAIIIDKHELHSTWPVYCQPETRQITHEGVTLTVERNHTCYGPGDRISV # MATLKSDSLHTILLRGFELTLKESTIFRAGPYTSGKKSVPQVRVAVVAETRLPVNFSLYGGMVQKAELTCAVSPNHTTTTLNTARHIDITYVLSVKAL # LGTGQPLVMDLPVILSNWQSQVNTRPPMTIERPTTSSRGPPASISNTTGGTADMSSRPDELGYNTNGPKSTMSTSAITPPVSAPSAAAKNAGWLSAEE # EKTRLFHKAQEAARKAQGLDAYSASPPPQDNPPAVTSSAAGGPQYLSAEEEKAALRRYEDAKRAVQRTQLGGTDDVGSSSSSSAYVPPPVTNDLPPSF # EASVPVVDARTQLAEKERLRREYEARDAAAVAQRPSVDNVPAYSEDNSGSQPLTGTIIRSAIAEKEMLRRKFEMQDAQAAGSPSQPPRQASPVQSKSR # PTPAPPSSTVRVPTAAEEKAMLRARFEAEDSAPSHSTPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g628 ### # start gene g629 Scaffold_3 AUGUSTUS gene 2834532 2834987 0.73 - . g629 Scaffold_3 AUGUSTUS transcript 2834532 2834987 0.73 - . g629.t1 Scaffold_3 AUGUSTUS stop_codon 2834532 2834534 . - 0 transcript_id "g629.t1"; gene_id "g629"; Scaffold_3 AUGUSTUS CDS 2834532 2834987 0.73 - 0 transcript_id "g629.t1"; gene_id "g629"; Scaffold_3 AUGUSTUS start_codon 2834985 2834987 . - 0 transcript_id "g629.t1"; gene_id "g629"; # protein sequence = [MDTSTPFLRCSGCQILNDDSIEYNITFVPRASPNTGIAAPGLETALTSYPRSLPIKPLTDVCFSGTTWYNDRGPESGV # SEGARAEFFRNSRKSGVSRPPAIVETTLAIPDGVSRPEGVWTPSTGATDTSSSSSSDSSSDSSSDSSMNECND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g629 ### # start gene g630 Scaffold_3 AUGUSTUS gene 2836330 2837607 0.53 + . g630 Scaffold_3 AUGUSTUS transcript 2836330 2837607 0.53 + . g630.t1 Scaffold_3 AUGUSTUS start_codon 2836330 2836332 . + 0 transcript_id "g630.t1"; gene_id "g630"; Scaffold_3 AUGUSTUS CDS 2836330 2836844 0.55 + 0 transcript_id "g630.t1"; gene_id "g630"; Scaffold_3 AUGUSTUS CDS 2837241 2837607 0.97 + 1 transcript_id "g630.t1"; gene_id "g630"; Scaffold_3 AUGUSTUS stop_codon 2837605 2837607 . + 0 transcript_id "g630.t1"; gene_id "g630"; # protein sequence = [MPAQWEFQVGPCEGISMGDHLWMARYLLVRIAEQWGIKVSFHPKPLQGDWNGAGCHTNYSTKSMREPGGMKYIEAAIE # KLSKRHDEHIAVYGEDNDLRLTGRHETGHIGSFSSGVANRGASIRVPRHVAAQGYGYMEDRRPASNIGMIITSVPVLTVDISVSQTHIVSLASCFYIK # GQPGEDAVLCTQDKTYTIRSVSLSNSILVVTSPPDSDISFDGGDNGLPNIVIRDQLSQILELTQTVPKLHKLNTLLKGKEYGEDEEDNEDGMNVELAI # DHSQNMEVWIFMGKMKSRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g630 ### # start gene g631 Scaffold_3 AUGUSTUS gene 2840377 2840660 0.42 - . g631 Scaffold_3 AUGUSTUS transcript 2840377 2840660 0.42 - . g631.t1 Scaffold_3 AUGUSTUS stop_codon 2840377 2840379 . - 0 transcript_id "g631.t1"; gene_id "g631"; Scaffold_3 AUGUSTUS CDS 2840377 2840512 0.82 - 1 transcript_id "g631.t1"; gene_id "g631"; Scaffold_3 AUGUSTUS CDS 2840593 2840660 0.42 - 0 transcript_id "g631.t1"; gene_id "g631"; Scaffold_3 AUGUSTUS start_codon 2840658 2840660 . - 0 transcript_id "g631.t1"; gene_id "g631"; # protein sequence = [MGTNRANPAAMILSATMMLRHLGIATATFDVINSGKVRTADMGGAPYYVLFTSCFHSMHAHRIIYHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g631 ### # start gene g632 Scaffold_3 AUGUSTUS gene 2849149 2851539 0.64 - . g632 Scaffold_3 AUGUSTUS transcript 2849149 2851539 0.64 - . g632.t1 Scaffold_3 AUGUSTUS stop_codon 2849149 2849151 . - 0 transcript_id "g632.t1"; gene_id "g632"; Scaffold_3 AUGUSTUS CDS 2849149 2849513 0.64 - 2 transcript_id "g632.t1"; gene_id "g632"; Scaffold_3 AUGUSTUS CDS 2849613 2851539 0.84 - 0 transcript_id "g632.t1"; gene_id "g632"; Scaffold_3 AUGUSTUS start_codon 2851537 2851539 . - 0 transcript_id "g632.t1"; gene_id "g632"; # protein sequence = [MTRFLPLLDVPQGDLFNALSRIGPVLLSNPSLPLPPNSYVLLNEDTSNELDHIIPWLDEGAEKVVLPLSSAKEVIGLI # PQERLVLLLDAVSVSAVSDKVRNAVSGVLLKTPEIDLDLISSVSNFFSKSAIFVLVDSPDLPSIYNIRSLLQAGANLVLPSSQLTLDISSSTHLNVGD # VFLAPINSDRADGLFPTIVSTETGHSLGLVYSSIESLRESIITGKGVYQSRKHGLWRKGETSGSTQEVVSIRLDCDSDSLEFRVIQHGSGFCHLGRQS # CFGEASGLPLLESTLRSRFESAPAGSYTKRLFNDPDLLRSKIMEEADELCRADTEYEVAFEAADLIYFALTKCTAHGVSIADIERSLDKKAKRVTRRA # GNAKPQWSTPKPASAPTPATYMPPADDPNAPIRMRTAVLAGISEEERALLLRRPVLKSDEMIEKVKPIVSEIRARGDAAPSRIHCQIDKAELLSTCMF # PPYSKESMKISPNVKDAIDKAYSNIRKFHAAQVDGSTLKVETMPGVVCSRFARAISRVGLYIPGGTAILPSTALMLGIPAQVAGCKEIVFATPPRPDG # SISPEVMYVAHLIGASAILKAGGAQAVAAMAYGTETVPKVDKIFGPGNQWVTAAKMLVQNDTDALVSIDMPAGPTADLLSQAEHGIDSQVVLVAVNLS # TEHLEQIENEVDKQARALSRVDIVRQSVAKSLIVQTTSVEEAIEYSNDYAPEHLILHLENAPTRSNSLPMREVFSLDHSLQKGKIPLLHRSPQSSAN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g632 ### # start gene g633 Scaffold_3 AUGUSTUS gene 2853518 2854745 0.71 - . g633 Scaffold_3 AUGUSTUS transcript 2853518 2854745 0.71 - . g633.t1 Scaffold_3 AUGUSTUS stop_codon 2853518 2853520 . - 0 transcript_id "g633.t1"; gene_id "g633"; Scaffold_3 AUGUSTUS CDS 2853518 2854036 0.75 - 0 transcript_id "g633.t1"; gene_id "g633"; Scaffold_3 AUGUSTUS CDS 2854323 2854745 0.94 - 0 transcript_id "g633.t1"; gene_id "g633"; Scaffold_3 AUGUSTUS start_codon 2854743 2854745 . - 0 transcript_id "g633.t1"; gene_id "g633"; # protein sequence = [MAIRGIVHENIQYTNDLSRSTQVAAGNPLSLDQSSVPLVGHAFEARIYAENPRNNFLPDSGQLLYLSTPTPTLTLPQS # YKPSPTLISSNVESVAPTLVSYESVAPSVRLEQGFAQGSQIGVYYDPMIAKLIVHGKAEVRPCQTSTAQSPWTSLVSRRFGGDVYERVIHLQDDTSTG # EAQPMAVRIKSLVGGLFDVEVETSGTPVKFYDVSAKLISPTSLSITLNDKLSTITIVSQPPPPSIPASLSHNTMERLHVFSAERKTTLVIPTPKWLLM # QGGDVLSAATGTGALKAPMPSLVVEVRVKVGDRVEKGRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g633 ### # start gene g634 Scaffold_3 AUGUSTUS gene 2866793 2867201 0.68 + . g634 Scaffold_3 AUGUSTUS transcript 2866793 2867201 0.68 + . g634.t1 Scaffold_3 AUGUSTUS start_codon 2866793 2866795 . + 0 transcript_id "g634.t1"; gene_id "g634"; Scaffold_3 AUGUSTUS CDS 2866793 2866909 0.68 + 0 transcript_id "g634.t1"; gene_id "g634"; Scaffold_3 AUGUSTUS CDS 2866950 2867201 0.94 + 0 transcript_id "g634.t1"; gene_id "g634"; Scaffold_3 AUGUSTUS stop_codon 2867199 2867201 . + 0 transcript_id "g634.t1"; gene_id "g634"; # protein sequence = [MVDWRGRWLDDEDDEYDEDDEEEEEDRQMEDFDPVRSNPEANDDDDEEEEEEEEEDERPSNPLPAGRQHAVANTTSAR # TTPTSNANARPPNTNISLPKMHTSIGNGKLRVIRSWSPAVGLAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g634 ### # start gene g635 Scaffold_3 AUGUSTUS gene 2869353 2869862 0.74 - . g635 Scaffold_3 AUGUSTUS transcript 2869353 2869862 0.74 - . g635.t1 Scaffold_3 AUGUSTUS stop_codon 2869353 2869355 . - 0 transcript_id "g635.t1"; gene_id "g635"; Scaffold_3 AUGUSTUS CDS 2869353 2869862 0.74 - 0 transcript_id "g635.t1"; gene_id "g635"; Scaffold_3 AUGUSTUS start_codon 2869860 2869862 . - 0 transcript_id "g635.t1"; gene_id "g635"; # protein sequence = [MKFMKLTWQVTAVQGKVPMNEPNMQSHVGTPQTPQAILIPDHGTTPTSLSTESLTQAPEVLDIEFTSVSADDGGLFAW # PSNAERVISRTRGRKRMTSGANGAASDDAQSEPIVVRNVNRIVANTGENSAPASTFHMTLPGIDHACFHTAVTARTPTTCIDGQNPLSEYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g635 ### # start gene g636 Scaffold_3 AUGUSTUS gene 2872345 2872758 0.22 + . g636 Scaffold_3 AUGUSTUS transcript 2872345 2872758 0.22 + . g636.t1 Scaffold_3 AUGUSTUS start_codon 2872345 2872347 . + 0 transcript_id "g636.t1"; gene_id "g636"; Scaffold_3 AUGUSTUS CDS 2872345 2872758 0.22 + 0 transcript_id "g636.t1"; gene_id "g636"; Scaffold_3 AUGUSTUS stop_codon 2872756 2872758 . + 0 transcript_id "g636.t1"; gene_id "g636"; # protein sequence = [MFGAGLGGAALIVFLVLVSLDKTASGGSSNWISSQIGVGTAPAFFICWFAVALGFNVASTVTMSLLSKQLPPTVKWNG # MSSVMVQYSNYLGRVTGAVWGGAGVSVGMSRYVGLEIAITGIGMALASSVWKHLKAKTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g636 ### # start gene g637 Scaffold_3 AUGUSTUS gene 2880281 2880511 0.13 + . g637 Scaffold_3 AUGUSTUS transcript 2880281 2880511 0.13 + . g637.t1 Scaffold_3 AUGUSTUS start_codon 2880281 2880283 . + 0 transcript_id "g637.t1"; gene_id "g637"; Scaffold_3 AUGUSTUS CDS 2880281 2880511 0.13 + 0 transcript_id "g637.t1"; gene_id "g637"; Scaffold_3 AUGUSTUS stop_codon 2880509 2880511 . + 0 transcript_id "g637.t1"; gene_id "g637"; # protein sequence = [MDVDVPPEVTEEGIRIVEDFLRSWASSKDGEDVVMEEDEEKEASPEQQLEQLKAHVEKFLPQIESNPWLKSLLTTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g637 ### # start gene g638 Scaffold_3 AUGUSTUS gene 2890980 2891427 0.49 - . g638 Scaffold_3 AUGUSTUS transcript 2890980 2891427 0.49 - . g638.t1 Scaffold_3 AUGUSTUS stop_codon 2890980 2890982 . - 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_3 AUGUSTUS CDS 2890980 2891222 0.61 - 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_3 AUGUSTUS CDS 2891272 2891427 0.49 - 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_3 AUGUSTUS start_codon 2891425 2891427 . - 0 transcript_id "g638.t1"; gene_id "g638"; # protein sequence = [MVLMNPSDPHSLYQADVEYGKVVEEWKVHDDITVSHIAPTDKFAPTTHEQTLVPRWWDSQYKQYAGKNKFSGVVTTAS # GKLAVASEKGDLRLFDSIGKNAKTALPPLGDPIIGIDATADGRWIVATTKRIYC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g638 ### # start gene g639 Scaffold_3 AUGUSTUS gene 2891750 2892082 0.64 - . g639 Scaffold_3 AUGUSTUS transcript 2891750 2892082 0.64 - . g639.t1 Scaffold_3 AUGUSTUS stop_codon 2891750 2891752 . - 0 transcript_id "g639.t1"; gene_id "g639"; Scaffold_3 AUGUSTUS CDS 2891750 2892082 0.64 - 0 transcript_id "g639.t1"; gene_id "g639"; Scaffold_3 AUGUSTUS start_codon 2892080 2892082 . - 0 transcript_id "g639.t1"; gene_id "g639"; # protein sequence = [MNPKFNPRMHSVTWNHVKEGQDVNSWLFAFPSEEEYSKFCTIYLQCGWKHSTSYLSARSKRRDRRYVMSSTNEDVEML # DIEDEEEDEEEVLSELDPDGMRSHCFTSAFPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g639 ### # start gene g640 Scaffold_3 AUGUSTUS gene 2895001 2895444 0.39 - . g640 Scaffold_3 AUGUSTUS transcript 2895001 2895444 0.39 - . g640.t1 Scaffold_3 AUGUSTUS stop_codon 2895001 2895003 . - 0 transcript_id "g640.t1"; gene_id "g640"; Scaffold_3 AUGUSTUS CDS 2895001 2895444 0.39 - 0 transcript_id "g640.t1"; gene_id "g640"; Scaffold_3 AUGUSTUS start_codon 2895442 2895444 . - 0 transcript_id "g640.t1"; gene_id "g640"; # protein sequence = [MDEIGNEMMNSVVGIDTTINSANLLGGTFHSFQVMLDTPIQSQEQQPTPGEGTIAPQLLDIKVDNTKSEIANTYSTAM # RVNDETNANLNENRALVIPSYHGYMGPGDEHGPQDKDVGNAELVMAALQRRFSRARTVRKRLTKFWKQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g640 ### # start gene g641 Scaffold_3 AUGUSTUS gene 2899873 2900466 0.48 - . g641 Scaffold_3 AUGUSTUS transcript 2899873 2900466 0.48 - . g641.t1 Scaffold_3 AUGUSTUS stop_codon 2899873 2899875 . - 0 transcript_id "g641.t1"; gene_id "g641"; Scaffold_3 AUGUSTUS CDS 2899873 2900466 0.48 - 0 transcript_id "g641.t1"; gene_id "g641"; Scaffold_3 AUGUSTUS start_codon 2900464 2900466 . - 0 transcript_id "g641.t1"; gene_id "g641"; # protein sequence = [MRAMILANIATEADLANGTRGTVTDIVLDDREPMDHEVKDGATLLHYPPAIVYFKPDGSTSVKLEGFPEGLLPIVPQS # NKFVAAVGDNKSRTILRRQVALTPGYAFTDLKGQGQTIEYVIVDLGRPSYGARLDAFGAYVALSRSRGRDTIRLLRGFDEALFVTHPSPDLEVEDARL # DELEEETTVAWNTGNLWHRPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g641 ### # start gene g642 Scaffold_3 AUGUSTUS gene 2900771 2902417 0.62 - . g642 Scaffold_3 AUGUSTUS transcript 2900771 2902417 0.62 - . g642.t1 Scaffold_3 AUGUSTUS stop_codon 2900771 2900773 . - 0 transcript_id "g642.t1"; gene_id "g642"; Scaffold_3 AUGUSTUS CDS 2900771 2902417 0.62 - 0 transcript_id "g642.t1"; gene_id "g642"; Scaffold_3 AUGUSTUS start_codon 2902415 2902417 . - 0 transcript_id "g642.t1"; gene_id "g642"; # protein sequence = [MVAGQLGNRTQLDDYGDRGETLAHYNVKDFFAETYDKYEKAAGTEVSTRNPSSDDPSTRRGRAPGIRHPYLEGTKPNH # VRLVRQQGHETVPLYIGRWFPRNDRPEDRASYILVMLSLLKPWRRITDITDGFHNLEDAWDAFVSSCAEDILDFISNVQYFYRCSDQSAARREKEYKS # YIAQEGDETTGDDSQTLALDIQEGAEGSVSDAEVYAAQQKEGMAQELYAYVAMECAFGAGVFDREYDIEDGVATAGRCSIDDKVDFQEWHQQLVDYTA # TGGLLVDNDIVDVGHVTVNPPPPPRVTAVDDGVVDPSEGAIGGNLRKKLNEEQARAHDIVVDHVLRTLNGDPPPQLLMLLLGPGGTGKTVVINAINET # MTKLGVGSWLAKTATTGVAASHFGGKTLHSWAGIKVAAKASDDLIGNASAAVQKRRTANIGLSRYLLCDECSMATKELVGRTSTICSHVATLENKNNG # DSYFGGMNVVLCGDFHQFPPVGQPNGALYLANASGANSYAVLGRHLYSQFTTVVTLKKQIRVKHKVDGTARSITCRGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g642 ### # start gene g643 Scaffold_3 AUGUSTUS gene 2902615 2903367 0.52 - . g643 Scaffold_3 AUGUSTUS transcript 2902615 2903367 0.52 - . g643.t1 Scaffold_3 AUGUSTUS stop_codon 2902615 2902617 . - 0 transcript_id "g643.t1"; gene_id "g643"; Scaffold_3 AUGUSTUS CDS 2902615 2903367 0.52 - 0 transcript_id "g643.t1"; gene_id "g643"; Scaffold_3 AUGUSTUS start_codon 2903365 2903367 . - 0 transcript_id "g643.t1"; gene_id "g643"; # protein sequence = [MQEALKSKEFRDKVAKFISCTIRADVGKTMSELTQISTNPSIAYARPLSTKDPEYERKRAEQEVHLARNLQLHECSPE # RCYRKGTARCKRRAPWPTSQFDFIDEDGTWGMKRSVGFMNGFNPTISEVQFCNNDQKLVTNGDETQDMTYYITTYSTKKRDRSTNESAILAQRLAYHK # EQERLNSDHVDVSRKLVMRCATALNRQQELSAPEVVSYLMGWGDRYISHNFTPIYIDGLNGMLRKHYPTLQEKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g643 ### # start gene g644 Scaffold_3 AUGUSTUS gene 2904464 2905654 0.41 - . g644 Scaffold_3 AUGUSTUS transcript 2904464 2905654 0.41 - . g644.t1 Scaffold_3 AUGUSTUS stop_codon 2904464 2904466 . - 0 transcript_id "g644.t1"; gene_id "g644"; Scaffold_3 AUGUSTUS CDS 2904464 2905654 0.41 - 0 transcript_id "g644.t1"; gene_id "g644"; Scaffold_3 AUGUSTUS start_codon 2905652 2905654 . - 0 transcript_id "g644.t1"; gene_id "g644"; # protein sequence = [MLDRRVESCSLSHILSVTRAEGVTVDDASAQSKAKLTEVIIAQRPAIVNSILHRLQPPRQPVMERSFLTVPDEAGRRA # LVEKYIEATGNDAVRQVVCCICAREVFSSEAKSIHPDQIPHPELLHPAKPHSAHALTSGMLLYRDPWTKKVPEFACSTCIQSLSANPAKRPPLSLSNN # LWIGEVPFELRILTLCERILVSRFFSAAYIIKLYPKSRGARGWPKEMLTSAVKGNVSSYFLNTEDIVGMIDPGFLPPRPAILTATIGVTFIGPQNIPL # KFLPPYLRVRRKRVKDALEWLIRYNPLYLGQKLSPQHLELLPEDGVPPEVLHSMKWIDDVRVLDRENGGYIPNLESPGNDEDELASGEGIVADELAEV # FRSSYGTISDIAKCLLLVLIDIRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g644 ### # start gene g645 Scaffold_3 AUGUSTUS gene 2915082 2915830 0.39 + . g645 Scaffold_3 AUGUSTUS transcript 2915082 2915830 0.39 + . g645.t1 Scaffold_3 AUGUSTUS start_codon 2915082 2915084 . + 0 transcript_id "g645.t1"; gene_id "g645"; Scaffold_3 AUGUSTUS CDS 2915082 2915107 0.39 + 0 transcript_id "g645.t1"; gene_id "g645"; Scaffold_3 AUGUSTUS CDS 2915155 2915830 0.94 + 1 transcript_id "g645.t1"; gene_id "g645"; Scaffold_3 AUGUSTUS stop_codon 2915828 2915830 . + 0 transcript_id "g645.t1"; gene_id "g645"; # protein sequence = [MVPLDPAPLRPSLQRSSTSQSFNSSRPTLQRSATSGSKPLESPPLPSLPPDLRNSDLSSEDEYYDEGDNDILSASAGL # SWPTPPSAIAPLPPTPSLPSLRSSLKPKLRSNSDEFRVPALPAHVTQSSPQPPFEPVLISGVPSGVVDPSTVLVTVETSTTSHKTTFKTLTSRPSQLA # SYLHSLFPRPRRDSDASSVYSTASDDMSTYRNHLASQGLLPQAPVNIHIFLDRPSAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g645 ### # start gene g646 Scaffold_3 AUGUSTUS gene 2917256 2917675 1 - . g646 Scaffold_3 AUGUSTUS transcript 2917256 2917675 1 - . g646.t1 Scaffold_3 AUGUSTUS stop_codon 2917256 2917258 . - 0 transcript_id "g646.t1"; gene_id "g646"; Scaffold_3 AUGUSTUS CDS 2917256 2917675 1 - 0 transcript_id "g646.t1"; gene_id "g646"; Scaffold_3 AUGUSTUS start_codon 2917673 2917675 . - 0 transcript_id "g646.t1"; gene_id "g646"; # protein sequence = [MFKYDQNHVYDEHTHTLQIYWSNKDVITWLAENSDDEHLNKIKQNAEQHALKMEVTSRSVHDEKALFDEEDVEEDEII # LGRNDQSAGPETSKQRLLSIAKPAPVFEGLRKAPSGHKIQDIRELMTVPVSISAVCASHDH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g646 ### # start gene g647 Scaffold_3 AUGUSTUS gene 2919942 2921972 0.12 - . g647 Scaffold_3 AUGUSTUS transcript 2919942 2921972 0.12 - . g647.t1 Scaffold_3 AUGUSTUS stop_codon 2919942 2919944 . - 0 transcript_id "g647.t1"; gene_id "g647"; Scaffold_3 AUGUSTUS CDS 2919942 2920221 0.96 - 1 transcript_id "g647.t1"; gene_id "g647"; Scaffold_3 AUGUSTUS CDS 2920292 2920571 0.93 - 2 transcript_id "g647.t1"; gene_id "g647"; Scaffold_3 AUGUSTUS CDS 2921384 2921972 0.14 - 0 transcript_id "g647.t1"; gene_id "g647"; Scaffold_3 AUGUSTUS start_codon 2921970 2921972 . - 0 transcript_id "g647.t1"; gene_id "g647"; # protein sequence = [MPKETLALLPGASNKKPTQAPESGSESATRKGTDSGKKSEQQQRKNTGGANRQQTHRKASASQAGRRDAKSSPVPQNK # ESSDALSSLQRVIADLKTTSPQPPVNNPGPIGSSVSSNLPVNAPVFQPGNTYAGMASNLDPKHRKVQSLGASGLSGNFNSFSPNLGSMMEDAEDSSGM # PLEVKFRVTITPPLDTRCVHNGGVGGIQNTAFTSDLAQAQAQLQSLQQFRAAAGGGSSQDGFSFPNMLPNMMAANMMGMGLGGINLLQQQQQQFQSQL # KAKQRKSLFAPYLPQASDAYVATEVLDADIYICGSKDRNRALEGDIVAVELLDVDEVWGTKKEKEEKKRKKEENAAYDLKSTAGRKDDKKKDDVEVEG # QGLMLFEDEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g647 ### # start gene g648 Scaffold_3 AUGUSTUS gene 2926055 2926576 0.93 + . g648 Scaffold_3 AUGUSTUS transcript 2926055 2926576 0.93 + . g648.t1 Scaffold_3 AUGUSTUS start_codon 2926055 2926057 . + 0 transcript_id "g648.t1"; gene_id "g648"; Scaffold_3 AUGUSTUS CDS 2926055 2926576 0.93 + 0 transcript_id "g648.t1"; gene_id "g648"; Scaffold_3 AUGUSTUS stop_codon 2926574 2926576 . + 0 transcript_id "g648.t1"; gene_id "g648"; # protein sequence = [MDNSFHGKYLVKYMVKRVKCNMIDCIQIASPSGESSPPANSTQPNGDSIPWGVGSLNSASANSSDNQESNSSLSATTV # TSAPSSTITASNSPPGSSSKLRKSRMSTTSTERQATPTIDIPSGTLTTDAAATAATFAAYRPNVQNGNSAQGWNQAFSAWTVVFVLVLIDLNNLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g648 ### # start gene g649 Scaffold_3 AUGUSTUS gene 2927962 2928706 0.28 - . g649 Scaffold_3 AUGUSTUS transcript 2927962 2928706 0.28 - . g649.t1 Scaffold_3 AUGUSTUS stop_codon 2927962 2927964 . - 0 transcript_id "g649.t1"; gene_id "g649"; Scaffold_3 AUGUSTUS CDS 2927962 2928599 0.45 - 2 transcript_id "g649.t1"; gene_id "g649"; Scaffold_3 AUGUSTUS CDS 2928700 2928706 0.28 - 0 transcript_id "g649.t1"; gene_id "g649"; Scaffold_3 AUGUSTUS start_codon 2928704 2928706 . - 0 transcript_id "g649.t1"; gene_id "g649"; # protein sequence = [MIIDETTRRELKTIEFLKSKALQRSKPDPPSVTPTTNGDTTNGSVTTPDNAAQLLLNIHRSPPAVGSPKAPFPSLFNL # DSDHINPTSTYNYNGNHAAGTTAHLTLSPTYQRLQHPPEYSPASSSPAAEESESTAQILFDHWCNTVSNAPLESLNAPLAWGGQGGADLSGWAAQAAA # GTSVQQLTGAVNGAVNGSDNQDWSFYWEALVNQIPRTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g649 ### # start gene g650 Scaffold_3 AUGUSTUS gene 2931427 2931720 0.3 + . g650 Scaffold_3 AUGUSTUS transcript 2931427 2931720 0.3 + . g650.t1 Scaffold_3 AUGUSTUS start_codon 2931427 2931429 . + 0 transcript_id "g650.t1"; gene_id "g650"; Scaffold_3 AUGUSTUS CDS 2931427 2931720 0.3 + 0 transcript_id "g650.t1"; gene_id "g650"; Scaffold_3 AUGUSTUS stop_codon 2931718 2931720 . + 0 transcript_id "g650.t1"; gene_id "g650"; # protein sequence = [MSRKLLSSQLCSLTSLVSKETPTEVLGRNLQRIYEERGLEFFELLKDGSLQSGVLPSVDAADKREDESQDTAFDEESN # HTMTKDELYKLKMEVMPQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g650 ### # start gene g651 Scaffold_3 AUGUSTUS gene 2931785 2932339 0.26 + . g651 Scaffold_3 AUGUSTUS transcript 2931785 2932339 0.26 + . g651.t1 Scaffold_3 AUGUSTUS start_codon 2931785 2931787 . + 0 transcript_id "g651.t1"; gene_id "g651"; Scaffold_3 AUGUSTUS CDS 2931785 2932339 0.26 + 0 transcript_id "g651.t1"; gene_id "g651"; Scaffold_3 AUGUSTUS stop_codon 2932337 2932339 . + 0 transcript_id "g651.t1"; gene_id "g651"; # protein sequence = [MTLARDLLSSILASSNGLSTALPSILHSIAAPEPQTQQPESLPPLSATVVTKPPSIVSVQAFNAQLAIGGKDEALRKA # AHLFKSVATRMERGRLQNERYWVDALKIRRGNWGLVPAPLPPGSAIGKGADKTSKDFIISYGLEECLSSLFHHSGALVLIVQLQHLRYFEEVLSPTCP # TAVLRRSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g651 ### # start gene g652 Scaffold_3 AUGUSTUS gene 2933720 2934470 0.46 - . g652 Scaffold_3 AUGUSTUS transcript 2933720 2934470 0.46 - . g652.t1 Scaffold_3 AUGUSTUS stop_codon 2933720 2933722 . - 0 transcript_id "g652.t1"; gene_id "g652"; Scaffold_3 AUGUSTUS CDS 2933720 2933966 0.99 - 1 transcript_id "g652.t1"; gene_id "g652"; Scaffold_3 AUGUSTUS CDS 2934021 2934343 0.46 - 0 transcript_id "g652.t1"; gene_id "g652"; Scaffold_3 AUGUSTUS CDS 2934447 2934470 0.72 - 0 transcript_id "g652.t1"; gene_id "g652"; Scaffold_3 AUGUSTUS start_codon 2934468 2934470 . - 0 transcript_id "g652.t1"; gene_id "g652"; # protein sequence = [MGSPTGLLLGLADKYEGVAEPEGEFTLTEALDEEDAPRPFKCFLDVGLKRTSTGSRVFGAMKGASDGGIFIPHSEKRF # PGYDPESKELDAEVLKKYIFGGHVAEYMESLEEEDDERFKKQFATYLADGIGSEDMEEIYTNAHAAIREDPVFKPTEKTKDWKAESSKYATPRLTHAQ # RKEKINARIEQFRAGAGDDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g652 ### # start gene g653 Scaffold_3 AUGUSTUS gene 2935171 2935491 0.56 + . g653 Scaffold_3 AUGUSTUS transcript 2935171 2935491 0.56 + . g653.t1 Scaffold_3 AUGUSTUS start_codon 2935171 2935173 . + 0 transcript_id "g653.t1"; gene_id "g653"; Scaffold_3 AUGUSTUS CDS 2935171 2935491 0.56 + 0 transcript_id "g653.t1"; gene_id "g653"; Scaffold_3 AUGUSTUS stop_codon 2935489 2935491 . + 0 transcript_id "g653.t1"; gene_id "g653"; # protein sequence = [MDYSNSNSYYSQSTFDNPYHKPYAGPSYPAAGSSSNHSAPVPANAYEYDVGILAQQSVYVPGAMIDKRGGSGGKLAKG # GKRTTVLRKGGGKVWEDQTLLEWNPCEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g653 ### # start gene g654 Scaffold_3 AUGUSTUS gene 2936697 2937136 0.47 + . g654 Scaffold_3 AUGUSTUS transcript 2936697 2937136 0.47 + . g654.t1 Scaffold_3 AUGUSTUS start_codon 2936697 2936699 . + 0 transcript_id "g654.t1"; gene_id "g654"; Scaffold_3 AUGUSTUS CDS 2936697 2936722 0.54 + 0 transcript_id "g654.t1"; gene_id "g654"; Scaffold_3 AUGUSTUS CDS 2936806 2937136 0.47 + 1 transcript_id "g654.t1"; gene_id "g654"; Scaffold_3 AUGUSTUS stop_codon 2937134 2937136 . + 0 transcript_id "g654.t1"; gene_id "g654"; # protein sequence = [MNSDNALDLIPTHRSDPDCVMASEPTLSSLAQLASNAEDAFDFSQNQDPGSSTGKTKEQIRKHYLRTLHKVIDQSDII # ILVLDARDPEGCRSRLVEEEVRRRESEGKKLVFVLNKVGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g654 ### # start gene g655 Scaffold_3 AUGUSTUS gene 2938063 2938371 0.71 + . g655 Scaffold_3 AUGUSTUS transcript 2938063 2938371 0.71 + . g655.t1 Scaffold_3 AUGUSTUS start_codon 2938063 2938065 . + 0 transcript_id "g655.t1"; gene_id "g655"; Scaffold_3 AUGUSTUS CDS 2938063 2938371 0.71 + 0 transcript_id "g655.t1"; gene_id "g655"; Scaffold_3 AUGUSTUS stop_codon 2938369 2938371 . + 0 transcript_id "g655.t1"; gene_id "g655"; # protein sequence = [MISAVPNFSTAPDLSGSAPGQAGQIIAPGAENVGHAQILSSFSEPFELEGLFGAADAGAFGGGRSGPDVNMDAEGDGD # DMFWDANETLSNENADDGMQEGDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g655 ### # start gene g656 Scaffold_3 AUGUSTUS gene 2941408 2941746 0.69 + . g656 Scaffold_3 AUGUSTUS transcript 2941408 2941746 0.69 + . g656.t1 Scaffold_3 AUGUSTUS start_codon 2941408 2941410 . + 0 transcript_id "g656.t1"; gene_id "g656"; Scaffold_3 AUGUSTUS CDS 2941408 2941746 0.69 + 0 transcript_id "g656.t1"; gene_id "g656"; Scaffold_3 AUGUSTUS stop_codon 2941744 2941746 . + 0 transcript_id "g656.t1"; gene_id "g656"; # protein sequence = [MPANPTPEMLKKMRIESEASEKGIETLPNSPGGKSKTRATVEDAMDEDEDQSFAPGGDADYFIEEDEDGRFYGGGLTS # EQKDILNIFERAGDEVLAEVSVQYFHVCDLTCNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g656 ### # start gene g657 Scaffold_3 AUGUSTUS gene 2945980 2946338 0.42 + . g657 Scaffold_3 AUGUSTUS transcript 2945980 2946338 0.42 + . g657.t1 Scaffold_3 AUGUSTUS start_codon 2945980 2945982 . + 0 transcript_id "g657.t1"; gene_id "g657"; Scaffold_3 AUGUSTUS CDS 2945980 2946120 0.8 + 0 transcript_id "g657.t1"; gene_id "g657"; Scaffold_3 AUGUSTUS CDS 2946174 2946338 0.49 + 0 transcript_id "g657.t1"; gene_id "g657"; Scaffold_3 AUGUSTUS stop_codon 2946336 2946338 . + 0 transcript_id "g657.t1"; gene_id "g657"; # protein sequence = [MESGANPSSEDADEALEDGATQVNNVVYSFRLQSTSFDKKSYLTYLKGYMKKIKNHLQAVNPDRVEPFEKDAAAFAKK # VVANFKDYEFVRSIISIRSNKAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g657 ### # start gene g658 Scaffold_3 AUGUSTUS gene 2952536 2952996 0.39 - . g658 Scaffold_3 AUGUSTUS transcript 2952536 2952996 0.39 - . g658.t1 Scaffold_3 AUGUSTUS stop_codon 2952536 2952538 . - 0 transcript_id "g658.t1"; gene_id "g658"; Scaffold_3 AUGUSTUS CDS 2952536 2952922 0.39 - 0 transcript_id "g658.t1"; gene_id "g658"; Scaffold_3 AUGUSTUS CDS 2952973 2952996 0.39 - 0 transcript_id "g658.t1"; gene_id "g658"; Scaffold_3 AUGUSTUS start_codon 2952994 2952996 . - 0 transcript_id "g658.t1"; gene_id "g658"; # protein sequence = [MSAENGHEVLLSYSSDGVYLFSTLHDPESSSSPSSSTIVPPNLKRRRISRESPSTSSTVSSSPPSEGAAVNLDLLDHL # EREDGNQGEDEDLEEDDVVDPLRGEEPKAFYSWTDIVTPYRRFSGARNVDTVKDGAKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g658 ### # start gene g659 Scaffold_3 AUGUSTUS gene 2954822 2955323 0.66 - . g659 Scaffold_3 AUGUSTUS transcript 2954822 2955323 0.66 - . g659.t1 Scaffold_3 AUGUSTUS stop_codon 2954822 2954824 . - 0 transcript_id "g659.t1"; gene_id "g659"; Scaffold_3 AUGUSTUS CDS 2954822 2955161 0.99 - 1 transcript_id "g659.t1"; gene_id "g659"; Scaffold_3 AUGUSTUS CDS 2955274 2955323 0.66 - 0 transcript_id "g659.t1"; gene_id "g659"; Scaffold_3 AUGUSTUS start_codon 2955321 2955323 . - 0 transcript_id "g659.t1"; gene_id "g659"; # protein sequence = [MVPHSAFNTVLDPWRAIRPSVPALIKHFRFDGILGLAYDTIAVNHIPPPFYNMVDQNLVDEPVFSFRLGSSENDGGEV # VFGGVDDNAYTGDITYVPLRRKAYWEVELEKISFGDEDVELENTGAAIDTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g659 ### # start gene g660 Scaffold_3 AUGUSTUS gene 2956582 2957876 0.16 + . g660 Scaffold_3 AUGUSTUS transcript 2956582 2957876 0.16 + . g660.t1 Scaffold_3 AUGUSTUS start_codon 2956582 2956584 . + 0 transcript_id "g660.t1"; gene_id "g660"; Scaffold_3 AUGUSTUS CDS 2956582 2956886 0.18 + 0 transcript_id "g660.t1"; gene_id "g660"; Scaffold_3 AUGUSTUS CDS 2957453 2957876 0.29 + 1 transcript_id "g660.t1"; gene_id "g660"; Scaffold_3 AUGUSTUS stop_codon 2957874 2957876 . + 0 transcript_id "g660.t1"; gene_id "g660"; # protein sequence = [MANFTTIFQESQHRMEAVASKYLAEDSAIVEPNEVFLGMDSPKVVAEMSLDMALFSQASRGQIAPTIKATIQSSFSLL # DVESPAQKKARIDAEATGSVWAGMLLHYPALGNNLHTLFAKVLIGLSDAIVNKETPQNAAFLITLTFNTCLDRLDALTVIHEEIAAAAERTKNGETSI # LNDAYIEKARPVGGAVYALEKPEEIMMGMFECSSCRVTLIVHSRIPSSVSHIAARLSSMPRDVKKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g660 ### # start gene g661 Scaffold_3 AUGUSTUS gene 2959390 2960166 0.51 + . g661 Scaffold_3 AUGUSTUS transcript 2959390 2960166 0.51 + . g661.t1 Scaffold_3 AUGUSTUS start_codon 2959390 2959392 . + 0 transcript_id "g661.t1"; gene_id "g661"; Scaffold_3 AUGUSTUS CDS 2959390 2960166 0.51 + 0 transcript_id "g661.t1"; gene_id "g661"; Scaffold_3 AUGUSTUS stop_codon 2960164 2960166 . + 0 transcript_id "g661.t1"; gene_id "g661"; # protein sequence = [MQDVYLILHQITNRFTALCLDDSWSRKIAGCGCIKMMTETPEVGVKWVRDREIDLVRTLLHILKDLPADLPQDVDEII # GVLTEVLRIGSLDIDFHSDAGVQAQIRSKLIALVGVFFPELQSAVPVVRQAAQACIEFLVQLSGRPAVELLLPHRDRMLISIFTKPLRALTFPIQIGL # IEAVRYCVSLNPPLLDLNDELLRLLHETLALADAEDAALLGRSNPRQGIIEMTKLRVSCIKLLTASMPMTDFFQKHPQTRQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g661 ### # start gene g662 Scaffold_3 AUGUSTUS gene 2963402 2964103 0.46 + . g662 Scaffold_3 AUGUSTUS transcript 2963402 2964103 0.46 + . g662.t1 Scaffold_3 AUGUSTUS start_codon 2963402 2963404 . + 0 transcript_id "g662.t1"; gene_id "g662"; Scaffold_3 AUGUSTUS CDS 2963402 2964103 0.46 + 0 transcript_id "g662.t1"; gene_id "g662"; Scaffold_3 AUGUSTUS stop_codon 2964101 2964103 . + 0 transcript_id "g662.t1"; gene_id "g662"; # protein sequence = [MINLLSKEYHIKQAEMRPNVIQTVLTGLHACTPPMILPPHLIKYLAKTFGAWYIALEILASSLEYLKDDELTLRDNAL # DSLADVYSELAEDDMFYGLWRRRCLQPETNNAIALEQNGMWDQAMNAYETAQQRARSGAIPYTEQEYCLWEDHWILSAEKLQQWDLLYELGRNEGNHD # LILESAWRVKDWLENREALEDHIAQLPEVPTPRRRVFEAFIALLKLPSPLKKIPSLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g662 ### # start gene g663 Scaffold_3 AUGUSTUS gene 2965250 2965762 0.99 + . g663 Scaffold_3 AUGUSTUS transcript 2965250 2965762 0.99 + . g663.t1 Scaffold_3 AUGUSTUS start_codon 2965250 2965252 . + 0 transcript_id "g663.t1"; gene_id "g663"; Scaffold_3 AUGUSTUS CDS 2965250 2965762 0.99 + 0 transcript_id "g663.t1"; gene_id "g663"; Scaffold_3 AUGUSTUS stop_codon 2965760 2965762 . + 0 transcript_id "g663.t1"; gene_id "g663"; # protein sequence = [MVSRPSVPSAQTTPVRASESSSTNGSGSDVPGSGSDPNNSQTSLPSADNAQGIGASQNGSQFVADAAVHRPTWDCVEE # LVQNLKTSFPLLILSLETLVDQIINRFKPSHEEDIYRHICMLLQDALQVCHPNYSNSSIHSAKHYMVRVNQTEDDGSLTASTVANLHRLAKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g663 ### # start gene g664 Scaffold_3 AUGUSTUS gene 2969211 2969866 0.33 - . g664 Scaffold_3 AUGUSTUS transcript 2969211 2969866 0.33 - . g664.t1 Scaffold_3 AUGUSTUS stop_codon 2969211 2969213 . - 0 transcript_id "g664.t1"; gene_id "g664"; Scaffold_3 AUGUSTUS CDS 2969211 2969741 0.76 - 0 transcript_id "g664.t1"; gene_id "g664"; Scaffold_3 AUGUSTUS CDS 2969825 2969866 0.34 - 0 transcript_id "g664.t1"; gene_id "g664"; Scaffold_3 AUGUSTUS start_codon 2969864 2969866 . - 0 transcript_id "g664.t1"; gene_id "g664"; # protein sequence = [MELKWALKTLLLILVEPSNDETANLLRSPQHSDIEEVASLARDNSAEARDDNKEGRDEVESLAISHDDTPPLLHVRPL # EGDAPQRSVVEVSIDADDEVSRSSQAPTPTAETEHDRMEIDEEGVTSGDEPLQRARRASNYQIYTHVREYLLNDLIRSRKAPTQGQYSSSNEERTSSA # SPFHTRYRNGTRGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g664 ### # start gene g665 Scaffold_3 AUGUSTUS gene 2976506 2977360 0.58 + . g665 Scaffold_3 AUGUSTUS transcript 2976506 2977360 0.58 + . g665.t1 Scaffold_3 AUGUSTUS start_codon 2976506 2976508 . + 0 transcript_id "g665.t1"; gene_id "g665"; Scaffold_3 AUGUSTUS CDS 2976506 2976508 0.59 + 0 transcript_id "g665.t1"; gene_id "g665"; Scaffold_3 AUGUSTUS CDS 2976611 2977360 0.58 + 0 transcript_id "g665.t1"; gene_id "g665"; Scaffold_3 AUGUSTUS stop_codon 2977358 2977360 . + 0 transcript_id "g665.t1"; gene_id "g665"; # protein sequence = [MEFKAADKFVAVAYVSSTTDAPAVAFNQVAETHRDDFLFGLSTDPDVIAAEAVTPPAVVVYRSFDEPRVVYPYPILDA # KPEDFEEWMADLSIPVIDEVSSDNYAVYASSTKPLAYVFLDPTAENKEEIIASVRPVAEEYKSKVNFVWIDAIKFGDHAKALNLQEPKWPSFVIQDLE # KQLKYPLDQSKEVSTESVKDWTKQFVSGELKPELKSQPIPEVQDESVYNLVGKEFEEVVFDDSKDVFVEFYASW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g665 ### # start gene g666 Scaffold_3 AUGUSTUS gene 2978454 2980676 0.24 + . g666 Scaffold_3 AUGUSTUS transcript 2978454 2980676 0.24 + . g666.t1 Scaffold_3 AUGUSTUS start_codon 2978454 2978456 . + 0 transcript_id "g666.t1"; gene_id "g666"; Scaffold_3 AUGUSTUS CDS 2978454 2979008 0.65 + 0 transcript_id "g666.t1"; gene_id "g666"; Scaffold_3 AUGUSTUS CDS 2979049 2979311 0.86 + 0 transcript_id "g666.t1"; gene_id "g666"; Scaffold_3 AUGUSTUS CDS 2979379 2979420 0.65 + 1 transcript_id "g666.t1"; gene_id "g666"; Scaffold_3 AUGUSTUS CDS 2979721 2979988 0.4 + 1 transcript_id "g666.t1"; gene_id "g666"; Scaffold_3 AUGUSTUS CDS 2980158 2980676 0.51 + 0 transcript_id "g666.t1"; gene_id "g666"; Scaffold_3 AUGUSTUS stop_codon 2980674 2980676 . + 0 transcript_id "g666.t1"; gene_id "g666"; # protein sequence = [MPHNGRNHQRRPRGNKDDDRSAYSREDDNSYYSRSRQSDHRYRENASGSGRHSYDAGSREVSSSRVADSSWQHTGGNF # QDRYQNKGRRDDYDAVAVLDSRETDVGWSSHRSTNDADLYSHPQREEWPPPPRYESNYSSTSYQDQYQPPASNSYPQPQPWERYKTPRRPSPGPELSS # PELARGRCEDNGWEPRRPEQDQRQNWDENSVDRQWEPAHHSWDSSQHGFDSSQRSHGYSQQNGHRNSSNRKNSRKSDSHSKVNGSNKDWREVDELNNW # SRRERQPDFYDHRSPVSPTSSYRRNDKVGFHRSVSPTGDPVRSHRVRSPTPVNHVRAPSPQLPDPAPPTPIPSVDIPPPEPKPAQATQDPPSQPQQKG # KNKKMPPPSHPTQYPHNQYAYPYQYPAHYPAQYYAFPVPSRGAMVYGAPQMAHHHLPTHTPPPLQSPALPASLPERPPQPTSSLPPPSASLPPKPSTN # VTPNLPNHVEPQKSLTIPVPGSFIPIRNTALKPPKSSLKQFFPAFTEDEESASNTPQEQQAQTEAEVAGRDPRGHAYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g666 ### # start gene g667 Scaffold_3 AUGUSTUS gene 2982181 2982858 0.95 - . g667 Scaffold_3 AUGUSTUS transcript 2982181 2982858 0.95 - . g667.t1 Scaffold_3 AUGUSTUS stop_codon 2982181 2982183 . - 0 transcript_id "g667.t1"; gene_id "g667"; Scaffold_3 AUGUSTUS CDS 2982181 2982858 0.95 - 0 transcript_id "g667.t1"; gene_id "g667"; Scaffold_3 AUGUSTUS start_codon 2982856 2982858 . - 0 transcript_id "g667.t1"; gene_id "g667"; # protein sequence = [MAAVTAAVLAPAGPNRSRVLASLYRDERTTELPTYNILSKMFLDHILRPAEIKEFEGTLKPHQLAKIAISSNDRVATS # TNDEEIDTPSDPPISTRTAPATVLDRAVMEHNLLASSKIYHNISFRGLGALLDLTPGAAENMARKMIEQGRLRGTIDQVDKLIWFEGNHEEDDAQGKA # GGLGEVEEAEDTGAPFTKRWDAQIRITAANVRPSHSNGHEHYTDVECPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g667 ### # start gene g668 Scaffold_3 AUGUSTUS gene 2984617 2986224 0.94 + . g668 Scaffold_3 AUGUSTUS transcript 2984617 2986224 0.94 + . g668.t1 Scaffold_3 AUGUSTUS start_codon 2984617 2984619 . + 0 transcript_id "g668.t1"; gene_id "g668"; Scaffold_3 AUGUSTUS CDS 2984617 2986224 0.94 + 0 transcript_id "g668.t1"; gene_id "g668"; Scaffold_3 AUGUSTUS stop_codon 2986222 2986224 . + 0 transcript_id "g668.t1"; gene_id "g668"; # protein sequence = [MYGQLSAIAREFNFPSTTGICLYFHFTENGITATPRISDESWQMIWSNVFDPSFPAPRVPIVGKVEFDIDIRHARWYS # AWIASTHREHVDVPASVGPSTAPSLAHFRGDSRNTELEINFQDDQLDNESISPPSITRHGRHVPKKLSLVDRLDSSLRAVARTATAAAHISPEHSASA # RALSPIFQEDEPKTAKLEDSLAKRVKSWRASASLTPSALAAKGQTSLEPANLPNTMSLDGVADGEDMEELNLEDFTWSVSSLGPNDWEEGSVASRPRL # PSVHLANRMESSVCMTPSVCTSFGPSDYTLPSPIPSWARVMTPDIAHRMYEDCPPTPSTATSWGPPSEYPASPISFGRVSSVDLGDRAVFSPPPTPMT # ATSWGPPSEYPQSPMSFGRAPSVHLGDRLVFSPPPTPSTATTWGPASWPSSPITPFYVQTPDVGQRAFDPEDLALPSAPWKQVWPYHQQHLDTVSGPE # SQVSPYNSAHAPSAELTMSVHAPWGHSWPYHSYASQDLSPVTVRPACSYPSLKICASPSRTYNLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g668 ### # start gene g669 Scaffold_3 AUGUSTUS gene 2989559 2989834 0.41 - . g669 Scaffold_3 AUGUSTUS transcript 2989559 2989834 0.41 - . g669.t1 Scaffold_3 AUGUSTUS stop_codon 2989559 2989561 . - 0 transcript_id "g669.t1"; gene_id "g669"; Scaffold_3 AUGUSTUS CDS 2989559 2989834 0.41 - 0 transcript_id "g669.t1"; gene_id "g669"; Scaffold_3 AUGUSTUS start_codon 2989832 2989834 . - 0 transcript_id "g669.t1"; gene_id "g669"; # protein sequence = [MLKESLDLHEEKKARASVSKQTVQEARAEVIEKVQLAFMEDRRTKMEHDERERQLRAARAEIAARKEARERANTDIEE # DNVIAADQPPPYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g669 ### # start gene g670 Scaffold_3 AUGUSTUS gene 2990623 2991216 0.55 - . g670 Scaffold_3 AUGUSTUS transcript 2990623 2991216 0.55 - . g670.t1 Scaffold_3 AUGUSTUS stop_codon 2990623 2990625 . - 0 transcript_id "g670.t1"; gene_id "g670"; Scaffold_3 AUGUSTUS CDS 2990623 2991216 0.55 - 0 transcript_id "g670.t1"; gene_id "g670"; Scaffold_3 AUGUSTUS start_codon 2991214 2991216 . - 0 transcript_id "g670.t1"; gene_id "g670"; # protein sequence = [MIENRARIERQIFLGRQLVRRTLQNSGRQVNTQTIALPARLSTTPSYTGTDAPISVDTDAENAYASASRKYFRRRHQS # ANGQLKPRANNGGKGLSSRNASAELVNPGSTPNRRTEPMLNRTTNGDNLPSGHMLRPPTKSFPNVLVLRENEMDEDGWSSESSFDDDLVAMDEHRRYT # SHSSLPPVEDSDQLQRDEWSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g670 ### # start gene g671 Scaffold_3 AUGUSTUS gene 2997591 2999762 0.36 + . g671 Scaffold_3 AUGUSTUS transcript 2997591 2999762 0.36 + . g671.t1 Scaffold_3 AUGUSTUS start_codon 2997591 2997593 . + 0 transcript_id "g671.t1"; gene_id "g671"; Scaffold_3 AUGUSTUS CDS 2997591 2999762 0.36 + 0 transcript_id "g671.t1"; gene_id "g671"; Scaffold_3 AUGUSTUS stop_codon 2999760 2999762 . + 0 transcript_id "g671.t1"; gene_id "g671"; # protein sequence = [MTFELGFSLMFLENVLLLSLPLIVTAYPINVLNSSGSATTFAVLLAVALSVTVLVLTKFLYMRYRRSHVSYNFSDCSL # QSSQRSTTSFFYNSEKLVKPGKAAFLVGFFGSPSWETSVKTLYDGPSVYSNQLQFQSRRSQKFARRTSRFSISEFGGLRRSTRYSDTSDSRALSNTLV # ALSHPPPHSYASSPTYPADARTNSSGRRYSLPVTRQMHPEHPNDRRRRPSSLKSSSFDSLPIPGLRLVNLVNNNPDLLHQTSFLDFEPFSPTPSSIHS # RSRSKSSRASSCIPPLPPLPASVLLSPLPDLPESISNEGRSYISSPYALSPKQTSLNETKLSPVVPGADTGMTITRRLRKLSGTLPRIKAQPSRSPSL # RSRKSPVVGPSPLRIVTLPEGSLANLNKEIDKDLLPSIPSLSSSTGSATAPASHAGEWSKHQNYADLGIGYPSSWGLGLGLEEGGTSQIQSEIVSENR # SSVPCRLSQAASTQSQMPSSPDADAMLGIIQELVEETSQWDDSLFMDTSFKALIENSRSTSSDSPLSSKSSHHSHQPSGPREVAPPVPSPPSSRSSSD # SARPRTHSSSSVTSAKSKAPSIAVNGAAVTRAPGNTSSPRNSSTIGTERKLSPKSILKKTLMMPSRSVEFELGLVGLDAVRMENFRMSAYESPRLHGG # GYDEPIVDYVMHIPTMPGAYEHGSVLTPLQEISEEQEQEAEHVQVVQRLVVFFDKDC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g671 ### # start gene g672 Scaffold_3 AUGUSTUS gene 3002773 3003530 0.26 + . g672 Scaffold_3 AUGUSTUS transcript 3002773 3003530 0.26 + . g672.t1 Scaffold_3 AUGUSTUS start_codon 3002773 3002775 . + 0 transcript_id "g672.t1"; gene_id "g672"; Scaffold_3 AUGUSTUS CDS 3002773 3003063 0.26 + 0 transcript_id "g672.t1"; gene_id "g672"; Scaffold_3 AUGUSTUS CDS 3003171 3003530 0.99 + 0 transcript_id "g672.t1"; gene_id "g672"; Scaffold_3 AUGUSTUS stop_codon 3003528 3003530 . + 0 transcript_id "g672.t1"; gene_id "g672"; # protein sequence = [MNDNVFVLLEDPLAPTRADVVQAIADKTAPPNFHPTHYRTTFLTLNPPGALEQLLAQLKARWVPVRQTSTNNAQRGQA # SGHQLLIEGQVFGIGSDWLAEYLPLPGLNVGPAADGTSELLSNLLTSVLPNVPDAKTVAVTISEAQWEDVLWDREEDEKAQKEVAQAKERESNGENDD # IFVYGLEDIPIKRRGDWTGVDRDRRSAFLIIGALKSEGIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g672 ### # start gene g673 Scaffold_3 AUGUSTUS gene 3006957 3007415 0.85 + . g673 Scaffold_3 AUGUSTUS transcript 3006957 3007415 0.85 + . g673.t1 Scaffold_3 AUGUSTUS start_codon 3006957 3006959 . + 0 transcript_id "g673.t1"; gene_id "g673"; Scaffold_3 AUGUSTUS CDS 3006957 3007415 0.85 + 0 transcript_id "g673.t1"; gene_id "g673"; Scaffold_3 AUGUSTUS stop_codon 3007413 3007415 . + 0 transcript_id "g673.t1"; gene_id "g673"; # protein sequence = [MFRYGAPYIELSESSSIISKNYVCSIDYKGKGYFSGKTHSFKATLNPAPGLGGTLGSHVIEGTWHTTSKFTSGPKTGM # EFHNVTGPKEEVTAIGGQTSGEMGEFETRELWKLVAKGIREGDFDMASREKSKIEVCSTFCAHMFLYELEFYPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g673 ### # start gene g674 Scaffold_3 AUGUSTUS gene 3019587 3020069 0.66 + . g674 Scaffold_3 AUGUSTUS transcript 3019587 3020069 0.66 + . g674.t1 Scaffold_3 AUGUSTUS start_codon 3019587 3019589 . + 0 transcript_id "g674.t1"; gene_id "g674"; Scaffold_3 AUGUSTUS CDS 3019587 3020069 0.66 + 0 transcript_id "g674.t1"; gene_id "g674"; Scaffold_3 AUGUSTUS stop_codon 3020067 3020069 . + 0 transcript_id "g674.t1"; gene_id "g674"; # protein sequence = [MIGPIPRSTYAPYTVFLEDLFLIVAQWSLYAYADKIQEAKRLAALTAKSTQENQMEQEQRKAQRTQRKKANAPWSTNI # GKQEEREVRKQKKKRKRQWLKTQAASGDTQNNMKRTGEDFEEVEEDDNDEDWSEIAREERMAKKVRKGEISKREFDAEFGDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g674 ### # start gene g675 Scaffold_3 AUGUSTUS gene 3021263 3022771 0.96 + . g675 Scaffold_3 AUGUSTUS transcript 3021263 3022771 0.96 + . g675.t1 Scaffold_3 AUGUSTUS start_codon 3021263 3021265 . + 0 transcript_id "g675.t1"; gene_id "g675"; Scaffold_3 AUGUSTUS CDS 3021263 3022771 0.96 + 0 transcript_id "g675.t1"; gene_id "g675"; Scaffold_3 AUGUSTUS stop_codon 3022769 3022771 . + 0 transcript_id "g675.t1"; gene_id "g675"; # protein sequence = [MFDPLPPSPPLTESLKTKIGSEFHQPLASQAVADMAQCATCDMTYPALFSIMFSPLPPSPPLTESLETKIGSEFHQPL # ASQAVADMAQCATCAVTYPTLFSIMFSPLPPSPPLTESLETKIGSEFHQPLASQAVADMAQCATCDMTYPALFSIMFSPLPPSPPLTESLETKIGSEF # HQPLASQAVADMAQCATCDMTYPALFSIMFSPLPPSPPLTESLETKIGSEFHQPLASQAVADMAQCATCAVTYPTLFSIMFSPLPPSPPLTESLETKI # GSEFHQPLASQAVADMAQCATCDVTYPALFSIMFSPLPPSPPLTESLETKIGSEFHQPLASQAVADMAQCATCDMAYPALFSIMFSPLPPSPPLTESL # ETKMGSEFHQPLASQAVADMAQCATCAVTYPALFSVMFSPLPSSPPLIESLEPKIGSEFHQPLASQAVADMAQCATCTVTYPTLFSIMFSPLPPSPPL # TESLETKIGSEFSVMFSPLPPSPPLSITRNQD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g675 ### # start gene g676 Scaffold_3 AUGUSTUS gene 3028515 3030238 0.6 - . g676 Scaffold_3 AUGUSTUS transcript 3028515 3030238 0.6 - . g676.t1 Scaffold_3 AUGUSTUS stop_codon 3028515 3028517 . - 0 transcript_id "g676.t1"; gene_id "g676"; Scaffold_3 AUGUSTUS CDS 3028515 3028963 0.6 - 2 transcript_id "g676.t1"; gene_id "g676"; Scaffold_3 AUGUSTUS CDS 3029047 3030238 0.61 - 0 transcript_id "g676.t1"; gene_id "g676"; Scaffold_3 AUGUSTUS start_codon 3030236 3030238 . - 0 transcript_id "g676.t1"; gene_id "g676"; # protein sequence = [MVAVRPGQPPNVQHLFDLCRSFPVQGAINFGHNYGGAVPYEARTILSLGEEPWLNPTPTIRSEPQYKCNPFYDPELTR # LFQQDSAVSPEGSYLPTVDPAVTFSGHKVNFTRGESDHFNKLPNEILLSLLYYLPSPSVASLKLASRVYAAIVLPDRFWFSRFWPDQEFEHVFEAIQH # AALWGGRWKLLFDSVKDLHHRLITRNAMSNRKRVWELAKSLQALLDEGGEGPCAGDPVCSFFEPNAPLDDCICWATASRNLKSPIEIFGSGSRSLFER # LLVLPSEIIAIFISTIEVSGHCYISGLRLELDDGETSVLGYIYPRNETLVTWDATTTTRVSIAGFHVAQSNQGVSALAILSTEGYLSNWVGEIQGIPK # RRLTIDLIEDGCSDPARFLKGGFDVKPSSILLDPAASLRNTAAWLPDIPDPNLFFMGEDYQGDLPLTIITFDGSNGKNLRDFVISIWSQDGEIYGIKI # SYDHLLDGPKTLLLGDELLDAPVDEVDRCDISIDYANGEYITGMEIFERNRASMALKVPPSCNSSRRSILIGNTRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g676 ### # start gene g677 Scaffold_3 AUGUSTUS gene 3031534 3032609 0.1 + . g677 Scaffold_3 AUGUSTUS transcript 3031534 3032609 0.1 + . g677.t1 Scaffold_3 AUGUSTUS start_codon 3031534 3031536 . + 0 transcript_id "g677.t1"; gene_id "g677"; Scaffold_3 AUGUSTUS CDS 3031534 3031537 0.31 + 0 transcript_id "g677.t1"; gene_id "g677"; Scaffold_3 AUGUSTUS CDS 3031619 3032086 0.53 + 2 transcript_id "g677.t1"; gene_id "g677"; Scaffold_3 AUGUSTUS CDS 3032134 3032379 0.42 + 2 transcript_id "g677.t1"; gene_id "g677"; Scaffold_3 AUGUSTUS CDS 3032500 3032609 0.58 + 2 transcript_id "g677.t1"; gene_id "g677"; Scaffold_3 AUGUSTUS stop_codon 3032607 3032609 . + 0 transcript_id "g677.t1"; gene_id "g677"; # protein sequence = [MLLLITRYRFDVAAWVKANLAGGDDKNSDSPGAGLKIAGSDPNRPEDEGVGVVIASDKDEATRKMERDAQAELKRQQN # ALPSWHLKSTISGDLTALGIKESARAEAAVANGVGSTSNDEVLRGLGVVGMKPSQSTTALVVETKRESKPVTNPDADCDYYEQYYASLAASAVASVQV # TPSGSVPGSLDLDDFGEDEEDRKPSLEYLNSLNDYRKRSRSQENEGFSGRNKIAKTESNKWRTLNGNPVAFSKVTEEDHELMTPEEYTAYFEVMQSLE # E] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g677 ### # start gene g678 Scaffold_3 AUGUSTUS gene 3033572 3034027 0.44 + . g678 Scaffold_3 AUGUSTUS transcript 3033572 3034027 0.44 + . g678.t1 Scaffold_3 AUGUSTUS start_codon 3033572 3033574 . + 0 transcript_id "g678.t1"; gene_id "g678"; Scaffold_3 AUGUSTUS CDS 3033572 3033598 0.44 + 0 transcript_id "g678.t1"; gene_id "g678"; Scaffold_3 AUGUSTUS CDS 3033674 3034027 0.66 + 0 transcript_id "g678.t1"; gene_id "g678"; Scaffold_3 AUGUSTUS stop_codon 3034025 3034027 . + 0 transcript_id "g678.t1"; gene_id "g678"; # protein sequence = [MTHRYTLNLSFTFFQIGNEINNGILWPVGEIASAGYSPLSQLLHSAANGAHDADSSVQVVVHLANGWEESAVASFYEQ # IFIAGEFATTDFDVMGFSFYPFYDAGATYAALLASMNNIVSKYGKMSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g678 ### # start gene g679 Scaffold_3 AUGUSTUS gene 3049877 3050479 0.98 + . g679 Scaffold_3 AUGUSTUS transcript 3049877 3050479 0.98 + . g679.t1 Scaffold_3 AUGUSTUS start_codon 3049877 3049879 . + 0 transcript_id "g679.t1"; gene_id "g679"; Scaffold_3 AUGUSTUS CDS 3049877 3050479 0.98 + 0 transcript_id "g679.t1"; gene_id "g679"; Scaffold_3 AUGUSTUS stop_codon 3050477 3050479 . + 0 transcript_id "g679.t1"; gene_id "g679"; # protein sequence = [MSLKWVKENIELGYADVYADGSSSDPVFSLVQIDTDKMARIGFDFNLNVADFHESETITIRAAPELYLPDPARFTENR # ALSSGASLLEASELAEAWRDATAKLEASSGLGEHWMPILETLEDLDSGGYRVQFVNLEDLSETHWISTDDPEIKDFKAYLDERLKALDHAYEFEGGTF # VQKEDVTSAKAIDGLNAMFVVKTH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g679 ### # start gene g680 Scaffold_3 AUGUSTUS gene 3058379 3060451 0.18 - . g680 Scaffold_3 AUGUSTUS transcript 3058379 3060451 0.18 - . g680.t1 Scaffold_3 AUGUSTUS stop_codon 3058379 3058381 . - 0 transcript_id "g680.t1"; gene_id "g680"; Scaffold_3 AUGUSTUS CDS 3058379 3059231 0.95 - 1 transcript_id "g680.t1"; gene_id "g680"; Scaffold_3 AUGUSTUS CDS 3059880 3060451 0.18 - 0 transcript_id "g680.t1"; gene_id "g680"; Scaffold_3 AUGUSTUS start_codon 3060449 3060451 . - 0 transcript_id "g680.t1"; gene_id "g680"; # protein sequence = [MERESSVQPVSALYSTSVQLVAAPPPKQLSSKNTAVDFSTEQKDEVQTIYESAPKHQINKLTLPHLYQLSLFIAKLKL # ASSARSKLNSVDPLPDLYADEGWVAPPEEGHPQIGDEECYYDEESAESDDDEEEDNCEEEQSEVDPVETVLPIPNPSRKPLSKEETVQATNTLQDFVH # IHVSPPLATFKQPPXSYGTNYVHTILPKSETALLKGVNVQHFLPIATLYTDCFENVDNRGTRVADLFDDEIPSEPAVLDWASTSLPLLEKSSYALLQE # WINQSDTPGTAFIRAKIVWQAKFRDMNFATQDSGAPNSQVVFNMSGRPWSAGSIQCIFVAGWENEKVQHTKTFVEIYPYCALSNVDAQADNYRQFSFA # GRLFYNRLDRTQALVLPLDAIAGHFGHSPQFHSGMQEKTIHVLPLNRVCLGKYGICTLTKSKLSRNSCLTPTKWLRGVLMSLRRIFLSRLILSLLNIK # FFKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g680 ### # start gene g681 Scaffold_3 AUGUSTUS gene 3068081 3069473 0.27 - . g681 Scaffold_3 AUGUSTUS transcript 3068081 3069473 0.27 - . g681.t1 Scaffold_3 AUGUSTUS stop_codon 3068081 3068083 . - 0 transcript_id "g681.t1"; gene_id "g681"; Scaffold_3 AUGUSTUS CDS 3068081 3068866 0.46 - 0 transcript_id "g681.t1"; gene_id "g681"; Scaffold_3 AUGUSTUS CDS 3069303 3069473 0.29 - 0 transcript_id "g681.t1"; gene_id "g681"; Scaffold_3 AUGUSTUS start_codon 3069471 3069473 . - 0 transcript_id "g681.t1"; gene_id "g681"; # protein sequence = [MQSDDRAGATDSLASIVRKRKRSVEHEDLSQTWLSPWLDLKNNSLSQEMLIAGLGPLDLALLTPVSVSSSWRSPEDVA # RPLPITISLPLGTLPAVSSPQDVVTHTPTELSSPQYVAHTPPSSPTSLPPPPPPSESSSTTVNHSVPSYSQPRNALLELDYVSDDEDMEQIAPKLLTI # RAPEHEVHMQSTQLQSDRVRHESGSIDTSAPLHNILSTMVPSPDLLHPVGYPSTALGKRKAEDSSIGEPTGLSGSSDNVQQMNGESGVLKSKSRVGTG # AKQARMELPSKLLIRMTKLIPNHLSQPLEEKCCEKISLKAALPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g681 ### # start gene g682 Scaffold_3 AUGUSTUS gene 3077924 3078277 0.97 + . g682 Scaffold_3 AUGUSTUS transcript 3077924 3078277 0.97 + . g682.t1 Scaffold_3 AUGUSTUS start_codon 3077924 3077926 . + 0 transcript_id "g682.t1"; gene_id "g682"; Scaffold_3 AUGUSTUS CDS 3077924 3078277 0.97 + 0 transcript_id "g682.t1"; gene_id "g682"; Scaffold_3 AUGUSTUS stop_codon 3078275 3078277 . + 0 transcript_id "g682.t1"; gene_id "g682"; # protein sequence = [MDTDYDAERGVVWAFVELPGVHRENLKVILANDPIIGQRGIQIWGFTLPPDSQFAGVSSNYGDSMAPMTDPSMSLAFG # YGTPPNLTLHERKYGEFFRFLPVPTMTKVGSSFSLPMIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g682 ### # start gene g683 Scaffold_3 AUGUSTUS gene 3084427 3084759 0.92 + . g683 Scaffold_3 AUGUSTUS transcript 3084427 3084759 0.92 + . g683.t1 Scaffold_3 AUGUSTUS start_codon 3084427 3084429 . + 0 transcript_id "g683.t1"; gene_id "g683"; Scaffold_3 AUGUSTUS CDS 3084427 3084759 0.92 + 0 transcript_id "g683.t1"; gene_id "g683"; Scaffold_3 AUGUSTUS stop_codon 3084757 3084759 . + 0 transcript_id "g683.t1"; gene_id "g683"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSLLELILQSSKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g683 ### # start gene g684 Scaffold_3 AUGUSTUS gene 3085024 3086076 0.98 + . g684 Scaffold_3 AUGUSTUS transcript 3085024 3086076 0.98 + . g684.t1 Scaffold_3 AUGUSTUS start_codon 3085024 3085026 . + 0 transcript_id "g684.t1"; gene_id "g684"; Scaffold_3 AUGUSTUS CDS 3085024 3086076 0.98 + 0 transcript_id "g684.t1"; gene_id "g684"; Scaffold_3 AUGUSTUS stop_codon 3086074 3086076 . + 0 transcript_id "g684.t1"; gene_id "g684"; # protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLS # YLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIK # DEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSG # QSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g684 ### # start gene g685 Scaffold_3 AUGUSTUS gene 3089132 3089959 0.26 + . g685 Scaffold_3 AUGUSTUS transcript 3089132 3089959 0.26 + . g685.t1 Scaffold_3 AUGUSTUS start_codon 3089132 3089134 . + 0 transcript_id "g685.t1"; gene_id "g685"; Scaffold_3 AUGUSTUS CDS 3089132 3089959 0.26 + 0 transcript_id "g685.t1"; gene_id "g685"; Scaffold_3 AUGUSTUS stop_codon 3089957 3089959 . + 0 transcript_id "g685.t1"; gene_id "g685"; # protein sequence = [MELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPE # VDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRR # IHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPLKPG # P] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g685 ### # start gene g686 Scaffold_3 AUGUSTUS gene 3099122 3100056 0.4 + . g686 Scaffold_3 AUGUSTUS transcript 3099122 3100056 0.4 + . g686.t1 Scaffold_3 AUGUSTUS start_codon 3099122 3099124 . + 0 transcript_id "g686.t1"; gene_id "g686"; Scaffold_3 AUGUSTUS CDS 3099122 3099162 0.4 + 0 transcript_id "g686.t1"; gene_id "g686"; Scaffold_3 AUGUSTUS CDS 3099273 3100056 0.75 + 1 transcript_id "g686.t1"; gene_id "g686"; Scaffold_3 AUGUSTUS stop_codon 3100054 3100056 . + 0 transcript_id "g686.t1"; gene_id "g686"; # protein sequence = [MFEQLGTRLRCLLSAKKDKEKKQRTSSKRKDDESSKGYSTGSGPGGYKSTSGYSKGGSPGPTTSNGSGSSNRPSPTSA # MTPRPPSRVDEDYDEGVADALTGLAAYRPPPAEGSSESHSYAPSISSGSRHSDSRPSVSHRDSISSNRSHMSPPPQPMKRALSPVPDDSNDDKRSRID # SVKRRASSPSNGRRTPVPSTRPSPIPFRTQPTSHSPDSVKHEAYPPSLPLPAVLLPHPRPIGAGAGVGITQPSSSASIALPPIATLVPHLKCTVSWCW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g686 ### # start gene g687 Scaffold_3 AUGUSTUS gene 3104877 3105107 0.74 - . g687 Scaffold_3 AUGUSTUS transcript 3104877 3105107 0.74 - . g687.t1 Scaffold_3 AUGUSTUS stop_codon 3104877 3104879 . - 0 transcript_id "g687.t1"; gene_id "g687"; Scaffold_3 AUGUSTUS CDS 3104877 3105107 0.74 - 0 transcript_id "g687.t1"; gene_id "g687"; Scaffold_3 AUGUSTUS start_codon 3105105 3105107 . - 0 transcript_id "g687.t1"; gene_id "g687"; # protein sequence = [MDGSKRRLLIDALEALRKERKHRDADEEKLWRNLAKRVCAFGPLGGERGNEGDEGTGDSESKVDMGYSIRHFEDLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g687 ### # start gene g688 Scaffold_3 AUGUSTUS gene 3111086 3111415 0.35 + . g688 Scaffold_3 AUGUSTUS transcript 3111086 3111415 0.35 + . g688.t1 Scaffold_3 AUGUSTUS start_codon 3111086 3111088 . + 0 transcript_id "g688.t1"; gene_id "g688"; Scaffold_3 AUGUSTUS CDS 3111086 3111415 0.35 + 0 transcript_id "g688.t1"; gene_id "g688"; Scaffold_3 AUGUSTUS stop_codon 3111413 3111415 . + 0 transcript_id "g688.t1"; gene_id "g688"; # protein sequence = [MAQCATCDVTYPALFSVMFGPLPPSPPLTESLETKIGSEFHQPLASQAVADMAQCATCDMTYRTLFFNHVQSPTTFTT # THRITKNQDWLRVPSSQAVADMAQCATCDMA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g688 ### # start gene g689 Scaffold_3 AUGUSTUS gene 3111565 3112005 0.78 + . g689 Scaffold_3 AUGUSTUS transcript 3111565 3112005 0.78 + . g689.t1 Scaffold_3 AUGUSTUS start_codon 3111565 3111567 . + 0 transcript_id "g689.t1"; gene_id "g689"; Scaffold_3 AUGUSTUS CDS 3111565 3112005 0.78 + 0 transcript_id "g689.t1"; gene_id "g689"; Scaffold_3 AUGUSTUS stop_codon 3112003 3112005 . + 0 transcript_id "g689.t1"; gene_id "g689"; # protein sequence = [MSYTIFNHVQSPTTFTTTHRITRTKIGSEFHQPLASQAVADMAQCATCDVTYPALFSVMFGPLPPSPPLTESLETKIG # SEFHQPLASQAVADMAQCATCDVTYRTLFSIMFDPLPPSPPLTESLKPRLAQSSIVPSCRRHGAVCHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g689 ### # start gene g690 Scaffold_3 AUGUSTUS gene 3115361 3117179 0.34 - . g690 Scaffold_3 AUGUSTUS transcript 3115361 3117179 0.34 - . g690.t1 Scaffold_3 AUGUSTUS stop_codon 3115361 3115363 . - 0 transcript_id "g690.t1"; gene_id "g690"; Scaffold_3 AUGUSTUS CDS 3115361 3116467 0.36 - 0 transcript_id "g690.t1"; gene_id "g690"; Scaffold_3 AUGUSTUS CDS 3116711 3116945 0.95 - 1 transcript_id "g690.t1"; gene_id "g690"; Scaffold_3 AUGUSTUS CDS 3117022 3117179 0.97 - 0 transcript_id "g690.t1"; gene_id "g690"; Scaffold_3 AUGUSTUS start_codon 3117177 3117179 . - 0 transcript_id "g690.t1"; gene_id "g690"; # protein sequence = [MFTGSLFEEVKELEDEIQAVKTKVDDPVMCEKIKNFVNAPKEIQDALKADAGNIVLRSGEEPVLSRAQLHRVAKASQA # HAIYLKHRETLADSDDDDGPQDDDSWLYEDLKVLGQLYSRLKDREQLIDLVFESFTVTQEDPNRTVQSFVDLIQRHEQSFYSFVHKVHSKGEGLFDSL # MRWIELFLTFMREGLGPPISLEFLLPHMGLERTEILAEVDKVALYHYKLKLLYENKVRRRFGRTQAQGDADAEDQVTKALVDGVVGEISFGDLVQGAA # DDMAAEDAEEDSEDEDEDESSTEYETDSESGSDVSEASNEPPPPPPPKAVDLRRSRTAATQTPPPPRPMNARSGSRPPDIRRSRQEPSPLKSSRSMTS # MDYQRQRGHAPPVPPLPRNAHLVALSKPLPPSPAPSSERFGSPSRASVESKPHPEKTKKSRPKGKQIIKPPELTRIPTLLPIFREMVSPAYLHVGLTH # YSLKLGSQIRPLLRPRQRTHTSNTPTPNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g690 ### # start gene g691 Scaffold_3 AUGUSTUS gene 3118330 3119085 0.84 - . g691 Scaffold_3 AUGUSTUS transcript 3118330 3119085 0.84 - . g691.t1 Scaffold_3 AUGUSTUS stop_codon 3118330 3118332 . - 0 transcript_id "g691.t1"; gene_id "g691"; Scaffold_3 AUGUSTUS CDS 3118330 3119085 0.84 - 0 transcript_id "g691.t1"; gene_id "g691"; Scaffold_3 AUGUSTUS start_codon 3119083 3119085 . - 0 transcript_id "g691.t1"; gene_id "g691"; # protein sequence = [MSSVSMTDVAPPPPTRPRRPTRSAPPPPELPDVDIPRASSPEIQPEQQSSKPQPSNEILTPLRAHYLKKSLIQLEFER # EIDDITTSAPNNVSTFSYLGPPFNPPPKEAPPIDLPFLRFMFRQFVLTFPFMASAPSNFYSEKLQPFLGALFSRNLTATSVFDDNHEGDSSTTSMNAV # ARLERNFSLFFGAATKVIEPEEVVRLNQSDLDHLEALAKKREARNLKHRDIFEVNIVSVRTVIDKGRVRSRAHEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g691 ### # start gene g692 Scaffold_3 AUGUSTUS gene 3120566 3120895 0.98 + . g692 Scaffold_3 AUGUSTUS transcript 3120566 3120895 0.98 + . g692.t1 Scaffold_3 AUGUSTUS start_codon 3120566 3120568 . + 0 transcript_id "g692.t1"; gene_id "g692"; Scaffold_3 AUGUSTUS CDS 3120566 3120895 0.98 + 0 transcript_id "g692.t1"; gene_id "g692"; Scaffold_3 AUGUSTUS stop_codon 3120893 3120895 . + 0 transcript_id "g692.t1"; gene_id "g692"; # protein sequence = [MAPASKSKPANGSTAKGKASTPTTNGTTTPVSVASEKKDTSEVPSVSGGKPDKKAYDVEQERLKGEIDALQVKLVCIF # HHSVAFPVAHVPDAIVGCKRQNFPCHQRRGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g692 ### # start gene g693 Scaffold_3 AUGUSTUS gene 3125765 3127270 0.48 - . g693 Scaffold_3 AUGUSTUS transcript 3125765 3127270 0.48 - . g693.t1 Scaffold_3 AUGUSTUS stop_codon 3125765 3125767 . - 0 transcript_id "g693.t1"; gene_id "g693"; Scaffold_3 AUGUSTUS CDS 3125765 3127270 0.48 - 0 transcript_id "g693.t1"; gene_id "g693"; Scaffold_3 AUGUSTUS start_codon 3127268 3127270 . - 0 transcript_id "g693.t1"; gene_id "g693"; # protein sequence = [MRHRKASLDLPDLAAMYDTVQTRSSPWSIPVKAQERKETIYVQPKVHIENNLGRRVQDQPQTPIPSVESFPRTVSFHP # AAPPPSRTTTSETLVIRSSLPMALDFDAIPEAVEPSISLVDRKINWHGKAASVFVVHMADNVSVRTMMDQLSVSPCLLFRILISFVCYTSSPTSFSTS # VAFPPGTHHIRFLVDDQWRVTDDLPKAVDDAGNLANYIHVDPPHDPNNPQPTRITPPRSPLGTHVIVTSLPPLEGNLANLGRLSLGRSFWSSSTENSD # HDHDSGSADERAALSRYMPRWTTDIPLELLQAAKEEEVYLEYASKTPSRRPGESQVQQGFVPLPNIPPAPGLPRYLEKLILNQGFTHTVGHDRRHKDK # RSSRENIERLNEDLIHRSGVILPLPVTTASGTDIATGVSVRAPELAGTERMLPVMEAIEGGELDPTSPHAAAALATLATISDDSSVLPVPSHVVLHHV # CTSTIKEGVLAVASTVRYRKKYLTTVFYKPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g693 ### # start gene g694 Scaffold_3 AUGUSTUS gene 3129953 3131191 0.22 - . g694 Scaffold_3 AUGUSTUS transcript 3129953 3131191 0.22 - . g694.t1 Scaffold_3 AUGUSTUS stop_codon 3129953 3129955 . - 0 transcript_id "g694.t1"; gene_id "g694"; Scaffold_3 AUGUSTUS CDS 3129953 3130441 0.44 - 0 transcript_id "g694.t1"; gene_id "g694"; Scaffold_3 AUGUSTUS CDS 3130920 3130956 0.74 - 1 transcript_id "g694.t1"; gene_id "g694"; Scaffold_3 AUGUSTUS CDS 3131010 3131191 0.51 - 0 transcript_id "g694.t1"; gene_id "g694"; Scaffold_3 AUGUSTUS start_codon 3131189 3131191 . - 0 transcript_id "g694.t1"; gene_id "g694"; # protein sequence = [MYGGAPPQTMAPSPEANHAAGAFGRMTLSNDQTLEKLAANVRAATTTSASDRAKQIFVQAWLTANYAPYPDGNDSSDK # TPTAATLLSQAQSAHRPPGSFPPQAPIRRHPQADSSLTVSQSSPSSSVPYLASSQPVSVRQFPHFPSIEEAVGSNSTSQHSIAAREVWGWFQDHLDLL # LENVRLFRFDHLRSISERFGPAWAVIIGKLFMLLLLLALWPKLMQLYMMYVGAKHWLRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g694 ### # start gene g695 Scaffold_3 AUGUSTUS gene 3145527 3146120 0.79 + . g695 Scaffold_3 AUGUSTUS transcript 3145527 3146120 0.79 + . g695.t1 Scaffold_3 AUGUSTUS start_codon 3145527 3145529 . + 0 transcript_id "g695.t1"; gene_id "g695"; Scaffold_3 AUGUSTUS CDS 3145527 3146120 0.79 + 0 transcript_id "g695.t1"; gene_id "g695"; Scaffold_3 AUGUSTUS stop_codon 3146118 3146120 . + 0 transcript_id "g695.t1"; gene_id "g695"; # protein sequence = [MDHAEFLKRGTSYLKNPNDDPELSKSIDDFKSVLSYVAGDYEDGSAFDNLNQHLEEIESHYQSKECNRIFYLALPPSV # FIPVAKNLKEHCYVTKGGINRIIVEKPFGKDTESARELLGSLKKYWTEDETFRIDHYLGKEMVKNLLVLRFANVAMNAAWDKNSISNVQITFKEPFGT # EGRGGYFDEFGIIRDILQNRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g695 ### # start gene g696 Scaffold_3 AUGUSTUS gene 3149540 3150139 0.52 - . g696 Scaffold_3 AUGUSTUS transcript 3149540 3150139 0.52 - . g696.t1 Scaffold_3 AUGUSTUS stop_codon 3149540 3149542 . - 0 transcript_id "g696.t1"; gene_id "g696"; Scaffold_3 AUGUSTUS CDS 3149540 3150139 0.52 - 0 transcript_id "g696.t1"; gene_id "g696"; Scaffold_3 AUGUSTUS start_codon 3150137 3150139 . - 0 transcript_id "g696.t1"; gene_id "g696"; # protein sequence = [MSSSASSSSASSSNLNASDQIEYGTMLEIRSVQMLPDGRSMVETWGVWRFRILERGLMDGYVNARIERIDDIPDEEEN # EESESPVAPVEVHRPSTLQRLTSRLSSVTSTADSPSSSQFLASGSTYSGIASTSHYLKVHPKLIRSLSTTSTTSSSFHKTSYRALHFVFIPVAHFDYS # LGRATSFLHTWASTSFRPIGPCI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g696 ### # start gene g697 Scaffold_3 AUGUSTUS gene 3153284 3154216 0.64 + . g697 Scaffold_3 AUGUSTUS transcript 3153284 3154216 0.64 + . g697.t1 Scaffold_3 AUGUSTUS start_codon 3153284 3153286 . + 0 transcript_id "g697.t1"; gene_id "g697"; Scaffold_3 AUGUSTUS CDS 3153284 3154216 0.64 + 0 transcript_id "g697.t1"; gene_id "g697"; Scaffold_3 AUGUSTUS stop_codon 3154214 3154216 . + 0 transcript_id "g697.t1"; gene_id "g697"; # protein sequence = [MGTGKDGLSSIAGLPSVASHSHLLSGSSLPLASGFKTGLASGLTGTLASTLTGGSMNSGAASVLMPMSDLEEFIEVIL # GEISYRRNREEKREKRERKERIKIRIKEEKEEQKERERERERDKKGADNLSSSSSSDGLVDFSRAAKKVKAKVKGRSVDKGDERDSEEAKDVVKEHKR # RKDKDNVGGVGGLVLGLWTGRVNLVIKLREKTEERERERERSIQFSDARQVAERDGVLSDGVTSWQNNPRIPPKISIIDRHFGVTEMPTLTLILTMIE # RESHFLHAMELPQHLHGGPVYLARDPEAAMVRFRTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g697 ### # start gene g698 Scaffold_3 AUGUSTUS gene 3154460 3156365 0.92 + . g698 Scaffold_3 AUGUSTUS transcript 3154460 3156365 0.92 + . g698.t1 Scaffold_3 AUGUSTUS start_codon 3154460 3154462 . + 0 transcript_id "g698.t1"; gene_id "g698"; Scaffold_3 AUGUSTUS CDS 3154460 3155598 0.92 + 0 transcript_id "g698.t1"; gene_id "g698"; Scaffold_3 AUGUSTUS CDS 3155660 3156365 0.95 + 1 transcript_id "g698.t1"; gene_id "g698"; Scaffold_3 AUGUSTUS stop_codon 3156363 3156365 . + 0 transcript_id "g698.t1"; gene_id "g698"; # protein sequence = [MPHAESNVVSLSPTPSPPGSPSIPHFITREPPSPTQPFHVPSVPSSAAAKISSGGKLSIPSFGSLQIHLHSRSHSPVY # GDDDDDLLSSGQVSPIGYGSGYGLGFESGTDDPRTPRGWPADYLNNRLVRLGSSFPNVPSKRGSEASAQTQSSTSSKFQDMSPKKEQDIAYRSLGKGH # PTQRTWAGNRVPHASRVSSWSDPISARDVMQGIGDRTRQSSEIDEGLESEDRLSKDEELERGKTIFVDYNQRHRRSSTVRPTQNAFTNEAGTWTNEGA # SDIMAYSHHIRSQSITGRRSVRLRDSGSRNEGKTYHLEDDTAEEGATTRKMLGIVPRRRRSFHSLSIYRHDFSPIDVEMTDEDVKQRIPIKVLPIDRM # RIDVDLCGLVSCLAIMFSPISPRLLQILTSRLSDTNARMRSYYEAHLPDIVELETHTKAIAEVDLENANVMKISQATKTLWYEAEQFRVPDLWHIASP # PRQKVLVMRQKLFGTGGRRFPQGVHGAHGRFNRVQKTLDGRERLVDSEGKTESEVEEERKIDEDGVFISPPKEDVEDVVEHPSIKPMWLLRFFTSWVN # WRPSASVATQRIENPSSPASPTVTQEMTGEVSTPSQPIRLEKAVSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g698 ### # start gene g699 Scaffold_3 AUGUSTUS gene 3159852 3160514 0.47 - . g699 Scaffold_3 AUGUSTUS transcript 3159852 3160514 0.47 - . g699.t1 Scaffold_3 AUGUSTUS stop_codon 3159852 3159854 . - 0 transcript_id "g699.t1"; gene_id "g699"; Scaffold_3 AUGUSTUS CDS 3159852 3160514 0.47 - 0 transcript_id "g699.t1"; gene_id "g699"; Scaffold_3 AUGUSTUS start_codon 3160512 3160514 . - 0 transcript_id "g699.t1"; gene_id "g699"; # protein sequence = [MRMNKIIIDLNGDHIDILEGTPTALEFARIVQISRPVLIKSHLKTHSPSLETDMAICPRIPGIQLQMVERLSDQQDGL # PPNICGCHSQWVRVSTFSSCTNPTNTRKRRADAITLGPNGKLYFAEPAVEKMTMKSLLDNLSDDKASDGDGAVCARLPLRTFPAHSTRQAAEKYYLQS # QNGNVYSSRFFNGQDDSSEFETLRQDIPSDVKWCTEALGWSNLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g699 ### # start gene g700 Scaffold_3 AUGUSTUS gene 3160772 3162874 0.27 + . g700 Scaffold_3 AUGUSTUS transcript 3160772 3162874 0.27 + . g700.t1 Scaffold_3 AUGUSTUS start_codon 3160772 3160774 . + 0 transcript_id "g700.t1"; gene_id "g700"; Scaffold_3 AUGUSTUS CDS 3160772 3160855 0.3 + 0 transcript_id "g700.t1"; gene_id "g700"; Scaffold_3 AUGUSTUS CDS 3160952 3162874 0.68 + 0 transcript_id "g700.t1"; gene_id "g700"; Scaffold_3 AUGUSTUS stop_codon 3162872 3162874 . + 0 transcript_id "g700.t1"; gene_id "g700"; # protein sequence = [MADEKRSDNVPKSSTIPSRKSKLVCLMPKTAASITVDLDDSPAGLQELRQESFDSHLNLDYDPPKLTGASHLWLQVIL # TDLFQGESVDIPLISEQITSRPEQMVSASSLETLASNSMRFLTPDIQVVERATGLREDDPIVVDSSPVKLYSQPTRAVPQTLYSIFAPRTRVEPSVTP # VNPAKIPISHLEAPFPDASSQHVRGPQTTYNAPSISFPPRYQDTTASNTSLHVSDVIGIPSLVETKDEHAHKLRLDASTSHTVRAVHLTSIPTEHLQS # HPVIAHLVETATFEPDSFSGDSHRLWTDKWRPSRADHVLGNEEQATFLRQWLCALEVNFITASAPPDVNAFAASRAPGRLGKGKTKSTANEKRGTKRR # VIRAVEKRKRQRIDSDDDDDSWIIYSDNVSETESPPIDNFEDTEECVENASPRLYRQSRRNDSSSTIHYPTHLTFQERLTNTILLSGPNSTGKTAAVY # ACAAELGWEIFEVYPGVGKRSGANLDNLIGEVGKNHLVRKTQLQNENSGTNPKVDGSLKSAFARGKEKNNGKIWIPNDHRERSTSMNGFGFVEELNGT # QHEEHEAAARQSLILLEEVDVLFKEDVNFWGSIISLIKDCKRPVILTCNGTILFCLFIILLNDIRCLSGACGRASFARCAEFSALFHKCCYFVLTGIV # LR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g700 ### # start gene g701 Scaffold_3 AUGUSTUS gene 3164839 3165596 0.78 + . g701 Scaffold_3 AUGUSTUS transcript 3164839 3165596 0.78 + . g701.t1 Scaffold_3 AUGUSTUS start_codon 3164839 3164841 . + 0 transcript_id "g701.t1"; gene_id "g701"; Scaffold_3 AUGUSTUS CDS 3164839 3165163 0.78 + 0 transcript_id "g701.t1"; gene_id "g701"; Scaffold_3 AUGUSTUS CDS 3165241 3165596 1 + 2 transcript_id "g701.t1"; gene_id "g701"; Scaffold_3 AUGUSTUS stop_codon 3165594 3165596 . + 0 transcript_id "g701.t1"; gene_id "g701"; # protein sequence = [MSVPNVLSASPPTSTGPTRVLRSRSRPPSRQTRAEDAQSASPEDPLADPLASSSSSVKAAKDSGATPYSRSPELRVSH # KLAERKRRKEMKDLFDELRDQLPADRGMKATIDFVNQLKQSHQDMAREIDMLRHELDAVRQNAGLPPFTGPPPPHLIYAQGPIPAPYPLPPGVLPHPP # PISHPTAQQQHPQHPLSRPASSQNMLPLGEQNPPPPQNGDLPRPEVHPTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g701 ### # start gene g702 Scaffold_3 AUGUSTUS gene 3165959 3167231 0.66 + . g702 Scaffold_3 AUGUSTUS transcript 3165959 3167231 0.66 + . g702.t1 Scaffold_3 AUGUSTUS start_codon 3165959 3165961 . + 0 transcript_id "g702.t1"; gene_id "g702"; Scaffold_3 AUGUSTUS CDS 3165959 3166768 0.94 + 0 transcript_id "g702.t1"; gene_id "g702"; Scaffold_3 AUGUSTUS CDS 3166827 3167231 0.68 + 0 transcript_id "g702.t1"; gene_id "g702"; Scaffold_3 AUGUSTUS stop_codon 3167229 3167231 . + 0 transcript_id "g702.t1"; gene_id "g702"; # protein sequence = [MAPKAKADISLLFHPKKNKKSTSISSPRPPPPNSALNGSRPSSPVKAKPSPKPSPPKPNADDDEADLQLPDGPYQEFR # IMSSALNGWKYDVMKFDSRKSVDILRWQGPIKLNRKDLRREDPSMSGAGQAVRPMLGLDGQPVIGSDGKTVMVDSEGRPVTENGASGSGAGKGKGLTN # GKKKFQKKTRQVFIVPDEVRNLRKEERYPWVIEDAPGSEVWTAQLDDLGKAETHAFFMPAANDVFKFVPSHRYYKFQKKLKHDMPTDTTSVESAYQKS # LKRDPSTWLHQRNGKGPSAATAAMFKAEADGQPQANGSLVHQAQQSLGPGGRRLKAVDSGADDLFGEDDEDNGAAKRRAKEFGGEGDMDEMVYEEDFA # DDEEKMDVEDTNDQEAKELEVRCLNKQQSNSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g702 ### # start gene g703 Scaffold_3 AUGUSTUS gene 3169136 3169438 0.58 + . g703 Scaffold_3 AUGUSTUS transcript 3169136 3169438 0.58 + . g703.t1 Scaffold_3 AUGUSTUS start_codon 3169136 3169138 . + 0 transcript_id "g703.t1"; gene_id "g703"; Scaffold_3 AUGUSTUS CDS 3169136 3169438 0.58 + 0 transcript_id "g703.t1"; gene_id "g703"; Scaffold_3 AUGUSTUS stop_codon 3169436 3169438 . + 0 transcript_id "g703.t1"; gene_id "g703"; # protein sequence = [MVIYRHVPSAWAAAYPSSTPDTSQLPAAWTAALNTAVGAGKIPNVPVSSQPVPDTNPVYPDGYDPTGPDVCSGTYKCR # IPGNVWDAPDGFIGTGNSSVFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g703 ### # start gene g704 Scaffold_3 AUGUSTUS gene 3172070 3172744 0.49 - . g704 Scaffold_3 AUGUSTUS transcript 3172070 3172744 0.49 - . g704.t1 Scaffold_3 AUGUSTUS stop_codon 3172070 3172072 . - 0 transcript_id "g704.t1"; gene_id "g704"; Scaffold_3 AUGUSTUS CDS 3172070 3172744 0.49 - 0 transcript_id "g704.t1"; gene_id "g704"; Scaffold_3 AUGUSTUS start_codon 3172742 3172744 . - 0 transcript_id "g704.t1"; gene_id "g704"; # protein sequence = [MGWDANSSIRSDWNFDTIKTSSIMGTYRNMAKDLSSMSEAYEDEFIDSGLPSTIDTAAATKGSDPIANGRIGSNFDAA # HSTVVIKSPVIEKDMETLLEATESPVSSEPLSDSVTPPPAYSGSIRSNRRSSYAERHSIDGAGTVMREADLGTGVDTIRPVKKVDTVGSLKISAEHVG # SLRKNSGSSSGPSSPTLHRRAASEIGRAGTSIVDEVVLPVLSQVRRAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g704 ### # start gene g705 Scaffold_3 AUGUSTUS gene 3172930 3173872 0.86 - . g705 Scaffold_3 AUGUSTUS transcript 3172930 3173872 0.86 - . g705.t1 Scaffold_3 AUGUSTUS stop_codon 3172930 3172932 . - 0 transcript_id "g705.t1"; gene_id "g705"; Scaffold_3 AUGUSTUS CDS 3172930 3173570 0.89 - 2 transcript_id "g705.t1"; gene_id "g705"; Scaffold_3 AUGUSTUS CDS 3173632 3173872 0.96 - 0 transcript_id "g705.t1"; gene_id "g705"; Scaffold_3 AUGUSTUS start_codon 3173870 3173872 . - 0 transcript_id "g705.t1"; gene_id "g705"; # protein sequence = [MAQFSQHDDGFQTSAQSAYSISSLFSQAEHRNGPRDPYPIPSSNPASQYTLLEKLGTGSFGIVYKAMHNETKQIVAIK # QIDLEDTDDDISEIQQEIASLAQCDSEYVTRYYGSFVVAYKLWIVMEYLAGGSCLDLLKPGPFSEAHIAVICRELLLGLDYLHTEGTIHRDIKAANVL # LSSSGKVKLADFGVAAQLTNTLRHTFVGTPFWMAPEVIRQAGYDAKADMWSLGITAIEMALGEPPLAEYHPMRVLFLIPKAKPPVLEGPFSAAFKDFV # SLCLTKDTNAVRPYHSIQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g705 ### # start gene g706 Scaffold_3 AUGUSTUS gene 3179327 3181048 0.8 - . g706 Scaffold_3 AUGUSTUS transcript 3179327 3181048 0.8 - . g706.t1 Scaffold_3 AUGUSTUS stop_codon 3179327 3179329 . - 0 transcript_id "g706.t1"; gene_id "g706"; Scaffold_3 AUGUSTUS CDS 3179327 3181048 0.8 - 0 transcript_id "g706.t1"; gene_id "g706"; Scaffold_3 AUGUSTUS start_codon 3181046 3181048 . - 0 transcript_id "g706.t1"; gene_id "g706"; # protein sequence = [MPSPGIRNHRPLSTSSSSSPLAPTESSFPVVIVAPPLPPPLSPRALRRRARSSLVDAFRLYVLPELNRRIRFSHLAGS # HMTSSIPSYGSDTPASYYTWIVGSTLKRVDKRLSEIGKDLKDELDAIGIEPSSLPLGLFAGLGKLFISLVYILSLNLLQGIGSSADPPTAQSLPCSLP # SLAGDSSDGDAGSRSEVDGELAERNDSDNVSEVTLFEPNASSTGNPITVHYHLPKPPANGSSTSSVIAFPPSLYLRSSLSSSDILTPASIVHPEVPLP # ESLNELLIQHNDFSSLHLRLAHLLLTSHTRAAAAAADIAQREAILQVRGRRRSWLNGALKAHGSSNSDTKGYPVNWSGAMATPFRQSGLGKYFYSSDE # NGVDPYHYLKMSRLSSLSTLVTDVYPNLFDYAGDNGFSTYFHGHRRKGSVNEKNLSLFPVSEEEFVDDGPSVHRNNFGHRGYLEVEIDEDDEDEDGED # TDVDPLVDVEFDGLDDDDDDMLTRPLRPFLQLDTHSSTGIPKSSTPFSPTAVSMHLEARIPKGASDDRVDDFAPLALANISKRIQNETKAEFLSDNIS # DVAPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g706 ### # start gene g707 Scaffold_3 AUGUSTUS gene 3181266 3181817 0.62 - . g707 Scaffold_3 AUGUSTUS transcript 3181266 3181817 0.62 - . g707.t1 Scaffold_3 AUGUSTUS stop_codon 3181266 3181268 . - 0 transcript_id "g707.t1"; gene_id "g707"; Scaffold_3 AUGUSTUS CDS 3181266 3181817 0.62 - 0 transcript_id "g707.t1"; gene_id "g707"; Scaffold_3 AUGUSTUS start_codon 3181815 3181817 . - 0 transcript_id "g707.t1"; gene_id "g707"; # protein sequence = [MLIRLIPSASQPTVLFKLVFENLPETLQTPAAWVNHLATLDSDDLEIPELMHALDKAVGVQGILEQVTFDLVEQKIKC # VFFDGETEEWHIGSCYQGLLGEAAHRRKADLVRRLDSVIDDVNESAAEVERERRREEERKEQKRMREEDERLDAAKQDEITASIHGRRNRPGHKKQRS # LLMNLVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g707 ### # start gene g708 Scaffold_3 AUGUSTUS gene 3189954 3190247 0.76 - . g708 Scaffold_3 AUGUSTUS transcript 3189954 3190247 0.76 - . g708.t1 Scaffold_3 AUGUSTUS stop_codon 3189954 3189956 . - 0 transcript_id "g708.t1"; gene_id "g708"; Scaffold_3 AUGUSTUS CDS 3189954 3190247 0.76 - 0 transcript_id "g708.t1"; gene_id "g708"; Scaffold_3 AUGUSTUS start_codon 3190245 3190247 . - 0 transcript_id "g708.t1"; gene_id "g708"; # protein sequence = [MGYDGSGVAGTLRWKDLALDQLLPVDEEKETALKAAEARKMASGTGNQNPQTQQQPAALAPGDETIDEEDDEDEDDES # EDDENDDEADEDEDSEEDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g708 ### # start gene g709 Scaffold_3 AUGUSTUS gene 3202790 3203137 0.65 - . g709 Scaffold_3 AUGUSTUS transcript 3202790 3203137 0.65 - . g709.t1 Scaffold_3 AUGUSTUS stop_codon 3202790 3202792 . - 0 transcript_id "g709.t1"; gene_id "g709"; Scaffold_3 AUGUSTUS CDS 3202790 3203137 0.65 - 0 transcript_id "g709.t1"; gene_id "g709"; Scaffold_3 AUGUSTUS start_codon 3203135 3203137 . - 0 transcript_id "g709.t1"; gene_id "g709"; # protein sequence = [MNGLARIEDWESHPKQLANAHSVHQAFMRHVDAVKKHDPSSAELSLAPTAAYVKILGATGLHQEIFDVFYSLDAEGRL # APDHLLFTAMFQALAMKPTAETGDLYKTQLVQNCCGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g709 ### # start gene g710 Scaffold_3 AUGUSTUS gene 3208162 3208800 0.6 - . g710 Scaffold_3 AUGUSTUS transcript 3208162 3208800 0.6 - . g710.t1 Scaffold_3 AUGUSTUS stop_codon 3208162 3208164 . - 0 transcript_id "g710.t1"; gene_id "g710"; Scaffold_3 AUGUSTUS CDS 3208162 3208800 0.6 - 0 transcript_id "g710.t1"; gene_id "g710"; Scaffold_3 AUGUSTUS start_codon 3208798 3208800 . - 0 transcript_id "g710.t1"; gene_id "g710"; # protein sequence = [MRHVHDIPDENSAFGITNLLTGPFSEIETGNTDRAPREWELDSAEWNDWGGRVPINVGRQAKKKEIARMRAHLLDDED # EDDPFSRLAKPMRDGAKKNPGNGQKPPSQPKKMRFELKVKGASNQASGPQDLLRRISSDVGSKGSGRPKDNDTYHRQHGSGRSDKDRERKRNQYRDRD # SPREDRNLKREQDRGREKGREQGPRYKGGYSNGYYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g710 ### # start gene g711 Scaffold_3 AUGUSTUS gene 3210585 3212162 0.61 + . g711 Scaffold_3 AUGUSTUS transcript 3210585 3212162 0.61 + . g711.t1 Scaffold_3 AUGUSTUS start_codon 3210585 3210587 . + 0 transcript_id "g711.t1"; gene_id "g711"; Scaffold_3 AUGUSTUS CDS 3210585 3212162 0.61 + 0 transcript_id "g711.t1"; gene_id "g711"; Scaffold_3 AUGUSTUS stop_codon 3212160 3212162 . + 0 transcript_id "g711.t1"; gene_id "g711"; # protein sequence = [MEKHHSSTSAPATELNTVRVYSTSSNTTIDLDPESQSSSNHTTGTNTQRTSMRSNPFEDNHSIQTTGTEGTNVIPIAL # VTPDSLHHSAVSSETETSRSPSPMRPARTPEIDLNLDHINVSHDSLKQIGNYPTSTRSDVSAMSRNSYMSSASYSSDFLNEAPMIMTPNKGAVRQVLG # VVKAEMVNAPGHSPTSAEGLKPSASTSKPAVRSPLAASSFGPADLNFDAVSVSTSEEGGNPFSDRHSTRTTLASSPAASHTTFGEPSPAFNTGTDWAE # TGPRLPWSTGDDGSRPSSVSTQAGSVIDIANATRVNLGLSQLSRESGVLTPRTRTTMGKLVNPSTATTELDTFEEQQQRALAHAQAQAQAQGGVQSRR # ISASSAMSATADSILESFPFVPPSPISNRPARSPPLSPLAQQAFNVSPPSPMSSQNFQATPFDSKLDSNAVVPTPNRKTLGLSTGSQLSTVSTGLGSF # PFQIDTGNSRDSTAPSAFSGRQRASLDTLAITSDLSSFPLGFDRDSVTVPVPRRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g711 ### # start gene g712 Scaffold_3 AUGUSTUS gene 3213457 3214122 0.97 - . g712 Scaffold_3 AUGUSTUS transcript 3213457 3214122 0.97 - . g712.t1 Scaffold_3 AUGUSTUS stop_codon 3213457 3213459 . - 0 transcript_id "g712.t1"; gene_id "g712"; Scaffold_3 AUGUSTUS CDS 3213457 3214122 0.97 - 0 transcript_id "g712.t1"; gene_id "g712"; Scaffold_3 AUGUSTUS start_codon 3214120 3214122 . - 0 transcript_id "g712.t1"; gene_id "g712"; # protein sequence = [MNIAVWSLEFAIAVFVVACPCGIGLAAPTALLVGSGLAAKYGLLARGGGEAFQEASRLDIVVFDKTGTITTGKLQVSD # VKYVTNSWNEETILGIIDEMESTSSHPLAIAIREFCAAKTTHPQNGASFRETAGRGLFASFQSLSCSVVIGNEYWMQENSVQISLELRDLADSWKNEA # KSVVFVAAQRDAQWEVLAIFGVADLIRPEASNVISLLIKLESKHG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g712 ### # start gene g713 Scaffold_3 AUGUSTUS gene 3214353 3215502 0.32 - . g713 Scaffold_3 AUGUSTUS transcript 3214353 3215502 0.32 - . g713.t1 Scaffold_3 AUGUSTUS stop_codon 3214353 3214355 . - 0 transcript_id "g713.t1"; gene_id "g713"; Scaffold_3 AUGUSTUS CDS 3214353 3214812 0.82 - 1 transcript_id "g713.t1"; gene_id "g713"; Scaffold_3 AUGUSTUS CDS 3215191 3215354 0.33 - 0 transcript_id "g713.t1"; gene_id "g713"; Scaffold_3 AUGUSTUS CDS 3215464 3215502 0.61 - 0 transcript_id "g713.t1"; gene_id "g713"; Scaffold_3 AUGUSTUS start_codon 3215500 3215502 . - 0 transcript_id "g713.t1"; gene_id "g713"; # protein sequence = [MTQFCNIIPSNPSRREQRNLLLRLLSTVIVAIPTFIIGIVYMSLVPDGDSNKAFFMKPMWTGNTSRAHKARTADAISS # LALLKPAEAYLLTASDEWSGSSVSSSEGLTAVPMTAKGAVAFKIENIPADMLELGDIVRVPHGSSPPADGMMVSGTSGVFDESSLTGESEPVRKEAGD # KVYVGTINRGDVVHVSVVDISGTTMCVIQFCFAISTNVSVGWII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g713 ### # start gene g714 Scaffold_3 AUGUSTUS gene 3217384 3218365 0.18 + . g714 Scaffold_3 AUGUSTUS transcript 3217384 3218365 0.18 + . g714.t1 Scaffold_3 AUGUSTUS start_codon 3217384 3217386 . + 0 transcript_id "g714.t1"; gene_id "g714"; Scaffold_3 AUGUSTUS CDS 3217384 3218060 0.44 + 0 transcript_id "g714.t1"; gene_id "g714"; Scaffold_3 AUGUSTUS CDS 3218170 3218365 0.18 + 1 transcript_id "g714.t1"; gene_id "g714"; Scaffold_3 AUGUSTUS stop_codon 3218363 3218365 . + 0 transcript_id "g714.t1"; gene_id "g714"; # protein sequence = [MKSKLGIVLGGYKVTPEVALREDGDAIIIDGNVLEKPFVEKPVSGEDHNVYIYFRGGGGRRLFRKVRAVVFSEFDIDR # ILQVGNKSSELDPSLNHPRTDGSYIYEQFIDVDNSEDIKVYTVGKDYTHAETRKSPVVDGVVRRNTEGKEIRYVRLHVPIPSVKLQRLDRFITRLTDE # ERAWASRICEGFGQRVCGYDMLRCDNGHKSQVIDVNGWSFVKGNESYYGAAAEILASLCMQVSSSPSRALPATENTPEEAPTWLLKANVTVFRHADRT # PKQKLKLQVIPAIYSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g714 ### # start gene g715 Scaffold_3 AUGUSTUS gene 3222127 3223758 0.99 + . g715 Scaffold_3 AUGUSTUS transcript 3222127 3223758 0.99 + . g715.t1 Scaffold_3 AUGUSTUS start_codon 3222127 3222129 . + 0 transcript_id "g715.t1"; gene_id "g715"; Scaffold_3 AUGUSTUS CDS 3222127 3223758 0.99 + 0 transcript_id "g715.t1"; gene_id "g715"; Scaffold_3 AUGUSTUS stop_codon 3223756 3223758 . + 0 transcript_id "g715.t1"; gene_id "g715"; # protein sequence = [MQRSDSLSSSSSNPSSSRPNSSSSGPFAYQTRLLERTSSSSKGSLSRTNSQSSNNILTNTTGSSTSSATRRWTPGHRV # ANSLDAVRGKWEERVRENAIDEGPSIPQTPTRLTTFAKLQNAVDSSPVHSTSSPLERTPTYLKRYTTSSVPSPIIATPLSPNSTGVTVEADSPSPTMS # SQRIHLPSYDHVSRSAGAIGRPTSPTLPQPSPARRNTVDFSSLKRINPPRNDAQPPSTPSSPSMFDQSSSVISTPTSVQRRPTSLYSRPSVSSDRDRI # QHQSTGSTSFNPLSPTSANSITAPTPSSPSSNVMFPSTYKSSYMQNKSRYGNTLSAGGRRFGKHLPRIASGDTEDHVEEKKEKEVEREVEKEPPPSRV # ERRAMRRDGNFDTTPRRATTLEAPVADSDAVIGIPGRMRLSRNKAFNAPAPLPSARLARGLWADTQRHLIQAYEYLCHVGEAGVEGCLDQELGFGVVE # MEEGLRNGVVLAKLVRVFQGEGVVRRIMRFVQRFDLLRVLLLYFDIGTQIRLSTFRQYQLLLQLCSARRTAEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g715 ### # start gene g716 Scaffold_3 AUGUSTUS gene 3224797 3227601 0.11 + . g716 Scaffold_3 AUGUSTUS transcript 3224797 3227601 0.11 + . g716.t1 Scaffold_3 AUGUSTUS start_codon 3224797 3224799 . + 0 transcript_id "g716.t1"; gene_id "g716"; Scaffold_3 AUGUSTUS CDS 3224797 3225885 0.39 + 0 transcript_id "g716.t1"; gene_id "g716"; Scaffold_3 AUGUSTUS CDS 3226191 3226311 0.47 + 0 transcript_id "g716.t1"; gene_id "g716"; Scaffold_3 AUGUSTUS CDS 3226362 3226396 0.47 + 2 transcript_id "g716.t1"; gene_id "g716"; Scaffold_3 AUGUSTUS CDS 3227101 3227601 0.95 + 0 transcript_id "g716.t1"; gene_id "g716"; Scaffold_3 AUGUSTUS stop_codon 3227599 3227601 . + 0 transcript_id "g716.t1"; gene_id "g716"; # protein sequence = [MRKQMAKLEDVSQTVVRIQAAVRTYLARKRLLVLIRGLRKATPLVVGFQARARAGLARQKHENLGKALSEVKTIKAVH # GMQSLARAALARNRHREITRKLDFIAPDVVGLQAAVRGALSRDLYYRWRDHLHNNEHVATVLQAMLRGLAQRKKFRAKMDYYRANLSKVVKIQSLFRA # KETREQYRQLTMGKNVTVGTIKNFVHLLDDSETDFQEELKVERLRKKVVENIRENQALESDVTDLDVKIALVVQNVKSFEDVLKARRGLGADSAAAHA # ARSHLLAAHGDPFAGPNTLDQTARRKLELYQQLFYHLQTHSEYLSRLFVRLSRDDTPEKDRRFTEAAVLTLYGFGQDRREDFLLLKLFQVHRARIELE # EMRAGRPSSQPKDVSFRQALDDPATRPIFIRHLQALQLWTDRFAPAPDDAIRAILTELNGVPNFGNEELKDARDRTITLELTNRFANVEGTGKIIESI # SSSSLRILDPLAEEKTLWVQAKRGVLAILRVQPTQDLLGALLRPVTEEDESVWEDILDAEIANEARQIPRRQASAIGADAAYRLEDIRLWAILHSLRT # CSSNLWPDLISLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g716 ### # start gene g717 Scaffold_3 AUGUSTUS gene 3231976 3234190 0.09 + . g717 Scaffold_3 AUGUSTUS transcript 3231976 3234190 0.09 + . g717.t1 Scaffold_3 AUGUSTUS start_codon 3231976 3231978 . + 0 transcript_id "g717.t1"; gene_id "g717"; Scaffold_3 AUGUSTUS CDS 3231976 3232635 0.27 + 0 transcript_id "g717.t1"; gene_id "g717"; Scaffold_3 AUGUSTUS CDS 3233744 3234190 0.25 + 0 transcript_id "g717.t1"; gene_id "g717"; Scaffold_3 AUGUSTUS stop_codon 3234188 3234190 . + 0 transcript_id "g717.t1"; gene_id "g717"; # protein sequence = [MLGPGGQLYYYNVQTKESTYIRPLPSFQNIPPVQPPKKKERPLTKTQIPDTDWIRVKTTEGNVFYSHKVKKQSIWSVP # DEIKDAVAQLELNEKKAGEGEHLMQAEEMLEVERVKAEIKDTAKRKAGETEDTHLDEVVITKKIRIEEAPEDEDEEDESEEEEEWQREAAAQLAAEAE # VEKKRAEEEARQEAEAELKRAKEAQIVMPEKVDLSIEEAKALFKQLHLFHEHISKLRSKHLASLHVLFDSHAPSLATTFDHLPVSSLMSSTPTSKLGM # SERALQQEFEKWQRERTHASRKAFDQMLSENSFVEFWGRLGKIGGEGVDGGVKADEDDAESEGLGTKVDMKVLAKNVDVEEMEKVLRVSLVNLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g717 ### # start gene g718 Scaffold_3 AUGUSTUS gene 3235770 3236153 0.3 + . g718 Scaffold_3 AUGUSTUS transcript 3235770 3236153 0.3 + . g718.t1 Scaffold_3 AUGUSTUS start_codon 3235770 3235772 . + 0 transcript_id "g718.t1"; gene_id "g718"; Scaffold_3 AUGUSTUS CDS 3235770 3235813 0.41 + 0 transcript_id "g718.t1"; gene_id "g718"; Scaffold_3 AUGUSTUS CDS 3235871 3236153 0.34 + 1 transcript_id "g718.t1"; gene_id "g718"; Scaffold_3 AUGUSTUS stop_codon 3236151 3236153 . + 0 transcript_id "g718.t1"; gene_id "g718"; # protein sequence = [MILQSILRTRKLLRWSKHSSFSTSFPIYLFTQRTDEIPDEDVILEETSSAESVPKPTSDTDDADADDTDEAVIEDVSE # EEQTPAPPKMKSITVDEWVRLNGQPPIWTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g718 ### # start gene g719 Scaffold_3 AUGUSTUS gene 3236756 3237370 0.83 + . g719 Scaffold_3 AUGUSTUS transcript 3236756 3237370 0.83 + . g719.t1 Scaffold_3 AUGUSTUS start_codon 3236756 3236758 . + 0 transcript_id "g719.t1"; gene_id "g719"; Scaffold_3 AUGUSTUS CDS 3236756 3236920 0.84 + 0 transcript_id "g719.t1"; gene_id "g719"; Scaffold_3 AUGUSTUS CDS 3237056 3237201 1 + 0 transcript_id "g719.t1"; gene_id "g719"; Scaffold_3 AUGUSTUS CDS 3237253 3237370 0.99 + 1 transcript_id "g719.t1"; gene_id "g719"; Scaffold_3 AUGUSTUS stop_codon 3237368 3237370 . + 0 transcript_id "g719.t1"; gene_id "g719"; # protein sequence = [MADLETEDSEKFEKFYEIFGGILKLGAVEDQKNREKLAAITRFTTNHRNFTTLDQIFYLAEMGENPQELAKSVFVEKL # HARGYEVLLFTEPLDEIFVQNIRRWKNIPFQDIAKVGLKFGDEGEVITSRYELFIEFPLWIRHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g719 ### # start gene g720 Scaffold_3 AUGUSTUS gene 3238845 3240870 0.22 + . g720 Scaffold_3 AUGUSTUS transcript 3238845 3240870 0.22 + . g720.t1 Scaffold_3 AUGUSTUS start_codon 3238845 3238847 . + 0 transcript_id "g720.t1"; gene_id "g720"; Scaffold_3 AUGUSTUS CDS 3238845 3240046 0.23 + 0 transcript_id "g720.t1"; gene_id "g720"; Scaffold_3 AUGUSTUS CDS 3240096 3240870 0.41 + 1 transcript_id "g720.t1"; gene_id "g720"; Scaffold_3 AUGUSTUS stop_codon 3240868 3240870 . + 0 transcript_id "g720.t1"; gene_id "g720"; # protein sequence = [MDLDLTSWGLDAFMSKDKSGKGKGKAKSLPSAQPLSAVQAHFPKTNDVLGEVHRRPRTTRSMSVGNYDFLSPAEEVRR # KSIGSPLDLSAMEIPASFQRPVASTSQSLGYDSLAYDGLAFEESHPAMGSIPFPTTSVRSPSPMTLDHRRTYSTASFESKMAMSAPRLRTTSNGTMEP # TDDNPFTIAPPSRASRFDPKAAAHARTVSNASLGSRMLLENDGASVMTGRPPLESRYSTTMELLRPKVLVMPSPLQSANAPPPPPKGRDGFTLADAPP # MPPGARTPMRIPNIGSSTVPVPSNSFTPNPRLNLSLSQLTFRNNLTVGGQRDIAYNDIDGDLPRALEDGEQAKLSTTPTMEMEMNLPIPSEHATSPHR # PAGKLYGKSLIDDLENRKAGMKSKQRYIHVFRGDDRPSMMARTPLARSSTLIDPATLQDHPVNIRASSFEPTSGMARRNSRHVGPLLNFDDDGKVPTV # AVNKGPPNRSVFGVDTLWEREMAKLREIEAQEAFERERQQAIEETEALKNGGKKKKKKGKKGQGSEFASPVPDLSPSVAGRSVLEDTPAESVVSSGPP # VLPTIPAIRGPPPVIDDEVSDSEESVGGRVVQSSQAEGWYADSDEDKDGPRRITGIGLRYPQKQTPPPQIHATDDDSEEDLPWLLQLVVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g720 ### # start gene g721 Scaffold_3 AUGUSTUS gene 3241627 3242914 0.78 - . g721 Scaffold_3 AUGUSTUS transcript 3241627 3242914 0.78 - . g721.t1 Scaffold_3 AUGUSTUS stop_codon 3241627 3241629 . - 0 transcript_id "g721.t1"; gene_id "g721"; Scaffold_3 AUGUSTUS CDS 3241627 3242250 1 - 0 transcript_id "g721.t1"; gene_id "g721"; Scaffold_3 AUGUSTUS CDS 3242393 3242914 0.78 - 0 transcript_id "g721.t1"; gene_id "g721"; Scaffold_3 AUGUSTUS start_codon 3242912 3242914 . - 0 transcript_id "g721.t1"; gene_id "g721"; # protein sequence = [MASHSLILLVCLGLGIAGLVSAFTSISLTTPTSNLSKRTSSTNFHLHTGHGIASLAFFIVLYGVLPLLWLLSGRFNRP # SKATDHIEGLNSDKQHITSADTVEKTTKSRSRTPSRPSSPRRRTHSWGPSILWRPSTDRGDSDSNNSADAQAALTQTDPVPAEPPRTFEVVNRPPRDA # LDYALTENQRSRERALLSTSAVPNTPNHLSPTPEIPDANGIVLHILLQSSILGLAIISLIKLWSSSLVGFIVFLIWTVAFYITLVVLAWNGKPKLSIL # AVILTRLRAKPAATAQEVNQYLASQSPPLSAPDHYAFPQGSGPYYHEPPFQAVSTDLSHGDLLSVETDEDDDEDEDARQQRIESEMARREIVTVTVPR # RKLLIANPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g721 ### # start gene g722 Scaffold_3 AUGUSTUS gene 3252298 3253074 0.83 + . g722 Scaffold_3 AUGUSTUS transcript 3252298 3253074 0.83 + . g722.t1 Scaffold_3 AUGUSTUS start_codon 3252298 3252300 . + 0 transcript_id "g722.t1"; gene_id "g722"; Scaffold_3 AUGUSTUS CDS 3252298 3252343 0.84 + 0 transcript_id "g722.t1"; gene_id "g722"; Scaffold_3 AUGUSTUS CDS 3252395 3253074 0.99 + 2 transcript_id "g722.t1"; gene_id "g722"; Scaffold_3 AUGUSTUS stop_codon 3253072 3253074 . + 0 transcript_id "g722.t1"; gene_id "g722"; # protein sequence = [MPGDSGASKVNDPYAGIFFSKDRREEVIEIEEESVFVSVPEINEKVEVMTQGRWMAGCAEGGEQSFLFSLYSQLGESQ # LSDLDGVCPCPSGCGQTVKRQQSDFFAIYVSFVLDQQISDSDSALLFPAQVFHYIQHLQSKVPQRCPKCQTDFCFACGEKISQDASDPLWHCSNLQGV # ILGVGLFMIERLFEQQKEESEIKETTERETKRRKTRDIDDDELDTGSGKTKGGVGYAGDLKEDVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g722 ### # start gene g723 Scaffold_3 AUGUSTUS gene 3253770 3254072 0.68 + . g723 Scaffold_3 AUGUSTUS transcript 3253770 3254072 0.68 + . g723.t1 Scaffold_3 AUGUSTUS start_codon 3253770 3253772 . + 0 transcript_id "g723.t1"; gene_id "g723"; Scaffold_3 AUGUSTUS CDS 3253770 3254072 0.68 + 0 transcript_id "g723.t1"; gene_id "g723"; Scaffold_3 AUGUSTUS stop_codon 3254070 3254072 . + 0 transcript_id "g723.t1"; gene_id "g723"; # protein sequence = [MKNRSEKTVVANKGKSKGDALAEGNFDETAKLYGFCNRLLATTVQIDRSLRELKGDDFVTRMHESLPKAYTSASDTIY # VDAGDTEEDAKEAYVKWATSSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g723 ### # start gene g724 Scaffold_3 AUGUSTUS gene 3255204 3255518 0.97 + . g724 Scaffold_3 AUGUSTUS transcript 3255204 3255518 0.97 + . g724.t1 Scaffold_3 AUGUSTUS start_codon 3255204 3255206 . + 0 transcript_id "g724.t1"; gene_id "g724"; Scaffold_3 AUGUSTUS CDS 3255204 3255518 0.97 + 0 transcript_id "g724.t1"; gene_id "g724"; Scaffold_3 AUGUSTUS stop_codon 3255516 3255518 . + 0 transcript_id "g724.t1"; gene_id "g724"; # protein sequence = [MVVKTAVSEALALQIVQVLTGDEFQMLDALQNPPEPFEDVIRTHFRLKARSLKKQLDSWLKEDDHRALASDGAEYSGA # GRNSSTSSSNDFKADINSLKSLLNDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g724 ### # start gene g725 Scaffold_3 AUGUSTUS gene 3264872 3265312 0.49 - . g725 Scaffold_3 AUGUSTUS transcript 3264872 3265312 0.49 - . g725.t1 Scaffold_3 AUGUSTUS stop_codon 3264872 3264874 . - 0 transcript_id "g725.t1"; gene_id "g725"; Scaffold_3 AUGUSTUS CDS 3264872 3265312 0.49 - 0 transcript_id "g725.t1"; gene_id "g725"; Scaffold_3 AUGUSTUS start_codon 3265310 3265312 . - 0 transcript_id "g725.t1"; gene_id "g725"; # protein sequence = [MPVSEKYKDMGTIIVGKIESGHMRKDDKLVLMPNKDQVEIAAIYNEIEDEVPDAFCGDNVRIRIRGVDDEDINPGFVL # TSPSKPIHAVRQFEAQLAILEHKSIICAGYSAVMHVHTLAEEVTLVVSIVYVEWERFADRPSVLVTLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g725 ### # start gene g726 Scaffold_3 AUGUSTUS gene 3267565 3268514 0.21 + . g726 Scaffold_3 AUGUSTUS transcript 3267565 3268514 0.21 + . g726.t1 Scaffold_3 AUGUSTUS start_codon 3267565 3267567 . + 0 transcript_id "g726.t1"; gene_id "g726"; Scaffold_3 AUGUSTUS CDS 3267565 3267597 0.64 + 0 transcript_id "g726.t1"; gene_id "g726"; Scaffold_3 AUGUSTUS CDS 3267675 3268514 0.26 + 0 transcript_id "g726.t1"; gene_id "g726"; Scaffold_3 AUGUSTUS stop_codon 3268512 3268514 . + 0 transcript_id "g726.t1"; gene_id "g726"; # protein sequence = [MKGTLGIGSGAAAVQKWPTSSISNINVEKAKHVHFDVEGGVSLHFNVGSKDNCEAIVAKLESSKALALQPSEETPAPT # PSRAPPPPSLGSLPARAVKASVHFAPESPAIIPSPPEAEEPEEEEEPEEEGEMAVALYPFTADGDDELSVIEGEQLLVLEKDGDEWWKCRNAEGAEGV # VPASYIELAPSNRQTAPRSTPLEEEPEEEEEKEDLVAKEAQARENEQRRKLLLLRPPNVRGKRKRDVEKRIRKKRERRRRRKREQRLLKPSGPRGRRL # QPSVILRLHLHQPTTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g726 ### # start gene g727 Scaffold_3 AUGUSTUS gene 3268817 3270420 0.11 + . g727 Scaffold_3 AUGUSTUS transcript 3268817 3270420 0.11 + . g727.t1 Scaffold_3 AUGUSTUS start_codon 3268817 3268819 . + 0 transcript_id "g727.t1"; gene_id "g727"; Scaffold_3 AUGUSTUS CDS 3268817 3269126 0.11 + 0 transcript_id "g727.t1"; gene_id "g727"; Scaffold_3 AUGUSTUS CDS 3269213 3270420 0.99 + 2 transcript_id "g727.t1"; gene_id "g727"; Scaffold_3 AUGUSTUS stop_codon 3270418 3270420 . + 0 transcript_id "g727.t1"; gene_id "g727"; # protein sequence = [MSVEDMRYVDKLLSKKSHPPTNDNLSDDDTPLALHRSKSSGGKVAPPRVSPQPKKGPTIDWFDFFLTAGCDLDDCTRY # AASFERDKIDESILPDITESTMRSLARDEALAKQLQSAGEQRFPKVTAPPNYCKRAERCAQTWKERKTSTDQSLSSAVDLNTISEVSDKIQRTESPSL # LSPVSAGTPVQPPARSSSAALVASGFDDDAWTNRPISTEPLAPASRAPPVTVPRAPSAPPTSAPAQAVPVPTPPNPPVAASARGPPSLANTTEDDVFQ # QLARLSELRKSTAPAPAPSPSPITNVVQMGTPSPIPQAPTPPTAPNGYQSGMGMSNSPIPMGQHLQAQQTGVYGPGPRGPYAPVPSNQNLLQPLIPTQ # TGFNGFVPTRANNVNLSQPSFLQSQPTGFPTTQPMISYPNGFPITTQSTGMPFGGMNGGMTGLNSGMNAVNPFGAGGVMTSMSSVSFCYHSSHFYLSR # SNRFQSCNGPELQRWHVFASACSSAPIGYFKSQQH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g727 ### # start gene g728 Scaffold_3 AUGUSTUS gene 3273910 3274393 0.16 - . g728 Scaffold_3 AUGUSTUS transcript 3273910 3274393 0.16 - . g728.t1 Scaffold_3 AUGUSTUS stop_codon 3273910 3273912 . - 0 transcript_id "g728.t1"; gene_id "g728"; Scaffold_3 AUGUSTUS CDS 3273910 3274283 0.31 - 2 transcript_id "g728.t1"; gene_id "g728"; Scaffold_3 AUGUSTUS CDS 3274333 3274393 0.48 - 0 transcript_id "g728.t1"; gene_id "g728"; Scaffold_3 AUGUSTUS start_codon 3274391 3274393 . - 0 transcript_id "g728.t1"; gene_id "g728"; # protein sequence = [MLKFAERYVAGNTQTAFANADTAYVLAYSVVLLNTDAHNPQVKKRMTKQDFIKNNRGINDGADLPEDLLGPIFDEITS # NEIKMKDEVEAITVSATGPGIASALANVGRDLQREAYVMQSSGMLNKPKFVTLATESFYNLIRSLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g728 ### # start gene g729 Scaffold_3 AUGUSTUS gene 3276100 3277638 0.84 - . g729 Scaffold_3 AUGUSTUS transcript 3276100 3277638 0.84 - . g729.t1 Scaffold_3 AUGUSTUS stop_codon 3276100 3276102 . - 0 transcript_id "g729.t1"; gene_id "g729"; Scaffold_3 AUGUSTUS CDS 3276100 3277638 0.84 - 0 transcript_id "g729.t1"; gene_id "g729"; Scaffold_3 AUGUSTUS start_codon 3277636 3277638 . - 0 transcript_id "g729.t1"; gene_id "g729"; # protein sequence = [MDDQHSAAEIPLPSSPPHTPAQNGYANPSISVAHKSDADASHRSGPSPQPDLKPQKIEDSLKYEPSAAENVEGHIDVV # DELSVGVPIPQIHAPILGVQEQELSVLNSTAPMTEEQMDGNASAVDEAVIAVSDSRITAPNSDAQERELPVPEPESSLELTPTLKSAEPSSSTVREIP # PVPSSPVFNPNTFKESHHPKTPGSPLSSNSVTHRRSLTISRGNNSVSAVLISSALEIIASSKDAKRSAPLKESTQKALDLIRSNQGGDHPKEIFEPLR # LACETRNEKLMIASLDCISKLISYSFFAESPLSANSDYNSPPNSPGPSLEDNLPSLVDLVAHTITACHTENTPDAVSLQIVKALLSLVLSPTVLVHHS # SLLKAVRTVYNVFLLSTDPVNQMVAQGGLTQMVHHVFTRCRIGDYPPSIDSATLSRSPSQTSFASPKHLPFTIPSPRTPTAINGRNTPDSYTKDNASA # STASLPQETASPLPVTTESESVNGSHPEEDDESGPRTPKAFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g729 ### # start gene g730 Scaffold_3 AUGUSTUS gene 3278437 3279708 0.83 - . g730 Scaffold_3 AUGUSTUS transcript 3278437 3279708 0.83 - . g730.t1 Scaffold_3 AUGUSTUS stop_codon 3278437 3278439 . - 0 transcript_id "g730.t1"; gene_id "g730"; Scaffold_3 AUGUSTUS CDS 3278437 3279708 0.83 - 0 transcript_id "g730.t1"; gene_id "g730"; Scaffold_3 AUGUSTUS start_codon 3279706 3279708 . - 0 transcript_id "g730.t1"; gene_id "g730"; # protein sequence = [MHPQGNIQHHHHAGDSYVTIGFDFVLSPNAPLSGPIPPQAGATGNTPQNAPLNHSDNHGTNNRDADNSYAAQDGVPHQ # TDSRGQTSGNSEAELPNEVEFHTIGVDIGIDHLGSMDPSSFDEGTCLRYVFRGVLVFIVTAAEEDFMSFPDILNAHPQRPEGPVMSSGARTPGDVSNS # TVPVAAPPLQTSDPRTAHNNFAANQRRAASSDATGNNAQPNPNTSPRIPDITGYLDSMFGSAVPSTAGPRRPQYATRGSRPRSAARGGYRTQERRPWA # PPPPPGLTLRQTIEKREREAGLRCWDVSCGLAPDDDCPLREIPEGQKRQVRIRQGSAASTSSPQEGGEDPKGKGKEKADHDPEPKYVCEHTFHTPCLV # SAQRVALNGAEEVIVEEGKSVEVSCPICRTIGVVPRDDWEDGVRALESDLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g730 ### # start gene g731 Scaffold_3 AUGUSTUS gene 3280505 3282458 0.46 - . g731 Scaffold_3 AUGUSTUS transcript 3280505 3282458 0.46 - . g731.t1 Scaffold_3 AUGUSTUS stop_codon 3280505 3280507 . - 0 transcript_id "g731.t1"; gene_id "g731"; Scaffold_3 AUGUSTUS CDS 3280505 3281297 0.8 - 1 transcript_id "g731.t1"; gene_id "g731"; Scaffold_3 AUGUSTUS CDS 3281842 3282458 0.46 - 0 transcript_id "g731.t1"; gene_id "g731"; Scaffold_3 AUGUSTUS start_codon 3282456 3282458 . - 0 transcript_id "g731.t1"; gene_id "g731"; # protein sequence = [MSNNSNLLSGLLRSISRRSQRRDADTEESEQPLRADVDMESESQQSRTADPQTAITAVANNAVNANDGNQSDSSMPAL # QDVSDSEDSEVDSEDEDEARRDQFMNTSQVSHSGGIVNANSEFSQHTFGRSGLHTDDDEDMPSLESTHPTRSSNTRPQGTRRARVEDDVDGDSERDRR # HPSQRASNNQSEASSPLPIHPVHPGQANITPAWRDSFLWFPTGSGTRESGACKSLVDGLEEVPVGLIRRLERVSPESSGCAICWEKLLEQDAEYLRRE # EQEQKKVEDASKAGGNMAPDASSTITQNDLQTTNPSLSIPSSTPSPSSSASKGTSINNKVPTYPRIVSLPCSHVFHSECLLPWFTRPRQTTCPTCRFN # IDPDDLTRGVGIRRRAAASTAAGGRGGTETVAGEDAMPSASTTTDGFGAVDPATGLPAPLSVNAQRMPFIGSVNGRSNGMQVQPPFPGMTGSGARAW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g731 ### # start gene g732 Scaffold_3 AUGUSTUS gene 3293692 3294749 0.47 + . g732 Scaffold_3 AUGUSTUS transcript 3293692 3294749 0.47 + . g732.t1 Scaffold_3 AUGUSTUS start_codon 3293692 3293694 . + 0 transcript_id "g732.t1"; gene_id "g732"; Scaffold_3 AUGUSTUS CDS 3293692 3293954 0.83 + 0 transcript_id "g732.t1"; gene_id "g732"; Scaffold_3 AUGUSTUS CDS 3294287 3294749 0.81 + 1 transcript_id "g732.t1"; gene_id "g732"; Scaffold_3 AUGUSTUS stop_codon 3294747 3294749 . + 0 transcript_id "g732.t1"; gene_id "g732"; # protein sequence = [MANRPPLDSVSSHGSDSTAYGDPFADRPRQAQFVEPERPYRNNNPQAFESSASIPQEFGGRDYNDEEDYMEKQPLTAG # QTYPGGFYPPHMRYTAATCDPDEFSEANGYSLRTKIYGRETELLIAVTSYNEDKTLYARTLHGVMLNIRDICKTKQSKYWRRQAEEGMPGWQKITVAL # IVDGLDAMDKSVLDLLATVGVYQDGVMKKQLDGKDTVAHIFEVRSNHHLLNLIQQFHLVHYSTFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g732 ### # start gene g733 Scaffold_3 AUGUSTUS gene 3307886 3308834 0.64 + . g733 Scaffold_3 AUGUSTUS transcript 3307886 3308834 0.64 + . g733.t1 Scaffold_3 AUGUSTUS start_codon 3307886 3307888 . + 0 transcript_id "g733.t1"; gene_id "g733"; Scaffold_3 AUGUSTUS CDS 3307886 3308012 0.64 + 0 transcript_id "g733.t1"; gene_id "g733"; Scaffold_3 AUGUSTUS CDS 3308095 3308834 0.96 + 2 transcript_id "g733.t1"; gene_id "g733"; Scaffold_3 AUGUSTUS stop_codon 3308832 3308834 . + 0 transcript_id "g733.t1"; gene_id "g733"; # protein sequence = [MGTIVLSPPSTPAEYFRIVSPTLQIPSPGTGISVPVGILACQLVIACTVSQPPSTPAGKKTKKAVSAPTLPNEPILEV # ILHDTVIFPEGGGQPTDTGVITTSDGKTWSVLQAKRNGGHAVHYVKVKEGDLESALLVFTPGSTVTAALGQDDYDRRYDHVRLLRPADLLRVYSDTLQ # MSMHTSQHLLSALLETRLNLPTLSWSLTNAPSPCYIEVPRGMTVEEIRFIQSEANRLVFEGRQVHTEVEELDRDKKAAPVVIGGRSVGKGLPSDYTGG # VNRVVVIDGVDRNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g733 ### # start gene g734 Scaffold_3 AUGUSTUS gene 3308954 3309565 1 + . g734 Scaffold_3 AUGUSTUS transcript 3308954 3309565 1 + . g734.t1 Scaffold_3 AUGUSTUS start_codon 3308954 3308956 . + 0 transcript_id "g734.t1"; gene_id "g734"; Scaffold_3 AUGUSTUS CDS 3308954 3309565 1 + 0 transcript_id "g734.t1"; gene_id "g734"; Scaffold_3 AUGUSTUS stop_codon 3309563 3309565 . + 0 transcript_id "g734.t1"; gene_id "g734"; # protein sequence = [MSRSNTTSARLYFLSGPRLINYLTSAHDLLTSTASILSCGAPLVPERVSQVVDERKKSEKHITDLELELAKRISAELS # SEATVGSGNDGYIFRKHLHRTDDGGNVLGFLSAISVAFSEQMAHSQIPYLLVFTSTPSAQITSSTTVVMVVGSDDKEVKTIGEYLKSQLGVKGGGKGL # KWSGKYTGVWKEKNEGERVNHILKNVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g734 ### # start gene g735 Scaffold_3 AUGUSTUS gene 3309663 3310210 0.83 - . g735 Scaffold_3 AUGUSTUS transcript 3309663 3310210 0.83 - . g735.t1 Scaffold_3 AUGUSTUS stop_codon 3309663 3309665 . - 0 transcript_id "g735.t1"; gene_id "g735"; Scaffold_3 AUGUSTUS CDS 3309663 3310084 0.97 - 2 transcript_id "g735.t1"; gene_id "g735"; Scaffold_3 AUGUSTUS CDS 3310156 3310210 0.83 - 0 transcript_id "g735.t1"; gene_id "g735"; Scaffold_3 AUGUSTUS start_codon 3310208 3310210 . - 0 transcript_id "g735.t1"; gene_id "g735"; # protein sequence = [MVHNAFCLPFVPDTRIDPYSDGESSDGGEYLPTEEDEEEEDLYLLDTDDMVEADESDFEMEEVDLDIYQNWEPTDVED # NIEDVSSEWGLTDGDSLSNSDGDISFESDSAPTHSGKSFFVLWEYWLSLPHDSVVIDDNVIIQQDADTNLDIDFSDEDEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g735 ### # start gene g736 Scaffold_3 AUGUSTUS gene 3321830 3322138 0.89 + . g736 Scaffold_3 AUGUSTUS transcript 3321830 3322138 0.89 + . g736.t1 Scaffold_3 AUGUSTUS start_codon 3321830 3321832 . + 0 transcript_id "g736.t1"; gene_id "g736"; Scaffold_3 AUGUSTUS CDS 3321830 3322138 0.89 + 0 transcript_id "g736.t1"; gene_id "g736"; Scaffold_3 AUGUSTUS stop_codon 3322136 3322138 . + 0 transcript_id "g736.t1"; gene_id "g736"; # protein sequence = [MVIDIPQDPLSSYEADRVLPSVFTDPHFLAAAHTFQDHLYSGWLKDDFKAKVAKYEEGIRNGTLAAPWKDQEWEKEHA # MLENDALTSSKPRSTGPGGAIKAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g736 ### # start gene g737 Scaffold_3 AUGUSTUS gene 3323377 3324091 0.36 - . g737 Scaffold_3 AUGUSTUS transcript 3323377 3324091 0.36 - . g737.t1 Scaffold_3 AUGUSTUS stop_codon 3323377 3323379 . - 0 transcript_id "g737.t1"; gene_id "g737"; Scaffold_3 AUGUSTUS CDS 3323377 3323859 0.36 - 0 transcript_id "g737.t1"; gene_id "g737"; Scaffold_3 AUGUSTUS CDS 3323965 3323968 0.71 - 1 transcript_id "g737.t1"; gene_id "g737"; Scaffold_3 AUGUSTUS CDS 3324036 3324091 0.82 - 0 transcript_id "g737.t1"; gene_id "g737"; Scaffold_3 AUGUSTUS start_codon 3324089 3324091 . - 0 transcript_id "g737.t1"; gene_id "g737"; # protein sequence = [MSPVVSKNEFIYYLAYWDGSKAKAKELQSKKKQTATPSKSKPSKSKSKTVDSSETTEEEVYHFIGYVPAFGKVWELDG # LKPGPLEVGELASEGNTTDWMDVARPAIRMKMAKYGGGADAGNIRFSLLAFVDGSYEKANDEWEYWRRERRSIERRLDETDSGWKSKASSTTVYSFPQ # SIVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g737 ### # start gene g738 Scaffold_3 AUGUSTUS gene 3324806 3329082 0.98 + . g738 Scaffold_3 AUGUSTUS transcript 3324806 3329082 0.98 + . g738.t1 Scaffold_3 AUGUSTUS start_codon 3324806 3324808 . + 0 transcript_id "g738.t1"; gene_id "g738"; Scaffold_3 AUGUSTUS CDS 3324806 3326942 0.98 + 0 transcript_id "g738.t1"; gene_id "g738"; Scaffold_3 AUGUSTUS CDS 3327071 3329082 0.98 + 2 transcript_id "g738.t1"; gene_id "g738"; Scaffold_3 AUGUSTUS stop_codon 3329080 3329082 . + 0 transcript_id "g738.t1"; gene_id "g738"; # protein sequence = [MSLQFTVASNNTPQILTRYRSALLADATRTLSELPFFDSDLSLSRELDINHGFYQVPIPAYQPLSPVSSDSDSDSDSE # YYLSLATTHIAMPAVFSSALDETVTYAKWNKSGNGCLVTCPVERSPLRLSKPLNETCESFSPTTVSSPSDYTLRCLNVWEDPRVSNWIDQNREDFTKL # SFDEFFVVVRNRVLDPDWQDSTFRKMRAVRMPDDLQTSISDLAVQLMVLNNLLQGTPRFQSEENLQMMLIDAADTGLREAYNKEVDDHAGNPLHGIHS # KDFHTFTRAFQVLDHGRHRQLVIARQMAEHMIRSRPNSRATTPLAPSAAANTQNRRTTNGNTGQNGRLPPLTTNERRLLSENDGCFKCRSFFVKCRTS # SSEHEFPLPNGNGYKELNASDVDTARKLRGTVETNKKARTGPIAAIGVADDGDDGVVASIMPSAVLGDGTDSEEEVSGPFRVSHLRWKCHVAGPKSPF # PIIVNSLIDNGAHLALIHPDLVCRLGLSRRILKKPETVCAAFQSGSNQSIAPLTEYVQLKVSSVDGSFTSRNVPFIIAPNLCTQLLLGLPWLTHNNIV # IDYASRSCTHKPSGFDLLNNTPVSHKFAFKTKSVEKIRDSLVKLGNRSKEHRRKLLVELKEKCASIRPRCPPSSVSSTPTSSEVIASIRSRIEHLATL # ETLKGHESRLREKYHAIFEPIPHVDDLPASVTAKIQLVDASKSISSHPNALPRWVADYRQLNDNTVTDAHPLPRIDDILADCAKGQIWGKIDMTDSFF # QTRMDEDSIKLTAITTPFGLYEWTVMPQGLKNSPAIHQRRVTSALRHLIGKICYVYVDDIIIWSKSVEEHIINVEKVLLALRSARLYCNPNKCDLFTF # NVHFLGHSISKDGISPDDKKVDRIMDWPTPRTVKELRAFLGLVRYVAAFLPRLAELTEILTRLTANDIDKDNLPWEARHDRAFEAIKVLVASCECLTV # IDLDLLDTHKIFVTTDASDKCSGAVLSFGTSWESARPVSFDSSTFKGAELNYPVHEKEMLAIIRALKKWRVDLLGVPFVIMTDHRTLENFHTQPDLSR # RQARWMEFFSQFDCKIVYVSGDQNSVADALSRRTDLYSAPVSSADAILASQHPYAYCADSDDDLDLPILCVLEDSPWSGARALANSPHFEPALPLIAA # TLEITSDATLLQEIRDGYSTDPWCKDLPSMAASMPLVRKELGSKLWYIGERLIIPRTGHIREELFRLAHDNLGHFGFDKSYAALRESYYWPHMRRDLE # KAYVPACDECQRNKSTTQKKVGPLHPLPVPEHRFSSVAMDFVGPLPEDSGSNCILTITDRLGADLRIIPCRTDLSAADCAQLFFDHWYCENGLPEDIV # CDRDHLFVSKLGGLTVSIWRPPAHVYLLSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g738 ### # start gene g739 Scaffold_3 AUGUSTUS gene 3336380 3337713 0.41 - . g739 Scaffold_3 AUGUSTUS transcript 3336380 3337713 0.41 - . g739.t1 Scaffold_3 AUGUSTUS stop_codon 3336380 3336382 . - 0 transcript_id "g739.t1"; gene_id "g739"; Scaffold_3 AUGUSTUS CDS 3336380 3336411 0.41 - 2 transcript_id "g739.t1"; gene_id "g739"; Scaffold_3 AUGUSTUS CDS 3336552 3337713 0.67 - 0 transcript_id "g739.t1"; gene_id "g739"; Scaffold_3 AUGUSTUS start_codon 3337711 3337713 . - 0 transcript_id "g739.t1"; gene_id "g739"; # protein sequence = [MDITNWDSVLQFSSGANMEFGLQNDDFPEQSTSSTPNLQVPTPPVCSELLLLILRLILPFHLQHSTDGGSPICDDPSD # NNVLVSISTTFYPGANLHSLPPDLALLSTDSVFFYVHSHIILAASDNNFLSLLPTSSSKEQSSNMVIHVPELSPVLNIILHIIYNISCSHYSPSFETL # SDAVHRLPSYGIDPKSCITPSTPIHALLLSHAPLCPLDVYTLAAKYDLYDLAVPTSSHLLSFQLSTLTDDTAEAIGPKYLRRMFFLHIGRSDALKRVR # SKKIQNLSQLTSGQILLQPPHPHAPTPWCDFADQKNLTRAWALASAYLAWDARPGEYPLQSLKPTSDIPCLRCVNRFSGSCSYSSGGAFILRSVQTRS # ERPHQKSHRAVVCREESTDALPSNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g739 ### # start gene g740 Scaffold_3 AUGUSTUS gene 3344620 3345818 0.45 - . g740 Scaffold_3 AUGUSTUS transcript 3344620 3345818 0.45 - . g740.t1 Scaffold_3 AUGUSTUS stop_codon 3344620 3344622 . - 0 transcript_id "g740.t1"; gene_id "g740"; Scaffold_3 AUGUSTUS CDS 3344620 3345016 0.45 - 1 transcript_id "g740.t1"; gene_id "g740"; Scaffold_3 AUGUSTUS CDS 3345100 3345818 0.45 - 0 transcript_id "g740.t1"; gene_id "g740"; Scaffold_3 AUGUSTUS start_codon 3345816 3345818 . - 0 transcript_id "g740.t1"; gene_id "g740"; # protein sequence = [MLSTQVLRCDPTSISFDSTGKPKVTSQDTLNSLSIAAKNLVDLQPVAFPTETVYGLGALALDSSAASCIFSVKGRPPD # NPLIVHVSSPDMLRTLLPSSFKMPQSYELLMRRFWPGALTLLFPSDPNTIPSIITANQPTVAIRMPSHPVARALIALVNAPVAAPSANSSGKPSPTTA # EHVRRDLSGKLNVILDGGACDVGLESTVVDGLQEDGKFGYSDQVESVWRTSKRHYRRASRIMRLHYSPAAPVTLLMTTSAPPEKVVPSKAESFLISLK # NEMEPSAFVKVGVLVLTNSILGTLTLPVVDGIEWRRYELGPVDDPSVTARRLFDGLLTLDQQGVDMILIEEVTETKEGLAIMNRVRKAASEVRWITF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g740 ### # start gene g741 Scaffold_3 AUGUSTUS gene 3348308 3350502 0.07 + . g741 Scaffold_3 AUGUSTUS transcript 3348308 3350502 0.07 + . g741.t1 Scaffold_3 AUGUSTUS start_codon 3348308 3348310 . + 0 transcript_id "g741.t1"; gene_id "g741"; Scaffold_3 AUGUSTUS CDS 3348308 3348637 0.14 + 0 transcript_id "g741.t1"; gene_id "g741"; Scaffold_3 AUGUSTUS CDS 3348823 3349136 0.39 + 0 transcript_id "g741.t1"; gene_id "g741"; Scaffold_3 AUGUSTUS CDS 3349222 3349248 0.97 + 1 transcript_id "g741.t1"; gene_id "g741"; Scaffold_3 AUGUSTUS CDS 3349412 3349572 0.77 + 1 transcript_id "g741.t1"; gene_id "g741"; Scaffold_3 AUGUSTUS CDS 3349664 3350502 0.8 + 2 transcript_id "g741.t1"; gene_id "g741"; Scaffold_3 AUGUSTUS stop_codon 3350500 3350502 . + 0 transcript_id "g741.t1"; gene_id "g741"; # protein sequence = [MGGLEALPEAEDIQTTPGPALELSSRGLTGLSFFNLQQSKESLPTPTLPVAINNGNHTSYSSVGGGFTSSSPASSLDS # SSHFAASVDLQTQSFEAQLKASPMIHDLLDRLSAPADDISTISQRLNTLTSSVGQLLALQTQQIQTASSIPGLPLMNTGAGLEVNSTPTMLGHGLPNR # SDIRPSPRLPNPPLRTWSTGTLDLPVRGADMNGSRPDAHLILNNLCRCVGPPNKIQQRALPFLLRGADIIAQAPPTQERIAAYVIPAIQIAINGIANQ # PVNPLGVGTTNTDLTQELRLLHQNVPHIICGTPQKLHALFTSSGGLPGSEVRFLVLDEVDQLIARNLHEFVFNIVKLLPSPRSRPLSSSAPGGNIVPG # SGAFGSNFDPSATPFQNNNSRRFSAVAPSPDPSGQNTPQSVERQTALFSNTVPQDVLNLATAIQLREPVRVLVRRDGNVTQAEASQGGSRGLRQYYLY # LAFTAGSRADPAAANSGGGLGIIGSGRGSTNAESVQAREWKLDALADLFDDVDVQQAIVHVGGMTALDSVVYKLASRGLEAVPLVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g741 ### # start gene g742 Scaffold_3 AUGUSTUS gene 3352795 3353313 0.36 + . g742 Scaffold_3 AUGUSTUS transcript 3352795 3353313 0.36 + . g742.t1 Scaffold_3 AUGUSTUS start_codon 3352795 3352797 . + 0 transcript_id "g742.t1"; gene_id "g742"; Scaffold_3 AUGUSTUS CDS 3352795 3353313 0.36 + 0 transcript_id "g742.t1"; gene_id "g742"; Scaffold_3 AUGUSTUS stop_codon 3353311 3353313 . + 0 transcript_id "g742.t1"; gene_id "g742"; # protein sequence = [MHSAPRRNQECAGGTPVHAFDRSAMTPDSSSLLPDFIVICGRGLTAPPSPTTRPTPRQYLVTIEPPNTSDETSQSLAP # MSPYLCLLIQIVLELVRFSGSVKIVAGDQSMREESVDVERSVSVDCVEFDGRHEIDVTPASCPTRRASKVTEKMKLNKLITILPENGSMLTVLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g742 ### # start gene g743 Scaffold_3 AUGUSTUS gene 3362555 3363034 0.95 + . g743 Scaffold_3 AUGUSTUS transcript 3362555 3363034 0.95 + . g743.t1 Scaffold_3 AUGUSTUS start_codon 3362555 3362557 . + 0 transcript_id "g743.t1"; gene_id "g743"; Scaffold_3 AUGUSTUS CDS 3362555 3363034 0.95 + 0 transcript_id "g743.t1"; gene_id "g743"; Scaffold_3 AUGUSTUS stop_codon 3363032 3363034 . + 0 transcript_id "g743.t1"; gene_id "g743"; # protein sequence = [MAQESKTPIQLGFIGLSATGWAAIALAPPLFEEPLSSKYSLVAVSTSKPESAAASAAKYSELASNSTGTSVTVKPYHG # SAKHIASNIDVGMVAVSVKVLDHKEVASEVIKAGKDLFIEWPAGVRLAETKELYEAAKAKGIRTMIGFQSRFTAYALKVSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g743 ### # start gene g744 Scaffold_3 AUGUSTUS gene 3363226 3363801 0.65 + . g744 Scaffold_3 AUGUSTUS transcript 3363226 3363801 0.65 + . g744.t1 Scaffold_3 AUGUSTUS start_codon 3363226 3363228 . + 0 transcript_id "g744.t1"; gene_id "g744"; Scaffold_3 AUGUSTUS CDS 3363226 3363801 0.65 + 0 transcript_id "g744.t1"; gene_id "g744"; Scaffold_3 AUGUSTUS stop_codon 3363799 3363801 . + 0 transcript_id "g744.t1"; gene_id "g744"; # protein sequence = [MPANYDYTLSSSNGATMLDIPGGHALDMFTHILGPISSLSAIIKNQFPLTTLTDSDGNPTSRTVPNDSPNQVCVTGTL # ANGALFTVHFQSPVKEADFNWIINGENGVLRIVDESDRTTKRGFFDATPDVYLNGEKVAVDADNITRRTGLNWQAFANRDVSQYADLEQALKVKEILQ # AVVKSSEDGRRVEMQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g744 ### # start gene g745 Scaffold_3 AUGUSTUS gene 3369326 3370303 0.52 - . g745 Scaffold_3 AUGUSTUS transcript 3369326 3370303 0.52 - . g745.t1 Scaffold_3 AUGUSTUS stop_codon 3369326 3369328 . - 0 transcript_id "g745.t1"; gene_id "g745"; Scaffold_3 AUGUSTUS CDS 3369326 3369723 0.99 - 2 transcript_id "g745.t1"; gene_id "g745"; Scaffold_3 AUGUSTUS CDS 3370036 3370303 0.52 - 0 transcript_id "g745.t1"; gene_id "g745"; Scaffold_3 AUGUSTUS start_codon 3370301 3370303 . - 0 transcript_id "g745.t1"; gene_id "g745"; # protein sequence = [MDDENEYEYPYTSDSEVDDDPFTAFLNSRAEYQGLIAMQRDKKPSTGITPRLTDVKFYFVDKIAWVLIFLSGVWQTHP # GLRRSASRTVQELLSPFTKNIATSWGKLFETDLLSHFEETVQAAICRLLDDMVESAAAGLRERVGMQGDLCKAEADVVLKQVVAVVRDTITTQQKDVS # RCLAPHVQNNLIDGYDLAMEETGKGSVARQKVGSGLQCASLENNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g745 ### # start gene g746 Scaffold_3 AUGUSTUS gene 3370994 3371374 0.48 - . g746 Scaffold_3 AUGUSTUS transcript 3370994 3371374 0.48 - . g746.t1 Scaffold_3 AUGUSTUS stop_codon 3370994 3370996 . - 0 transcript_id "g746.t1"; gene_id "g746"; Scaffold_3 AUGUSTUS CDS 3370994 3371374 0.48 - 0 transcript_id "g746.t1"; gene_id "g746"; Scaffold_3 AUGUSTUS start_codon 3371372 3371374 . - 0 transcript_id "g746.t1"; gene_id "g746"; # protein sequence = [MEEDASDDSDSEIDSDTDKESDSDASDDKGSESDRSEHSCDEDGNSDIEVEELVEEATVESVKAKLEHTKADITASRA # RLSESRKDKKTVLDRLANLKKSLGKVQKTKNGWCSLKRSEVKLYLSVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g746 ### # start gene g747 Scaffold_3 AUGUSTUS gene 3374312 3375868 1 - . g747 Scaffold_3 AUGUSTUS transcript 3374312 3375868 1 - . g747.t1 Scaffold_3 AUGUSTUS stop_codon 3374312 3374314 . - 0 transcript_id "g747.t1"; gene_id "g747"; Scaffold_3 AUGUSTUS CDS 3374312 3375868 1 - 0 transcript_id "g747.t1"; gene_id "g747"; Scaffold_3 AUGUSTUS start_codon 3375866 3375868 . - 0 transcript_id "g747.t1"; gene_id "g747"; # protein sequence = [MPGILTNSRTSNTKNLKFSFSHEAIRPPAFLETVFLKGTSHCAKSVPNEPLSDNSTSSQNDSTPSTPPKLKLRKVPNP # SVKNHSRSSTVSSSSFDNEVTETPIAQAESEVWDIEREGYNLPSTMSSTSPERNQSVVLNTCSLPWVLETATSGEIHEKHKRKALAHERDRTSQLSSS # LAPSQSASQHGLNGRCRTTTPVPLLASKYFMPQRPHSVADALAKDETAIPFSSPSAPALQAPPIQTHESSLSDYFLHLPVAPNVQANTSYHPPHRADD # IIYEPYIAPIYAGENPWDPLAFSDPVNFSDTDAPQPPPEIVAPNLTLGISYPYDFYIPPRVDAPPLQYDSGYDVEDANSMFYLDDDGCGHTGWGLQEI # VCDNHEEEYLEHGQMYDEHEHLSCQTQQFGAEHENTTDQNWQRDFCSIEDDALFGMGIDSEEADMLQCPSEEWMEPIGQDRVLSEANSDDSVVREMPR # FLQGRELLLGFGATSRQEDIVRDWSGYASVAEADVARNLKGHWLPQRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g747 ### # start gene g748 Scaffold_3 AUGUSTUS gene 3376243 3376695 0.88 - . g748 Scaffold_3 AUGUSTUS transcript 3376243 3376695 0.88 - . g748.t1 Scaffold_3 AUGUSTUS stop_codon 3376243 3376245 . - 0 transcript_id "g748.t1"; gene_id "g748"; Scaffold_3 AUGUSTUS CDS 3376243 3376695 0.88 - 0 transcript_id "g748.t1"; gene_id "g748"; Scaffold_3 AUGUSTUS start_codon 3376693 3376695 . - 0 transcript_id "g748.t1"; gene_id "g748"; # protein sequence = [MPVPVEFAAQVSSTLQLGSIPKLDKTRFISSFVDTQRLHTKYYAEEGRTLWNNLVDTARDPSPKSPPQENTVFGLSTP # VLVPRIPQVIIAKEPGSKTSTPKENPPKKTKSKAKSTFHAKSGQRPNEHPQNAPHTKKRAGKLSDDDETAAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g748 ### # start gene g749 Scaffold_3 AUGUSTUS gene 3382165 3383323 0.14 - . g749 Scaffold_3 AUGUSTUS transcript 3382165 3383323 0.14 - . g749.t1 Scaffold_3 AUGUSTUS stop_codon 3382165 3382167 . - 0 transcript_id "g749.t1"; gene_id "g749"; Scaffold_3 AUGUSTUS CDS 3382165 3382372 0.28 - 1 transcript_id "g749.t1"; gene_id "g749"; Scaffold_3 AUGUSTUS CDS 3382426 3382618 0.85 - 2 transcript_id "g749.t1"; gene_id "g749"; Scaffold_3 AUGUSTUS CDS 3382672 3383323 0.45 - 0 transcript_id "g749.t1"; gene_id "g749"; Scaffold_3 AUGUSTUS start_codon 3383321 3383323 . - 0 transcript_id "g749.t1"; gene_id "g749"; # protein sequence = [MSSRSDATTINKVCASGMKSIMLASQSIQLGQASVVAAGGMESMSNAPYVFICSFGVPRLIDLLLSFLLPRQNPVFGK # FTATDSLEYDGLWDTYNNQAMGCCGESAAEKHSISREAQDAHAIESYKRAEQAWKNGAFDAEIVPITVKGKKGDTIVREDEEYKRIIYEKVPSLRSAF # KQGGSITAANSSPLNDGASALILMSVEKAKELGLTPLAKVISYADAGMDPIDFPIAPTVALPKALERANLTVDDISLFEINEAFSVVIRIAEKVLKID # PAKININGGAVALGHAIGSSGSRIVVSLVHALKSGQYGAAGVCNGVSCHAISWETLVLTRHFMQGGAASAIIIQKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g749 ### # start gene g750 Scaffold_3 AUGUSTUS gene 3386947 3388178 0.19 - . g750 Scaffold_3 AUGUSTUS transcript 3386947 3388178 0.19 - . g750.t1 Scaffold_3 AUGUSTUS stop_codon 3386947 3386949 . - 0 transcript_id "g750.t1"; gene_id "g750"; Scaffold_3 AUGUSTUS CDS 3386947 3387437 0.46 - 2 transcript_id "g750.t1"; gene_id "g750"; Scaffold_3 AUGUSTUS CDS 3387521 3387670 0.61 - 2 transcript_id "g750.t1"; gene_id "g750"; Scaffold_3 AUGUSTUS CDS 3387722 3388178 0.43 - 0 transcript_id "g750.t1"; gene_id "g750"; Scaffold_3 AUGUSTUS start_codon 3388176 3388178 . - 0 transcript_id "g750.t1"; gene_id "g750"; # protein sequence = [MSPSRRKLRKIEDHQCPAYQPFRSARGRRVNDSGLVVGIQGRADADYSRELVALDANEADSTHWSRSGWCERPKVELF # VRESIYLYLQLQTVSTPQSYDFILSPNGKVSPEDLSPSKVKLEPVPDGYVIQNVTGIRTHIVQRFDGRGYDVRKLGHYTVRPGQLVYINDSSLLLSAA # SPSTAAIEHFGAIQLRFYVDAVDTMFNSEELPSKFQGLVPVYRDDDNEFGCTQYHKSFQDGILLVRRGECTFIQKLVEARDAGAAGVLVLSDENTAIN # PTANSEDLEAAGDISQVAIIVLPRTAGQSVEHLLDTTQGIGQVMLSLEHEHQPGVDAEADEGPEPGEGSKKDPNRILYLNGHPLLNTRLLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g750 ### # start gene g751 Scaffold_3 AUGUSTUS gene 3395018 3395392 0.86 - . g751 Scaffold_3 AUGUSTUS transcript 3395018 3395392 0.86 - . g751.t1 Scaffold_3 AUGUSTUS stop_codon 3395018 3395020 . - 0 transcript_id "g751.t1"; gene_id "g751"; Scaffold_3 AUGUSTUS CDS 3395018 3395392 0.86 - 0 transcript_id "g751.t1"; gene_id "g751"; Scaffold_3 AUGUSTUS start_codon 3395390 3395392 . - 0 transcript_id "g751.t1"; gene_id "g751"; # protein sequence = [MRIGKSHRDVAIILLGSFSRYINHLDDSELQKPRTKTILKALRANLKLAIDVGLAKSQSDLTASFMQTLIMSEGDKWI # HAQTSNVVIALRAGTAGEPVKTADAAVRKFATKELGKAELIASLED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g751 ### # start gene g752 Scaffold_3 AUGUSTUS gene 3398097 3399062 0.75 + . g752 Scaffold_3 AUGUSTUS transcript 3398097 3399062 0.75 + . g752.t1 Scaffold_3 AUGUSTUS start_codon 3398097 3398099 . + 0 transcript_id "g752.t1"; gene_id "g752"; Scaffold_3 AUGUSTUS CDS 3398097 3399062 0.75 + 0 transcript_id "g752.t1"; gene_id "g752"; Scaffold_3 AUGUSTUS stop_codon 3399060 3399062 . + 0 transcript_id "g752.t1"; gene_id "g752"; # protein sequence = [MVERGNPVHSAIISHLSNSNTRVRAWMNVLCRTPQSSIAREIPYTNGDPYLSDSEQESEHSFIKDPTTGSRLYPQDAM # NAMHILAVDDGKSGDEESLYNPMFDFDIQDDGRFVCRVKAAGQFQDVQQSWSTPSSTKAGARRLASYDACAHLYERGLLDSRVFPKNWTIPPDSDILP # AFDPIVVGTRVYGKKLPTFWSNSALFSLGSLNRLYPVIISIESGANTIPPHAPLLLLTRQPLPDVPMFNVFFAGLPTRISLTRAEPFMVNEHQLQDIH # SYNNQLWRGVLNKPYSAALNETLALYAPFIPVGARAFSMSPAIYPGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g752 ### # start gene g753 Scaffold_3 AUGUSTUS gene 3402770 3403814 0.46 - . g753 Scaffold_3 AUGUSTUS transcript 3402770 3403814 0.46 - . g753.t1 Scaffold_3 AUGUSTUS stop_codon 3402770 3402772 . - 0 transcript_id "g753.t1"; gene_id "g753"; Scaffold_3 AUGUSTUS CDS 3402770 3403066 0.6 - 0 transcript_id "g753.t1"; gene_id "g753"; Scaffold_3 AUGUSTUS CDS 3403179 3403814 0.47 - 0 transcript_id "g753.t1"; gene_id "g753"; Scaffold_3 AUGUSTUS start_codon 3403812 3403814 . - 0 transcript_id "g753.t1"; gene_id "g753"; # protein sequence = [MYNSICQSVHINSSEHKPRNFKDFETVLMYNAETIESHLELSHAGLILISLLLKNDYSDGVNGIGSETAAGLAKCGYG # DDLLKAYSSFSTMPQQLAEAFDQLNNDMVEELEFNTHHKLRYRSPYKANVLRVSQFPSLKDLSTLTAFLEPVTSWSRSMDSSGAPNASKWPPRTPDII # EITKFCCNTFGWPDKHALKRFHAELWPAVIMRMLSSSTFAIDVNGKSYPSMLSTVVRNKNSLRLQGMRANDAISTTFTTEFFLQLTGLASSVSETSRR # VDVPAAMIAVALQQSDQIRGLNKRLGELFMLSDVLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g753 ### # start gene g754 Scaffold_3 AUGUSTUS gene 3410433 3411256 0.64 - . g754 Scaffold_3 AUGUSTUS transcript 3410433 3411256 0.64 - . g754.t1 Scaffold_3 AUGUSTUS stop_codon 3410433 3410435 . - 0 transcript_id "g754.t1"; gene_id "g754"; Scaffold_3 AUGUSTUS CDS 3410433 3411134 0.65 - 0 transcript_id "g754.t1"; gene_id "g754"; Scaffold_3 AUGUSTUS CDS 3411230 3411256 0.67 - 0 transcript_id "g754.t1"; gene_id "g754"; Scaffold_3 AUGUSTUS start_codon 3411254 3411256 . - 0 transcript_id "g754.t1"; gene_id "g754"; # protein sequence = [MAKEKAASTISSLTATIQMLVVGLPTLPQLPSEVLEKLTQITTSTGSFEHATIAGEFIALNCYLSHLIICILWTATSR # GSILSNPQVSFTSPAPIPFRSLPFNSSINSNTSSVDGSANGNDMANATLPVMPTTNAVTTANGAGDERVHSLTVGHGQVLTYKYSHIREPRQISFATN # IARLDRVWDDERPNWDPVDCAKNLLEINGMGIALRYWQEVFSGKKNKVWSWLKKLWIEWKVSCIFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g754 ### # start gene g755 Scaffold_3 AUGUSTUS gene 3413645 3414689 0.45 - . g755 Scaffold_3 AUGUSTUS transcript 3413645 3414689 0.45 - . g755.t1 Scaffold_3 AUGUSTUS stop_codon 3413645 3413647 . - 0 transcript_id "g755.t1"; gene_id "g755"; Scaffold_3 AUGUSTUS CDS 3413645 3413941 0.53 - 0 transcript_id "g755.t1"; gene_id "g755"; Scaffold_3 AUGUSTUS CDS 3414054 3414689 0.48 - 0 transcript_id "g755.t1"; gene_id "g755"; Scaffold_3 AUGUSTUS start_codon 3414687 3414689 . - 0 transcript_id "g755.t1"; gene_id "g755"; # protein sequence = [MYNSICQSVHINSSEHKPRNFKDFETVLMYNAETIESHLELSHAGLILISLLLKNDYSDGVNGIGSETAAGLAKCGYG # DDLLKAYSSFSTMPQQLAEAFDQLNNDMVEELEFNTHHKLRYRSPYKANVLRVSQFPSLKDLSTLTAFLEPVTSWSRSMDSSGAPNASKWPPRTPDII # EITKFCCNTFGWPDKHALKRFHAELWPAVIMRMLSSSTFAIDVNGKSYPSMLSTVVRNKNSLRLQGMRANDAISTTFTTEFFLQLTGLASSVSETSRR # VDVPAAMIAVALQQSDQIRGLNKRLGELFMLSDVLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g755 ### # start gene g756 Scaffold_3 AUGUSTUS gene 3421312 3422135 0.62 - . g756 Scaffold_3 AUGUSTUS transcript 3421312 3422135 0.62 - . g756.t1 Scaffold_3 AUGUSTUS stop_codon 3421312 3421314 . - 0 transcript_id "g756.t1"; gene_id "g756"; Scaffold_3 AUGUSTUS CDS 3421312 3422013 0.63 - 0 transcript_id "g756.t1"; gene_id "g756"; Scaffold_3 AUGUSTUS CDS 3422109 3422135 0.64 - 0 transcript_id "g756.t1"; gene_id "g756"; Scaffold_3 AUGUSTUS start_codon 3422133 3422135 . - 0 transcript_id "g756.t1"; gene_id "g756"; # protein sequence = [MAKEKAASTISSLTATIQMLVVGLPTLPQLPSEVLEKLTQITTSTGSFEHATIAGEFIALNCYLSHLIICILWTATSR # GSILSNPQVSFTSPAPIPFRSLPFNSSINSNTSSVDGSANGNDMANATLPVMPTTNAVTTANGAGDERVHSLTVGHGQVLTYKYSHIREPRQISFATN # IARLDRVWDDERPNWDPVDCAKNLLEINGMGIALRYWQEVFSGKKNKVWSWLKKLWIEWKVSCIFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g756 ### # start gene g757 Scaffold_3 AUGUSTUS gene 3425152 3425562 0.36 - . g757 Scaffold_3 AUGUSTUS transcript 3425152 3425562 0.36 - . g757.t1 Scaffold_3 AUGUSTUS stop_codon 3425152 3425154 . - 0 transcript_id "g757.t1"; gene_id "g757"; Scaffold_3 AUGUSTUS CDS 3425152 3425562 0.36 - 0 transcript_id "g757.t1"; gene_id "g757"; Scaffold_3 AUGUSTUS start_codon 3425560 3425562 . - 0 transcript_id "g757.t1"; gene_id "g757"; # protein sequence = [MYNSICQSVHINSSEHKPRNFKDFETVLMYNAETIESHLELSHAGLILISLLLKNDYSDGVNGIGSETAAGLAKCGYG # DDLLKAYSSFSTMPQQLAEAFDQLNNDMVEELEFNTHHKLRYRSPYKANVPRIPISIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g757 ### # start gene g758 Scaffold_3 AUGUSTUS gene 3432185 3433007 0.76 - . g758 Scaffold_3 AUGUSTUS transcript 3432185 3433007 0.76 - . g758.t1 Scaffold_3 AUGUSTUS stop_codon 3432185 3432187 . - 0 transcript_id "g758.t1"; gene_id "g758"; Scaffold_3 AUGUSTUS CDS 3432185 3432886 0.77 - 0 transcript_id "g758.t1"; gene_id "g758"; Scaffold_3 AUGUSTUS CDS 3432981 3433007 0.76 - 0 transcript_id "g758.t1"; gene_id "g758"; Scaffold_3 AUGUSTUS start_codon 3433005 3433007 . - 0 transcript_id "g758.t1"; gene_id "g758"; # protein sequence = [MAKEKAASTISSLTATIQMLVVGLPTLPQLPSEVLEKLTQITTSTGSFEHATIAGEFIALNCYLSHLIICILWTATSR # GSILSNPQVSFTSPAPIPFRSLPFNSSINSNTSSVDGSANGNDMANATLPVMPTTNAVTTANGAGDERVHSLTVGHGQVLTYKYSHIREPRQISFATN # IARLDRVWDDERPNWDPVDCAKNLLEINGMGIALRYWQEVFSGKKNKVWSWLKKLWIEWKVSCIFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g758 ### # start gene g759 Scaffold_3 AUGUSTUS gene 3435396 3436440 0.45 - . g759 Scaffold_3 AUGUSTUS transcript 3435396 3436440 0.45 - . g759.t1 Scaffold_3 AUGUSTUS stop_codon 3435396 3435398 . - 0 transcript_id "g759.t1"; gene_id "g759"; Scaffold_3 AUGUSTUS CDS 3435396 3435692 0.59 - 0 transcript_id "g759.t1"; gene_id "g759"; Scaffold_3 AUGUSTUS CDS 3435805 3436440 0.47 - 0 transcript_id "g759.t1"; gene_id "g759"; Scaffold_3 AUGUSTUS start_codon 3436438 3436440 . - 0 transcript_id "g759.t1"; gene_id "g759"; # protein sequence = [MYNSICQSVHINSSEHKPRNFKDFETVLMYNAETIESHLELSHAGLILISLLLKNDYSDGVNGIGSETAAGLAKCGYG # DDLLKAYSSFSTMPQQLAEAFDQLNNDMVEELEFNTHHKLRYRSPYKANVLRVSQFPSLKDLSTLTAFLEPVTSWSRSMDSSGAPNASKWPPRTPDII # EITKFCCNTFGWPDKHALKRFHAELWPAVIMRMLSSSTFAIDVNGKSYPSMLSTVVRNKNSLRLQGMRANDAISTTFTTEFFLQLTGLASSVSETSRR # VDVPAAMIAVALQQSDQIRGLNKRLGELFMLSDVLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g759 ### # start gene g760 Scaffold_3 AUGUSTUS gene 3443062 3443885 0.63 - . g760 Scaffold_3 AUGUSTUS transcript 3443062 3443885 0.63 - . g760.t1 Scaffold_3 AUGUSTUS stop_codon 3443062 3443064 . - 0 transcript_id "g760.t1"; gene_id "g760"; Scaffold_3 AUGUSTUS CDS 3443062 3443763 0.63 - 0 transcript_id "g760.t1"; gene_id "g760"; Scaffold_3 AUGUSTUS CDS 3443859 3443885 0.67 - 0 transcript_id "g760.t1"; gene_id "g760"; Scaffold_3 AUGUSTUS start_codon 3443883 3443885 . - 0 transcript_id "g760.t1"; gene_id "g760"; # protein sequence = [MAKEKAASTISSLTATIQMLVVGLPTLPQLPSEVLEKLTQITTSTGSFEHATIAGEFIALNCYLSHLIICILWTATSR # GSILSNPQVSFTSPAPIPFRSLPFNSSINSNTSSVDGSANGNDMANATLPVMPTTNAVTTANGAGDERVHSLTVGHGQVLTYKYSHIREPRQISFATN # IARLDRVWDDERPNWDPVVCAKNLLEINGMGIALRYWQEVFSGKKNKVWSWLKKLWIEWKVSCIFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g760 ### # start gene g761 Scaffold_3 AUGUSTUS gene 3445879 3446436 0.58 + . g761 Scaffold_3 AUGUSTUS transcript 3445879 3446436 0.58 + . g761.t1 Scaffold_3 AUGUSTUS start_codon 3445879 3445881 . + 0 transcript_id "g761.t1"; gene_id "g761"; Scaffold_3 AUGUSTUS CDS 3445879 3445994 0.94 + 0 transcript_id "g761.t1"; gene_id "g761"; Scaffold_3 AUGUSTUS CDS 3446079 3446436 0.58 + 1 transcript_id "g761.t1"; gene_id "g761"; Scaffold_3 AUGUSTUS stop_codon 3446434 3446436 . + 0 transcript_id "g761.t1"; gene_id "g761"; # protein sequence = [MANTVKIPVPALNKEISVSTGLFINNEFVPSVDSSEVIQRNHCERCGRCVQKSFSTSWIHQNIIIIGSSKDIDVAVAA # ARKAFKTSWGKNVTGWERSRLINKLADLIERDAQELAELETLNNGKPVAIARLVLVCGVCETQLTSLIETSISEIASSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g761 ### # start gene g762 Scaffold_3 AUGUSTUS gene 3455622 3456398 0.59 + . g762 Scaffold_3 AUGUSTUS transcript 3455622 3456398 0.59 + . g762.t1 Scaffold_3 AUGUSTUS start_codon 3455622 3455624 . + 0 transcript_id "g762.t1"; gene_id "g762"; Scaffold_3 AUGUSTUS CDS 3455622 3456398 0.59 + 0 transcript_id "g762.t1"; gene_id "g762"; Scaffold_3 AUGUSTUS stop_codon 3456396 3456398 . + 0 transcript_id "g762.t1"; gene_id "g762"; # protein sequence = [MAERAEHVSNQVNRLTRLLPARLRQDASSISSDFLAAHHSSITWYLSRRLAEVSQKQKEMQEERVKRELERSRTLGSG # AGLEVLNMTTNDAFRTHNASEPRVSASSSWLGDTSSLIAATIGAPTIDETHRPGPSFPLPDTAPPSDDEDDFELSSSQILQFETENANILRSVQETLD # SVHQAESRLMEISTLQMELVEHLTKQTVLTDQLYEDAIASTSMVEKGNAQLREARRRSKDSRFFILVFFIISSLSLLFLHYY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g762 ### # start gene g763 Scaffold_3 AUGUSTUS gene 3464426 3464806 0.85 - . g763 Scaffold_3 AUGUSTUS transcript 3464426 3464806 0.85 - . g763.t1 Scaffold_3 AUGUSTUS stop_codon 3464426 3464428 . - 0 transcript_id "g763.t1"; gene_id "g763"; Scaffold_3 AUGUSTUS CDS 3464426 3464806 0.85 - 0 transcript_id "g763.t1"; gene_id "g763"; Scaffold_3 AUGUSTUS start_codon 3464804 3464806 . - 0 transcript_id "g763.t1"; gene_id "g763"; # protein sequence = [MAKWRLAKALGVDLRLNTLNLLLAQSFRSSFVLADTSQLHTKITEMGQRIRQLEDALAISHSGISNEPHPLLRDELLS # IKFGPENGTTSRAPPSRDPSVESIDAFGTSLSLIETCQNTLVAQQDQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g763 ### # start gene g764 Scaffold_3 AUGUSTUS gene 3467465 3467800 0.96 - . g764 Scaffold_3 AUGUSTUS transcript 3467465 3467800 0.96 - . g764.t1 Scaffold_3 AUGUSTUS stop_codon 3467465 3467467 . - 0 transcript_id "g764.t1"; gene_id "g764"; Scaffold_3 AUGUSTUS CDS 3467465 3467800 0.96 - 0 transcript_id "g764.t1"; gene_id "g764"; Scaffold_3 AUGUSTUS start_codon 3467798 3467800 . - 0 transcript_id "g764.t1"; gene_id "g764"; # protein sequence = [MLICILQLFLEEEREKELEALYENGTVEALNRADLAIGSGVGDGFPESSISAEATGVSKQTGETLMAGERIMDALDLA # DGERRIFREYEETMSRTTEDDAVKLQPHLGTLY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g764 ### # start gene g765 Scaffold_3 AUGUSTUS gene 3469213 3470175 1 - . g765 Scaffold_3 AUGUSTUS transcript 3469213 3470175 1 - . g765.t1 Scaffold_3 AUGUSTUS stop_codon 3469213 3469215 . - 0 transcript_id "g765.t1"; gene_id "g765"; Scaffold_3 AUGUSTUS CDS 3469213 3470175 1 - 0 transcript_id "g765.t1"; gene_id "g765"; Scaffold_3 AUGUSTUS start_codon 3470173 3470175 . - 0 transcript_id "g765.t1"; gene_id "g765"; # protein sequence = [MWHDTGHRAEVTCILRSPQKDHFAVGYADGSIRLWSASTGSVITTFNGHKKAVSALAFDQEGTRLASGSQDTDLIVWD # IVAEAGLYRYDREFTTDRNESIIVQASRSPRPNYCNKFIPATNDVPSTSTAFTSVMLLTTSKDTFMKLWNMSTQHCIQTIVAHRSDIWAMDVNVERNI # IFTGSGEGEVKAWSINTESISKGLTESDSGEVRNHSVSHRFVALKLLLDQQIILPIATLPLSSRHRVSQISFHPTQPFLAVQSHDRSVELFRIRTEEE # VQKKQLRRKKRAKEKKDKQQSNSEKADNEKLEDDEITLSFPCLLRM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g765 ### # start gene g766 Scaffold_3 AUGUSTUS gene 3482236 3482757 0.98 - . g766 Scaffold_3 AUGUSTUS transcript 3482236 3482757 0.98 - . g766.t1 Scaffold_3 AUGUSTUS stop_codon 3482236 3482238 . - 0 transcript_id "g766.t1"; gene_id "g766"; Scaffold_3 AUGUSTUS CDS 3482236 3482757 0.98 - 0 transcript_id "g766.t1"; gene_id "g766"; Scaffold_3 AUGUSTUS start_codon 3482755 3482757 . - 0 transcript_id "g766.t1"; gene_id "g766"; # protein sequence = [MKQTPCRPPRPPSPNLFGTPRPVEDTSEVPTLRRELSQRKHIRVQRPNRTADSLKAKRSLPELDGVWKGFLNEVNEDH # DSLYQHPIPDLPTLQRQSPTVRPELKDEEVSGSRSHFPRRRPFGGSQPRVTLHTSRSTTCVAIPEERSLSPRSSVSSADYETDMDSLALFPAPPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g766 ### # start gene g767 Scaffold_3 AUGUSTUS gene 3488327 3489622 0.48 - . g767 Scaffold_3 AUGUSTUS transcript 3488327 3489622 0.48 - . g767.t1 Scaffold_3 AUGUSTUS stop_codon 3488327 3488329 . - 0 transcript_id "g767.t1"; gene_id "g767"; Scaffold_3 AUGUSTUS CDS 3488327 3489622 0.48 - 0 transcript_id "g767.t1"; gene_id "g767"; Scaffold_3 AUGUSTUS start_codon 3489620 3489622 . - 0 transcript_id "g767.t1"; gene_id "g767"; # protein sequence = [MTLQWARLNPSQKPGFPNPGWPGCCRAPAPSEYRMIQAADWRSISIVHHIPIPPEIKVILDGLTTGGRSSSKPFMPPL # DRRNSNSGTGTGTGGGSPPTKLGNTAVKPVSSANKVRTSASPKTPAATLSKATANAVEGIRNSPEKEKASYNNSAHSSPGRKQIELDTNTTPRRNSGS # RAPPAIPSFNKGSPDLRSSTLPSGKSSLESRSSAIPSNKGSPDLRPSVIPSGKSSPESRSSAIPSNKGSPDLRPSVIPSGKGSPESRSPATTLNKGSP # ESRSSVVPLSKGSPEMRPSLDRRRSSNIHPPTPSSKSSIPSRNTASSFTLASRKASKNDDASSVASGGSGGSDSLSDSTVTSDGGFTDYLSDESEAEL # QRQAEAKAALLAQNQAEELEFKAARQQLAHVDLRPPKSWNPTNITNNNTALRLTTTTKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g767 ### # start gene g768 Scaffold_3 AUGUSTUS gene 3491365 3491703 0.77 - . g768 Scaffold_3 AUGUSTUS transcript 3491365 3491703 0.77 - . g768.t1 Scaffold_3 AUGUSTUS stop_codon 3491365 3491367 . - 0 transcript_id "g768.t1"; gene_id "g768"; Scaffold_3 AUGUSTUS CDS 3491365 3491703 0.77 - 0 transcript_id "g768.t1"; gene_id "g768"; Scaffold_3 AUGUSTUS start_codon 3491701 3491703 . - 0 transcript_id "g768.t1"; gene_id "g768"; # protein sequence = [MDVRWVSSLSWYFLNFFGLNGLYRLILGNDNCMSSLELIGGFLILNSSLAAADTSQTMMASPFAAGANQPGQPQDYVK # LFKAEKDNLAFAEGLYSWMGDDVETRLLRKHGKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g768 ### # start gene g769 Scaffold_3 AUGUSTUS gene 3492806 3493267 0.87 + . g769 Scaffold_3 AUGUSTUS transcript 3492806 3493267 0.87 + . g769.t1 Scaffold_3 AUGUSTUS start_codon 3492806 3492808 . + 0 transcript_id "g769.t1"; gene_id "g769"; Scaffold_3 AUGUSTUS CDS 3492806 3493267 0.87 + 0 transcript_id "g769.t1"; gene_id "g769"; Scaffold_3 AUGUSTUS stop_codon 3493265 3493267 . + 0 transcript_id "g769.t1"; gene_id "g769"; # protein sequence = [MELDEADEMVSSISYLESFTKALLIVSTGSQMDIEIQGIPQSIRPQYQNRLKSAKADLSRFKKTFKDLSAQLARSSLL # ASSTPRPGYSSDDPYGSSSDRSRLLAGTALLEDGTKRLQDSQRLALETEDLGADILSNLRVQREQIENSRSTVGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g769 ### # start gene g770 Scaffold_3 AUGUSTUS gene 3493709 3494463 0.46 - . g770 Scaffold_3 AUGUSTUS transcript 3493709 3494463 0.46 - . g770.t1 Scaffold_3 AUGUSTUS stop_codon 3493709 3493711 . - 0 transcript_id "g770.t1"; gene_id "g770"; Scaffold_3 AUGUSTUS CDS 3493709 3494184 0.54 - 2 transcript_id "g770.t1"; gene_id "g770"; Scaffold_3 AUGUSTUS CDS 3494292 3494463 0.46 - 0 transcript_id "g770.t1"; gene_id "g770"; Scaffold_3 AUGUSTUS start_codon 3494461 3494463 . - 0 transcript_id "g770.t1"; gene_id "g770"; # protein sequence = [MKQRLVDAAKLAKKEAMGDYSHLKDKKGKMVGKPLPQPTLPNLSVDDDDDRSSIRTRVPGSYPYLNPSQPALSREDYQ # SGYEEDDTTGLAVAAAPFAQQSQTHLNAHSSSLTNPYSPGPTGGTGFNAHDVYQGRDPDHDGLAYYSNSHSETSEGLAYDQDSQPQQGAYHQDYVPHY # DKQYSGGTYQDYSTSQPVYGAYALSQNKDNGGGAHGYAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g770 ### # start gene g771 Scaffold_3 AUGUSTUS gene 3496751 3497125 0.32 + . g771 Scaffold_3 AUGUSTUS transcript 3496751 3497125 0.32 + . g771.t1 Scaffold_3 AUGUSTUS start_codon 3496751 3496753 . + 0 transcript_id "g771.t1"; gene_id "g771"; Scaffold_3 AUGUSTUS CDS 3496751 3497125 0.32 + 0 transcript_id "g771.t1"; gene_id "g771"; Scaffold_3 AUGUSTUS stop_codon 3497123 3497125 . + 0 transcript_id "g771.t1"; gene_id "g771"; # protein sequence = [MRVVARTCNLIFIVLDVLKPLGDKKIIETELEGFGIRLNKRPPAVLVRKKERGGIAITNTVPLTKIDHDEIKAVLSEY # KINNADVAIREPNATADDLVDVIEGNRVYIPALYVSVPVSVIHQRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g771 ### # start gene g772 Scaffold_3 AUGUSTUS gene 3505583 3506195 0.6 + . g772 Scaffold_3 AUGUSTUS transcript 3505583 3506195 0.6 + . g772.t1 Scaffold_3 AUGUSTUS start_codon 3505583 3505585 . + 0 transcript_id "g772.t1"; gene_id "g772"; Scaffold_3 AUGUSTUS CDS 3505583 3505599 0.6 + 0 transcript_id "g772.t1"; gene_id "g772"; Scaffold_3 AUGUSTUS CDS 3505736 3506195 0.76 + 1 transcript_id "g772.t1"; gene_id "g772"; Scaffold_3 AUGUSTUS stop_codon 3506193 3506195 . + 0 transcript_id "g772.t1"; gene_id "g772"; # protein sequence = [MKHFSSVSRQKGLFYFDSSFRPVPLEQHFLGIKGKPGSSQAKKNLDHVTFEKVSELVAQGHQVMVFVHARKETVKSAL # AIQEAALAEGSSDDFSCEDQTQWSLFRREIAQSRNKEMKQLFDHGFGIHHAGMLRSDRNIMERMFEARAIKVDSFPSITP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g772 ### # start gene g773 Scaffold_3 AUGUSTUS gene 3507144 3508375 0.4 + . g773 Scaffold_3 AUGUSTUS transcript 3507144 3508375 0.4 + . g773.t1 Scaffold_3 AUGUSTUS start_codon 3507144 3507146 . + 0 transcript_id "g773.t1"; gene_id "g773"; Scaffold_3 AUGUSTUS CDS 3507144 3507206 0.4 + 0 transcript_id "g773.t1"; gene_id "g773"; Scaffold_3 AUGUSTUS CDS 3507336 3507365 0.93 + 0 transcript_id "g773.t1"; gene_id "g773"; Scaffold_3 AUGUSTUS CDS 3507419 3508375 1 + 0 transcript_id "g773.t1"; gene_id "g773"; Scaffold_3 AUGUSTUS stop_codon 3508373 3508375 . + 0 transcript_id "g773.t1"; gene_id "g773"; # protein sequence = [MRDNEERELKDLLNIVPCEVKNTGNNEGAGDVGVVITSEGKVNILLQAYISRRTLEDFALVSDSAYVAQNGGRIVRAL # LEIAISRKWANVSAVLMGMSKAIEKRLWPFDQPLKQFDLKGDLIYHLENWGDDYSPADLAAMSAEELGELTHLNSIQGKALLNAAKQFPTVQIQSVLR # PLGSEVLKVVVRLTKQFTWVNKLHGTSEPFWVWIEDHNGINILQMSHLIVRPNTETIHLDFIIPIAYEHTPPFITIRCVSDRWLGAENEIEVSLDGLI # MPRPIRSMTALLDLPLLPLTALRRPEVEIMYSRRLHNFNSLQTQVLWSLTNTKSHSLFCAPAGSGKSLMADIVAW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g773 ### # start gene g774 Scaffold_3 AUGUSTUS gene 3508422 3509300 0.91 + . g774 Scaffold_3 AUGUSTUS transcript 3508422 3509300 0.91 + . g774.t1 Scaffold_3 AUGUSTUS start_codon 3508422 3508424 . + 0 transcript_id "g774.t1"; gene_id "g774"; Scaffold_3 AUGUSTUS CDS 3508422 3509300 0.91 + 0 transcript_id "g774.t1"; gene_id "g774"; Scaffold_3 AUGUSTUS stop_codon 3509298 3509300 . + 0 transcript_id "g774.t1"; gene_id "g774"; # protein sequence = [MTALQATNSWVLVVAPRRSSAAEIISELRLVSRRSNAALELANSEKDLLQRPNVRTIRVVSAYHLFQAISLWDSRVPL # LGLDLVVCENLDQMDGVYELGISLLRHATQMTPTRYLGISNSLNDAADLAAWLNADESAFHSFRPTDRSQSLITSTQSFTIPHSGSLFKAMAKPAHSV # IRKVILEDSAIVFVSSRTQCKATALDLLTQCALEDQSDRGYLPPGVHEYIREDYLTRLEDSSLTDFLSKGVGFFHDGIRRSDRSLMLQLYAEGIVRVL # IVPGKHAGRCPYVLLLWW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g774 ### # start gene g775 Scaffold_3 AUGUSTUS gene 3519074 3519508 1 + . g775 Scaffold_3 AUGUSTUS transcript 3519074 3519508 1 + . g775.t1 Scaffold_3 AUGUSTUS start_codon 3519074 3519076 . + 0 transcript_id "g775.t1"; gene_id "g775"; Scaffold_3 AUGUSTUS CDS 3519074 3519508 1 + 0 transcript_id "g775.t1"; gene_id "g775"; Scaffold_3 AUGUSTUS stop_codon 3519506 3519508 . + 0 transcript_id "g775.t1"; gene_id "g775"; # protein sequence = [MDLNAQPPADWKTRGPPYEVAEYALKEDVDVVVMLNAWLDSRVKHYESKLSDDGEVMKKMKADWGKEEENEKDFGDIF # DWTTVEFWATRLKPLWVQGGASSSLRQHDTIQARLSGSNSSAKEQKNPRTRKKCKEEFARPIEEPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g775 ### # start gene g776 Scaffold_3 AUGUSTUS gene 3521026 3521503 0.62 + . g776 Scaffold_3 AUGUSTUS transcript 3521026 3521503 0.62 + . g776.t1 Scaffold_3 AUGUSTUS start_codon 3521026 3521028 . + 0 transcript_id "g776.t1"; gene_id "g776"; Scaffold_3 AUGUSTUS CDS 3521026 3521177 0.62 + 0 transcript_id "g776.t1"; gene_id "g776"; Scaffold_3 AUGUSTUS CDS 3521278 3521503 1 + 1 transcript_id "g776.t1"; gene_id "g776"; Scaffold_3 AUGUSTUS stop_codon 3521501 3521503 . + 0 transcript_id "g776.t1"; gene_id "g776"; # protein sequence = [MDEAIEIEQRAHVHDLQRKQRIEEKRMHHGYPMQNEVMSREEREARIWAFMNYKPSESDLEDVEDDDEDDDPAGWFED # DQDDGRKGQNIVEPDEEDPESLHNIIRVMDPNQMHYNTFYEPRDDGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g776 ### # start gene g777 Scaffold_3 AUGUSTUS gene 3522382 3523122 0.94 + . g777 Scaffold_3 AUGUSTUS transcript 3522382 3523122 0.94 + . g777.t1 Scaffold_3 AUGUSTUS start_codon 3522382 3522384 . + 0 transcript_id "g777.t1"; gene_id "g777"; Scaffold_3 AUGUSTUS CDS 3522382 3523122 0.94 + 0 transcript_id "g777.t1"; gene_id "g777"; Scaffold_3 AUGUSTUS stop_codon 3523120 3523122 . + 0 transcript_id "g777.t1"; gene_id "g777"; # protein sequence = [MEPVLENEIAAHPPLPHTPKPKQHQAYAPPVVQSTPSSQRFTSHAEDEVPQRAEIVNKFLEDDISDRLEISLNDFATL # ILDLPTDWHVRKEFTLLPESEVVKDAFAAYVKVAIGEVDGEGKKKIGIAGNESGLYQPLANLLNSLRDGEGRLGKDIDEKIFYVQDPRPVLGSLVARK # PDLGGIYTELLGLTENAKLSDYLAENNIVGVFWGLLLYFIEVKHERGRFVGLNVNKQEGIFTGLNSLPYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g777 ### # start gene g778 Scaffold_3 AUGUSTUS gene 3526108 3527361 0.89 + . g778 Scaffold_3 AUGUSTUS transcript 3526108 3527361 0.89 + . g778.t1 Scaffold_3 AUGUSTUS start_codon 3526108 3526110 . + 0 transcript_id "g778.t1"; gene_id "g778"; Scaffold_3 AUGUSTUS CDS 3526108 3526795 0.94 + 0 transcript_id "g778.t1"; gene_id "g778"; Scaffold_3 AUGUSTUS CDS 3526856 3527361 0.94 + 2 transcript_id "g778.t1"; gene_id "g778"; Scaffold_3 AUGUSTUS stop_codon 3527359 3527361 . + 0 transcript_id "g778.t1"; gene_id "g778"; # protein sequence = [MEASSDTKPATPTSLPQQKQPDAPPIVGSTPESNGAAHPTQDDAPQRTSALTKFLEDDANESVVLSLDEFVTLILDLP # AEWKIKEDFSLLPETKAVTEAFEAYLKVAIKIAEGTRKKWKNAATNEIELNQPLTKVLDTLKGGEGLGQLSREIDEEVFHVEEPHLVLDSLLKRKPGL # GGIYSQVLELTENKKLSTYLAEKNIFGVFWWLFLLFAEVKLRKGCAEPDIQREKFGIAMDESSQSLVIEALRPISTVPSPSNFSLLEKRPSHPKSKKR # LRSNEELDSTSMCSKLILERLGTDKCLKSSNQIRSLNLTQRPGYSQEPWRDLRNYRREKVRYNLTFGIYLDVETVKVKHPDPSLSMHLDQLPAIDFQS # DDSAPLPSTPSTPTATSFECRIDLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g778 ### # start gene g779 Scaffold_3 AUGUSTUS gene 3527746 3529080 0.98 + . g779 Scaffold_3 AUGUSTUS transcript 3527746 3529080 0.98 + . g779.t1 Scaffold_3 AUGUSTUS start_codon 3527746 3527748 . + 0 transcript_id "g779.t1"; gene_id "g779"; Scaffold_3 AUGUSTUS CDS 3527746 3529080 0.98 + 0 transcript_id "g779.t1"; gene_id "g779"; Scaffold_3 AUGUSTUS stop_codon 3529078 3529080 . + 0 transcript_id "g779.t1"; gene_id "g779"; # protein sequence = [MICQLKNLPTEKLVFVPTLVLNGFDYLRDPEQFLQEFADDPQGLIDTVYSFKEVDGRTRQVIIKSILYHATDSVGLRS # IIVDVECLCTKPGCEWHGNGRKIVKISYMSTTRTSEPRLIKEVRLKAESTSELWALNHLPNPIHSLTLLPNRRKASHRRLKKNLKEKYKEQAMHVTVH # EQLYPLSELEDPRDFAQVFYDILQSTPPIFDLMYPHHLTGPCALTYIAHQWLYECGGILHRDLSSGNIMFRRKDGKIYGVLNDFDLSSRVEDVDNGDI # RTGTRPFMSLDLLNSYWEGGHLYRHDLESLFYIILCLACRYEAPGVPATEPRAYSKWFSGSDQDISGYKNTFLTSPFVLAQGLPIQPYFADFEPWLNL # MHQFVSEGYHARPRPGIDVSAYPGLKKPLPSKTLFDWQTLDGNVTYSVLRQFMSSFQKEPLDTRWTGFNPDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g779 ### # start gene g780 Scaffold_3 AUGUSTUS gene 3532195 3534222 0.66 + . g780 Scaffold_3 AUGUSTUS transcript 3532195 3534222 0.66 + . g780.t1 Scaffold_3 AUGUSTUS start_codon 3532195 3532197 . + 0 transcript_id "g780.t1"; gene_id "g780"; Scaffold_3 AUGUSTUS CDS 3532195 3534222 0.66 + 0 transcript_id "g780.t1"; gene_id "g780"; Scaffold_3 AUGUSTUS stop_codon 3534220 3534222 . + 0 transcript_id "g780.t1"; gene_id "g780"; # protein sequence = [MSVTFAAAISTTGPDMNTLVMNSLPSPIPAIGSSKIPRKVFVLASMDSTAAPGTPKPATSNTGAVGVVRLPTVPKGTT # NAAFPISTRLRAEAWEAALIQAGLFDEFSDVPKGIREGFRIGIEDVFLSRTFIPDNHFKSDIEANIVRSKFIEEIQLGRLSPGFAPDHLESLIGPFRT # APMAVLEQKPGKFRIIINHSYPQSEFPNALEARSALPDTMIIDPSKISINSLIDSDDYPCDWGTFADCYLQVAVAPDGTQVAVFDVDAAFRNVPLHES # TRRFVALFIDNLVFLDLCLNFGKCSAPGIWGRIADVMVKILRSRGIEALLKWVDDFIFFRFPKSKAADGSFTYSYDESLIWSVAEELGWPWAPQKFVP # FSSSFLYIGFLWDLKNKTVQLPLNKKIKYADRVLPRTAPDAVMSLDKAEELIGTLNHVCLVLPTGRTRLVSLYKFRASFKSSRSPLATHRIGLLLRED # LVWWLNTLQANFVGMTIFTLPDYLDISLFVDASTSWGIGLVLNGRWLAWEFKPDWSSPERKIGWAEMVAVELAIRTLVSTGISNARVIVRSDNEGVVG # SLRKGCSRGSEQNFILRKIIELMQAHSIWVECNWVSTHENPADDPSRGIFPPRKQLHPHPPAVPRHLFQYINNSISPSDIRLDNRKLHLVLCSLTHIV # VVHTWHAIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g780 ### # start gene g781 Scaffold_3 AUGUSTUS gene 3543799 3544179 0.5 - . g781 Scaffold_3 AUGUSTUS transcript 3543799 3544179 0.5 - . g781.t1 Scaffold_3 AUGUSTUS stop_codon 3543799 3543801 . - 0 transcript_id "g781.t1"; gene_id "g781"; Scaffold_3 AUGUSTUS CDS 3543799 3544179 0.5 - 0 transcript_id "g781.t1"; gene_id "g781"; Scaffold_3 AUGUSTUS start_codon 3544177 3544179 . - 0 transcript_id "g781.t1"; gene_id "g781"; # protein sequence = [MSQFNYLPNSLPSATFKMRANPGGIYDRLAKSFTEMGAIALANAEINQDFFPHNFGESWLMNYSYRDCDSALFSANVF # GEIVGQAHGTFIGAQGNHYAGKDPSNVSVIWRFELCLISLGILAYSIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g781 ### # start gene g782 Scaffold_3 AUGUSTUS gene 3545388 3545855 0.41 - . g782 Scaffold_3 AUGUSTUS transcript 3545388 3545855 0.41 - . g782.t1 Scaffold_3 AUGUSTUS stop_codon 3545388 3545390 . - 0 transcript_id "g782.t1"; gene_id "g782"; Scaffold_3 AUGUSTUS CDS 3545388 3545855 0.41 - 0 transcript_id "g782.t1"; gene_id "g782"; Scaffold_3 AUGUSTUS start_codon 3545853 3545855 . - 0 transcript_id "g782.t1"; gene_id "g782"; # protein sequence = [MNILTHRAAYCLFPQLTLEDKTTLLIDLVSPLTEIQTAAVRKYALRGFTIIHQAPTSMACNANSALTFLRPRRVGDKH # CFKINFEHLGKGAPKPDYIEANTWGLAYLRKFNTMDTSRIDIASPIPFLAFTQDLLNIERGIEKLNDSDRNFRSAFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g782 ### # start gene g783 Scaffold_3 AUGUSTUS gene 3547900 3548187 0.99 - . g783 Scaffold_3 AUGUSTUS transcript 3547900 3548187 0.99 - . g783.t1 Scaffold_3 AUGUSTUS stop_codon 3547900 3547902 . - 0 transcript_id "g783.t1"; gene_id "g783"; Scaffold_3 AUGUSTUS CDS 3547900 3548187 0.99 - 0 transcript_id "g783.t1"; gene_id "g783"; Scaffold_3 AUGUSTUS start_codon 3548185 3548187 . - 0 transcript_id "g783.t1"; gene_id "g783"; # protein sequence = [MPQVYQAIINSLKVVAKSDVPVATPVAALMGTEGSLSPRRTSAALKAFDAIGSSSKCSSTMNKPTNEANAFDFSPSDE # DMVDDNNTIAHKKSKTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g783 ### # start gene g784 Scaffold_3 AUGUSTUS gene 3550989 3553737 0.33 - . g784 Scaffold_3 AUGUSTUS transcript 3550989 3553737 0.33 - . g784.t1 Scaffold_3 AUGUSTUS stop_codon 3550989 3550991 . - 0 transcript_id "g784.t1"; gene_id "g784"; Scaffold_3 AUGUSTUS CDS 3550989 3551755 0.77 - 2 transcript_id "g784.t1"; gene_id "g784"; Scaffold_3 AUGUSTUS CDS 3551877 3553737 0.33 - 0 transcript_id "g784.t1"; gene_id "g784"; Scaffold_3 AUGUSTUS start_codon 3553735 3553737 . - 0 transcript_id "g784.t1"; gene_id "g784"; # protein sequence = [MIWLEGGLNPNEIKQRAIEDPESDFCARLIQFLDESISNSVPPLPNEPVHVPSDDKHPCSVRGTIMEGFDRSTMTSET # AKQKDVHNLVMKCQVHTHSGTCYKYCKGNTHPKQCRFGLDASNTEPITYFNPANGELTLRCLDRLVNNFNEFIIRTIRCNMDIKFIGSGASAKAVLYY # ITNYITKSQLKAHVAFAALERAVTRLNEQDVDDDPLTVRAKKLLQKCAYMMISQQELSAQQVCTHLLGLEDHFTSHSYRNFYWISIERFLDSQVPSPE # CIVPKKPQELFESMLDDESERTTIPTTADALIERDVADCEIEDQSDDEDDEVTLTLDNNGGLVAKASPLDDYRFRPREVEGLCLWEAVARCKKIRIPA # KKIRADATSELQDLVDIEESEDNIEYAEHDTTNDEISNPLDEILDSDARIRPKFRFVAQHPEYESHLYVVEDSKTRKVPVPIGPTIPRRDRENVRPRY # CRLMLMFFKPWRNGIDLREDHQSWEDAFDVFMESCSIRIKAIMDNMQILHECRDSRDDHFANRANARRLRTSFAENEAQNPHGEHEDDFQPDIDQETD # IINHLLSIEMTHSDAAANANGEALDCVNHMDASGAFCRDELATSSSADHENVIEGTTYDGSIRHIEGVTSVNEDAVIQGGLYKQYEADKVDVDEFISQ # YTPRMNTEQERAFRIVASHSQEKKPAPLRMYLGGPGGTGKSHVISALKNFFEQQEQTRRFRLASYTGVAAKNIAGMTLHAALSLVSNSNMKRNSKSHK # DLIAMWHGVDYLFVDEVSMLGCRFMLKISRALSKAKQNDLPFGGMNVIFAGDFAQLGPVRDPRLFSFVDTSRVGTVSGQEAVFGKLLWLAVTTVVILT # VVMRQGGMQIAHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g784 ### # start gene g785 Scaffold_3 AUGUSTUS gene 3553818 3556100 0.5 - . g785 Scaffold_3 AUGUSTUS transcript 3553818 3556100 0.5 - . g785.t1 Scaffold_3 AUGUSTUS stop_codon 3553818 3553820 . - 0 transcript_id "g785.t1"; gene_id "g785"; Scaffold_3 AUGUSTUS CDS 3553818 3556100 0.5 - 0 transcript_id "g785.t1"; gene_id "g785"; Scaffold_3 AUGUSTUS start_codon 3556098 3556100 . - 0 transcript_id "g785.t1"; gene_id "g785"; # protein sequence = [MLRSLQRYLSRVQNMNVDESKALPSRATDILIGLDKFPISVLLLYCRQHGVEVSIATATVARVRDLLGRHLVTGTCYG # KHDLVGCRSVVESFFPSGTTKNQGDEFRILLLDLLRKNMNLTSLRTILDILEVKRGKTDNKKELQRRLRLYVDEIASVSDSKRDIARSKLEQIKNMWP # ALVPITVKEQCVRNFIELTSTENLKMFTCASCSVEDLKANACEVDHGSIDMTLLNAPNVRSSSKFPSVVVDSNWLDEQCLPPDIPTPLAEHPEAILDN # NGIKILEDGRKMLLLCRSCHSALKNNKTPALSLANHLFVGEVPPELKELTVVEEAMISRCRAKSWIIQLKEENGFVTPTNQRGLKGNIIIFPQKVSSV # IKTLPPSLEELSQPICVIFVGSSRPSDEWLRKQARPLTVRPAKVRAALMWLKMHNKWYKDIEINNDLLHSLPHEFSLPVHVEHVVPDDMNESLTAGYD # RSSINPDELQGTGPSFESVVIADVNGNATVNELRAAAMRHIKKGGSYAEIPHEVNPVNEFFNPSMFPMIYPTLFPFGIGGFEDHHRACPLSMKRHVKH # LLSCRDRRFQEHYSFPFTVFNILQRREMLLSTALKTKRSNFPFLAKQLATVSATAVSAVARRLALGEPVLFRNSEEQLVSKLMEQVNLVTSNVPGSSS # SLVNMRNQIRALMTDQGLPSFYVTINPADVYNPVVKLLAGNEIDIDNMLDSEVPRYWDQATLIAKNPVVAAKFSISIFDLSCLHYWVMTPARKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g785 ### # start gene g786 Scaffold_3 AUGUSTUS gene 3560622 3561300 0.97 - . g786 Scaffold_3 AUGUSTUS transcript 3560622 3561300 0.97 - . g786.t1 Scaffold_3 AUGUSTUS stop_codon 3560622 3560624 . - 0 transcript_id "g786.t1"; gene_id "g786"; Scaffold_3 AUGUSTUS CDS 3560622 3561190 0.97 - 2 transcript_id "g786.t1"; gene_id "g786"; Scaffold_3 AUGUSTUS CDS 3561276 3561300 0.97 - 0 transcript_id "g786.t1"; gene_id "g786"; Scaffold_3 AUGUSTUS start_codon 3561298 3561300 . - 0 transcript_id "g786.t1"; gene_id "g786"; # protein sequence = [MELRLGVSGDTDIERKTQAQVLLHTYTRELERQKASAEVQGWVLTTPGAGEGIHDGDEYDYEEDDDDDDESFHYPMSP # TNASGSTSIRPSSRSSSSNRPEPGRSSSINSATNSTISDLTHHLSQAPEFRVPTHEAPRSQTVSRAGSGWGSGTARSTTWVIPSPQYVHQWEKDDDVS # QCRECRRRFSFLLRRVSYCLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g786 ### # start gene g787 Scaffold_3 AUGUSTUS gene 3561477 3563559 0.53 - . g787 Scaffold_3 AUGUSTUS transcript 3561477 3563559 0.53 - . g787.t1 Scaffold_3 AUGUSTUS stop_codon 3561477 3561479 . - 0 transcript_id "g787.t1"; gene_id "g787"; Scaffold_3 AUGUSTUS CDS 3561477 3562933 0.87 - 2 transcript_id "g787.t1"; gene_id "g787"; Scaffold_3 AUGUSTUS CDS 3563025 3563559 0.61 - 0 transcript_id "g787.t1"; gene_id "g787"; Scaffold_3 AUGUSTUS start_codon 3563557 3563559 . - 0 transcript_id "g787.t1"; gene_id "g787"; # protein sequence = [MNNLRPYAHLGTIEESGLSDTQLNGHEEDAEEDRFVYDGESRSVSQSPSHREEEEEEEFVYPGLNAEDTTPLSPQESP # KPLTPPTISELSSRPRSDPLSESLPDLVLQAQPQEQAPQPLRTHPTPAQLESSYAASSSGDLSLLQKIFVTAHETGGISAFSLANDASTRTGLTALHA # AAKSCGAMSDLEDKEGETALHKAALNGHLHIVKYLLPSKHAANSSDALSRASVHAQDADGWTALHNACSKGYLDIVRYLCEEGGATESVDDDDSDQPP # ANGVNIRSKAGYTPLMNASSKGHLPVVRYLLSKQHADPLVRNNWGETAYDVAAAVFEVWICEVLERAEREWWYNRNSAHSNPNSPSKIPYNSLAIHTT # IPLVLYENQRLDARLKTLATSGGKPRFSASGLGRRGRRAPFELRILSVDDDNKRQNEGNEDSTVNNNIYQRNTTIPAWRSTVQLPLLDSPYSLPRPGS # YHSQSQGSTGPDRSQEEKSHFWLSDWTLDVTHPGVDADQGWQYARTFEDPEEDWTPEVTGALGRVLGGGLGGLSGVLRTPPGLGRSSSNSDSRSGSGS # NSTSATPTPTTYVRRRRWVRVMRRRLDIPSLPFLFPDGKMYLVREDGGLVRYIHHPNVSDEDASHPRSPAYWDPNASPMRLRIRMVKKVIRKDKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g787 ### # start gene g788 Scaffold_3 AUGUSTUS gene 3563751 3564883 0.73 + . g788 Scaffold_3 AUGUSTUS transcript 3563751 3564883 0.73 + . g788.t1 Scaffold_3 AUGUSTUS start_codon 3563751 3563753 . + 0 transcript_id "g788.t1"; gene_id "g788"; Scaffold_3 AUGUSTUS CDS 3563751 3564078 0.73 + 0 transcript_id "g788.t1"; gene_id "g788"; Scaffold_3 AUGUSTUS CDS 3564180 3564883 0.98 + 2 transcript_id "g788.t1"; gene_id "g788"; Scaffold_3 AUGUSTUS stop_codon 3564881 3564883 . + 0 transcript_id "g788.t1"; gene_id "g788"; # protein sequence = [MANILDASALTSLIPTLLPPNQKSLQSPQDALAVLSHAILSSLAFRLIAVDDSNNNNEINSNSLPENWNSHGPGGYTF # RYKHEQSSLEFVVKLTKLGKRTVVNAIAVEVHDFTSPSSFPYILNTDTNSSSSSSPLVHCYISSSRITDFVSQFKLKIIQKLVPGLRKDGYTEEVDLD # DKSSTSTTNNTHSLNPVRPGPSRTIPRYNPDEEEFPMRFPPPRNPSSHIAPNNPLEIGRRDLDPIPGGSFQPPPLFPQSGSGDGMFVGPDHPIFGGRI # GQGQGSGGGFGPGIGGGGIGGIGGRGPRWGGDGFLPPMGAPPGARFDPVGPMFGPVLGALELVHSLVVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g788 ### # start gene g789 Scaffold_3 AUGUSTUS gene 3565805 3567844 0.48 + . g789 Scaffold_3 AUGUSTUS transcript 3565805 3567844 0.48 + . g789.t1 Scaffold_3 AUGUSTUS start_codon 3565805 3565807 . + 0 transcript_id "g789.t1"; gene_id "g789"; Scaffold_3 AUGUSTUS CDS 3565805 3565815 0.69 + 0 transcript_id "g789.t1"; gene_id "g789"; Scaffold_3 AUGUSTUS CDS 3567040 3567844 0.93 + 1 transcript_id "g789.t1"; gene_id "g789"; Scaffold_3 AUGUSTUS stop_codon 3567842 3567844 . + 0 transcript_id "g789.t1"; gene_id "g789"; # protein sequence = [MTSRSIPSSSDCTTSSSTFPSSDSDSSDSDSDYYXFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVAN # QSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQ # LHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g789 ### # start gene g790 Scaffold_3 AUGUSTUS gene 3567914 3570935 0.67 + . g790 Scaffold_3 AUGUSTUS transcript 3567914 3570935 0.67 + . g790.t1 Scaffold_3 AUGUSTUS start_codon 3567914 3567916 . + 0 transcript_id "g790.t1"; gene_id "g790"; Scaffold_3 AUGUSTUS CDS 3567914 3568885 0.67 + 0 transcript_id "g790.t1"; gene_id "g790"; Scaffold_3 AUGUSTUS CDS 3568932 3570935 0.82 + 0 transcript_id "g790.t1"; gene_id "g790"; Scaffold_3 AUGUSTUS stop_codon 3570933 3570935 . + 0 transcript_id "g790.t1"; gene_id "g790"; # protein sequence = [MDTNDVNKKRSLRRLSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPI # KSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSF # EKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATL # PDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVC # KIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPY # GPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAF # LCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRP # INFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNA # TINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIE # LDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKF # QVDDQGRLYHRNTDQPDQPQLVVEKKSVCTC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g790 ### # start gene g791 Scaffold_3 AUGUSTUS gene 3574193 3575626 0.55 - . g791 Scaffold_3 AUGUSTUS transcript 3574193 3575626 0.55 - . g791.t1 Scaffold_3 AUGUSTUS stop_codon 3574193 3574195 . - 0 transcript_id "g791.t1"; gene_id "g791"; Scaffold_3 AUGUSTUS CDS 3574193 3575626 0.55 - 0 transcript_id "g791.t1"; gene_id "g791"; Scaffold_3 AUGUSTUS start_codon 3575624 3575626 . - 0 transcript_id "g791.t1"; gene_id "g791"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g791 ### # start gene g792 Scaffold_3 AUGUSTUS gene 3575677 3576843 0.84 - . g792 Scaffold_3 AUGUSTUS transcript 3575677 3576843 0.84 - . g792.t1 Scaffold_3 AUGUSTUS stop_codon 3575677 3575679 . - 0 transcript_id "g792.t1"; gene_id "g792"; Scaffold_3 AUGUSTUS CDS 3575677 3576843 0.84 - 0 transcript_id "g792.t1"; gene_id "g792"; Scaffold_3 AUGUSTUS start_codon 3576841 3576843 . - 0 transcript_id "g792.t1"; gene_id "g792"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g792 ### # start gene g793 Scaffold_3 AUGUSTUS gene 3577492 3578056 0.61 + . g793 Scaffold_3 AUGUSTUS transcript 3577492 3578056 0.61 + . g793.t1 Scaffold_3 AUGUSTUS start_codon 3577492 3577494 . + 0 transcript_id "g793.t1"; gene_id "g793"; Scaffold_3 AUGUSTUS CDS 3577492 3577495 0.61 + 0 transcript_id "g793.t1"; gene_id "g793"; Scaffold_3 AUGUSTUS CDS 3577767 3578056 0.78 + 2 transcript_id "g793.t1"; gene_id "g793"; Scaffold_3 AUGUSTUS stop_codon 3578054 3578056 . + 0 transcript_id "g793.t1"; gene_id "g793"; # protein sequence = [MESPRDLPPHFDLDAGDHDDQDPLVKPNDPGANNDNPDNDNLNDGSGSLPCGEPGNPSGPGGPRGPRSPISPDIPNEQ # RAMLELFLGFKGSILAALG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g793 ### # start gene g794 Scaffold_3 AUGUSTUS gene 3580545 3581711 0.85 + . g794 Scaffold_3 AUGUSTUS transcript 3580545 3581711 0.85 + . g794.t1 Scaffold_3 AUGUSTUS start_codon 3580545 3580547 . + 0 transcript_id "g794.t1"; gene_id "g794"; Scaffold_3 AUGUSTUS CDS 3580545 3581711 0.85 + 0 transcript_id "g794.t1"; gene_id "g794"; Scaffold_3 AUGUSTUS stop_codon 3581709 3581711 . + 0 transcript_id "g794.t1"; gene_id "g794"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g794 ### # start gene g795 Scaffold_3 AUGUSTUS gene 3581762 3583900 0.85 + . g795 Scaffold_3 AUGUSTUS transcript 3581762 3583900 0.85 + . g795.t1 Scaffold_3 AUGUSTUS start_codon 3581762 3581764 . + 0 transcript_id "g795.t1"; gene_id "g795"; Scaffold_3 AUGUSTUS CDS 3581762 3583900 0.85 + 0 transcript_id "g795.t1"; gene_id "g795"; Scaffold_3 AUGUSTUS stop_codon 3583898 3583900 . + 0 transcript_id "g795.t1"; gene_id "g795"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGSKHPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g795 ### # start gene g796 Scaffold_3 AUGUSTUS gene 3584422 3585515 0.29 + . g796 Scaffold_3 AUGUSTUS transcript 3584422 3585515 0.29 + . g796.t1 Scaffold_3 AUGUSTUS start_codon 3584422 3584424 . + 0 transcript_id "g796.t1"; gene_id "g796"; Scaffold_3 AUGUSTUS CDS 3584422 3584692 0.39 + 0 transcript_id "g796.t1"; gene_id "g796"; Scaffold_3 AUGUSTUS CDS 3584794 3585097 0.42 + 2 transcript_id "g796.t1"; gene_id "g796"; Scaffold_3 AUGUSTUS CDS 3585269 3585515 0.77 + 1 transcript_id "g796.t1"; gene_id "g796"; Scaffold_3 AUGUSTUS stop_codon 3585513 3585515 . + 0 transcript_id "g796.t1"; gene_id "g796"; # protein sequence = [MPPKTRAQSRANFEENTFFTTAQSSAPFSESISAIGQPCRRNRSFGPATVPTTLTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPCCGQPRESPRDPPLTSIWTLVITMIKTLLSTLTTPGADNNNDNLENDSGDLPHGEPGDPSGPGGPGGPGGPHFPISPDIPTSNMLCWNFSQD # SRVPLKPLVPFSPPRPGSAKERFVPDILNPDLNSLPAWSSSFKALVKPLQDNFGVYDAQGEAEDSLSNLKMKETENIRKYNIRFNTLAASTNWDSAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g796 ### # start gene g797 Scaffold_3 AUGUSTUS gene 3585560 3585988 0.95 + . g797 Scaffold_3 AUGUSTUS transcript 3585560 3585988 0.95 + . g797.t1 Scaffold_3 AUGUSTUS start_codon 3585560 3585562 . + 0 transcript_id "g797.t1"; gene_id "g797"; Scaffold_3 AUGUSTUS CDS 3585560 3585988 0.95 + 0 transcript_id "g797.t1"; gene_id "g797"; Scaffold_3 AUGUSTUS stop_codon 3585986 3585988 . + 0 transcript_id "g797.t1"; gene_id "g797"; # protein sequence = [MAHLPEPVMLADYRQEVLCIDNCYWKCGETQKREAGKPFIAQNPKKGSSDFKTGSTNQQNNSQPSGSSALFTPKPKPF # SGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g797 ### # start gene g798 Scaffold_3 AUGUSTUS gene 3594455 3595399 0.54 - . g798 Scaffold_3 AUGUSTUS transcript 3594455 3595399 0.54 - . g798.t1 Scaffold_3 AUGUSTUS stop_codon 3594455 3594457 . - 0 transcript_id "g798.t1"; gene_id "g798"; Scaffold_3 AUGUSTUS CDS 3594455 3595399 0.54 - 0 transcript_id "g798.t1"; gene_id "g798"; Scaffold_3 AUGUSTUS start_codon 3595397 3595399 . - 0 transcript_id "g798.t1"; gene_id "g798"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSHYNPLIDWVSRNITFRNTSHLDSPQTSVPSAINPLLQRSLF # CYRNFRRRFYRQFWRPLLGTHFALALAPALGLHRPSPFRPNFPLNPSILYPTVSQFTAQLETPEVDIALVSAAVFHRACKDAGMEPILLRAIHSEVAA # RAADCSSTAPTVPPLPPSIRAEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGHIYPLSEKELVALKGFIDKQLATGAITPSSSPHGAPVLF # VPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g798 ### # start gene g799 Scaffold_3 AUGUSTUS gene 3596473 3597411 1 - . g799 Scaffold_3 AUGUSTUS transcript 3596473 3597411 1 - . g799.t1 Scaffold_3 AUGUSTUS stop_codon 3596473 3596475 . - 0 transcript_id "g799.t1"; gene_id "g799"; Scaffold_3 AUGUSTUS CDS 3596473 3597411 1 - 0 transcript_id "g799.t1"; gene_id "g799"; Scaffold_3 AUGUSTUS start_codon 3597409 3597411 . - 0 transcript_id "g799.t1"; gene_id "g799"; # protein sequence = [MPLKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRCRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTQIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVGPDDPGADNNHDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGSRSSNSPDIPNEQRAMLDLLSGFKVSMETLGSVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRP # KYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g799 ### # command line: # augustus --species=saccharomyces split/input_1/input_1.fa_chunk_0000009